F493409

General Info

Members Datasets Scaffolds Average Seq Length
1370 548 1349 149

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100307401|Ga0307415_1003074013
Length 176
Sequence MPPPGPNSYRHEVRSFGPCIRSTGSLMKTFSPTPSDLHHDWHVVDAAGVPLGRLASHVAQLIRGKHKPTFAPHMDGGDFVIVINASQVKFTGRKLDQKTYFKHTGYMGHESHVAARDMLAKHPDRVIEKAVFGMLPKTSLARQDLRGKLKVYANAEHPHAAQQPKPYSVTSEKVKA

Samples

Sample ID Description Type Environment
1 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
2 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
3 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
4 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
5 2738543017 Bacillus sp. OV186 Isolate Unclassified
6 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
7 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
8 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
9 2818991459 Paenibacillus sp. 597 Isolate Unclassified
10 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
11 2857586860 Bacillus sp. R-71935 Isolate Unclassified
12 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
13 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
14 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
15 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
16 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
17 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
18 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
19 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
20 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
21 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
22 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
41 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
119 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
120 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
121 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
278 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
282 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
283 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
295 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
296 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
297 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
298 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
299 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
300 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
303 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
306 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
307 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
308 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
309 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
310 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
311 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
312 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
313 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
314 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
315 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
316 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
317 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
318 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
319 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
320 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
321 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
322 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
323 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
324 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
325 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
326 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
332 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
336 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
337 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
338 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
346 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
388 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
389 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
390 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
391 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
392 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
393 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
394 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
422 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
423 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
424 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
425 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
426 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
427 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
428 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
429 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
430 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
431 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
432 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
433 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
434 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
435 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
436 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
437 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
438 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
439 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
440 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
441 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
442 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
443 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
444 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
445 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
446 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
447 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
448 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
449 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
450 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
451 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
452 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
453 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
454 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
455 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
456 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
457 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
458 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
459 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
460 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
461 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
462 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
463 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
464 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
465 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
466 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
467 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
468 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
469 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
470 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
471 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
472 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
473 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
474 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
475 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
476 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
477 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
478 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
479 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
480 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
481 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
482 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
483 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
487 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
488 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
489 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
490 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
491 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
492 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
493 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
494 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
495 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
496 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
497 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
498 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
499 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
500 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
501 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
502 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
503 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
504 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
505 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
506 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
507 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
547 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
548 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.74
Metatranscriptomes 10.73
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 2.19
Rhizosphere 92.99
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24030J14995_100090 3300001426 Bacteria 2060
2 JGI24034J14986_100111 3300001432 Bacteria 3633
3 JGI24737J22298_10099895 3300001990 Unclassified 860
4 JGI24748J21848_1000002 3300002074 Bacteria 426946
5 JGI24749J21850_1068974 3300002076 Unclassified 544
6 JGI24034J26672_10000004 3300002239 Bacteria 426946
7 JGI24751J29686_10000043 3300002459 Bacteria 78179
8 Ga0006778J45830_1034592 3300003162 Bacteria 746
9 JGI25406J46586_10066683 3300003203 Bacteria 1142
10 JGI25406J46586_10119960 3300003203 Bacteria 774
11 JGI25406J46586_10123520 3300003203 Bacteria 761
12 rootL2_10056321 3300003322 Bacteria 1672
13 Ga0007417J51691_1041585 3300003544 Bacteria 684
14 Ga0007410J51695_1044966 3300003574 Bacteria 592
15 Ga0007416J51690_1041750 3300003577 Bacteria 616
16 Ga0007429J51699_1074031 3300003579 Bacteria 593
17 Ga0006780_1026678 3300003735 Bacteria 531
18 Ga0055532_1000266 3300003758 Bacteria 34080
19 Ga0055536_1028902 3300003781 Bacteria 1500
20 Ga0055541_1012017 3300003841 Bacteria 1252
21 Ga0058861_11574531 3300004800 Bacteria 757
22 Ga0058861_12052293 3300004800 Bacteria 2429
23 Ga0058860_10119785 3300004801 Unclassified 623
24 Ga0058862_10040385 3300004803 Unclassified 701
25 Ga0058862_12335695 3300004803 Bacteria 764
26 Ga0058862_12645996 3300004803 Bacteria 1998
27 Ga0065714_10378440 3300005288 Bacteria 609
28 Ga0065704_10006068 3300005289 Bacteria 5032
29 Ga0065704_10319899 3300005289 Bacteria 854
30 Ga0065712_10004680 3300005290 Bacteria 4164
31 Ga0065712_10033824 3300005290 Bacteria 1975
32 Ga0065712_10067728 3300005290 Bacteria 178215
33 Ga0065712_10321286 3300005290 Unclassified 787
34 Ga0065712_10632539 3300005290 Unclassified 540
35 Ga0065715_10016269 3300005293 Bacteria 1922
36 Ga0065715_10102020 3300005293 Bacteria 3151
37 Ga0065715_10132100 3300005293 Bacteria 1996
38 Ga0065715_10189677 3300005293 Bacteria 1423
39 Ga0065715_10477965 3300005293 Bacteria 800
40 Ga0065715_10497524 3300005293 Unclassified 782
41 Ga0065707_10090144 3300005295 Bacteria 4201
42 Ga0065707_10182165 3300005295 Bacteria 1412
43 Ga0065707_10562132 3300005295 Bacteria 714
44 Ga0065707_10748818 3300005295 Bacteria 616
45 Ga0070683_100202291 3300005329 Bacteria 1886
46 Ga0070690_100082134 3300005330 Bacteria 2109
47 Ga0070690_100251554 3300005330 Bacteria 1250
48 Ga0070690_100267179 3300005330 Bacteria 1215
49 Ga0070690_100297906 3300005330 Bacteria 1155
50 Ga0070690_101219369 3300005330 Bacteria 600
51 Ga0070670_100058808 3300005331 Bacteria 3300
52 Ga0070670_100092380 3300005331 Bacteria 2602
53 Ga0070670_100345033 3300005331 Bacteria 1307
54 Ga0070670_101852565 3300005331 Unclassified 555
55 Ga0070677_10856470 3300005333 Unclassified 523
56 Ga0068869_100042361 3300005334 Bacteria 3263
57 Ga0068869_100091051 3300005334 Bacteria 2293
58 Ga0068869_100100721 3300005334 Bacteria 2184
59 Ga0068869_100327120 3300005334 Bacteria 1244
60 Ga0068869_100391230 3300005334 Bacteria 1141
61 Ga0070666_10042134 3300005335 Bacteria 3053
62 Ga0070666_10275761 3300005335 Bacteria 1195
63 Ga0070680_100007591 3300005336 Bacteria 8272
64 Ga0070680_100034077 3300005336 Bacteria 4106
65 Ga0070680_100114808 3300005336 Bacteria 2243
66 Ga0070680_100422887 3300005336 Bacteria 1137
67 Ga0070680_100786614 3300005336 Bacteria 820
68 Ga0070680_100852988 3300005336 Bacteria 785
69 Ga0070682_100004665 3300005337 Bacteria 7614
70 Ga0070682_100139105 3300005337 Bacteria 1653
71 Ga0070682_100178981 3300005337 Unclassified 1479
72 Ga0070682_101055797 3300005337 Bacteria 677
73 Ga0068868_100024305 3300005338 Bacteria 4596
74 Ga0068868_100471816 3300005338 Bacteria 1095
75 Ga0070660_100234739 3300005339 Bacteria 1493
76 Ga0070689_100005909 3300005340 Bacteria 8416
77 Ga0070689_100106631 3300005340 Bacteria 2223
78 Ga0070689_100323954 3300005340 Bacteria 1287
79 Ga0070689_100497215 3300005340 Bacteria 1044
80 Ga0070691_10173166 3300005341 Bacteria 1119
81 Ga0070691_10297087 3300005341 Bacteria 881
82 Ga0070691_10643157 3300005341 Bacteria 631
83 Ga0070687_100032186 3300005343 Bacteria 2578
84 Ga0070687_100116595 3300005343 Bacteria 1520
85 Ga0070687_100248643 3300005343 Bacteria 1103
86 Ga0070687_100450842 3300005343 Bacteria 856
87 Ga0070687_101078360 3300005343 Bacteria 586
88 Ga0070661_100426703 3300005344 Bacteria 1052
89 Ga0070692_10068274 3300005345 Bacteria 1888
90 Ga0070692_10224172 3300005345 Bacteria 1113
91 Ga0070692_10519847 3300005345 Bacteria 775
92 Ga0070669_100010968 3300005353 Bacteria 6430
93 Ga0070669_100227616 3300005353 Bacteria 1476
94 Ga0070675_100094595 3300005354 Bacteria 2507
95 Ga0070675_100160173 3300005354 Bacteria 1935
96 Ga0070675_100253320 3300005354 Bacteria 1541
97 Ga0070671_100006834 3300005355 Bacteria 9131
98 Ga0070671_100414269 3300005355 Bacteria 1154
99 Ga0070674_100595132 3300005356 Bacteria 934
100 Ga0070674_101311476 3300005356 Bacteria 646
101 Ga0070673_100021596 3300005364 Bacteria 4671
102 Ga0070673_100039470 3300005364 Bacteria 3613
103 Ga0070673_100060363 3300005364 Bacteria 3004
104 Ga0070673_100145891 3300005364 Bacteria 2000
105 Ga0070673_100363237 3300005364 Bacteria 1287
106 Ga0070673_101293892 3300005364 Bacteria 685
107 Ga0070673_101352122 3300005364 Bacteria 670
108 Ga0070673_101732248 3300005364 Bacteria 591
109 Ga0070688_100027695 3300005365 Bacteria 3376
110 Ga0070659_100254240 3300005366 Bacteria 1457
111 Ga0070667_100009924 3300005367 Bacteria 7893
112 Ga0070667_101227983 3300005367 Bacteria 702
113 Ga0070703_10016242 3300005406 Bacteria 2136
114 Ga0070709_10964241 3300005434 Bacteria 677
115 Ga0070709_11555215 3300005434 Unclassified 538
116 Ga0070710_10538173 3300005437 Unclassified 805
117 Ga0070701_10126900 3300005438 Bacteria 1445
118 Ga0070701_10139729 3300005438 Bacteria 1384
119 Ga0070701_10174029 3300005438 Bacteria 1255
120 Ga0070701_10260659 3300005438 Bacteria 1051
121 Ga0070701_10430622 3300005438 Unclassified 842
122 Ga0070701_11077122 3300005438 Unclassified 564
123 Ga0070705_100007700 3300005440 Bacteria 5314
124 Ga0070705_100112461 3300005440 Bacteria 1742
125 Ga0070705_100408288 3300005440 Bacteria 1008
126 Ga0070705_100422749 3300005440 Bacteria 992
127 Ga0070705_100768174 3300005440 Bacteria 764
128 Ga0070705_101360083 3300005440 Unclassified 590
129 Ga0070700_100000266 3300005441 Bacteria 27903
130 Ga0070700_100014593 3300005441 Bacteria 4437
131 Ga0070700_100052147 3300005441 Bacteria 2550
132 Ga0070700_100094620 3300005441 Bacteria 1956
133 Ga0070700_100185277 3300005441 Bacteria 1451
134 Ga0070700_100242128 3300005441 Bacteria 1289
135 Ga0070700_100282791 3300005441 Bacteria 1203
136 Ga0070700_100298186 3300005441 Bacteria 1175
137 Ga0070700_100321158 3300005441 Bacteria 1137
138 Ga0070700_101799189 3300005441 Unclassified 528
139 Ga0070700_102019979 3300005441 Bacteria 500
140 Ga0070694_100048840 3300005444 Bacteria 2847
141 Ga0070694_100070591 3300005444 Bacteria 2405
142 Ga0070694_100089907 3300005444 Bacteria 2152
143 Ga0070694_100093724 3300005444 Bacteria 2111
144 Ga0070694_100147049 3300005444 Bacteria 1717
145 Ga0070694_100152666 3300005444 Bacteria 1688
146 Ga0070694_100269767 3300005444 Bacteria 1294
147 Ga0070694_100374063 3300005444 Unclassified 1109
148 Ga0070694_100482878 3300005444 Unclassified 983
149 Ga0070694_100573966 3300005444 Unclassified 905
150 Ga0070694_100749252 3300005444 Bacteria 797
151 Ga0070694_101402326 3300005444 Bacteria 590
152 Ga0070708_100118953 3300005445 Bacteria 2435
153 Ga0070708_100842177 3300005445 Unclassified 862
154 Ga0070708_101185113 3300005445 Unclassified 715
155 Ga0070708_102226187 3300005445 Bacteria 506
156 Ga0070678_100077740 3300005456 Bacteria 2504
157 Ga0070678_100201921 3300005456 Bacteria 1641
158 Ga0070678_101792635 3300005456 Unclassified 578
159 Ga0070678_102141520 3300005456 Bacteria 530
160 Ga0070662_100021274 3300005457 Bacteria 4428
161 Ga0070662_100221238 3300005457 Unclassified 1511
162 Ga0070681_10000425 3300005458 Bacteria 34351
163 Ga0070681_10005227 3300005458 Bacteria 12536
164 Ga0070681_10072317 3300005458 Bacteria 3411
165 Ga0070681_10421388 3300005458 Bacteria 1247
166 Ga0068867_100039248 3300005459 Bacteria 3451
167 Ga0068867_100058827 3300005459 Unclassified 2848
168 Ga0068867_100134785 3300005459 Bacteria 1923
169 Ga0068867_100174768 3300005459 Bacteria 1703
170 Ga0068867_101750460 3300005459 Unclassified 583
171 Ga0070685_10008724 3300005466 Bacteria 5220
172 Ga0070685_10992291 3300005466 Bacteria 629
173 Ga0070706_100134104 3300005467 Bacteria 2312
174 Ga0070706_100352364 3300005467 Bacteria 1372
175 Ga0070706_100492659 3300005467 Bacteria 1140
176 Ga0070706_102007442 3300005467 Bacteria 524
177 Ga0070707_100149440 3300005468 Bacteria 2274
178 Ga0070707_100395387 3300005468 Bacteria 1342
179 Ga0070707_100432607 3300005468 Bacteria 1276
180 Ga0070707_100453731 3300005468 Bacteria 1243
181 Ga0070707_100817692 3300005468 Bacteria 896
182 Ga0070698_100004560 3300005471 Bacteria 15214
183 Ga0070698_100013809 3300005471 Bacteria 8544
184 Ga0070698_100014111 3300005471 Bacteria 8448
185 Ga0070698_100043199 3300005471 Bacteria 4622
186 Ga0070698_100086453 3300005471 Bacteria 3122
187 Ga0070698_100355978 3300005471 Bacteria 1395
188 Ga0070698_100510250 3300005471 Bacteria 1140
189 Ga0070698_100598680 3300005471 Bacteria 1043
190 Ga0070698_100930291 3300005471 Unclassified 815
191 Ga0070698_101570771 3300005471 Unclassified 610
192 Ga0070699_100031118 3300005518 Bacteria 4609
193 Ga0070699_100053005 3300005518 Bacteria 3511
194 Ga0070699_100060955 3300005518 Bacteria 3270
195 Ga0070699_100147720 3300005518 Bacteria 2077
196 Ga0070699_100206549 3300005518 Bacteria 1748
197 Ga0070699_100390850 3300005518 Bacteria 1257
198 Ga0070699_100601479 3300005518 Bacteria 1003
199 Ga0070679_100000308 3300005530 Bacteria 41614
200 Ga0070679_100051054 3300005530 Bacteria 4119
201 Ga0070684_100107878 3300005535 Bacteria 2494
202 Ga0070697_100021785 3300005536 Bacteria 5080
203 Ga0070697_100036520 3300005536 Bacteria 3970
204 Ga0070697_100041573 3300005536 Bacteria 3721
205 Ga0070697_100076841 3300005536 Bacteria 2746
206 Ga0070697_100106844 3300005536 Bacteria 2329
207 Ga0070697_100134497 3300005536 Bacteria 2075
208 Ga0070697_100918364 3300005536 Unclassified 777
209 Ga0068853_100021364 3300005539 Bacteria 5396
210 Ga0068853_100380667 3300005539 Bacteria 1318
211 Ga0068853_101528034 3300005539 Unclassified 646
212 Ga0070672_100043818 3300005543 Bacteria 3453
213 Ga0070686_100006820 3300005544 Bacteria 6358
214 Ga0070686_100315019 3300005544 Bacteria 1165
215 Ga0070686_101230031 3300005544 Bacteria 623
216 Ga0070695_100051632 3300005545 Bacteria 2639
217 Ga0070695_100057801 3300005545 Bacteria 2506
218 Ga0070695_100192404 3300005545 Bacteria 1453
219 Ga0070695_100225006 3300005545 Bacteria 1354
220 Ga0070695_100230618 3300005545 Bacteria 1338
221 Ga0070695_100323273 3300005545 Bacteria 1147
222 Ga0070695_100350209 3300005545 Bacteria 1106
223 Ga0070695_100389662 3300005545 Bacteria 1053
224 Ga0070695_100393957 3300005545 Bacteria 1048
225 Ga0070695_100529437 3300005545 Bacteria 916
226 Ga0070695_101201775 3300005545 Unclassified 624
227 Ga0070696_100006702 3300005546 Bacteria 7695
228 Ga0070696_100162444 3300005546 Bacteria 1646
229 Ga0070696_100288660 3300005546 Bacteria 1253
230 Ga0070696_100398146 3300005546 Bacteria 1077
231 Ga0070696_100492901 3300005546 Bacteria 973
232 Ga0070696_100681092 3300005546 Unclassified 836
233 Ga0070696_101565582 3300005546 Bacteria 565
234 Ga0070696_101870732 3300005546 Bacteria 519
235 Ga0070693_100003628 3300005547 Bacteria 7212
236 Ga0070693_100009251 3300005547 Bacteria 4894
237 Ga0070693_100345220 3300005547 Bacteria 1017
238 Ga0070693_100364454 3300005547 Bacteria 992
239 Ga0070704_100083694 3300005549 Bacteria 2356
240 Ga0070704_100093388 3300005549 Bacteria 2248
241 Ga0070704_100309990 3300005549 Bacteria 1318
242 Ga0070704_100350304 3300005549 Bacteria 1246
243 Ga0070704_100382999 3300005549 Bacteria 1195
244 Ga0070704_100441416 3300005549 Bacteria 1119
245 Ga0070704_100649124 3300005549 Bacteria 931
246 Ga0070704_101078396 3300005549 Unclassified 729
247 Ga0070704_101241523 3300005549 Unclassified 680
248 Ga0068855_100687812 3300005563 Bacteria 1096
249 Ga0070664_100027164 3300005564 Bacteria 4754
250 Ga0070664_100284158 3300005564 Bacteria 1492
251 Ga0070664_100426273 3300005564 Bacteria 1215
252 Ga0070664_100594897 3300005564 Bacteria 1025
253 Ga0070664_100648085 3300005564 Unclassified 981
254 Ga0068857_100224525 3300005577 Bacteria 1716
255 Ga0068857_100457779 3300005577 Bacteria 1193
256 Ga0068854_100017037 3300005578 Bacteria 4856
257 Ga0068854_100152959 3300005578 Bacteria 1780
258 Ga0068854_100270777 3300005578 Bacteria 1363
259 Ga0068854_100810642 3300005578 Bacteria 817
260 Ga0068854_101043847 3300005578 Unclassified 726
261 Ga0068856_100031217 3300005614 Bacteria 5212
262 Ga0068856_100158720 3300005614 Bacteria 2272
263 Ga0068856_100342321 3300005614 Bacteria 1514
264 Ga0068856_100885858 3300005614 Unclassified 911
265 Ga0070702_100020864 3300005615 Bacteria 3439
266 Ga0070702_100022419 3300005615 Bacteria 3338
267 Ga0070702_100056578 3300005615 Bacteria 2265
268 Ga0070702_100159528 3300005615 Bacteria 1456
269 Ga0070702_100202279 3300005615 Bacteria 1316
270 Ga0070702_100300332 3300005615 Bacteria 1110
271 Ga0070702_100304718 3300005615 Bacteria 1104
272 Ga0070702_100581226 3300005615 Bacteria 837
273 Ga0070702_100707420 3300005615 Bacteria 769
274 Ga0068852_100093014 3300005616 Bacteria 2701
275 Ga0068852_100381526 3300005616 Bacteria 1383
276 Ga0068852_100817665 3300005616 Bacteria 946
277 Ga0068859_100017683 3300005617 Bacteria 7167
278 Ga0068859_100046105 3300005617 Bacteria 4379
279 Ga0068859_100147685 3300005617 Bacteria 2426
280 Ga0068859_100205327 3300005617 Bacteria 2055
281 Ga0068859_100240844 3300005617 Bacteria 1898
282 Ga0068859_100271701 3300005617 Bacteria 1787
283 Ga0068859_100573248 3300005617 Bacteria 1222
284 Ga0068859_101344893 3300005617 Unclassified 787
285 Ga0068859_101672418 3300005617 Unclassified 703
286 Ga0068859_101949886 3300005617 Unclassified 648
287 Ga0068859_102682789 3300005617 Unclassified 548
288 Ga0068859_103148907 3300005617 Unclassified 502
289 Ga0068864_100077424 3300005618 Bacteria 2908
290 Ga0068864_100454383 3300005618 Bacteria 1225
291 Ga0068864_100456504 3300005618 Bacteria 1223
292 Ga0068864_100483826 3300005618 Bacteria 1188
293 Ga0068864_100653987 3300005618 Bacteria 1024
294 Ga0068864_100968402 3300005618 Bacteria 843
295 Ga0068864_101485406 3300005618 Bacteria 680
296 Ga0068864_101546933 3300005618 Unclassified 667
297 Ga0068866_10000684 3300005718 Bacteria 15437
298 Ga0068866_10028898 3300005718 Bacteria 2645
299 Ga0068861_100022941 3300005719 Bacteria 4500
300 Ga0068861_100166917 3300005719 Bacteria 1821
301 Ga0068861_100354324 3300005719 Bacteria 1288
302 Ga0068861_101738102 3300005719 Bacteria 617
303 Ga0068851_10016680 3300005834 Bacteria 3519
304 Ga0068870_10224937 3300005840 Bacteria 1150
305 Ga0068870_10507968 3300005840 Bacteria 804
306 Ga0068870_10763273 3300005840 Bacteria 672
307 Ga0068863_100074782 3300005841 Bacteria 3205
308 Ga0068863_100090858 3300005841 Bacteria 2895
309 Ga0068863_100377275 3300005841 Bacteria 1384
310 Ga0068863_100547436 3300005841 Unclassified 1142
311 Ga0068858_100002375 3300005842 Bacteria 19040
312 Ga0068858_100007656 3300005842 Bacteria 10433
313 Ga0068858_100033389 3300005842 Bacteria 4776
314 Ga0068858_100081988 3300005842 Bacteria 2998
315 Ga0068858_100082328 3300005842 Bacteria 2991
316 Ga0068858_100109652 3300005842 Bacteria 2577
317 Ga0068858_100287872 3300005842 Unclassified 1565
318 Ga0068858_102095082 3300005842 Unclassified 559
319 Ga0068858_102276598 3300005842 Unclassified 536
320 Ga0068860_100037964 3300005843 Bacteria 4609
321 Ga0068860_100059819 3300005843 Bacteria 3621
322 Ga0068860_100114135 3300005843 Bacteria 2583
323 Ga0068860_100226405 3300005843 Bacteria 1816
324 Ga0068860_100445817 3300005843 Unclassified 1286
325 Ga0068860_100983996 3300005843 Bacteria 861
326 Ga0068860_101059515 3300005843 Bacteria 830
327 Ga0068860_101723245 3300005843 Unclassified 648
328 Ga0068862_100040680 3300005844 Bacteria 3952
329 Ga0068862_100056661 3300005844 Bacteria 3358
330 Ga0068862_100057688 3300005844 Bacteria 3330
331 Ga0068862_100381212 3300005844 Bacteria 1315
332 Ga0068862_100451050 3300005844 Bacteria 1213
333 Ga0081455_10158880 3300005937 Bacteria 1735
334 Ga0081455_10636649 3300005937 Unclassified 689
335 Ga0081539_10001142 3300005985 Bacteria 48082
336 Ga0081539_10028340 3300005985 Bacteria 3524
337 Ga0081539_10106045 3300005985 Bacteria 1423
338 Ga0081539_10131462 3300005985 Bacteria 1229
339 Ga0075363_100301524 3300006048 Bacteria 930
340 Ga0075364_10085096 3300006051 Bacteria 2094
341 Ga0075432_10073290 3300006058 Bacteria 1232
342 Ga0070715_10140135 3300006163 Bacteria 1174
343 Ga0070715_10169058 3300006163 Bacteria 1087
344 Ga0070716_100164111 3300006173 Bacteria 1443
345 Ga0070716_100220426 3300006173 Bacteria 1274
346 Ga0070716_100290404 3300006173 Bacteria 1133
347 Ga0070712_101121529 3300006175 Bacteria 683
348 Ga0075367_10401214 3300006178 Unclassified 867
349 Ga0075367_10442706 3300006178 Unclassified 823
350 Ga0097621_100010001 3300006237 Bacteria 6915
351 Ga0097621_100010123 3300006237 Bacteria 6882
352 Ga0097621_100364737 3300006237 Bacteria 1287
353 Ga0075370_10300637 3300006353 Bacteria 954
354 Ga0068871_100024423 3300006358 Bacteria 4687
355 Ga0068871_100210249 3300006358 Bacteria 1682
356 Ga0068871_100523066 3300006358 Bacteria 1071
357 Ga0075428_100046558 3300006844 Bacteria 4764
358 Ga0075428_100058800 3300006844 Bacteria 4209
359 Ga0075428_100459402 3300006844 Bacteria 1363
360 Ga0075428_100925272 3300006844 Bacteria 924
361 Ga0075428_101286257 3300006844 Bacteria 769
362 Ga0075430_100144913 3300006846 Bacteria 1978
363 Ga0075430_100203120 3300006846 Bacteria 1645
364 Ga0075430_100434217 3300006846 Bacteria 1084
365 Ga0075431_100004485 3300006847 Bacteria 13699
366 Ga0075431_100023932 3300006847 Bacteria 6252
367 Ga0075431_100440701 3300006847 Bacteria 1299
368 Ga0075433_10008752 3300006852 Bacteria 8075
369 Ga0075433_10037879 3300006852 Bacteria 4162
370 Ga0075433_10142836 3300006852 Bacteria 2128
371 Ga0075433_10240666 3300006852 Bacteria 1606
372 Ga0075433_10264822 3300006852 Bacteria 1523
373 Ga0075433_10353404 3300006852 Bacteria 1299
374 Ga0075433_10385822 3300006852 Bacteria 1236
375 Ga0075433_10580550 3300006852 Bacteria 985
376 Ga0075434_100040176 3300006871 Bacteria 4634
377 Ga0075434_100148013 3300006871 Bacteria 2368
378 Ga0075434_100185361 3300006871 Bacteria 2101
379 Ga0075434_100427194 3300006871 Bacteria 1346
380 Ga0075434_100668646 3300006871 Bacteria 1056
381 Ga0075434_101080720 3300006871 Bacteria 816
382 Ga0075434_101212793 3300006871 Bacteria 766
383 Ga0075434_101493807 3300006871 Unclassified 685
384 Ga0075434_102100241 3300006871 Bacteria 569
385 Ga0075429_100004315 3300006880 Bacteria 12219
386 Ga0075429_100864370 3300006880 Bacteria 792
387 Ga0075429_101810688 3300006880 Bacteria 530
388 Ga0075429_101895462 3300006880 Unclassified 516
389 Ga0068865_100005466 3300006881 Bacteria 7707
390 Ga0068865_100396346 3300006881 Bacteria 1130
391 Ga0068865_100482499 3300006881 Bacteria 1030
392 Ga0068865_100671039 3300006881 Bacteria 883
393 Ga0075436_100000015 3300006914 Bacteria 174598
394 Ga0075436_100013759 3300006914 Bacteria 5541
395 Ga0097620_100017683 3300006931 Bacteria 7167
396 Ga0097620_100046105 3300006931 Bacteria 4379
397 Ga0097620_100147685 3300006931 Bacteria 2426
398 Ga0097620_100205338 3300006931 Bacteria 2055
399 Ga0097620_100240821 3300006931 Bacteria 1898
400 Ga0097620_100271678 3300006931 Bacteria 1787
401 Ga0097620_100573238 3300006931 Bacteria 1222
402 Ga0097620_101344889 3300006931 Unclassified 787
403 Ga0097620_101673160 3300006931 Unclassified 703
404 Ga0097620_101949810 3300006931 Unclassified 648
405 Ga0097620_102682474 3300006931 Unclassified 548
406 Ga0097620_103149039 3300006931 Unclassified 502
407 Ga0075435_100483478 3300007076 Bacteria 1070
408 Ga0075435_100859535 3300007076 Bacteria 790
409 Ga0075435_101725329 3300007076 Bacteria 549
410 Ga0105251_10176467 3300009011 Unclassified 962
411 Ga0105244_10259618 3300009036 Bacteria 809
412 Ga0105240_10023866 3300009093 Bacteria 8078
413 Ga0105240_10106929 3300009093 Bacteria 3392
414 Ga0105240_10323307 3300009093 Bacteria 1757
415 Ga0105240_11624294 3300009093 Bacteria 676
416 Ga0105240_12179640 3300009093 Bacteria 575
417 Ga0111539_10003746 3300009094 Bacteria 20004
418 Ga0111539_10029571 3300009094 Bacteria 6670
419 Ga0111539_10107148 3300009094 Bacteria 3279
420 Ga0111539_10667918 3300009094 Bacteria 1210
421 Ga0111539_11362722 3300009094 Unclassified 823
422 Ga0111539_12169441 3300009094 Bacteria 644
423 Ga0111539_13088412 3300009094 Bacteria 537
424 Ga0105245_10009220 3300009098 Bacteria 8603
425 Ga0105245_10191604 3300009098 Bacteria 1958
426 Ga0105245_11772465 3300009098 Unclassified 670
427 Ga0105247_10000005 3300009101 Bacteria 426989
428 Ga0105247_10209413 3300009101 Bacteria 1314
429 Ga0105247_11167274 3300009101 Bacteria 611
430 Ga0105247_11249209 3300009101 Unclassified 594
431 Ga0105247_11370099 3300009101 Unclassified 571
432 Ga0105247_11467234 3300009101 Unclassified 555
433 Ga0114129_10019427 3300009147 Bacteria 9673
434 Ga0114129_10108251 3300009147 Bacteria 3837
435 Ga0114129_10181912 3300009147 Bacteria 2860
436 Ga0114129_10341075 3300009147 Bacteria 1987
437 Ga0114129_10877672 3300009147 Bacteria 1138
438 Ga0114129_10975810 3300009147 Bacteria 1069
439 Ga0114129_11054672 3300009147 Bacteria 1020
440 Ga0114129_12521563 3300009147 Unclassified 614
441 Ga0105243_10019054 3300009148 Bacteria 5203
442 Ga0105243_10055155 3300009148 Bacteria 3157
443 Ga0105243_10246528 3300009148 Bacteria 1592
444 Ga0105243_10301221 3300009148 Bacteria 1453
445 Ga0105243_10787831 3300009148 Bacteria 936
446 Ga0105243_12227233 3300009148 Unclassified 585
447 Ga0105241_10107226 3300009174 Bacteria 2231
448 Ga0105241_10215505 3300009174 Bacteria 1611
449 Ga0105241_10710659 3300009174 Bacteria 918
450 Ga0105241_11037769 3300009174 Unclassified 769
451 Ga0105241_11230423 3300009174 Bacteria 710
452 Ga0105241_11734091 3300009174 Bacteria 608
453 Ga0105242_10007678 3300009176 Bacteria 8299
454 Ga0105242_10088295 3300009176 Unclassified 2604
455 Ga0105242_10130667 3300009176 Bacteria 2167
456 Ga0105242_10223473 3300009176 Bacteria 1684
457 Ga0105242_10454891 3300009176 Bacteria 1208
458 Ga0105242_10565038 3300009176 Unclassified 1093
459 Ga0105242_12600125 3300009176 Unclassified 555
460 Ga0105248_10014028 3300009177 Bacteria 8817
461 Ga0105248_10091433 3300009177 Bacteria 3427
462 Ga0105248_10179460 3300009177 Bacteria 2386
463 Ga0105248_10489049 3300009177 Bacteria 1387
464 Ga0105248_11113366 3300009177 Bacteria 893
465 Ga0105248_11591229 3300009177 Unclassified 740
466 Ga0105237_10035040 3300009545 Bacteria 5079
467 Ga0105237_10326547 3300009545 Bacteria 1538
468 Ga0105237_10508172 3300009545 Bacteria 1212
469 Ga0105237_10553910 3300009545 Bacteria 1156
470 Ga0105238_10049968 3300009551 Bacteria 4210
471 Ga0105249_10023100 3300009553 Bacteria 5577
472 Ga0105249_10033646 3300009553 Bacteria 4641
473 Ga0105249_10039009 3300009553 Bacteria 4311
474 Ga0105249_10260824 3300009553 Bacteria 1722
475 Ga0105249_11031258 3300009553 Bacteria 892
476 Ga0105249_11739543 3300009553 Bacteria 696
477 Ga0105249_12235555 3300009553 Bacteria 620
478 Ga0105249_12722649 3300009553 Bacteria 566
479 Ga0099796_10025723 3300010159 Bacteria 1862
480 Ga0105239_10017161 3300010375 Bacteria 8002
481 Ga0105239_10227608 3300010375 Bacteria 2092
482 Ga0105239_10537338 3300010375 Bacteria 1331
483 Ga0105239_11648093 3300010375 Unclassified 742
484 Ga0105239_12143442 3300010375 Bacteria 650
485 Ga0105246_10027132 3300011119 Bacteria 3750
486 Ga0105246_10224743 3300011119 Bacteria 1474
487 Ga0105246_10466384 3300011119 Bacteria 1065
488 Ga0157373_10910577 3300013100 Unclassified 653
489 Ga0157373_11065013 3300013100 Unclassified 605
490 Ga0157371_10266907 3300013102 Bacteria 1235
491 Ga0157371_11150040 3300013102 Bacteria 597
492 Ga0157374_10428206 3300013296 Bacteria 1323
493 Ga0157374_10516761 3300013296 Bacteria 1200
494 Ga0157378_10000067 3300013297 Bacteria 92867
495 Ga0157378_10006757 3300013297 Bacteria 10022
496 Ga0157378_10012876 3300013297 Bacteria 7324
497 Ga0157378_10033270 3300013297 Bacteria 4556
498 Ga0157378_10052148 3300013297 Bacteria 3639
499 Ga0157378_10098822 3300013297 Bacteria 2662
500 Ga0157378_10373867 3300013297 Bacteria 1398
501 Ga0157378_10695891 3300013297 Bacteria 1035
502 Ga0157378_10787995 3300013297 Bacteria 976
503 Ga0157378_10860832 3300013297 Bacteria 935
504 Ga0157378_11583504 3300013297 Unclassified 701
505 Ga0163162_10052139 3300013306 Bacteria 4108
506 Ga0163162_10088515 3300013306 Bacteria 3176
507 Ga0163162_10161247 3300013306 Bacteria 2364
508 Ga0163162_10225733 3300013306 Bacteria 2003
509 Ga0163162_10801311 3300013306 Bacteria 1059
510 Ga0163162_11342019 3300013306 Bacteria 813
511 Ga0157372_10560935 3300013307 Bacteria 1331
512 Ga0157372_13347804 3300013307 Unclassified 510
513 Ga0157375_10010135 3300013308 Bacteria 8289
514 Ga0157375_10248965 3300013308 Bacteria 1937
515 Ga0157375_10285952 3300013308 Bacteria 1812
516 Ga0157375_10426331 3300013308 Bacteria 1492
517 Ga0157375_12408685 3300013308 Unclassified 628
518 Ga0157375_12653253 3300013308 Unclassified 599
519 Ga0163163_10010551 3300014325 Bacteria 8314
520 Ga0163163_10181085 3300014325 Unclassified 2154
521 Ga0163163_10536157 3300014325 Bacteria 1233
522 Ga0163163_11400061 3300014325 Bacteria 761
523 Ga0163163_12293797 3300014325 Bacteria 599
524 Ga0163163_13273837 3300014325 Unclassified 505
525 Ga0157380_10006445 3300014326 Bacteria 8267
526 Ga0157380_10008575 3300014326 Bacteria 7309
527 Ga0157380_10262707 3300014326 Bacteria 1569
528 Ga0157380_10285385 3300014326 Unclassified 1513
529 Ga0157380_10459267 3300014326 Bacteria 1225
530 Ga0157380_10920336 3300014326 Bacteria 902
531 Ga0157380_11610301 3300014326 Bacteria 705
532 Ga0157380_12280292 3300014326 Unclassified 606
533 Ga0182008_10327499 3300014497 Unclassified 807
534 Ga0157377_10187065 3300014745 Bacteria 1306
535 Ga0157379_10115483 3300014968 Bacteria 2413
536 Ga0157379_10291413 3300014968 Bacteria 1486
537 Ga0157379_10489485 3300014968 Bacteria 1139
538 Ga0157376_10167934 3300014969 Bacteria 1995
539 Ga0157376_10271213 3300014969 Bacteria 1594
540 Ga0157376_10420225 3300014969 Bacteria 1297
541 Ga0157376_10960923 3300014969 Bacteria 875
542 Ga0182007_10132255 3300015262 Unclassified 840
543 Ga0163161_10039795 3300017792 Bacteria 3377
544 Ga0163161_10652039 3300017792 Bacteria 872
545 Ga0206352_10617335 3300020078 Unclassified 803
546 Ga0206354_11678042 3300020081 Bacteria 720
547 Ga0213876_10112732 3300021384 Bacteria 1443
548 Ga0224712_10017586 3300022467 Bacteria 2374
549 Ga0207672_1000403 3300025223 Bacteria 5536
550 Ga0209566_100273 3300025225 Bacteria 48159
551 Ga0209147_100198 3300025229 Bacteria 67714
552 Ga0209130_1016157 3300025284 Bacteria 1815
553 Ga0209675_1019703 3300025291 Bacteria 1847
554 Ga0209676_1000745 3300025292 Bacteria 44098
555 Ga0207656_10000878 3300025321 Bacteria 9805
556 Ga0207696_1110904 3300025711 Bacteria 743
557 Ga0207713_1080075 3300025735 Unclassified 1178
558 Ga0207653_10002754 3300025885 Bacteria 5592
559 Ga0207682_10072608 3300025893 Unclassified 1460
560 Ga0207692_10343151 3300025898 Unclassified 919
561 Ga0207642_10006933 3300025899 Bacteria 3797
562 Ga0207642_10059505 3300025899 Bacteria 1767
563 Ga0207642_10366178 3300025899 Unclassified 854
564 Ga0207710_10000004 3300025900 Bacteria 846540
565 Ga0207710_10076290 3300025900 Bacteria 1546
566 Ga0207710_10193559 3300025900 Bacteria 1002
567 Ga0207710_10429959 3300025900 Bacteria 680
568 Ga0207688_10075149 3300025901 Bacteria 1923
569 Ga0207688_10345918 3300025901 Bacteria 915
570 Ga0207688_10450943 3300025901 Bacteria 802
571 Ga0207680_10158946 3300025903 Bacteria 1513
572 Ga0207647_10002003 3300025904 Bacteria 15586
573 Ga0207647_10586971 3300025904 Unclassified 616
574 Ga0207699_10093594 3300025906 Bacteria 1892
575 Ga0207699_10905888 3300025906 Bacteria 651
576 Ga0207645_10113596 3300025907 Bacteria 1755
577 Ga0207645_10253700 3300025907 Bacteria 1164
578 Ga0207643_10456106 3300025908 Unclassified 814
579 Ga0207643_10976486 3300025908 Viruses 548
580 Ga0207684_10057428 3300025910 Bacteria 3302
581 Ga0207684_10098332 3300025910 Bacteria 2499
582 Ga0207684_10255210 3300025910 Bacteria 1513
583 Ga0207654_10215580 3300025911 Bacteria 1271
584 Ga0207654_10259353 3300025911 Bacteria 1168
585 Ga0207654_10941177 3300025911 Bacteria 627
586 Ga0207707_10000016 3300025912 Bacteria 256002
587 Ga0207707_10002220 3300025912 Bacteria 17547
588 Ga0207707_10010480 3300025912 Bacteria 8043
589 Ga0207707_11029920 3300025912 Bacteria 674
590 Ga0207695_10061311 3300025913 Bacteria 3887
591 Ga0207695_10290339 3300025913 Bacteria 1528
592 Ga0207695_10916558 3300025913 Unclassified 756
593 Ga0207671_10340550 3300025914 Bacteria 1188
594 Ga0207660_10052536 3300025917 Bacteria 2901
595 Ga0207660_10072579 3300025917 Bacteria 2507
596 Ga0207660_10073473 3300025917 Bacteria 2493
597 Ga0207660_10452968 3300025917 Bacteria 1038
598 Ga0207662_10029256 3300025918 Bacteria 3191
599 Ga0207662_10093326 3300025918 Bacteria 1855
600 Ga0207662_10201316 3300025918 Bacteria 1289
601 Ga0207662_10219743 3300025918 Bacteria 1237
602 Ga0207662_10253008 3300025918 Unclassified 1157
603 Ga0207662_10656776 3300025918 Unclassified 733
604 Ga0207657_10446216 3300025919 Bacteria 1015
605 Ga0207649_10935990 3300025920 Unclassified 680
606 Ga0207649_11196969 3300025920 Unclassified 600
607 Ga0207652_10000267 3300025921 Bacteria 54601
608 Ga0207652_10014383 3300025921 Bacteria 6411
609 Ga0207646_10010058 3300025922 Bacteria 9273
610 Ga0207646_10011116 3300025922 Bacteria 8741
611 Ga0207646_10029852 3300025922 Bacteria 4949
612 Ga0207646_10129683 3300025922 Bacteria 2269
613 Ga0207646_10364990 3300025922 Bacteria 1304
614 Ga0207646_11273842 3300025922 Bacteria 643
615 Ga0207646_11543974 3300025922 Bacteria 574
616 Ga0207646_11547076 3300025922 Bacteria 573
617 Ga0207681_10025237 3300025923 Bacteria 3821
618 Ga0207681_10152572 3300025923 Bacteria 1733
619 Ga0207681_10296731 3300025923 Bacteria 1277
620 Ga0207694_10008076 3300025924 Bacteria 7954
621 Ga0207650_10000011 3300025925 Bacteria 450115
622 Ga0207650_10058798 3300025925 Bacteria 2863
623 Ga0207650_10061701 3300025925 Bacteria 2799
624 Ga0207650_10071542 3300025925 Bacteria 2609
625 Ga0207650_11185431 3300025925 Bacteria 650
626 Ga0207659_10109170 3300025926 Bacteria 2100
627 Ga0207687_10852988 3300025927 Bacteria 778
628 Ga0207644_10003135 3300025931 Bacteria 10650
629 Ga0207644_10013122 3300025931 Bacteria 5516
630 Ga0207644_10086890 3300025931 Bacteria 2323
631 Ga0207690_10154128 3300025932 Bacteria 1706
632 Ga0207690_10295524 3300025932 Bacteria 1266
633 Ga0207706_10420423 3300025933 Bacteria 1158
634 Ga0207706_10889544 3300025933 Bacteria 753
635 Ga0207686_10005623 3300025934 Bacteria 6720
636 Ga0207686_10055449 3300025934 Unclassified 2487
637 Ga0207686_10172693 3300025934 Bacteria 1526
638 Ga0207686_10296618 3300025934 Bacteria 1199
639 Ga0207686_10336230 3300025934 Bacteria 1133
640 Ga0207686_10970124 3300025934 Unclassified 689
641 Ga0207709_10006883 3300025935 Bacteria 6364
642 Ga0207709_10012133 3300025935 Bacteria 4749
643 Ga0207709_10092751 3300025935 Bacteria 1978
644 Ga0207709_10128828 3300025935 Bacteria 1721
645 Ga0207709_10201887 3300025935 Bacteria 1421
646 Ga0207709_10286232 3300025935 Bacteria 1219
647 Ga0207709_10348055 3300025935 Bacteria 1118
648 Ga0207670_10004178 3300025936 Bacteria 7747
649 Ga0207670_10039470 3300025936 Bacteria 3092
650 Ga0207670_10220864 3300025936 Bacteria 1450
651 Ga0207670_10685541 3300025936 Bacteria 847
652 Ga0207704_10015168 3300025938 Bacteria 3917
653 Ga0207704_10987531 3300025938 Bacteria 711
654 Ga0207665_10044010 3300025939 Bacteria 2987
655 Ga0207665_10075933 3300025939 Bacteria 2303
656 Ga0207665_10264166 3300025939 Bacteria 1276
657 Ga0207665_10296770 3300025939 Bacteria 1207
658 Ga0207665_10675538 3300025939 Bacteria 811
659 Ga0207691_10011757 3300025940 Bacteria 8402
660 Ga0207691_10083615 3300025940 Bacteria 2866
661 Ga0207711_10008388 3300025941 Bacteria 8646
662 Ga0207711_10010629 3300025941 Bacteria 7656
663 Ga0207711_10157868 3300025941 Bacteria 2051
664 Ga0207711_10366421 3300025941 Bacteria 1336
665 Ga0207711_11013065 3300025941 Unclassified 770
666 Ga0207689_10030521 3300025942 Bacteria 4492
667 Ga0207689_10089386 3300025942 Bacteria 2530
668 Ga0207689_10125695 3300025942 Bacteria 2110
669 Ga0207689_10138079 3300025942 Bacteria 2007
670 Ga0207689_10196005 3300025942 Bacteria 1667
671 Ga0207661_10197993 3300025944 Bacteria 1765
672 Ga0207679_10014244 3300025945 Bacteria 5224
673 Ga0207679_10088992 3300025945 Bacteria 2382
674 Ga0207679_10988629 3300025945 Bacteria 771
675 Ga0207679_11451951 3300025945 Bacteria 629
676 Ga0207667_10239504 3300025949 Bacteria 1857
677 Ga0207667_10251941 3300025949 Bacteria 1806
678 Ga0207651_10195565 3300025960 Bacteria 1616
679 Ga0207651_10307270 3300025960 Bacteria 1321
680 Ga0207651_10324471 3300025960 Bacteria 1288
681 Ga0207651_10581801 3300025960 Unclassified 977
682 Ga0207651_11172523 3300025960 Bacteria 689
683 Ga0207651_11374073 3300025960 Unclassified 635
684 Ga0207651_11677465 3300025960 Unclassified 572
685 Ga0207712_10010700 3300025961 Bacteria 5826
686 Ga0207712_10029090 3300025961 Bacteria 3703
687 Ga0207712_10031309 3300025961 Bacteria 3582
688 Ga0207712_10167843 3300025961 Bacteria 1712
689 Ga0207712_10178431 3300025961 Bacteria 1666
690 Ga0207712_10787223 3300025961 Unclassified 835
691 Ga0207712_11406653 3300025961 Bacteria 624
692 Ga0207712_12076311 3300025961 Unclassified 508
693 Ga0207640_10022653 3300025981 Bacteria 3763
694 Ga0207640_10385266 3300025981 Bacteria 1137
695 Ga0207640_10746159 3300025981 Unclassified 843
696 Ga0207677_10012110 3300026023 Bacteria 4944
697 Ga0207677_10168987 3300026023 Bacteria 1708
698 Ga0207677_11133000 3300026023 Bacteria 714
699 Ga0207703_10000589 3300026035 Bacteria 36985
700 Ga0207703_10004977 3300026035 Bacteria 10784
701 Ga0207703_10074679 3300026035 Bacteria 2808
702 Ga0207703_10097689 3300026035 Bacteria 2482
703 Ga0207703_10161973 3300026035 Bacteria 1960
704 Ga0207703_10403191 3300026035 Unclassified 1269
705 Ga0207639_10018927 3300026041 Bacteria 4903
706 Ga0207678_10345583 3300026067 Unclassified 1282
707 Ga0207708_10132826 3300026075 Bacteria 1947
708 Ga0207708_10146529 3300026075 Bacteria 1856
709 Ga0207708_11253514 3300026075 Bacteria 649
710 Ga0207702_10160175 3300026078 Bacteria 2055
711 Ga0207641_10012708 3300026088 Bacteria 6903
712 Ga0207641_10043522 3300026088 Bacteria 3771
713 Ga0207641_10358719 3300026088 Bacteria 1391
714 Ga0207641_10550144 3300026088 Bacteria 1125
715 Ga0207641_11369446 3300026088 Unclassified 708
716 Ga0207641_11667011 3300026088 Unclassified 639
717 Ga0207648_10033880 3300026089 Bacteria 4503
718 Ga0207648_10168113 3300026089 Bacteria 1938
719 Ga0207648_10290567 3300026089 Bacteria 1463
720 Ga0207648_10394973 3300026089 Unclassified 1252
721 Ga0207648_11392547 3300026089 Bacteria 659
722 Ga0207676_10059723 3300026095 Bacteria 3012
723 Ga0207676_10097178 3300026095 Bacteria 2432
724 Ga0207676_10375883 3300026095 Bacteria 1321
725 Ga0207676_10974991 3300026095 Unclassified 834
726 Ga0207676_11238212 3300026095 Viruses 740
727 Ga0207676_11845153 3300026095 Unclassified 603
728 Ga0207674_10866817 3300026116 Bacteria 871
729 Ga0207674_11550029 3300026116 Unclassified 631
730 Ga0207675_100017622 3300026118 Bacteria 6662
731 Ga0207675_100039486 3300026118 Bacteria 4405
732 Ga0207675_100108369 3300026118 Bacteria 2620
733 Ga0207675_100274133 3300026118 Bacteria 1638
734 Ga0207675_100638653 3300026118 Bacteria 1070
735 Ga0207675_101615430 3300026118 Unclassified 669
736 Ga0207683_10320888 3300026121 Bacteria 1419
737 Ga0207683_10365711 3300026121 Bacteria 1325
738 Ga0207698_10453615 3300026142 Bacteria 1238
739 Ga0207698_10685147 3300026142 Bacteria 1019
740 Ga0207698_12686907 3300026142 Unclassified 507
741 Ga0209973_1069272 3300027252 Bacteria 551
742 Ga0209969_1000136 3300027360 Bacteria 9537
743 Ga0209996_1023790 3300027395 Bacteria 871
744 Ga0210000_1000292 3300027462 Bacteria 7188
745 Ga0209995_1000462 3300027471 Bacteria 6215
746 Ga0209995_1026906 3300027471 Bacteria 959
747 Ga0209968_1044634 3300027526 Bacteria 762
748 Ga0209999_1000658 3300027543 Bacteria 5554
749 Ga0209999_1006296 3300027543 Bacteria 2132
750 Ga0209999_1024666 3300027543 Bacteria 1110
751 Ga0209982_1005128 3300027552 Bacteria 1889
752 Ga0210002_1031091 3300027617 Bacteria 888
753 Ga0209983_1001263 3300027665 Bacteria 5623
754 Ga0209983_1002782 3300027665 Bacteria 3788
755 Ga0209983_1007161 3300027665 Bacteria 2290
756 Ga0209971_1007936 3300027682 Bacteria 2519
757 Ga0209971_1023765 3300027682 Bacteria 1462
758 Ga0209974_10000335 3300027876 Bacteria 15422
759 Ga0209974_10002524 3300027876 Bacteria 6638
760 Ga0209974_10033146 3300027876 Unclassified 1713
761 Ga0207428_10007924 3300027907 Bacteria 9653
762 Ga0207428_10677873 3300027907 Unclassified 738
763 Ga0207428_10736086 3300027907 Bacteria 704
764 Ga0268265_10034700 3300028380 Bacteria 3679
765 Ga0268265_10352928 3300028380 Bacteria 1343
766 Ga0268265_10452924 3300028380 Bacteria 1199
767 Ga0268265_10580258 3300028380 Bacteria 1068
768 Ga0268265_11392600 3300028380 Bacteria 703
769 Ga0268265_11825074 3300028380 Bacteria 614
770 Ga0268264_10042115 3300028381 Bacteria 3779
771 Ga0268264_10246915 3300028381 Bacteria 1656
772 Ga0268264_10748057 3300028381 Bacteria 974
773 Ga0268264_10776110 3300028381 Bacteria 956
774 Ga0268264_10902994 3300028381 Bacteria 887
775 Ga0268264_11131013 3300028381 Unclassified 792
776 Ga0268264_11277474 3300028381 Bacteria 744
777 Ga0268264_12441711 3300028381 Unclassified 528
778 Ga0265334_10003963 3300028573 Bacteria 6661
779 Ga0265331_10122487 3300031250 Bacteria 1188
780 Ga0265316_10021700 3300031344 Bacteria 5432
781 Ga0307408_100162100 3300031548 Bacteria 1777
782 Ga0307408_100662298 3300031548 Unclassified 934
783 Ga0307408_100691922 3300031548 Bacteria 915
784 Ga0307408_100714237 3300031548 Bacteria 902
785 Ga0307405_10006163 3300031731 Bacteria 5874
786 Ga0307405_10024793 3300031731 Bacteria 3433
787 Ga0307405_10108505 3300031731 Bacteria 1876
788 Ga0307405_10542975 3300031731 Bacteria 939
789 Ga0307405_10682171 3300031731 Bacteria 849
790 Ga0307405_10698647 3300031731 Bacteria 840
791 Ga0307413_10017567 3300031824 Bacteria 3729
792 Ga0307413_10047208 3300031824 Bacteria 2566
793 Ga0307413_10165095 3300031824 Bacteria 1560
794 Ga0307413_10262842 3300031824 Bacteria 1287
795 Ga0307413_10264847 3300031824 Bacteria 1283
796 Ga0307413_10893740 3300031824 Bacteria 754
797 Ga0307410_10065381 3300031852 Bacteria 2501
798 Ga0307410_10089432 3300031852 Bacteria 2182
799 Ga0307410_10109599 3300031852 Bacteria 1995
800 Ga0307410_10116915 3300031852 Bacteria 1938
801 Ga0307410_10173370 3300031852 Bacteria 1627
802 Ga0307410_10215225 3300031852 Bacteria 1475
803 Ga0307410_10514172 3300031852 Bacteria 987
804 Ga0307406_10003940 3300031901 Bacteria 8062
805 Ga0307406_10049725 3300031901 Bacteria 2654
806 Ga0307406_10109486 3300031901 Bacteria 1899
807 Ga0307406_10390168 3300031901 Bacteria 1100
808 Ga0307407_10020430 3300031903 Bacteria 3394
809 Ga0307407_10170574 3300031903 Bacteria 1432
810 Ga0307407_10256679 3300031903 Bacteria 1200
811 Ga0307407_10352877 3300031903 Bacteria 1042
812 Ga0307407_10476523 3300031903 Bacteria 911
813 Ga0307412_10039661 3300031911 Bacteria 3042
814 Ga0307412_10062960 3300031911 Bacteria 2500
815 Ga0307412_10355211 3300031911 Bacteria 1178
816 Ga0307412_10917005 3300031911 Bacteria 769
817 Ga0307412_11238834 3300031911 Bacteria 669
818 Ga0307409_100088713 3300031995 Bacteria 2526
819 Ga0307409_100120720 3300031995 Bacteria 2219
820 Ga0307409_100192694 3300031995 Bacteria 1816
821 Ga0307409_100444702 3300031995 Bacteria 1249
822 Ga0307409_100583498 3300031995 Bacteria 1102
823 Ga0307409_101014651 3300031995 Bacteria 848
824 Ga0307409_101420227 3300031995 Bacteria 720
825 Ga0307416_100030934 3300032002 Bacteria 4024
826 Ga0307416_100034134 3300032002 Bacteria 3867
827 Ga0307416_100069074 3300032002 Bacteria 2922
828 Ga0307416_100105312 3300032002 Bacteria 2468
829 Ga0307416_100803943 3300032002 Bacteria 1036
830 Ga0307416_101048680 3300032002 Bacteria 919
831 Ga0307416_101335414 3300032002 Bacteria 823
832 Ga0307414_10001220 3300032004 Bacteria 13243
833 Ga0307414_10078993 3300032004 Bacteria 2400
834 Ga0307414_10120589 3300032004 Bacteria 2015
835 Ga0307414_10162873 3300032004 Bacteria 1774
836 Ga0307414_10458794 3300032004 Bacteria 1119
837 Ga0307414_10585987 3300032004 Bacteria 998
838 Ga0307414_10849045 3300032004 Bacteria 835
839 Ga0307414_11596361 3300032004 Unclassified 608
840 Ga0307411_10004491 3300032005 Bacteria 6692
841 Ga0307411_10040958 3300032005 Bacteria 2943
842 Ga0307411_10206147 3300032005 Bacteria 1514
843 Ga0307411_10256030 3300032005 Bacteria 1379
844 Ga0307411_10280681 3300032005 Bacteria 1325
845 Ga0307411_10503450 3300032005 Bacteria 1024
846 Ga0307411_10699663 3300032005 Bacteria 883
847 Ga0307411_10756263 3300032005 Bacteria 852
848 Ga0307411_11365327 3300032005 Bacteria 647
849 Ga0307415_100003721 3300032126 Bacteria 7806
850 Ga0307415_100266187 3300032126 Bacteria 1401
851 Ga0307415_100291353 3300032126 Bacteria 1348
852 Ga0307415_100307401 3300032126 Bacteria 1316
853 Ga0307415_101487127 3300032126 Bacteria 647
854 Ga0307415_102055432 3300032126 Bacteria 557
855 Ga0316593_10085680 3300032168 Bacteria 1104
856 Ga0316593_10404949 3300032168 Bacteria 528
857 Ga0316592_1123632 3300033524 Bacteria 601
858 Ga0316592_1149130 3300033524 Bacteria 551
859 Ga0316588_1024200 3300033528 Bacteria 1396
860 Ga0316587_1026396 3300033529 Bacteria 1012
861 Ga0316587_1029176 3300033529 Bacteria 969
862 Ga0316596_1077254 3300033541 Bacteria 894
863 Ga0373951_0000993 3300035091 Bacteria 7605
864 Ga0373951_0016691 3300035091 Bacteria 1658
865 Ga0373952_0074749 3300035092 Unclassified 854
866 Ga0373932_0137063 3300035112 Unclassified 829
867 Ga0373932_0174589 3300035112 Bacteria 751
868 Ga0373932_0286560 3300035112 Unclassified 611
869 Ga0373939_0275552 3300035114 Unclassified 663
870 Ga0373941_0008984 3300035115 Bacteria 2504
871 Ga0373953_0018403 3300035117 Bacteria 2585
872 Ga0373954_0000059 3300035118 Bacteria 38918
873 Ga0373955_0376766 3300035172 Bacteria 861
874 Ga0373942_0031044 3300035207 Bacteria 1410
875 Ga0373961_0012637 3300035241 Unclassified 2118
876 Ga0373962_0095627 3300035242 Bacteria 921
877 Ga0316574_0053390 3300035398 Bacteria 2523
878 Ga0373931_0195668 3300035691 Bacteria 1205
879 Ga0373931_0841339 3300035691 Unclassified 614
880 Ga0373931_0950653 3300035691 Unclassified 580
881 Ga0373933_0019852 3300035724 Bacteria 3803
882 Ga0373933_0494407 3300035724 Unclassified 801
883 Ga0373947_0278960 3300035725 Bacteria 1111
884 Ga0373937_0002664 3300036401 Bacteria 14883
885 Ga0373937_0532011 3300036401 Bacteria 1117
886 Ga0373937_1099284 3300036401 Bacteria 744
887 Ga0373925_1610865 3300037068 Bacteria 531
888 Ga0395899_0028641 3300037312 Bacteria 4193
889 Ga0395899_0210171 3300037312 Bacteria 1352
890 Ga0395900_0725165 3300037418 Bacteria 926
891 Ga0395898_1475873 3300037466 Unclassified 606
892 Ga0395901_1971731 3300038443 Bacteria 530
893 Ga0242419_004777 3300038698 Unclassified 953
894 Ga0400484_20020 3300038725 Bacteria 11330
895 Ga0400484_40509 3300038725 Bacteria 10975
896 Ga0400488_35053 3300038741 Bacteria 2374
897 Ga0400486_28583 3300038742 Bacteria 22203
898 Ga0242420_004643 3300038996 Bacteria 2087
899 Ga0400483_001247 3300039062 Bacteria 12218
900 Ga0400483_146956 3300039062 Bacteria 16590
901 Ga0400483_187740 3300039062 Bacteria 1618
902 Ga0400483_198698 3300039062 Bacteria 1176
903 Ga0400483_213263 3300039062 Bacteria 16387
904 Ga0400483_286518 3300039062 Bacteria 6875
905 Ga0400487_23124 3300039110 Bacteria 1525
906 Ga0436365_1063002 3300039437 Bacteria 607
907 Ga0436365_1244758 3300039437 Bacteria 10107
908 Ga0439436_0075656 3300041404 Bacteria 938
909 Ga0439439_0002283 3300041406 Bacteria 4042
910 Ga0439439_0041887 3300041406 Bacteria 1189
911 Ga0439439_0080318 3300041406 Bacteria 881
912 Ga0439465_0215616 3300041413 Bacteria 703
913 Ga0451795_0900414 3300041456 Bacteria 1065
914 Ga0451798_0094922 3300041458 Bacteria 856
915 Ga0451800_1358168 3300041459 Bacteria 758
916 Ga0451805_090425 3300041461 Bacteria 629
917 Ga0451804_0704316 3300041463 Bacteria 695
918 Ga0451845_0928614 3300041501 Bacteria 1704
919 Ga0451849_0273965 3300041505 Bacteria 1672
920 Ga0439433_0103506 3300041999 Unclassified 708
921 Ga0439443_037385 3300042003 Bacteria 820
922 Ga0439448_0079594 3300042005 Bacteria 1099
923 Ga0439450_110915 3300042008 Bacteria 702
924 Ga0439455_0053784 3300042012 Bacteria 1056
925 Ga0439462_0087082 3300042015 Bacteria 855
926 Ga0450921_006157 3300042123 Bacteria 926
927 Ga0450894_007385 3300042131 Bacteria 1418
928 Ga0450898_009730 3300042134 Bacteria 1542
929 Ga0450910_018809 3300042147 Bacteria 1034
930 Ga0439446_0054111 3300042156 Bacteria 1203
931 Ga0439446_0098330 3300042156 Bacteria 923
932 Ga0439458_0026212 3300042157 Bacteria 1370
933 Ga0439459_0092623 3300042438 Unclassified 729
934 Ga0451577_0017338 3300042876 Bacteria 6656
935 Ga0451577_0788645 3300042876 Bacteria 858
936 Ga0451577_1457282 3300042876 Unclassified 606
937 Ga0453683_0267752 3300044673 Bacteria 1090
938 Ga0453683_0573509 3300044673 Unclassified 735
939 Ga0453684_0003452 3300044712 Bacteria 35581
940 Ga0453684_0066242 3300044712 Bacteria 4600
941 Ga0453684_1667936 3300044712 Unclassified 652
942 Ga0453684_1861800 3300044712 Bacteria 610
943 Ga0451576_0782912 3300045051 Bacteria 1002
944 Ga0451576_1593135 3300045051 Bacteria 677
945 Ga0495629_0549179 3300046459 Unclassified 775
946 Ga0495629_0622841 3300046459 Bacteria 720
947 Ga0495580_0043446 3300046472 Bacteria 3199
948 Ga0495582_0241338 3300046473 Bacteria 1035
949 Ga0495639_0113101 3300046475 Bacteria 1290
950 Ga0495594_0126452 3300046499 Bacteria 1446
951 Ga0495608_0149665 3300046511 Bacteria 1488
952 Ga0495608_0393312 3300046511 Bacteria 849
953 Ga0495618_0009589 3300046514 Bacteria 5846
954 Ga0495628_0178595 3300046516 Bacteria 1607
955 Ga0495630_0060577 3300046517 Bacteria 2841
956 Ga0495630_0209707 3300046517 Bacteria 1487
957 Ga0495663_0062646 3300046525 Bacteria 1172
958 Ga0495666_0025956 3300046526 Bacteria 2891
959 Ga0495652_0468599 3300046529 Unclassified 879
960 Ga0495640_0038941 3300046533 Bacteria 3340
961 Ga0495640_0607224 3300046533 Unclassified 660
962 Ga0495586_0001882 3300046535 Bacteria 11418
963 Ga0495586_0149653 3300046535 Bacteria 1313
964 Ga0495634_0041778 3300046642 Bacteria 3113
965 Ga0495635_0294853 3300046663 Bacteria 1088
966 Ga0495635_0314849 3300046663 Bacteria 1048
967 Ga0495657_0214837 3300046675 Bacteria 1168
968 Ga0495647_0039160 3300046681 Bacteria 1795
969 Ga0495647_0106343 3300046681 Bacteria 1167
970 Ga0495658_0024044 3300046683 Bacteria 3240
971 Ga0495658_0353318 3300046683 Unclassified 934
972 Ga0495613_0048441 3300046689 Bacteria 3138
973 Ga0495613_0278931 3300046689 Bacteria 1161
974 Ga0495624_0103007 3300046690 Bacteria 1757
975 Ga0495600_0173356 3300046809 Bacteria 1392
976 Ga0495581_0181766 3300047315 Bacteria 1230
977 Ga0495581_0463077 3300047315 Unclassified 738
978 Ga0495674_0003864 3300047319 Bacteria 14553
979 Ga0495676_0165594 3300047321 Bacteria 1560
980 Ga0495680_0026186 3300047322 Bacteria 4813
981 Ga0495680_0087918 3300047322 Bacteria 2336
982 Ga0495684_0241561 3300047471 Bacteria 1317
983 Ga0495684_0431556 3300047471 Bacteria 919
984 Ga0496100_0506796 3300048903 Bacteria 930
985 Ga0496101_0600903 3300048904 Bacteria 870
986 Ga0496102_0014942 3300048905 Bacteria 6756
987 Ga0496102_0134390 3300048905 Bacteria 2317
988 Ga0496102_0337884 3300048905 Bacteria 1419
989 Ga0496102_0596375 3300048905 Bacteria 1028
990 Ga0496103_0055914 3300048906 Bacteria 2449
991 Ga0496103_0073160 3300048906 Bacteria 2147
992 Ga0496104_0064013 3300048907 Bacteria 3489
993 Ga0496106_0011284 3300048909 Bacteria 6612
994 Ga0496106_0055981 3300048909 Bacteria 2982
995 Ga0496106_0167336 3300048909 Bacteria 1741
996 Ga0496107_0327116 3300048910 Bacteria 1141
997 Ga0496108_0128393 3300048911 Bacteria 2178
998 Ga0496108_1272203 3300048911 Bacteria 620
999 Ga0496109_0637578 3300048912 Bacteria 1002
1000 Ga0496109_0972430 3300048912 Unclassified 787
1001 Ga0496110_0704198 3300048913 Bacteria 912
1002 Ga0496111_0292601 3300048914 Bacteria 1208
1003 Ga0496112_0214235 3300048915 Bacteria 1883
1004 Ga0496112_0942103 3300048915 Bacteria 785
1005 Ga0496112_1079468 3300048915 Bacteria 721
1006 Ga0496112_1429218 3300048915 Bacteria 606
1007 Ga0496113_0079114 3300048916 Bacteria 2516
1008 Ga0496117_0000124 3300048920 Bacteria 169701
1009 Ga0496118_0271180 3300048921 Bacteria 950
1010 Ga0496119_0000020 3300048922 Bacteria 285602
1011 Ga0496120_0000006 3300048923 Bacteria 445068
1012 Ga0496122_0000040 3300048925 Bacteria 285095
1013 Ga0496122_0002362 3300048925 Bacteria 27135
1014 Ga0496123_0000572 3300048926 Bacteria 62779
1015 Ga0496123_0066153 3300048926 Bacteria 2291
1016 Ga0496124_0335935 3300048927 Bacteria 1075
1017 Ga0496125_0000010 3300048928 Bacteria 671167
1018 Ga0496126_0000210 3300048929 Bacteria 131214
1019 Ga0496126_0001553 3300048929 Bacteria 35275
1020 Ga0496126_0375927 3300048929 Bacteria 1157
1021 Ga0501306_040718 3300049127 Bacteria 720
1022 Ga0501306_099876 3300049127 Unclassified 518
1023 Ga0501308_023743 3300049128 Bacteria 784
1024 Ga0501308_024132 3300049128 Bacteria 780
1025 Ga0501308_045953 3300049128 Bacteria 627
1026 Ga0501308_058322 3300049128 Unclassified 578
1027 Ga0501309_026702 3300049129 Bacteria 835
1028 Ga0501309_056865 3300049129 Bacteria 623
1029 Ga0501310_015178 3300049130 Bacteria 911
1030 Ga0501310_035763 3300049130 Unclassified 675
1031 Ga0501310_048314 3300049130 Bacteria 610
1032 Ga0501343_011884 3300049132 Unclassified 720
1033 Ga0501344_06827 3300049133 Bacteria 664
1034 Ga0501304_005939 3300049160 Unclassified 971
1035 Ga0501304_018785 3300049160 Bacteria 670
1036 Ga0501304_028682 3300049160 Bacteria 583
1037 Ga0501305_016297 3300049161 Bacteria 1058
1038 Ga0501305_025732 3300049161 Bacteria 894
1039 Ga0501305_037827 3300049161 Unclassified 776
1040 Ga0501305_052204 3300049161 Bacteria 688
1041 Ga0501305_053400 3300049161 Bacteria 683
1042 Ga0501305_056471 3300049161 Bacteria 668
1043 Ga0501305_066389 3300049161 Bacteria 628
1044 Ga0501307_037061 3300049162 Bacteria 697
1045 Ga0501291_087566 3300049514 Bacteria 630
1046 Ga0501292_033197 3300049515 Bacteria 873
1047 Ga0501292_074768 3300049515 Bacteria 635
1048 Ga0501295_055282 3300049518 Bacteria 858
1049 Ga0501297_024037 3300049520 Unclassified 777
1050 Ga0501298_032456 3300049521 Bacteria 1031
1051 Ga0501298_087216 3300049521 Bacteria 694
1052 Ga0501299_013433 3300049522 Bacteria 1413
1053 Ga0501300_039120 3300049523 Bacteria 712
1054 Ga0501311_014226 3300049527 Bacteria 1014
1055 Ga0501311_043675 3300049527 Bacteria 686
1056 Ga0501312_031210 3300049528 Bacteria 836
1057 Ga0501312_061312 3300049528 Bacteria 652
1058 Ga0501312_090901 3300049528 Bacteria 563
1059 Ga0501313_018888 3300049529 Bacteria 840
1060 Ga0501313_039109 3300049529 Bacteria 634
1061 Ga0501313_053819 3300049529 Bacteria 561
1062 Ga0501313_062270 3300049529 Bacteria 530
1063 Ga0501314_019331 3300049530 Bacteria 699
1064 Ga0501315_017336 3300049531 Bacteria 941
1065 Ga0501316_017891 3300049532 Bacteria 872
1066 Ga0501316_038051 3300049532 Unclassified 663
1067 Ga0501317_001899 3300049533 Bacteria 1891
1068 Ga0501317_028335 3300049533 Bacteria 800
1069 Ga0501317_083258 3300049533 Bacteria 556
1070 Ga0501318_015346 3300049534 Bacteria 914
1071 Ga0501318_054930 3300049534 Bacteria 600
1072 Ga0501319_027394 3300049535 Bacteria 536
1073 Ga0501319_033509 3300049535 Bacteria 502
1074 Ga0501321_055582 3300049537 Unclassified 588
1075 Ga0501321_072315 3300049537 Bacteria 538
1076 Ga0501322_019756 3300049538 Bacteria 584
1077 Ga0501323_010617 3300049539 Bacteria 1100
1078 Ga0501323_061567 3300049539 Bacteria 587
1079 Ga0501325_055035 3300049541 Bacteria 514
1080 Ga0501325_058802 3300049541 Bacteria 504
1081 Ga0501328_03904 3300049544 Bacteria 707
1082 Ga0501336_007859 3300049552 Unclassified 816
1083 Ga0501336_013575 3300049552 Bacteria 683
1084 Ga0501338_17987 3300049554 Bacteria 516
1085 Ga0501031_0713524 3300049568 Bacteria 644
1086 Ga0501032_0138176 3300049569 Bacteria 1605
1087 Ga0501033_0026759 3300049570 Bacteria 4339
1088 Ga0501033_0318417 3300049570 Bacteria 1093
1089 Ga0501033_0506978 3300049570 Bacteria 834
1090 Ga0501034_0001355 3300049571 Bacteria 33121
1091 Ga0501034_0029781 3300049571 Bacteria 5549
1092 Ga0501034_0059419 3300049571 Bacteria 3840
1093 Ga0501034_0180453 3300049571 Bacteria 2076
1094 Ga0501034_0185921 3300049571 Bacteria 2041
1095 Ga0501036_0748652 3300049572 Bacteria 806
1096 Ga0501037_0037626 3300049573 Bacteria 3567
1097 Ga0501037_0078468 3300049573 Bacteria 2396
1098 Ga0501038_0266413 3300049574 Bacteria 1352
1099 Ga0501038_0789812 3300049574 Bacteria 706
1100 Ga0501043_0096873 3300049579 Bacteria 2319
1101 Ga0501046_0049179 3300049580 Bacteria 3336
1102 Ga0501047_0002187 3300049581 Bacteria 18716
1103 Ga0501047_0008012 3300049581 Bacteria 9964
1104 Ga0501048_0460568 3300049582 Bacteria 911
1105 Ga0501067_0001052 3300049583 Bacteria 14855
1106 Ga0501067_0002587 3300049583 Bacteria 9997
1107 Ga0501068_0000171 3300049584 Bacteria 30356
1108 Ga0501068_0011181 3300049584 Bacteria 5058
1109 Ga0501069_0000098 3300049585 Bacteria 40879
1110 Ga0501069_0000278 3300049585 Bacteria 23255
1111 Ga0501070_0000192 3300049586 Bacteria 57359
1112 Ga0501070_0005766 3300049586 Bacteria 10562
1113 Ga0501070_0141834 3300049586 Bacteria 1984
1114 Ga0501071_0000060 3300049587 Bacteria 37746
1115 Ga0501071_0006621 3300049587 Bacteria 7526
1116 Ga0501071_0334751 3300049587 Bacteria 1151
1117 Ga0501072_0000081 3300049588 Bacteria 70723
1118 Ga0501072_0172389 3300049588 Bacteria 1726
1119 Ga0501072_1060246 3300049588 Bacteria 631
1120 Ga0501073_0000699 3300049589 Bacteria 23637
1121 Ga0501073_0022302 3300049589 Bacteria 4561
1122 Ga0501074_0001663 3300049590 Bacteria 15116
1123 Ga0501074_0003209 3300049590 Bacteria 11537
1124 Ga0501074_0443048 3300049590 Bacteria 921
1125 Ga0501074_0540640 3300049590 Bacteria 825
1126 Ga0501075_0065194 3300049591 Bacteria 2748
1127 Ga0501076_0387765 3300049592 Bacteria 1148
1128 Ga0501198_014327 3300049649 Bacteria 1207
1129 Ga0501199_011422 3300049650 Bacteria 960
1130 Ga0501199_034519 3300049650 Bacteria 635
1131 Ga0501201_004663 3300049651 Bacteria 1274
1132 Ga0501201_024820 3300049651 Bacteria 654
1133 Ga0501202_006804 3300049652 Bacteria 2054
1134 Ga0501202_031347 3300049652 Bacteria 1111
1135 Ga0501202_218305 3300049652 Bacteria 527
1136 Ga0501206_022463 3300049653 Bacteria 905
1137 Ga0501206_075402 3300049653 Bacteria 578
1138 Ga0501207_033437 3300049654 Unclassified 872
1139 Ga0501208_098677 3300049655 Bacteria 623
1140 Ga0501209_046355 3300049656 Bacteria 1170
1141 Ga0501214_026930 3300049659 Bacteria 767
1142 Ga0501214_033838 3300049659 Unclassified 714
1143 Ga0501216_004483 3300049660 Bacteria 2074
1144 Ga0501216_153221 3300049660 Bacteria 549
1145 Ga0501217_001688 3300049661 Bacteria 4202
1146 Ga0501217_018391 3300049661 Bacteria 1622
1147 Ga0501217_023195 3300049661 Bacteria 1477
1148 Ga0501217_081198 3300049661 Bacteria 898
1149 Ga0501217_171747 3300049661 Unclassified 660
1150 Ga0501223_006757 3300049663 Bacteria 2362
1151 Ga0501224_002475 3300049664 Bacteria 2521
1152 Ga0501224_029439 3300049664 Bacteria 822
1153 Ga0501227_006471 3300049665 Bacteria 2518
1154 Ga0501227_023203 3300049665 Bacteria 1441
1155 Ga0501227_115432 3300049665 Bacteria 722
1156 Ga0501228_003303 3300049666 Bacteria 1321
1157 Ga0501230_004322 3300049667 Bacteria 1947
1158 Ga0501233_029106 3300049668 Bacteria 1237
1159 Ga0501233_039001 3300049668 Bacteria 1108
1160 Ga0501233_075427 3300049668 Bacteria 861
1161 Ga0501235_001522 3300049669 Bacteria 4964
1162 Ga0501235_013655 3300049669 Bacteria 1789
1163 Ga0501235_019237 3300049669 Bacteria 1515
1164 Ga0501236_018815 3300049670 Bacteria 1001
1165 Ga0501238_036710 3300049671 Bacteria 716
1166 Ga0501239_004726 3300049672 Bacteria 1349
1167 Ga0501239_010235 3300049672 Bacteria 1030
1168 Ga0501239_041565 3300049672 Bacteria 638
1169 Ga0501240_032149 3300049673 Bacteria 843
1170 Ga0501242_036833 3300049674 Bacteria 680
1171 Ga0501243_011673 3300049675 Bacteria 1380
1172 Ga0501243_049379 3300049675 Bacteria 756
1173 Ga0501246_009917 3300049676 Unclassified 863
1174 Ga0501247_000073 3300049677 Bacteria 5549
1175 Ga0501249_108615 3300049679 Bacteria 669
1176 Ga0501249_119467 3300049679 Bacteria 643
1177 Ga0501250_002177 3300049680 Bacteria 1743
1178 Ga0501250_080830 3300049680 Unclassified 552
1179 Ga0501252_007501 3300049682 Bacteria 1236
1180 Ga0501253_025427 3300049683 Bacteria 1082
1181 Ga0501256_009852 3300049685 Bacteria 906
1182 Ga0501257_012072 3300049686 Bacteria 1974
1183 Ga0501258_004870 3300049687 Bacteria 1283
1184 Ga0501260_018696 3300049689 Unclassified 740
1185 Ga0501260_018938 3300049689 Bacteria 736
1186 Ga0501219_006974 3300049703 Unclassified 813
1187 Ga0501221_004593 3300049704 Bacteria 2288
1188 Ga0501221_027066 3300049704 Bacteria 1170
1189 Ga0501221_069436 3300049704 Unclassified 829
1190 Ga0501225_0001628 3300049705 Bacteria 7020
1191 Ga0501225_0079146 3300049705 Bacteria 942
1192 Ga0501225_0117326 3300049705 Bacteria 788
1193 Ga0501234_004052 3300049707 Bacteria 2300
1194 Ga0501245_010568 3300049708 Bacteria 1335
1195 Ga0501245_034195 3300049708 Bacteria 851
1196 Ga0501079_0284538 3300049741 Bacteria 1293
1197 Ga0501079_0674288 3300049741 Bacteria 814
1198 Ga0501080_0000060 3300049742 Bacteria 71292
1199 Ga0501080_0001835 3300049742 Bacteria 18214
1200 Ga0501081_0026798 3300049743 Bacteria 3889
1201 Ga0501081_0420735 3300049743 Bacteria 990
1202 Ga0501083_0005831 3300049744 Bacteria 8722
1203 Ga0501083_0006130 3300049744 Bacteria 8524
1204 Ga0501083_0443158 3300049744 Bacteria 845
1205 Ga0501262_013326 3300049759 Bacteria 1059
1206 Ga0501262_077419 3300049759 Unclassified 552
1207 Ga0501263_021333 3300049760 Bacteria 873
1208 Ga0501267_028592 3300049764 Bacteria 647
1209 Ga0501268_001380 3300049765 Bacteria 3020
1210 Ga0501268_082798 3300049765 Bacteria 665
1211 Ga0501270_004084 3300049767 Bacteria 1620
1212 Ga0501270_102705 3300049767 Bacteria 599
1213 Ga0501272_007118 3300049769 Bacteria 1207
1214 Ga0501273_007298 3300049770 Bacteria 1298
1215 Ga0501276_024520 3300049773 Unclassified 598
1216 Ga0501279_024795 3300049775 Bacteria 869
1217 Ga0501283_004964 3300049779 Bacteria 1813
1218 Ga0501035_0000725 3300049822 Bacteria 35719
1219 Ga0501035_0166130 3300049822 Bacteria 1908
1220 Ga0501035_0269264 3300049822 Bacteria 1442
1221 Ga0501044_0000055 3300049823 Bacteria 140119
1222 Ga0501044_0035643 3300049823 Bacteria 5209
1223 Ga0501044_0038408 3300049823 Bacteria 4999
1224 Ga0501044_0825482 3300049823 Bacteria 805
1225 Ga0501212_034973 3300049851 Bacteria 819
1226 Ga0501226_010581 3300049853 Unclassified 1022
1227 nmdc:mga03n38_289882_c1 3300050490 Bacteria 876
1228 nmdc:mga00v17_182539_c1 3300050491 Bacteria 1354
1229 nmdc:mga06z11_346260_c1 3300050494 Unclassified 889
1230 nmdc:mga06z11_653659_c1 3300050494 Bacteria 640
1231 nmdc:mga07m45_289507_c1 3300050496 Bacteria 953
1232 nmdc:mga07m45_461163_c1 3300050496 Bacteria 737
1233 nmdc:mga05p37_1035569_c1 3300050507 Unclassified 868
1234 nmdc:mga05p37_136331_c2 3300050507 Bacteria 830
1235 nmdc:mga05p37_14945_c1 3300050507 Bacteria 9319
1236 nmdc:mga05p37_273385_c1 3300050507 Bacteria 2018
1237 nmdc:mga05p37_456412_c1 3300050507 Bacteria 1478
1238 nmdc:mga05p37_802723_c1 3300050507 Bacteria 1029
1239 nmdc:mga09592_18806_c1 3300050508 Bacteria 5668
1240 nmdc:mga09592_198902_c1 3300050508 Bacteria 1735
1241 nmdc:mga09592_281705_c1 3300050508 Bacteria 1442
1242 nmdc:mga0qj67_145881_c1 3300050509 Bacteria 1919
1243 nmdc:mga06r32_13980_c2 3300050510 Bacteria 4159
1244 nmdc:mga06r32_26098_c1 3300050510 Bacteria 5443
1245 nmdc:mga06r32_736506_c1 3300050510 Unclassified 950
1246 nmdc:mga08y16_1346998_c1 3300050511 Bacteria 679
1247 nmdc:mga08y16_135276_c1 3300050511 Bacteria 2562
1248 nmdc:mga08y16_276937_c1 3300050511 Bacteria 1731
1249 nmdc:mga08y16_3423_c1 3300050511 Bacteria 16464
1250 nmdc:mga08y16_397281_c1 3300050511 Bacteria 1411
1251 nmdc:mga08y16_466215_c1 3300050511 Bacteria 1287
1252 nmdc:mga08y16_63647_c1 3300050511 Bacteria 3852
1253 nmdc:mga0n895_210958_c1 3300050512 Bacteria 1972
1254 nmdc:mga0n895_3125_c1 3300050512 Bacteria 13200
1255 nmdc:mga0n895_43244_c1 3300050512 Bacteria 4389
1256 nmdc:mga0n895_521573_c1 3300050512 Bacteria 1196
1257 nmdc:mga0n895_597590_c1 3300050512 Bacteria 1106
1258 nmdc:mga0n895_87209_c1 3300050512 Bacteria 3118
1259 nmdc:mga0rr50_1548924_c1 3300050513 Bacteria 560
1260 nmdc:mga0a205_10797_c1 3300050515 Bacteria 8402
1261 nmdc:mga0a205_109324_c1 3300050515 Bacteria 2663
1262 nmdc:mga0a205_209373_c1 3300050515 Bacteria 1839
1263 nmdc:mga0a205_30310_c1 3300050515 Bacteria 5178
1264 nmdc:mga0a205_47953_c1 3300050515 Bacteria 4122
1265 nmdc:mga0a205_57086_c1 3300050515 Bacteria 2816
1266 nmdc:mga0a205_74150_c1 3300050515 Bacteria 3288
1267 nmdc:mga0a205_8297_c1 3300050515 Bacteria 9446
1268 Ga0495601_0442508 3300053077 Bacteria 841
1269 Ga0495619_0158459 3300053085 Bacteria 1563
1270 Ga0500555_019577 3300053103 Bacteria 1949
1271 Ga0500562_053230 3300053108 Bacteria 1084
1272 Ga0500562_061006 3300053108 Bacteria 1013
1273 Ga0500652_293418 3300053131 Bacteria 631
1274 Ga0500568_0009639 3300053139 Bacteria 4575
1275 Ga0501084_0005867 3300054114 Bacteria 10106
1276 Ga0501084_0089052 3300054114 Bacteria 2590
1277 Ga0587084_083359 3300059477 Unclassified 623
1278 Ga0587093_054102 3300059478 Bacteria 640
1279 Ga0587066_036361 3300059490 Bacteria 906
1280 Ga0587070_025959 3300059491 Bacteria 1026
1281 Ga0587070_042562 3300059491 Bacteria 875
1282 Ga0587070_107990 3300059491 Bacteria 649
1283 Ga0587070_217181 3300059491 Bacteria 516
1284 Ga0587073_0115243 3300059492 Bacteria 718
1285 Ga0587073_0166255 3300059492 Unclassified 636
1286 Ga0587077_103973 3300059493 Bacteria 686
1287 Ga0587077_121442 3300059493 Unclassified 652
1288 Ga0587080_079553 3300059503 Unclassified 670
1289 Ga0587082_037531 3300059504 Bacteria 874
1290 Ga0587082_107150 3300059504 Bacteria 616
1291 Ga0587082_107384 3300059504 Unclassified 616
1292 Ga0587083_0008127 3300059505 Bacteria 1631
1293 Ga0587085_081748 3300059506 Unclassified 652
1294 Ga0587085_084110 3300059506 Bacteria 646
1295 Ga0587086_027433 3300059507 Unclassified 817
1296 Ga0587088_051225 3300059508 Bacteria 809
1297 Ga0587089_057413 3300059509 Unclassified 637
1298 Ga0587090_027309 3300059510 Bacteria 933
1299 Ga0587090_060831 3300059510 Bacteria 716
1300 Ga0587090_152475 3300059510 Bacteria 525
1301 Ga0587091_103385 3300059511 Unclassified 671
1302 Ga0587091_175899 3300059511 Bacteria 560
1303 Ga0587092_012250 3300059512 Bacteria 1207
1304 Ga0587092_140704 3300059512 Bacteria 531
1305 Ga0587094_050094 3300059513 Bacteria 705
1306 Ga0587098_093001 3300059604 Unclassified 517
1307 Ga0587106_027033 3300059605 Bacteria 895
1308 Ga0587106_034352 3300059605 Bacteria 831
1309 Ga0587106_148539 3300059605 Unclassified 520
1310 Ga0587125_043802 3300059607 Bacteria 612
1311 Ga0587101_033300 3300059623 Bacteria 815
1312 Ga0587101_142642 3300059623 Unclassified 513
1313 Ga0587109_055645 3300059624 Unclassified 821
1314 Ga0587109_108434 3300059624 Bacteria 646
1315 Ga0587109_129831 3300059624 Bacteria 606
1316 Ga0587115_122583 3300059626 Bacteria 501
1317 Ga0587117_032576 3300059627 Bacteria 794
1318 Ga0587117_102387 3300059627 Bacteria 547
1319 Ga0587128_135202 3300059630 Bacteria 549
1320 Ga0587062_059017 3300059639 Unclassified 668
1321 Ga0587062_087577 3300059639 Unclassified 588
1322 Ga0587067_001767 3300059640 Bacteria 2426
1323 Ga0587067_101685 3300059640 Unclassified 666
1324 Ga0587068_064796 3300059641 Bacteria 710
1325 Ga0587068_073238 3300059641 Unclassified 679
1326 Ga0587072_008811 3300059643 Bacteria 1605
1327 Ga0587072_082714 3300059643 Bacteria 696
1328 Ga0587075_149732 3300059644 Unclassified 504
1329 Ga0587076_014747 3300059645 Bacteria 1208
1330 Ga0587076_088903 3300059645 Bacteria 672
1331 Ga0587076_124797 3300059645 Unclassified 600
1332 Ga0587076_152258 3300059645 Bacteria 562
1333 Ga0587078_013763 3300059646 Bacteria 962
1334 Ga0587078_035794 3300059646 Unclassified 685
1335 Ga0587079_052533 3300059647 Bacteria 860
1336 Ga0587100_012657 3300059648 Unclassified 741
1337 Ga0587100_039100 3300059648 Unclassified 529
1338 Ga0587102_065831 3300059649 Bacteria 514
1339 Ga0587107_033685 3300059652 Unclassified 794
1340 Ga0587124_009956 3300059660 Bacteria 841
1341 Ga0587071_046129 3300060344 Bacteria 888
1342 Ga0587071_049969 3300060344 Bacteria 862
1343 Ga0587111_0070334 3300060346 Bacteria 815
1344 Ga0587111_0104482 3300060346 Bacteria 710
1345 Ga0501082_0001299 3300060353 Bacteria 21903
1346 Ga0501082_0032717 3300060353 Bacteria 4485
1347 Ga0530510_0043032 3300061734 Bacteria 3262
1348 Ga0530510_0175054 3300061734 Bacteria 1590
1349 Ga0530510_0562287 3300061734 Bacteria 867

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0788645 Ga0451577_0788645_344_802 125
2 3300044712 Ga0453684_0066242 Ga0453684_0066242_801_1259 125
3 3300046459 Ga0495629_0549179 Ga0495629_0549179_366_743 125
4 iso_pu_bacteria 2565956521 2566035421 138
5 3300037312 Ga0395899_0028641 Ga0395899_0028641_121_543 140
6 3300037312 Ga0395899_0210171 Ga0395899_0210171_426_848 140
7 3300049161 Ga0501305_025732 Ga0501305_025732_91_513 140
8 3300049161 Ga0501305_066389 Ga0501305_066389_116_538 140
9 3300049529 Ga0501313_018888 Ga0501313_018888_337_759 140
10 3300049529 Ga0501313_039109 Ga0501313_039109_127_549 140
11 3300049529 Ga0501313_053819 Ga0501313_053819_55_477 140
12 3300049531 Ga0501315_017336 Ga0501315_017336_91_513 140
13 3300049532 Ga0501316_017891 Ga0501316_017891_96_518 140
14 3300049533 Ga0501317_028335 Ga0501317_028335_38_460 140
15 3300049534 Ga0501318_015346 Ga0501318_015346_402_824 140
16 3300049535 Ga0501319_033509 Ga0501319_033509_58_480 140
17 3300049538 Ga0501322_019756 Ga0501322_019756_82_504 140
18 3300049539 Ga0501323_061567 Ga0501323_061567_85_507 140
19 3300049544 Ga0501328_03904 Ga0501328_03904_229_651 140
20 3300049554 Ga0501338_17987 Ga0501338_17987_65_487 140
21 3300026089 Ga0207648_10290567 Ga0207648_102905672 141
22 3300031903 Ga0307407_10476523 Ga0307407_104765231 141
23 3300032005 Ga0307411_10699663 Ga0307411_106996632 141
24 3300049741 Ga0501079_0674288 Ga0501079_0674288_71_508 141
25 iso_pu_bacteria 2585428059 2587744046 141
26 iso_pu_bacteria 2593339131 2595092408 141
27 iso_pu_bacteria 2643221676 2644424465 141
28 iso_pu_bacteria 2738543017 2739271720 141
29 iso_pu_bacteria 2757320391 2757568934 141
30 iso_pu_bacteria 2775507177 2777764181 141
31 iso_pu_bacteria 2775507192 2777837256 141
32 iso_pu_bacteria 2818991459 2819676127 141
33 iso_pu_bacteria 2857453340 2857460130 141
34 iso_pu_bacteria 2857586860 2857590928 141
35 iso_pu_bacteria 2857609550 2857613449 141
36 iso_pu_bacteria 2904755435 2904755646 141
37 iso_pu_bacteria 2919425241 2919432438 141
38 iso_pu_bacteria 2936340661 2936343087 141
39 iso_pu_bacteria 2971410472 2971410955 141
40 iso_pu_bacteria 3001267043 3001271906 141
41 iso_pu_bacteria 3001272096 3001275992 141
42 iso_pu_bacteria 3006984091 3006988318 141
43 iso_pu_bacteria 3006988479 3006993178 141
44 iso_pu_bacteria 8056533031 8056535582 141
45 3300005336 Ga0070680_100852988 Ga0070680_1008529881 142
46 3300005441 Ga0070700_102019979 Ga0070700_1020199791 142
47 3300006844 Ga0075428_100925272 Ga0075428_1009252722 142
48 3300006846 Ga0075430_100434217 Ga0075430_1004342171 142
49 3300009176 Ga0105242_10223473 Ga0105242_102234733 142
50 3300027252 Ga0209973_1069272 Ga0209973_10692721 142
51 3300027360 Ga0209969_1000136 Ga0209969_10001369 142
52 3300027462 Ga0210000_1000292 Ga0210000_10002929 142
53 3300027471 Ga0209995_1000462 Ga0209995_10004622 142
54 3300027526 Ga0209968_1044634 Ga0209968_10446342 142
55 3300027543 Ga0209999_1000658 Ga0209999_10006586 142
56 3300027543 Ga0209999_1024666 Ga0209999_10246661 142
57 3300027617 Ga0210002_1031091 Ga0210002_10310912 142
58 3300027665 Ga0209983_1002782 Ga0209983_10027823 142
59 3300027665 Ga0209983_1007161 Ga0209983_10071613 142
60 3300027682 Ga0209971_1007936 Ga0209971_10079364 142
61 3300027876 Ga0209974_10000335 Ga0209974_1000033510 142
62 3300031344 Ga0265316_10021700 Ga0265316_100217004 142
63 3300032168 Ga0316593_10085680 Ga0316593_100856801 142
64 3300032168 Ga0316593_10404949 Ga0316593_104049492 142
65 3300033528 Ga0316588_1024200 Ga0316588_10242001 142
66 3300033529 Ga0316587_1026396 Ga0316587_10263962 142
67 3300033529 Ga0316587_1029176 Ga0316587_10291763 142
68 3300033541 Ga0316596_1077254 Ga0316596_10772541 142
69 3300035117 Ga0373953_0018403 Ga0373953_0018403_2067_2495 142
70 3300035118 Ga0373954_0000059 Ga0373954_0000059_30721_31149 142
71 3300035398 Ga0316574_0053390 Ga0316574_0053390_73_501 142
72 3300035724 Ga0373933_0019852 Ga0373933_0019852_841_1269 142
73 3300036401 Ga0373937_0002664 Ga0373937_0002664_6384_6812 142
74 3300038725 Ga0400484_20020 Ga0400484_20020_5266_5694 142
75 3300038725 Ga0400484_40509 Ga0400484_40509_7371_7799 142
76 3300038741 Ga0400488_35053 Ga0400488_35053_62_490 142
77 3300038742 Ga0400486_28583 Ga0400486_28583_624_1052 142
78 3300039062 Ga0400483_001247 Ga0400483_001247_8768_9196 142
79 3300039062 Ga0400483_146956 Ga0400483_146956_5874_6302 142
80 3300039062 Ga0400483_187740 Ga0400483_187740_634_1062 142
81 3300039062 Ga0400483_198698 Ga0400483_198698_559_987 142
82 3300039062 Ga0400483_213263 Ga0400483_213263_8126_8554 142
83 3300039062 Ga0400483_286518 Ga0400483_286518_19_447 142
84 3300039110 Ga0400487_23124 Ga0400487_23124_103_531 142
85 3300041456 Ga0451795_0900414 Ga0451795_0900414_33_461 142
86 3300042156 Ga0439446_0098330 Ga0439446_0098330_33_461 142
87 3300042876 Ga0451577_0017338 Ga0451577_0017338_1355_1813 142
88 3300044712 Ga0453684_0003452 Ga0453684_0003452_4496_4954 142
89 3300044712 Ga0453684_1667936 Ga0453684_1667936_128_556 142
90 3300044712 Ga0453684_1861800 Ga0453684_1861800_155_583 142
91 3300045051 Ga0451576_1593135 Ga0451576_1593135_68_496 142
92 3300046511 Ga0495608_0149665 Ga0495608_0149665_191_619 142
93 3300046675 Ga0495657_0214837 Ga0495657_0214837_237_665 142
94 3300049129 Ga0501309_056865 Ga0501309_056865_120_548 142
95 3300049130 Ga0501310_015178 Ga0501310_015178_178_615 142
96 3300049160 Ga0501304_005939 Ga0501304_005939_93_536 142
97 3300049161 Ga0501305_016297 Ga0501305_016297_433_876 142
98 3300049535 Ga0501319_027394 Ga0501319_027394_65_502 142
99 3300049539 Ga0501323_010617 Ga0501323_010617_409_846 142
100 3300049569 Ga0501032_0138176 Ga0501032_0138176_983_1411 142
101 3300049570 Ga0501033_0026759 Ga0501033_0026759_237_665 142
102 3300049570 Ga0501033_0318417 Ga0501033_0318417_217_645 142
103 3300049570 Ga0501033_0506978 Ga0501033_0506978_86_514 142
104 3300049571 Ga0501034_0029781 Ga0501034_0029781_2760_3188 142
105 3300049571 Ga0501034_0180453 Ga0501034_0180453_77_505 142
106 3300049572 Ga0501036_0748652 Ga0501036_0748652_217_645 142
107 3300049573 Ga0501037_0037626 Ga0501037_0037626_2217_2645 142
108 3300049573 Ga0501037_0078468 Ga0501037_0078468_1755_2183 142
109 3300049574 Ga0501038_0266413 Ga0501038_0266413_249_677 142
110 3300049574 Ga0501038_0789812 Ga0501038_0789812_82_510 142
111 3300049579 Ga0501043_0096873 Ga0501043_0096873_1562_1990 142
112 3300049580 Ga0501046_0049179 Ga0501046_0049179_2583_3011 142
113 3300049581 Ga0501047_0002187 Ga0501047_0002187_18037_18465 142
114 3300049581 Ga0501047_0008012 Ga0501047_0008012_5165_5593 142
115 3300049582 Ga0501048_0460568 Ga0501048_0460568_316_744 142
116 3300049586 Ga0501070_0141834 Ga0501070_0141834_1241_1669 142
117 3300049587 Ga0501071_0334751 Ga0501071_0334751_681_1109 142
118 3300049590 Ga0501074_0540640 Ga0501074_0540640_87_515 142
119 3300049744 Ga0501083_0443158 Ga0501083_0443158_308_736 142
120 3300049822 Ga0501035_0000725 Ga0501035_0000725_28482_28910 142
121 3300049822 Ga0501035_0166130 Ga0501035_0166130_1275_1703 142
122 3300049822 Ga0501035_0269264 Ga0501035_0269264_359_862 142
123 3300049823 Ga0501044_0000055 Ga0501044_0000055_75856_76359 142
124 3300049823 Ga0501044_0035643 Ga0501044_0035643_613_1041 142
125 3300049823 Ga0501044_0038408 Ga0501044_0038408_272_700 142
126 3300049823 Ga0501044_0825482 Ga0501044_0825482_292_720 142
127 3300006844 Ga0075428_100058800 Ga0075428_1000588004 143
128 3300006846 Ga0075430_100203120 Ga0075430_1002031203 143
129 3300006847 Ga0075431_100440701 Ga0075431_1004407012 143
130 3300027395 Ga0209996_1023790 Ga0209996_10237902 143
131 3300027543 Ga0209999_1006296 Ga0209999_10062964 143
132 3300031731 Ga0307405_10698647 Ga0307405_106986472 143
133 3300031824 Ga0307413_10893740 Ga0307413_108937402 143
134 3300031852 Ga0307410_10514172 Ga0307410_105141721 143
135 3300031903 Ga0307407_10352877 Ga0307407_103528771 143
136 3300031911 Ga0307412_10917005 Ga0307412_109170051 143
137 3300031995 Ga0307409_100583498 Ga0307409_1005834981 143
138 3300032002 Ga0307416_100803943 Ga0307416_1008039432 143
139 3300032002 Ga0307416_101048680 Ga0307416_1010486802 143
140 3300032002 Ga0307416_101335414 Ga0307416_1013354142 143
141 3300032005 Ga0307411_10256030 Ga0307411_102560302 143
142 3300032005 Ga0307411_10503450 Ga0307411_105034503 143
143 3300032005 Ga0307411_10756263 Ga0307411_107562632 143
144 3300032126 Ga0307415_102055432 Ga0307415_1020554321 143
145 3300049523 Ga0501300_039120 Ga0501300_039120_144_578 143
146 3300049541 Ga0501325_058802 Ga0501325_058802_37_468 143
147 3300049568 Ga0501031_0713524 Ga0501031_0713524_165_596 143
148 3300049661 Ga0501217_081198 Ga0501217_081198_343_774 143
149 3300049668 Ga0501233_075427 Ga0501233_075427_329_760 143
150 3300049679 Ga0501249_119467 Ga0501249_119467_113_547 143
151 3300050510 nmdc:mga06r32_13980_c2 nmdc:mga06r32_13980_c2_317_748 143
152 3300053108 Ga0500562_061006 Ga0500562_061006_425_862 143
153 3300053139 Ga0500568_0009639 Ga0500568_0009639_2637_3074 143
154 3300003758 Ga0055532_1000266 Ga0055532_100026635 144
155 3300003781 Ga0055536_1028902 Ga0055536_10289022 144
156 3300003841 Ga0055541_1012017 Ga0055541_10120172 144
157 3300005337 Ga0070682_100139105 Ga0070682_1001391052 144
158 3300005340 Ga0070689_100497215 Ga0070689_1004972152 144
159 3300005445 Ga0070708_101185113 Ga0070708_1011851131 144
160 3300005467 Ga0070706_100352364 Ga0070706_1003523641 144
161 3300005468 Ga0070707_100395387 Ga0070707_1003953872 144
162 3300005471 Ga0070698_100086453 Ga0070698_1000864533 144
163 3300005614 Ga0068856_100885858 Ga0068856_1008858582 144
164 3300005617 Ga0068859_100240844 Ga0068859_1002408443 144
165 3300005842 Ga0068858_102095082 Ga0068858_1020950822 144
166 3300006048 Ga0075363_100301524 Ga0075363_1003015242 144
167 3300006163 Ga0070715_10169058 Ga0070715_101690581 144
168 3300006847 Ga0075431_100023932 Ga0075431_1000239328 144
169 3300006852 Ga0075433_10142836 Ga0075433_101428362 144
170 3300006871 Ga0075434_100185361 Ga0075434_1001853613 144
171 3300006880 Ga0075429_100004315 Ga0075429_1000043154 144
172 3300006931 Ga0097620_100240821 Ga0097620_1002408213 144
173 3300009094 Ga0111539_13088412 Ga0111539_130884121 144
174 3300014325 Ga0163163_11400061 Ga0163163_114000611 144
175 3300014326 Ga0157380_10920336 Ga0157380_109203361 144
176 3300014969 Ga0157376_10271213 Ga0157376_102712132 144
177 3300014969 Ga0157376_10960923 Ga0157376_109609232 144
178 3300025225 Ga0209566_100273 Ga0209566_10027313 144
179 3300025229 Ga0209147_100198 Ga0209147_10019864 144
180 3300025284 Ga0209130_1016157 Ga0209130_10161572 144
181 3300025291 Ga0209675_1019703 Ga0209675_10197032 144
182 3300025292 Ga0209676_1000745 Ga0209676_100074530 144
183 3300025922 Ga0207646_10364990 Ga0207646_103649903 144
184 3300028573 Ga0265334_10003963 Ga0265334_100039634 144
185 3300031250 Ga0265331_10122487 Ga0265331_101224872 144
186 3300033524 Ga0316592_1123632 Ga0316592_11236321 144
187 3300033524 Ga0316592_1149130 Ga0316592_11491301 144
188 3300035172 Ga0373955_0376766 Ga0373955_0376766_25_459 144
189 3300036401 Ga0373937_0532011 Ga0373937_0532011_166_603 144
190 3300037418 Ga0395900_0725165 Ga0395900_0725165_466_903 144
191 3300038443 Ga0395901_1971731 Ga0395901_1971731_65_502 144
192 3300041463 Ga0451804_0704316 Ga0451804_0704316_215_649 144
193 3300044673 Ga0453683_0573509 Ga0453683_0573509_12_446 144
194 3300046459 Ga0495629_0622841 Ga0495629_0622841_221_658 144
195 3300046472 Ga0495580_0043446 Ga0495580_0043446_2461_2898 144
196 3300046473 Ga0495582_0241338 Ga0495582_0241338_198_635 144
197 3300046475 Ga0495639_0113101 Ga0495639_0113101_364_801 144
198 3300046499 Ga0495594_0126452 Ga0495594_0126452_210_647 144
199 3300046511 Ga0495608_0393312 Ga0495608_0393312_79_516 144
200 3300046514 Ga0495618_0009589 Ga0495618_0009589_2659_3096 144
201 3300046516 Ga0495628_0178595 Ga0495628_0178595_237_674 144
202 3300046517 Ga0495630_0060577 Ga0495630_0060577_926_1363 144
203 3300046526 Ga0495666_0025956 Ga0495666_0025956_2036_2473 144
204 3300046533 Ga0495640_0038941 Ga0495640_0038941_2603_3040 144
205 3300046535 Ga0495586_0001882 Ga0495586_0001882_9709_10146 144
206 3300046642 Ga0495634_0041778 Ga0495634_0041778_744_1181 144
207 3300046663 Ga0495635_0294853 Ga0495635_0294853_265_702 144
208 3300046681 Ga0495647_0039160 Ga0495647_0039160_391_828 144
209 3300046683 Ga0495658_0024044 Ga0495658_0024044_978_1415 144
210 3300046683 Ga0495658_0353318 Ga0495658_0353318_115_549 144
211 3300046689 Ga0495613_0048441 Ga0495613_0048441_2647_3084 144
212 3300046690 Ga0495624_0103007 Ga0495624_0103007_377_814 144
213 3300047315 Ga0495581_0181766 Ga0495581_0181766_259_696 144
214 3300047315 Ga0495581_0463077 Ga0495581_0463077_260_694 144
215 3300047319 Ga0495674_0003864 Ga0495674_0003864_2605_3042 144
216 3300047321 Ga0495676_0165594 Ga0495676_0165594_263_700 144
217 3300047322 Ga0495680_0026186 Ga0495680_0026186_1487_1921 144
218 3300047322 Ga0495680_0087918 Ga0495680_0087918_708_1145 144
219 3300047471 Ga0495684_0431556 Ga0495684_0431556_67_504 144
220 3300048905 Ga0496102_0014942 Ga0496102_0014942_5947_6384 144
221 3300048906 Ga0496103_0055914 Ga0496103_0055914_398_835 144
222 3300048920 Ga0496117_0000124 Ga0496117_0000124_68635_69069 144
223 3300048921 Ga0496118_0271180 Ga0496118_0271180_283_717 144
224 3300048922 Ga0496119_0000020 Ga0496119_0000020_87388_87822 144
225 3300048923 Ga0496120_0000006 Ga0496120_0000006_228113_228547 144
226 3300048925 Ga0496122_0000040 Ga0496122_0000040_122482_122916 144
227 3300048925 Ga0496122_0002362 Ga0496122_0002362_4311_4745 144
228 3300048926 Ga0496123_0000572 Ga0496123_0000572_39344_39778 144
229 3300048926 Ga0496123_0066153 Ga0496123_0066153_1188_1622 144
230 3300048927 Ga0496124_0335935 Ga0496124_0335935_421_855 144
231 3300048928 Ga0496125_0000010 Ga0496125_0000010_171902_172336 144
232 3300048929 Ga0496126_0000210 Ga0496126_0000210_122482_122916 144
233 3300048929 Ga0496126_0001553 Ga0496126_0001553_27465_27899 144
234 3300048929 Ga0496126_0375927 Ga0496126_0375927_336_770 144
235 3300049128 Ga0501308_023743 Ga0501308_023743_195_713 144
236 3300049128 Ga0501308_024132 Ga0501308_024132_11_445 144
237 3300049133 Ga0501344_06827 Ga0501344_06827_40_477 144
238 3300049527 Ga0501311_043675 Ga0501311_043675_97_534 144
239 3300049528 Ga0501312_031210 Ga0501312_031210_119_556 144
240 3300049552 Ga0501336_013575 Ga0501336_013575_228_665 144
241 3300049588 Ga0501072_1060246 Ga0501072_1060246_22_579 144
242 3300050490 nmdc:mga03n38_289882_c1 nmdc:mga03n38_289882_c1_346_780 144
243 3300050508 nmdc:mga09592_18806_c1 nmdc:mga09592_18806_c1_2410_2847 144
244 3300050510 nmdc:mga06r32_26098_c1 nmdc:mga06r32_26098_c1_56_493 144
245 3300050512 nmdc:mga0n895_3125_c1 nmdc:mga0n895_3125_c1_806_1243 144
246 3300050515 nmdc:mga0a205_57086_c1 nmdc:mga0a205_57086_c1_135_572 144
247 3300053077 Ga0495601_0442508 Ga0495601_0442508_150_587 144
248 3300053085 Ga0495619_0158459 Ga0495619_0158459_552_989 144
249 3300053103 Ga0500555_019577 Ga0500555_019577_1167_1601 144
250 3300053131 Ga0500652_293418 Ga0500652_293418_77_511 144
251 3300059504 Ga0587082_037531 Ga0587082_037531_338_775 144
252 3300059505 Ga0587083_0008127 Ga0587083_0008127_403_840 144
253 3300059605 Ga0587106_034352 Ga0587106_034352_379_816 144
254 3300059640 Ga0587067_001767 Ga0587067_001767_451_888 144
255 3300059643 Ga0587072_008811 Ga0587072_008811_403_840 144
256 3300059645 Ga0587076_014747 Ga0587076_014747_369_806 144
257 3300059646 Ga0587078_013763 Ga0587078_013763_108_545 144
258 3300003162 Ga0006778J45830_1034592 Ga0006778J45830_10345921 145
259 3300003322 rootL2_10056321 rootL2_100563212 145
260 3300003544 Ga0007417J51691_1041585 Ga0007417J51691_10415851 145
261 3300003574 Ga0007410J51695_1044966 Ga0007410J51695_10449661 145
262 3300003577 Ga0007416J51690_1041750 Ga0007416J51690_10417501 145
263 3300003579 Ga0007429J51699_1074031 Ga0007429J51699_10740311 145
264 3300003735 Ga0006780_1026678 Ga0006780_10266781 145
265 3300004800 Ga0058861_11574531 Ga0058861_115745312 145
266 3300004803 Ga0058862_12335695 Ga0058862_123356951 145
267 3300005336 Ga0070680_100034077 Ga0070680_1000340776 145
268 3300005458 Ga0070681_10072317 Ga0070681_100723173 145
269 3300005530 Ga0070679_100051054 Ga0070679_1000510544 145
270 3300005547 Ga0070693_100345220 Ga0070693_1003452202 145
271 3300006051 Ga0075364_10085096 Ga0075364_100850962 145
272 3300006178 Ga0075367_10401214 Ga0075367_104012142 145
273 3300006178 Ga0075367_10442706 Ga0075367_104427062 145
274 3300025912 Ga0207707_10002220 Ga0207707_1000222011 145
275 3300025917 Ga0207660_10073473 Ga0207660_100734733 145
276 3300025921 Ga0207652_10014383 Ga0207652_100143833 145
277 3300025935 Ga0207709_10201887 Ga0207709_102018872 145
278 3300031911 Ga0307412_10039661 Ga0307412_100396612 145
279 3300036401 Ga0373937_1099284 Ga0373937_1099284_124_567 145
280 3300039437 Ga0436365_1063002 Ga0436365_1063002_11_451 145
281 3300049530 Ga0501314_019331 Ga0501314_019331_178_621 145
282 3300049534 Ga0501318_054930 Ga0501318_054930_35_478 145
283 3300049571 Ga0501034_0059419 Ga0501034_0059419_2797_3258 145
284 3300049583 Ga0501067_0002587 Ga0501067_0002587_7909_8370 145
285 3300049584 Ga0501068_0000171 Ga0501068_0000171_29413_29874 145
286 3300049585 Ga0501069_0000278 Ga0501069_0000278_658_1119 145
287 3300049586 Ga0501070_0005766 Ga0501070_0005766_2615_3076 145
288 3300049587 Ga0501071_0006621 Ga0501071_0006621_6529_6990 145
289 3300049588 Ga0501072_0172389 Ga0501072_0172389_614_1075 145
290 3300049589 Ga0501073_0000699 Ga0501073_0000699_17647_18108 145
291 3300049590 Ga0501074_0003209 Ga0501074_0003209_617_1078 145
292 3300049742 Ga0501080_0001835 Ga0501080_0001835_1308_1769 145
293 3300049743 Ga0501081_0420735 Ga0501081_0420735_511_960 145
294 3300049744 Ga0501083_0005831 Ga0501083_0005831_576_1037 145
295 3300050491 nmdc:mga00v17_182539_c1 nmdc:mga00v17_182539_c1_31_468 145
296 3300050494 nmdc:mga06z11_346260_c1 nmdc:mga06z11_346260_c1_13_450 145
297 3300054114 Ga0501084_0089052 Ga0501084_0089052_574_1035 145
298 3300060353 Ga0501082_0032717 Ga0501082_0032717_659_1120 145
299 3300061734 Ga0530510_0175054 Ga0530510_0175054_658_1119 145
300 3300005293 Ga0065715_10132100 Ga0065715_101321002 146
301 3300005329 Ga0070683_100202291 Ga0070683_1002022912 146
302 3300005444 Ga0070694_100147049 Ga0070694_1001470491 146
303 3300005444 Ga0070694_100152666 Ga0070694_1001526663 146
304 3300005458 Ga0070681_10421388 Ga0070681_104213882 146
305 3300005471 Ga0070698_100013809 Ga0070698_1000138096 146
306 3300005518 Ga0070699_100031118 Ga0070699_1000311184 146
307 3300005536 Ga0070697_100036520 Ga0070697_1000365204 146
308 3300005545 Ga0070695_100230618 Ga0070695_1002306182 146
309 3300005545 Ga0070695_100393957 Ga0070695_1003939572 146
310 3300005546 Ga0070696_100006702 Ga0070696_1000067025 146
311 3300005549 Ga0070704_100350304 Ga0070704_1003503042 146
312 3300005564 Ga0070664_100027164 Ga0070664_1000271643 146
313 3300005614 Ga0068856_100158720 Ga0068856_1001587203 146
314 3300005842 Ga0068858_100007656 Ga0068858_1000076569 146
315 3300005842 Ga0068858_100109652 Ga0068858_1001096523 146
316 3300005843 Ga0068860_100983996 Ga0068860_1009839962 146
317 3300006173 Ga0070716_100220426 Ga0070716_1002204263 146
318 3300006175 Ga0070712_101121529 Ga0070712_1011215292 146
319 3300006353 Ga0075370_10300637 Ga0075370_103006371 146
320 3300006852 Ga0075433_10008752 Ga0075433_100087524 146
321 3300006871 Ga0075434_100427194 Ga0075434_1004271942 146
322 3300009147 Ga0114129_10975810 Ga0114129_109758102 146
323 3300009147 Ga0114129_11054672 Ga0114129_110546721 146
324 3300009545 Ga0105237_10508172 Ga0105237_105081722 146
325 3300010375 Ga0105239_10017161 Ga0105239_100171619 146
326 3300014968 Ga0157379_10115483 Ga0157379_101154833 146
327 3300020081 Ga0206354_11678042 Ga0206354_116780421 146
328 3300021384 Ga0213876_10112732 Ga0213876_101127322 146
329 3300022467 Ga0224712_10017586 Ga0224712_100175861 146
330 3300025910 Ga0207684_10255210 Ga0207684_102552101 146
331 3300025939 Ga0207665_10264166 Ga0207665_102641663 146
332 3300025944 Ga0207661_10197993 Ga0207661_101979932 146
333 3300025945 Ga0207679_10014244 Ga0207679_100142444 146
334 3300025949 Ga0207667_10251941 Ga0207667_102519413 146
335 3300026035 Ga0207703_10004977 Ga0207703_100049778 146
336 3300026035 Ga0207703_10074679 Ga0207703_100746792 146
337 3300026078 Ga0207702_10160175 Ga0207702_101601753 146
338 3300027471 Ga0209995_1026906 Ga0209995_10269062 146
339 3300027552 Ga0209982_1005128 Ga0209982_10051281 146
340 3300027665 Ga0209983_1001263 Ga0209983_10012635 146
341 3300027682 Ga0209971_1023765 Ga0209971_10237654 146
342 3300027876 Ga0209974_10002524 Ga0209974_100025242 146
343 3300027876 Ga0209974_10033146 Ga0209974_100331461 146
344 3300028381 Ga0268264_10748057 Ga0268264_107480571 146
345 3300031548 Ga0307408_100162100 Ga0307408_1001621003 146
346 3300031548 Ga0307408_100691922 Ga0307408_1006919222 146
347 3300031731 Ga0307405_10006163 Ga0307405_100061638 146
348 3300031731 Ga0307405_10108505 Ga0307405_101085053 146
349 3300031731 Ga0307405_10682171 Ga0307405_106821712 146
350 3300031824 Ga0307413_10017567 Ga0307413_100175673 146
351 3300031824 Ga0307413_10047208 Ga0307413_100472083 146
352 3300031824 Ga0307413_10262842 Ga0307413_102628422 146
353 3300031824 Ga0307413_10264847 Ga0307413_102648472 146
354 3300031852 Ga0307410_10065381 Ga0307410_100653814 146
355 3300031852 Ga0307410_10089432 Ga0307410_100894323 146
356 3300031852 Ga0307410_10109599 Ga0307410_101095993 146
357 3300031852 Ga0307410_10116915 Ga0307410_101169153 146
358 3300031852 Ga0307410_10173370 Ga0307410_101733702 146
359 3300031852 Ga0307410_10215225 Ga0307410_102152253 146
360 3300031901 Ga0307406_10049725 Ga0307406_100497253 146
361 3300031901 Ga0307406_10109486 Ga0307406_101094862 146
362 3300031901 Ga0307406_10390168 Ga0307406_103901682 146
363 3300031903 Ga0307407_10020430 Ga0307407_100204304 146
364 3300031903 Ga0307407_10170574 Ga0307407_101705741 146
365 3300031911 Ga0307412_10355211 Ga0307412_103552112 146
366 3300031911 Ga0307412_11238834 Ga0307412_112388342 146
367 3300031995 Ga0307409_100088713 Ga0307409_1000887133 146
368 3300031995 Ga0307409_100120720 Ga0307409_1001207203 146
369 3300031995 Ga0307409_100192694 Ga0307409_1001926943 146
370 3300031995 Ga0307409_100444702 Ga0307409_1004447021 146
371 3300031995 Ga0307409_101014651 Ga0307409_1010146512 146
372 3300031995 Ga0307409_101420227 Ga0307409_1014202271 146
373 3300032002 Ga0307416_100030934 Ga0307416_1000309343 146
374 3300032002 Ga0307416_100034134 Ga0307416_1000341342 146
375 3300032002 Ga0307416_100069074 Ga0307416_1000690743 146
376 3300032004 Ga0307414_10078993 Ga0307414_100789933 146
377 3300032004 Ga0307414_10120589 Ga0307414_101205893 146
378 3300032004 Ga0307414_10162873 Ga0307414_101628731 146
379 3300032004 Ga0307414_10458794 Ga0307414_104587941 146
380 3300032004 Ga0307414_10585987 Ga0307414_105859872 146
381 3300032005 Ga0307411_10004491 Ga0307411_100044914 146
382 3300032005 Ga0307411_10206147 Ga0307411_102061473 146
383 3300032005 Ga0307411_10280681 Ga0307411_102806812 146
384 3300032005 Ga0307411_11365327 Ga0307411_113653271 146
385 3300032126 Ga0307415_100266187 Ga0307415_1002661873 146
386 3300032126 Ga0307415_100307401 Ga0307415_1003074013 146
387 3300032126 Ga0307415_101487127 Ga0307415_1014871272 146
388 3300035724 Ga0373933_0494407 Ga0373933_0494407_82_522 146
389 3300037068 Ga0373925_1610865 Ga0373925_1610865_21_479 146
390 3300039437 Ga0436365_1244758 Ga0436365_1244758_8206_8646 146
391 3300041404 Ga0439436_0075656 Ga0439436_0075656_48_500 146
392 3300041406 Ga0439439_0002283 Ga0439439_0002283_2060_2512 146
393 3300041406 Ga0439439_0041887 Ga0439439_0041887_593_1045 146
394 3300041406 Ga0439439_0080318 Ga0439439_0080318_416_868 146
395 3300041413 Ga0439465_0215616 Ga0439465_0215616_180_662 146
396 3300042015 Ga0439462_0087082 Ga0439462_0087082_252_704 146
397 3300042123 Ga0450921_006157 Ga0450921_006157_456_908 146
398 3300042131 Ga0450894_007385 Ga0450894_007385_16_468 146
399 3300042134 Ga0450898_009730 Ga0450898_009730_598_1050 146
400 3300042147 Ga0450910_018809 Ga0450910_018809_305_757 146
401 3300042156 Ga0439446_0054111 Ga0439446_0054111_532_984 146
402 3300046681 Ga0495647_0106343 Ga0495647_0106343_124_576 146
403 3300048905 Ga0496102_0134390 Ga0496102_0134390_201_653 146
404 3300048909 Ga0496106_0167336 Ga0496106_0167336_534_986 146
405 3300049160 Ga0501304_028682 Ga0501304_028682_58_510 146
406 3300049161 Ga0501305_052204 Ga0501305_052204_18_470 146
407 3300049161 Ga0501305_056471 Ga0501305_056471_36_488 146
408 3300049515 Ga0501292_033197 Ga0501292_033197_209_661 146
409 3300049522 Ga0501299_013433 Ga0501299_013433_328_780 146
410 3300049528 Ga0501312_090901 Ga0501312_090901_62_514 146
411 3300049529 Ga0501313_062270 Ga0501313_062270_12_464 146
412 3300049537 Ga0501321_072315 Ga0501321_072315_11_463 146
413 3300049541 Ga0501325_055035 Ga0501325_055035_45_497 146
414 3300049571 Ga0501034_0001355 Ga0501034_0001355_14517_14969 146
415 3300049583 Ga0501067_0001052 Ga0501067_0001052_8618_9070 146
416 3300049584 Ga0501068_0011181 Ga0501068_0011181_3992_4444 146
417 3300049585 Ga0501069_0000098 Ga0501069_0000098_7699_8151 146
418 3300049586 Ga0501070_0000192 Ga0501070_0000192_56268_56720 146
419 3300049587 Ga0501071_0000060 Ga0501071_0000060_36758_37210 146
420 3300049588 Ga0501072_0000081 Ga0501072_0000081_37377_37829 146
421 3300049589 Ga0501073_0022302 Ga0501073_0022302_659_1111 146
422 3300049590 Ga0501074_0001663 Ga0501074_0001663_9805_10257 146
423 3300049590 Ga0501074_0443048 Ga0501074_0443048_194_646 146
424 3300049591 Ga0501075_0065194 Ga0501075_0065194_2188_2670 146
425 3300049592 Ga0501076_0387765 Ga0501076_0387765_332_784 146
426 3300049650 Ga0501199_011422 Ga0501199_011422_130_582 146
427 3300049651 Ga0501201_004663 Ga0501201_004663_370_822 146
428 3300049651 Ga0501201_024820 Ga0501201_024820_186_638 146
429 3300049652 Ga0501202_031347 Ga0501202_031347_70_522 146
430 3300049653 Ga0501206_022463 Ga0501206_022463_18_470 146
431 3300049655 Ga0501208_098677 Ga0501208_098677_152_604 146
432 3300049656 Ga0501209_046355 Ga0501209_046355_177_629 146
433 3300049659 Ga0501214_026930 Ga0501214_026930_196_648 146
434 3300049660 Ga0501216_153221 Ga0501216_153221_67_519 146
435 3300049661 Ga0501217_023195 Ga0501217_023195_693_1145 146
436 3300049666 Ga0501228_003303 Ga0501228_003303_223_675 146
437 3300049668 Ga0501233_029106 Ga0501233_029106_622_1074 146
438 3300049669 Ga0501235_013655 Ga0501235_013655_832_1284 146
439 3300049670 Ga0501236_018815 Ga0501236_018815_343_795 146
440 3300049672 Ga0501239_010235 Ga0501239_010235_339_791 146
441 3300049673 Ga0501240_032149 Ga0501240_032149_215_667 146
442 3300049674 Ga0501242_036833 Ga0501242_036833_130_582 146
443 3300049675 Ga0501243_011673 Ga0501243_011673_288_740 146
444 3300049675 Ga0501243_049379 Ga0501243_049379_95_547 146
445 3300049677 Ga0501247_000073 Ga0501247_000073_903_1355 146
446 3300049682 Ga0501252_007501 Ga0501252_007501_210_662 146
447 3300049683 Ga0501253_025427 Ga0501253_025427_454_906 146
448 3300049687 Ga0501258_004870 Ga0501258_004870_232_684 146
449 3300049704 Ga0501221_027066 Ga0501221_027066_197_649 146
450 3300049708 Ga0501245_010568 Ga0501245_010568_71_523 146
451 3300049741 Ga0501079_0284538 Ga0501079_0284538_431_883 146
452 3300049742 Ga0501080_0000060 Ga0501080_0000060_54809_55261 146
453 3300049743 Ga0501081_0026798 Ga0501081_0026798_2604_3056 146
454 3300049744 Ga0501083_0006130 Ga0501083_0006130_7834_8286 146
455 3300049759 Ga0501262_013326 Ga0501262_013326_281_733 146
456 3300049760 Ga0501263_021333 Ga0501263_021333_297_749 146
457 3300049765 Ga0501268_001380 Ga0501268_001380_2291_2743 146
458 3300049765 Ga0501268_082798 Ga0501268_082798_162_614 146
459 3300049767 Ga0501270_004084 Ga0501270_004084_782_1234 146
460 3300049769 Ga0501272_007118 Ga0501272_007118_134_586 146
461 3300049770 Ga0501273_007298 Ga0501273_007298_284_736 146
462 3300049779 Ga0501283_004964 Ga0501283_004964_678_1130 146
463 3300050494 nmdc:mga06z11_653659_c1 nmdc:mga06z11_653659_c1_16_462 146
464 3300050496 nmdc:mga07m45_289507_c1 nmdc:mga07m45_289507_c1_210_650 146
465 3300050496 nmdc:mga07m45_461163_c1 nmdc:mga07m45_461163_c1_210_668 146
466 3300050507 nmdc:mga05p37_802723_c1 nmdc:mga05p37_802723_c1_398_850 146
467 3300050512 nmdc:mga0n895_210958_c1 nmdc:mga0n895_210958_c1_685_1137 146
468 3300050515 nmdc:mga0a205_74150_c1 nmdc:mga0a205_74150_c1_2246_2698 146
469 3300053108 Ga0500562_053230 Ga0500562_053230_90_530 146
470 3300054114 Ga0501084_0005867 Ga0501084_0005867_2005_2457 146
471 3300059491 Ga0587070_042562 Ga0587070_042562_137_589 146
472 3300059511 Ga0587091_175899 Ga0587091_175899_41_493 146
473 3300059512 Ga0587092_140704 Ga0587092_140704_30_482 146
474 3300059626 Ga0587115_122583 Ga0587115_122583_11_463 146
475 3300059641 Ga0587068_064796 Ga0587068_064796_227_679 146
476 3300060346 Ga0587111_0104482 Ga0587111_0104482_40_492 146
477 3300060353 Ga0501082_0001299 Ga0501082_0001299_659_1111 146
478 3300061734 Ga0530510_0562287 Ga0530510_0562287_293_745 146
479 3300005343 Ga0070687_101078360 Ga0070687_1010783601 147
480 3300005438 Ga0070701_10430622 Ga0070701_104306221 147
481 3300005545 Ga0070695_100350209 Ga0070695_1003502092 147
482 3300009094 Ga0111539_10667918 Ga0111539_106679182 147
483 3300009177 Ga0105248_11113366 Ga0105248_111133662 147
484 3300013297 Ga0157378_10098822 Ga0157378_100988221 147
485 3300014326 Ga0157380_12280292 Ga0157380_122802922 147
486 3300041458 Ga0451798_0094922 Ga0451798_0094922_297_758 147
487 3300041459 Ga0451800_1358168 Ga0451800_1358168_87_548 147
488 3300041461 Ga0451805_090425 Ga0451805_090425_27_488 147
489 3300041501 Ga0451845_0928614 Ga0451845_0928614_745_1206 147
490 3300041505 Ga0451849_0273965 Ga0451849_0273965_425_886 147
491 3300049571 Ga0501034_0185921 Ga0501034_0185921_583_1041 147
492 3300050511 nmdc:mga08y16_397281_c1 nmdc:mga08y16_397281_c1_321_767 147
493 3300005331 Ga0070670_100058808 Ga0070670_1000588084 148
494 3300005444 Ga0070694_100482878 Ga0070694_1004828782 148
495 3300005456 Ga0070678_101792635 Ga0070678_1017926351 148
496 3300005459 Ga0068867_101750460 Ga0068867_1017504601 148
497 3300005539 Ga0068853_100380667 Ga0068853_1003806671 148
498 3300005545 Ga0070695_100389662 Ga0070695_1003896622 148
499 3300005614 Ga0068856_100031217 Ga0068856_1000312173 148
500 3300005618 Ga0068864_101546933 Ga0068864_1015469331 148
501 3300005985 Ga0081539_10028340 Ga0081539_100283403 148
502 3300006852 Ga0075433_10240666 Ga0075433_102406661 148
503 3300006871 Ga0075434_102100241 Ga0075434_1021002411 148
504 3300009093 Ga0105240_10323307 Ga0105240_103233073 148
505 3300009101 Ga0105247_11167274 Ga0105247_111672741 148
506 3300009148 Ga0105243_10301221 Ga0105243_103012212 148
507 3300009174 Ga0105241_11037769 Ga0105241_110377691 148
508 3300009545 Ga0105237_10553910 Ga0105237_105539102 148
509 3300009553 Ga0105249_10039009 Ga0105249_100390095 148
510 3300010375 Ga0105239_10227608 Ga0105239_102276082 148
511 3300013297 Ga0157378_10860832 Ga0157378_108608322 148
512 3300013306 Ga0163162_10161247 Ga0163162_101612474 148
513 3300013307 Ga0157372_10560935 Ga0157372_105609352 148
514 3300025908 Ga0207643_10976486 Ga0207643_109764861 148
515 3300025925 Ga0207650_10071542 Ga0207650_100715422 148
516 3300025935 Ga0207709_10128828 Ga0207709_101288281 148
517 3300025942 Ga0207689_10125695 Ga0207689_101256951 148
518 3300025961 Ga0207712_10029090 Ga0207712_100290902 148
519 3300026095 Ga0207676_11238212 Ga0207676_112382122 148
520 3300038996 Ga0242420_004643 Ga0242420_004643_56_502 148
521 3300048905 Ga0496102_0337884 Ga0496102_0337884_200_646 148
522 3300048906 Ga0496103_0073160 Ga0496103_0073160_152_598 148
523 3300048907 Ga0496104_0064013 Ga0496104_0064013_2754_3200 148
524 3300048909 Ga0496106_0055981 Ga0496106_0055981_774_1220 148
525 3300048911 Ga0496108_0128393 Ga0496108_0128393_1688_2134 148
526 3300048912 Ga0496109_0637578 Ga0496109_0637578_506_952 148
527 3300048913 Ga0496110_0704198 Ga0496110_0704198_244_690 148
528 3300048915 Ga0496112_1429218 Ga0496112_1429218_104_550 148
529 3300049533 Ga0501317_001899 Ga0501317_001899_146_613 148
530 3300050513 nmdc:mga0rr50_1548924_c1 nmdc:mga0rr50_1548924_c1_73_519 148
531 3300050515 nmdc:mga0a205_30310_c1 nmdc:mga0a205_30310_c1_142_588 148
532 3300004800 Ga0058861_12052293 Ga0058861_120522932 149
533 3300004803 Ga0058862_12645996 Ga0058862_126459961 149
534 3300005289 Ga0065704_10319899 Ga0065704_103198991 149
535 3300005290 Ga0065712_10004680 Ga0065712_100046804 149
536 3300005293 Ga0065715_10102020 Ga0065715_101020202 149
537 3300005295 Ga0065707_10748818 Ga0065707_107488181 149
538 3300005330 Ga0070690_101219369 Ga0070690_1012193691 149
539 3300005334 Ga0068869_100042361 Ga0068869_1000423614 149
540 3300005335 Ga0070666_10042134 Ga0070666_100421343 149
541 3300005336 Ga0070680_100007591 Ga0070680_1000075912 149
542 3300005338 Ga0068868_100024305 Ga0068868_1000243053 149
543 3300005340 Ga0070689_100323954 Ga0070689_1003239542 149
544 3300005353 Ga0070669_100227616 Ga0070669_1002276162 149
545 3300005354 Ga0070675_100094595 Ga0070675_1000945953 149
546 3300005355 Ga0070671_100006834 Ga0070671_1000068343 149
547 3300005355 Ga0070671_100414269 Ga0070671_1004142692 149
548 3300005364 Ga0070673_100039470 Ga0070673_1000394703 149
549 3300005365 Ga0070688_100027695 Ga0070688_1000276951 149
550 3300005367 Ga0070667_100009924 Ga0070667_1000099242 149
551 3300005438 Ga0070701_10260659 Ga0070701_102606592 149
552 3300005441 Ga0070700_100014593 Ga0070700_1000145933 149
553 3300005444 Ga0070694_100048840 Ga0070694_1000488402 149
554 3300005456 Ga0070678_100077740 Ga0070678_1000777403 149
555 3300005456 Ga0070678_102141520 Ga0070678_1021415201 149
556 3300005458 Ga0070681_10000425 Ga0070681_1000042510 149
557 3300005459 Ga0068867_100039248 Ga0068867_1000392482 149
558 3300005466 Ga0070685_10008724 Ga0070685_100087242 149
559 3300005468 Ga0070707_100817692 Ga0070707_1008176921 149
560 3300005471 Ga0070698_100014111 Ga0070698_1000141114 149
561 3300005471 Ga0070698_100598680 Ga0070698_1005986802 149
562 3300005518 Ga0070699_100147720 Ga0070699_1001477203 149
563 3300005530 Ga0070679_100000308 Ga0070679_1000003081 149
564 3300005535 Ga0070684_100107878 Ga0070684_1001078783 149
565 3300005536 Ga0070697_100041573 Ga0070697_1000415732 149
566 3300005543 Ga0070672_100043818 Ga0070672_1000438182 149
567 3300005544 Ga0070686_100006820 Ga0070686_1000068202 149
568 3300005544 Ga0070686_101230031 Ga0070686_1012300311 149
569 3300005545 Ga0070695_100192404 Ga0070695_1001924042 149
570 3300005546 Ga0070696_101565582 Ga0070696_1015655821 149
571 3300005546 Ga0070696_101870732 Ga0070696_1018707321 149
572 3300005549 Ga0070704_101241523 Ga0070704_1012415232 149
573 3300005564 Ga0070664_100648085 Ga0070664_1006480852 149
574 3300005578 Ga0068854_100017037 Ga0068854_1000170377 149
575 3300005615 Ga0070702_100304718 Ga0070702_1003047182 149
576 3300005616 Ga0068852_100093014 Ga0068852_1000930144 149
577 3300005617 Ga0068859_100573248 Ga0068859_1005732482 149
578 3300005618 Ga0068864_100483826 Ga0068864_1004838261 149
579 3300005718 Ga0068866_10028898 Ga0068866_100288983 149
580 3300005719 Ga0068861_100022941 Ga0068861_1000229414 149
581 3300005841 Ga0068863_100074782 Ga0068863_1000747823 149
582 3300005842 Ga0068858_100082328 Ga0068858_1000823282 149
583 3300005843 Ga0068860_100037964 Ga0068860_1000379643 149
584 3300005844 Ga0068862_100056661 Ga0068862_1000566612 149
585 3300005844 Ga0068862_100381212 Ga0068862_1003812122 149
586 3300006237 Ga0097621_100010001 Ga0097621_1000100016 149
587 3300006358 Ga0068871_100024423 Ga0068871_1000244232 149
588 3300006844 Ga0075428_100046558 Ga0075428_1000465582 149
589 3300006852 Ga0075433_10353404 Ga0075433_103534042 149
590 3300006852 Ga0075433_10580550 Ga0075433_105805501 149
591 3300006871 Ga0075434_101212793 Ga0075434_1012127931 149
592 3300006880 Ga0075429_101810688 Ga0075429_1018106881 149
593 3300006881 Ga0068865_100005466 Ga0068865_1000054668 149
594 3300006931 Ga0097620_100573238 Ga0097620_1005732382 149
595 3300007076 Ga0075435_100859535 Ga0075435_1008595351 149
596 3300007076 Ga0075435_101725329 Ga0075435_1017253291 149
597 3300009036 Ga0105244_10259618 Ga0105244_102596181 149
598 3300009093 Ga0105240_12179640 Ga0105240_121796401 149
599 3300009098 Ga0105245_10009220 Ga0105245_100092208 149
600 3300009101 Ga0105247_10209413 Ga0105247_102094133 149
601 3300009148 Ga0105243_10055155 Ga0105243_100551552 149
602 3300009174 Ga0105241_10215505 Ga0105241_102155052 149
603 3300009176 Ga0105242_10007678 Ga0105242_100076788 149
604 3300009177 Ga0105248_10014028 Ga0105248_100140288 149
605 3300009553 Ga0105249_10033646 Ga0105249_100336463 149
606 3300009553 Ga0105249_11739543 Ga0105249_117395432 149
607 3300009553 Ga0105249_12722649 Ga0105249_127226491 149
608 3300011119 Ga0105246_10027132 Ga0105246_100271326 149
609 3300013102 Ga0157371_11150040 Ga0157371_111500401 149
610 3300013296 Ga0157374_10516761 Ga0157374_105167612 149
611 3300013297 Ga0157378_10006757 Ga0157378_100067578 149
612 3300013306 Ga0163162_10088515 Ga0163162_100885153 149
613 3300013306 Ga0163162_11342019 Ga0163162_113420191 149
614 3300013308 Ga0157375_10248965 Ga0157375_102489652 149
615 3300014325 Ga0163163_10010551 Ga0163163_100105513 149
616 3300014326 Ga0157380_10006445 Ga0157380_100064452 149
617 3300014326 Ga0157380_11610301 Ga0157380_116103011 149
618 3300014745 Ga0157377_10187065 Ga0157377_101870652 149
619 3300014969 Ga0157376_10167934 Ga0157376_101679342 149
620 3300017792 Ga0163161_10039795 Ga0163161_100397953 149
621 3300025899 Ga0207642_10059505 Ga0207642_100595052 149
622 3300025900 Ga0207710_10193559 Ga0207710_101935592 149
623 3300025901 Ga0207688_10075149 Ga0207688_100751493 149
624 3300025903 Ga0207680_10158946 Ga0207680_101589461 149
625 3300025911 Ga0207654_10259353 Ga0207654_102593532 149
626 3300025912 Ga0207707_10000016 Ga0207707_1000001638 149
627 3300025917 Ga0207660_10072579 Ga0207660_100725792 149
628 3300025918 Ga0207662_10201316 Ga0207662_102013162 149
629 3300025921 Ga0207652_10000267 Ga0207652_1000026731 149
630 3300025922 Ga0207646_11543974 Ga0207646_115439741 149
631 3300025923 Ga0207681_10025237 Ga0207681_100252372 149
632 3300025931 Ga0207644_10013122 Ga0207644_100131226 149
633 3300025931 Ga0207644_10086890 Ga0207644_100868901 149
634 3300025934 Ga0207686_10005623 Ga0207686_100056236 149
635 3300025935 Ga0207709_10092751 Ga0207709_100927512 149
636 3300025936 Ga0207670_10220864 Ga0207670_102208642 149
637 3300025936 Ga0207670_10685541 Ga0207670_106855411 149
638 3300025938 Ga0207704_10015168 Ga0207704_100151682 149
639 3300025940 Ga0207691_10011757 Ga0207691_100117572 149
640 3300025942 Ga0207689_10030521 Ga0207689_100305211 149
641 3300025960 Ga0207651_10195565 Ga0207651_101955652 149
642 3300025961 Ga0207712_10031309 Ga0207712_100313094 149
643 3300025961 Ga0207712_11406653 Ga0207712_114066531 149
644 3300025981 Ga0207640_10022653 Ga0207640_100226533 149
645 3300026023 Ga0207677_10012110 Ga0207677_100121103 149
646 3300026035 Ga0207703_10161973 Ga0207703_101619732 149
647 3300026075 Ga0207708_10132826 Ga0207708_101328261 149
648 3300026088 Ga0207641_10043522 Ga0207641_100435224 149
649 3300026089 Ga0207648_11392547 Ga0207648_113925471 149
650 3300026095 Ga0207676_10097178 Ga0207676_100971783 149
651 3300026118 Ga0207675_100017622 Ga0207675_1000176222 149
652 3300026121 Ga0207683_10320888 Ga0207683_103208881 149
653 3300028380 Ga0268265_10452924 Ga0268265_104529242 149
654 3300028380 Ga0268265_10580258 Ga0268265_105802582 149
655 3300028381 Ga0268264_10246915 Ga0268264_102469152 149
656 3300035691 Ga0373931_0841339 Ga0373931_0841339_104_553 149
657 3300045051 Ga0451576_0782912 Ga0451576_0782912_496_945 149
658 3300048915 Ga0496112_0942103 Ga0496112_0942103_56_505 149
659 3300048915 Ga0496112_1079468 Ga0496112_1079468_95_544 149
660 3300050511 nmdc:mga08y16_276937_c1 nmdc:mga08y16_276937_c1_1252_1701 149
661 3300050512 nmdc:mga0n895_521573_c1 nmdc:mga0n895_521573_c1_638_1087 149
662 3300001990 JGI24737J22298_10099895 JGI24737J22298_100998951 150
663 3300002076 JGI24749J21850_1068974 JGI24749J21850_10689741 150
664 3300002459 JGI24751J29686_10000043 JGI24751J29686_1000004344 150
665 3300003203 JGI25406J46586_10066683 JGI25406J46586_100666832 150
666 3300003203 JGI25406J46586_10119960 JGI25406J46586_101199601 150
667 3300003203 JGI25406J46586_10123520 JGI25406J46586_101235201 150
668 3300004801 Ga0058860_10119785 Ga0058860_101197851 150
669 3300004803 Ga0058862_10040385 Ga0058862_100403852 150
670 3300005288 Ga0065714_10378440 Ga0065714_103784401 150
671 3300005289 Ga0065704_10006068 Ga0065704_100060681 150
672 3300005290 Ga0065712_10033824 Ga0065712_100338241 150
673 3300005290 Ga0065712_10321286 Ga0065712_103212861 150
674 3300005293 Ga0065715_10016269 Ga0065715_100162693 150
675 3300005293 Ga0065715_10477965 Ga0065715_104779651 150
676 3300005293 Ga0065715_10497524 Ga0065715_104975241 150
677 3300005295 Ga0065707_10090144 Ga0065707_100901441 150
678 3300005295 Ga0065707_10182165 Ga0065707_101821652 150
679 3300005330 Ga0070690_100267179 Ga0070690_1002671792 150
680 3300005330 Ga0070690_100297906 Ga0070690_1002979062 150
681 3300005331 Ga0070670_100092380 Ga0070670_1000923802 150
682 3300005331 Ga0070670_101852565 Ga0070670_1018525651 150
683 3300005333 Ga0070677_10856470 Ga0070677_108564701 150
684 3300005334 Ga0068869_100327120 Ga0068869_1003271201 150
685 3300005334 Ga0068869_100391230 Ga0068869_1003912301 150
686 3300005335 Ga0070666_10275761 Ga0070666_102757612 150
687 3300005336 Ga0070680_100422887 Ga0070680_1004228872 150
688 3300005337 Ga0070682_100178981 Ga0070682_1001789812 150
689 3300005337 Ga0070682_101055797 Ga0070682_1010557972 150
690 3300005340 Ga0070689_100106631 Ga0070689_1001066313 150
691 3300005341 Ga0070691_10173166 Ga0070691_101731662 150
692 3300005343 Ga0070687_100116595 Ga0070687_1001165952 150
693 3300005344 Ga0070661_100426703 Ga0070661_1004267031 150
694 3300005345 Ga0070692_10068274 Ga0070692_100682743 150
695 3300005354 Ga0070675_100253320 Ga0070675_1002533202 150
696 3300005356 Ga0070674_100595132 Ga0070674_1005951322 150
697 3300005364 Ga0070673_100060363 Ga0070673_1000603632 150
698 3300005364 Ga0070673_100145891 Ga0070673_1001458913 150
699 3300005364 Ga0070673_100363237 Ga0070673_1003632371 150
700 3300005434 Ga0070709_11555215 Ga0070709_115552151 150
701 3300005438 Ga0070701_11077122 Ga0070701_110771221 150
702 3300005440 Ga0070705_100112461 Ga0070705_1001124612 150
703 3300005440 Ga0070705_100422749 Ga0070705_1004227491 150
704 3300005441 Ga0070700_100000266 Ga0070700_10000026629 150
705 3300005441 Ga0070700_100185277 Ga0070700_1001852772 150
706 3300005441 Ga0070700_100282791 Ga0070700_1002827911 150
707 3300005441 Ga0070700_100321158 Ga0070700_1003211581 150
708 3300005441 Ga0070700_101799189 Ga0070700_1017991891 150
709 3300005444 Ga0070694_100089907 Ga0070694_1000899073 150
710 3300005444 Ga0070694_100374063 Ga0070694_1003740632 150
711 3300005456 Ga0070678_100201921 Ga0070678_1002019211 150
712 3300005457 Ga0070662_100221238 Ga0070662_1002212382 150
713 3300005458 Ga0070681_10005227 Ga0070681_100052276 150
714 3300005466 Ga0070685_10992291 Ga0070685_109922911 150
715 3300005518 Ga0070699_100060955 Ga0070699_1000609552 150
716 3300005539 Ga0068853_100021364 Ga0068853_1000213645 150
717 3300005545 Ga0070695_100323273 Ga0070695_1003232731 150
718 3300005546 Ga0070696_100492901 Ga0070696_1004929012 150
719 3300005547 Ga0070693_100009251 Ga0070693_1000092514 150
720 3300005549 Ga0070704_100309990 Ga0070704_1003099902 150
721 3300005564 Ga0070664_100594897 Ga0070664_1005948971 150
722 3300005615 Ga0070702_100022419 Ga0070702_1000224193 150
723 3300005615 Ga0070702_100159528 Ga0070702_1001595283 150
724 3300005615 Ga0070702_100202279 Ga0070702_1002022792 150
725 3300005615 Ga0070702_100300332 Ga0070702_1003003322 150
726 3300005616 Ga0068852_100817665 Ga0068852_1008176651 150
727 3300005617 Ga0068859_100147685 Ga0068859_1001476853 150
728 3300005617 Ga0068859_100205327 Ga0068859_1002053274 150
729 3300005617 Ga0068859_101344893 Ga0068859_1013448932 150
730 3300005617 Ga0068859_101949886 Ga0068859_1019498861 150
731 3300005617 Ga0068859_103148907 Ga0068859_1031489071 150
732 3300005618 Ga0068864_100454383 Ga0068864_1004543832 150
733 3300005719 Ga0068861_101738102 Ga0068861_1017381021 150
734 3300005840 Ga0068870_10763273 Ga0068870_107632732 150
735 3300005841 Ga0068863_100090858 Ga0068863_1000908583 150
736 3300005842 Ga0068858_100033389 Ga0068858_1000333891 150
737 3300005842 Ga0068858_100287872 Ga0068858_1002878721 150
738 3300005843 Ga0068860_100114135 Ga0068860_1001141352 150
739 3300005843 Ga0068860_101723245 Ga0068860_1017232451 150
740 3300005844 Ga0068862_100451050 Ga0068862_1004510502 150
741 3300005937 Ga0081455_10158880 Ga0081455_101588802 150
742 3300005985 Ga0081539_10001142 Ga0081539_1000114250 150
743 3300006058 Ga0075432_10073290 Ga0075432_100732902 150
744 3300006237 Ga0097621_100364737 Ga0097621_1003647372 150
745 3300006358 Ga0068871_100523066 Ga0068871_1005230662 150
746 3300006852 Ga0075433_10037879 Ga0075433_100378796 150
747 3300006852 Ga0075433_10264822 Ga0075433_102648223 150
748 3300006871 Ga0075434_100148013 Ga0075434_1001480133 150
749 3300006881 Ga0068865_100482499 Ga0068865_1004824992 150
750 3300006931 Ga0097620_100147685 Ga0097620_1001476853 150
751 3300006931 Ga0097620_100205338 Ga0097620_1002053384 150
752 3300006931 Ga0097620_101344889 Ga0097620_1013448892 150
753 3300006931 Ga0097620_101949810 Ga0097620_1019498101 150
754 3300006931 Ga0097620_103149039 Ga0097620_1031490391 150
755 3300009011 Ga0105251_10176467 Ga0105251_101764672 150
756 3300009093 Ga0105240_10106929 Ga0105240_101069293 150
757 3300009093 Ga0105240_11624294 Ga0105240_116242941 150
758 3300009094 Ga0111539_10003746 Ga0111539_1000374613 150
759 3300009098 Ga0105245_11772465 Ga0105245_117724651 150
760 3300009101 Ga0105247_11249209 Ga0105247_112492091 150
761 3300009101 Ga0105247_11370099 Ga0105247_113700991 150
762 3300009101 Ga0105247_11467234 Ga0105247_114672341 150
763 3300009147 Ga0114129_10181912 Ga0114129_101819122 150
764 3300009147 Ga0114129_10877672 Ga0114129_108776723 150
765 3300009148 Ga0105243_12227233 Ga0105243_122272331 150
766 3300009174 Ga0105241_10710659 Ga0105241_107106591 150
767 3300009174 Ga0105241_11230423 Ga0105241_112304232 150
768 3300009176 Ga0105242_10565038 Ga0105242_105650382 150
769 3300009176 Ga0105242_12600125 Ga0105242_126001251 150
770 3300009177 Ga0105248_10091433 Ga0105248_100914333 150
771 3300009177 Ga0105248_10179460 Ga0105248_101794601 150
772 3300009177 Ga0105248_10489049 Ga0105248_104890491 150
773 3300009177 Ga0105248_11591229 Ga0105248_115912291 150
774 3300009545 Ga0105237_10326547 Ga0105237_103265472 150
775 3300009551 Ga0105238_10049968 Ga0105238_100499681 150
776 3300009553 Ga0105249_10023100 Ga0105249_100231005 150
777 3300009553 Ga0105249_11031258 Ga0105249_110312581 150
778 3300009553 Ga0105249_12235555 Ga0105249_122355551 150
779 3300010375 Ga0105239_10537338 Ga0105239_105373382 150
780 3300011119 Ga0105246_10466384 Ga0105246_104663841 150
781 3300013100 Ga0157373_10910577 Ga0157373_109105771 150
782 3300013100 Ga0157373_11065013 Ga0157373_110650131 150
783 3300013297 Ga0157378_10787995 Ga0157378_107879952 150
784 3300013307 Ga0157372_13347804 Ga0157372_133478041 150
785 3300013308 Ga0157375_12653253 Ga0157375_126532531 150
786 3300014325 Ga0163163_12293797 Ga0163163_122937971 150
787 3300014325 Ga0163163_13273837 Ga0163163_132738371 150
788 3300014497 Ga0182008_10327499 Ga0182008_103274991 150
789 3300014968 Ga0157379_10291413 Ga0157379_102914132 150
790 3300014968 Ga0157379_10489485 Ga0157379_104894852 150
791 3300015262 Ga0182007_10132255 Ga0182007_101322551 150
792 3300017792 Ga0163161_10652039 Ga0163161_106520392 150
793 3300025899 Ga0207642_10366178 Ga0207642_103661782 150
794 3300025900 Ga0207710_10076290 Ga0207710_100762901 150
795 3300025900 Ga0207710_10429959 Ga0207710_104299592 150
796 3300025904 Ga0207647_10002003 Ga0207647_1000200313 150
797 3300025904 Ga0207647_10586971 Ga0207647_105869711 150
798 3300025908 Ga0207643_10456106 Ga0207643_104561061 150
799 3300025911 Ga0207654_10215580 Ga0207654_102155801 150
800 3300025911 Ga0207654_10941177 Ga0207654_109411772 150
801 3300025912 Ga0207707_10010480 Ga0207707_100104809 150
802 3300025913 Ga0207695_10061311 Ga0207695_100613114 150
803 3300025913 Ga0207695_10916558 Ga0207695_109165582 150
804 3300025914 Ga0207671_10340550 Ga0207671_103405502 150
805 3300025918 Ga0207662_10029256 Ga0207662_100292567 150
806 3300025918 Ga0207662_10093326 Ga0207662_100933261 150
807 3300025920 Ga0207649_10935990 Ga0207649_109359902 150
808 3300025920 Ga0207649_11196969 Ga0207649_111969691 150
809 3300025924 Ga0207694_10008076 Ga0207694_100080764 150
810 3300025925 Ga0207650_10000011 Ga0207650_10000011167 150
811 3300025927 Ga0207687_10852988 Ga0207687_108529882 150
812 3300025932 Ga0207690_10154128 Ga0207690_101541282 150
813 3300025934 Ga0207686_10296618 Ga0207686_102966182 150
814 3300025935 Ga0207709_10286232 Ga0207709_102862322 150
815 3300025936 Ga0207670_10039470 Ga0207670_100394703 150
816 3300025940 Ga0207691_10083615 Ga0207691_100836152 150
817 3300025941 Ga0207711_10008388 Ga0207711_100083888 150
818 3300025941 Ga0207711_10010629 Ga0207711_100106291 150
819 3300025941 Ga0207711_10157868 Ga0207711_101578682 150
820 3300025941 Ga0207711_10366421 Ga0207711_103664212 150
821 3300025941 Ga0207711_11013065 Ga0207711_110130651 150
822 3300025942 Ga0207689_10196005 Ga0207689_101960052 150
823 3300025945 Ga0207679_11451951 Ga0207679_114519512 150
824 3300025960 Ga0207651_10324471 Ga0207651_103244711 150
825 3300025960 Ga0207651_10581801 Ga0207651_105818011 150
826 3300025960 Ga0207651_11677465 Ga0207651_116774651 150
827 3300025961 Ga0207712_10010700 Ga0207712_100107006 150
828 3300025961 Ga0207712_10178431 Ga0207712_101784312 150
829 3300026023 Ga0207677_11133000 Ga0207677_111330002 150
830 3300026035 Ga0207703_10403191 Ga0207703_104031911 150
831 3300026041 Ga0207639_10018927 Ga0207639_100189273 150
832 3300026067 Ga0207678_10345583 Ga0207678_103455832 150
833 3300026075 Ga0207708_11253514 Ga0207708_112535142 150
834 3300026088 Ga0207641_10358719 Ga0207641_103587192 150
835 3300026095 Ga0207676_10974991 Ga0207676_109749911 150
836 3300026095 Ga0207676_11845153 Ga0207676_118451532 150
837 3300026116 Ga0207674_10866817 Ga0207674_108668172 150
838 3300026118 Ga0207675_100108369 Ga0207675_1001083693 150
839 3300026118 Ga0207675_100638653 Ga0207675_1006386532 150
840 3300026121 Ga0207683_10365711 Ga0207683_103657113 150
841 3300026142 Ga0207698_10685147 Ga0207698_106851471 150
842 3300026142 Ga0207698_12686907 Ga0207698_126869071 150
843 3300027907 Ga0207428_10007924 Ga0207428_100079249 150
844 3300028380 Ga0268265_11392600 Ga0268265_113926001 150
845 3300028381 Ga0268264_10042115 Ga0268264_100421152 150
846 3300028381 Ga0268264_10776110 Ga0268264_107761102 150
847 3300031548 Ga0307408_100662298 Ga0307408_1006622982 150
848 3300031731 Ga0307405_10024793 Ga0307405_100247931 150
849 3300031824 Ga0307413_10165095 Ga0307413_101650953 150
850 3300031901 Ga0307406_10003940 Ga0307406_100039404 150
851 3300031903 Ga0307407_10256679 Ga0307407_102566793 150
852 3300031911 Ga0307412_10062960 Ga0307412_100629601 150
853 3300032002 Ga0307416_100105312 Ga0307416_1001053121 150
854 3300032004 Ga0307414_10001220 Ga0307414_100012206 150
855 3300032005 Ga0307411_10040958 Ga0307411_100409582 150
856 3300032126 Ga0307415_100003721 Ga0307415_1000037214 150
857 3300032126 Ga0307415_100291353 Ga0307415_1002913531 150
858 3300035091 Ga0373951_0016691 Ga0373951_0016691_414_866 150
859 3300035092 Ga0373952_0074749 Ga0373952_0074749_266_718 150
860 3300035112 Ga0373932_0137063 Ga0373932_0137063_89_541 150
861 3300035112 Ga0373932_0174589 Ga0373932_0174589_129_581 150
862 3300035112 Ga0373932_0286560 Ga0373932_0286560_25_477 150
863 3300035114 Ga0373939_0275552 Ga0373939_0275552_16_468 150
864 3300035115 Ga0373941_0008984 Ga0373941_0008984_66_518 150
865 3300035207 Ga0373942_0031044 Ga0373942_0031044_437_889 150
866 3300035241 Ga0373961_0012637 Ga0373961_0012637_1171_1623 150
867 3300035242 Ga0373962_0095627 Ga0373962_0095627_315_767 150
868 3300035691 Ga0373931_0195668 Ga0373931_0195668_258_710 150
869 3300035691 Ga0373931_0950653 Ga0373931_0950653_16_468 150
870 3300035725 Ga0373947_0278960 Ga0373947_0278960_451_1095 150
871 3300037466 Ga0395898_1475873 Ga0395898_1475873_65_517 150
872 3300042003 Ga0439443_037385 Ga0439443_037385_204_656 150
873 3300042005 Ga0439448_0079594 Ga0439448_0079594_468_920 150
874 3300042012 Ga0439455_0053784 Ga0439455_0053784_392_844 150
875 3300042157 Ga0439458_0026212 Ga0439458_0026212_53_505 150
876 3300042438 Ga0439459_0092623 Ga0439459_0092623_184_636 150
877 3300042876 Ga0451577_1457282 Ga0451577_1457282_34_486 150
878 3300046517 Ga0495630_0209707 Ga0495630_0209707_739_1191 150
879 3300046525 Ga0495663_0062646 Ga0495663_0062646_389_946 150
880 3300046529 Ga0495652_0468599 Ga0495652_0468599_227_679 150
881 3300046533 Ga0495640_0607224 Ga0495640_0607224_184_636 150
882 3300046535 Ga0495586_0149653 Ga0495586_0149653_840_1292 150
883 3300046663 Ga0495635_0314849 Ga0495635_0314849_517_969 150
884 3300046689 Ga0495613_0278931 Ga0495613_0278931_83_535 150
885 3300046809 Ga0495600_0173356 Ga0495600_0173356_311_763 150
886 3300047471 Ga0495684_0241561 Ga0495684_0241561_697_1149 150
887 3300048912 Ga0496109_0972430 Ga0496109_0972430_209_661 150
888 3300048914 Ga0496111_0292601 Ga0496111_0292601_98_550 150
889 3300048915 Ga0496112_0214235 Ga0496112_0214235_936_1388 150
890 3300049127 Ga0501306_099876 Ga0501306_099876_55_507 150
891 3300049130 Ga0501310_035763 Ga0501310_035763_154_606 150
892 3300049132 Ga0501343_011884 Ga0501343_011884_234_686 150
893 3300049161 Ga0501305_037827 Ga0501305_037827_19_471 150
894 3300049162 Ga0501307_037061 Ga0501307_037061_47_499 150
895 3300049520 Ga0501297_024037 Ga0501297_024037_207_659 150
896 3300049521 Ga0501298_032456 Ga0501298_032456_562_1014 150
897 3300049527 Ga0501311_014226 Ga0501311_014226_133_585 150
898 3300049528 Ga0501312_061312 Ga0501312_061312_183_635 150
899 3300049532 Ga0501316_038051 Ga0501316_038051_15_467 150
900 3300049537 Ga0501321_055582 Ga0501321_055582_104_556 150
901 3300049552 Ga0501336_007859 Ga0501336_007859_50_502 150
902 3300049649 Ga0501198_014327 Ga0501198_014327_50_502 150
903 3300049652 Ga0501202_006804 Ga0501202_006804_1244_1696 150
904 3300049652 Ga0501202_218305 Ga0501202_218305_19_471 150
905 3300049654 Ga0501207_033437 Ga0501207_033437_57_509 150
906 3300049659 Ga0501214_033838 Ga0501214_033838_171_623 150
907 3300049661 Ga0501217_001688 Ga0501217_001688_207_659 150
908 3300049661 Ga0501217_171747 Ga0501217_171747_160_612 150
909 3300049663 Ga0501223_006757 Ga0501223_006757_1343_1795 150
910 3300049664 Ga0501224_002475 Ga0501224_002475_167_619 150
911 3300049665 Ga0501227_006471 Ga0501227_006471_1860_2312 150
912 3300049668 Ga0501233_039001 Ga0501233_039001_448_900 150
913 3300049669 Ga0501235_001522 Ga0501235_001522_120_572 150
914 3300049676 Ga0501246_009917 Ga0501246_009917_173_625 150
915 3300049679 Ga0501249_108615 Ga0501249_108615_27_479 150
916 3300049680 Ga0501250_080830 Ga0501250_080830_54_506 150
917 3300049685 Ga0501256_009852 Ga0501256_009852_99_551 150
918 3300049689 Ga0501260_018696 Ga0501260_018696_148_600 150
919 3300049703 Ga0501219_006974 Ga0501219_006974_134_586 150
920 3300049704 Ga0501221_069436 Ga0501221_069436_331_783 150
921 3300049705 Ga0501225_0001628 Ga0501225_0001628_231_683 150
922 3300049707 Ga0501234_004052 Ga0501234_004052_1532_1984 150
923 3300049767 Ga0501270_102705 Ga0501270_102705_94_546 150
924 3300049853 Ga0501226_010581 Ga0501226_010581_291_743 150
925 3300050507 nmdc:mga05p37_273385_c1 nmdc:mga05p37_273385_c1_543_995 150
926 3300050511 nmdc:mga08y16_1346998_c1 nmdc:mga08y16_1346998_c1_186_638 150
927 3300050511 nmdc:mga08y16_3423_c1 nmdc:mga08y16_3423_c1_6058_6510 150
928 3300050512 nmdc:mga0n895_43244_c1 nmdc:mga0n895_43244_c1_602_1054 150
929 3300050515 nmdc:mga0a205_109324_c1 nmdc:mga0a205_109324_c1_1079_1531 150
930 3300050515 nmdc:mga0a205_47953_c1 nmdc:mga0a205_47953_c1_579_1031 150
931 3300050515 nmdc:mga0a205_8297_c1 nmdc:mga0a205_8297_c1_4629_5081 150
932 3300059477 Ga0587084_083359 Ga0587084_083359_20_472 150
933 3300059478 Ga0587093_054102 Ga0587093_054102_45_497 150
934 3300059490 Ga0587066_036361 Ga0587066_036361_140_592 150
935 3300059491 Ga0587070_025959 Ga0587070_025959_46_498 150
936 3300059492 Ga0587073_0166255 Ga0587073_0166255_139_591 150
937 3300059493 Ga0587077_103973 Ga0587077_103973_223_675 150
938 3300059493 Ga0587077_121442 Ga0587077_121442_141_593 150
939 3300059504 Ga0587082_107384 Ga0587082_107384_79_531 150
940 3300059506 Ga0587085_081748 Ga0587085_081748_183_635 150
941 3300059507 Ga0587086_027433 Ga0587086_027433_17_469 150
942 3300059509 Ga0587089_057413 Ga0587089_057413_140_592 150
943 3300059510 Ga0587090_027309 Ga0587090_027309_468_920 150
944 3300059510 Ga0587090_060831 Ga0587090_060831_120_572 150
945 3300059510 Ga0587090_152475 Ga0587090_152475_52_504 150
946 3300059511 Ga0587091_103385 Ga0587091_103385_20_472 150
947 3300059512 Ga0587092_012250 Ga0587092_012250_99_551 150
948 3300059604 Ga0587098_093001 Ga0587098_093001_52_504 150
949 3300059605 Ga0587106_027033 Ga0587106_027033_315_767 150
950 3300059605 Ga0587106_148539 Ga0587106_148539_47_499 150
951 3300059623 Ga0587101_142642 Ga0587101_142642_25_477 150
952 3300059624 Ga0587109_129831 Ga0587109_129831_32_484 150
953 3300059627 Ga0587117_032576 Ga0587117_032576_321_773 150
954 3300059630 Ga0587128_135202 Ga0587128_135202_58_510 150
955 3300059639 Ga0587062_059017 Ga0587062_059017_16_468 150
956 3300059639 Ga0587062_087577 Ga0587062_087577_46_498 150
957 3300059640 Ga0587067_101685 Ga0587067_101685_204_656 150
958 3300059641 Ga0587068_073238 Ga0587068_073238_115_567 150
959 3300059643 Ga0587072_082714 Ga0587072_082714_84_536 150
960 3300059644 Ga0587075_149732 Ga0587075_149732_31_483 150
961 3300059648 Ga0587100_012657 Ga0587100_012657_204_656 150
962 3300059652 Ga0587107_033685 Ga0587107_033685_22_474 150
963 3300059660 Ga0587124_009956 Ga0587124_009956_379_831 150
964 3300060344 Ga0587071_046129 Ga0587071_046129_369_821 150
965 3300060344 Ga0587071_049969 Ga0587071_049969_343_795 150
966 3300060346 Ga0587111_0070334 Ga0587111_0070334_215_667 150
967 3300001426 JGI24030J14995_100090 JGI24030J14995_1000905 151
968 3300001432 JGI24034J14986_100111 JGI24034J14986_1001118 151
969 3300002074 JGI24748J21848_1000002 JGI24748J21848_10000027 151
970 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004365 151
971 3300005290 Ga0065712_10067728 Ga0065712_10067728104 151
972 3300005290 Ga0065712_10632539 Ga0065712_106325391 151
973 3300005293 Ga0065715_10189677 Ga0065715_101896771 151
974 3300005295 Ga0065707_10562132 Ga0065707_105621321 151
975 3300005330 Ga0070690_100082134 Ga0070690_1000821343 151
976 3300005330 Ga0070690_100251554 Ga0070690_1002515543 151
977 3300005331 Ga0070670_100345033 Ga0070670_1003450332 151
978 3300005334 Ga0068869_100091051 Ga0068869_1000910512 151
979 3300005334 Ga0068869_100100721 Ga0068869_1001007213 151
980 3300005336 Ga0070680_100114808 Ga0070680_1001148082 151
981 3300005336 Ga0070680_100786614 Ga0070680_1007866141 151
982 3300005337 Ga0070682_100004665 Ga0070682_1000046654 151
983 3300005338 Ga0068868_100471816 Ga0068868_1004718161 151
984 3300005339 Ga0070660_100234739 Ga0070660_1002347392 151
985 3300005340 Ga0070689_100005909 Ga0070689_1000059091 151
986 3300005341 Ga0070691_10297087 Ga0070691_102970871 151
987 3300005341 Ga0070691_10643157 Ga0070691_106431571 151
988 3300005343 Ga0070687_100032186 Ga0070687_1000321863 151
989 3300005343 Ga0070687_100248643 Ga0070687_1002486431 151
990 3300005343 Ga0070687_100450842 Ga0070687_1004508422 151
991 3300005345 Ga0070692_10224172 Ga0070692_102241722 151
992 3300005345 Ga0070692_10519847 Ga0070692_105198471 151
993 3300005353 Ga0070669_100010968 Ga0070669_1000109682 151
994 3300005354 Ga0070675_100160173 Ga0070675_1001601732 151
995 3300005356 Ga0070674_101311476 Ga0070674_1013114761 151
996 3300005364 Ga0070673_100021596 Ga0070673_1000215967 151
997 3300005364 Ga0070673_101293892 Ga0070673_1012938922 151
998 3300005364 Ga0070673_101352122 Ga0070673_1013521221 151
999 3300005364 Ga0070673_101732248 Ga0070673_1017322481 151
1000 3300005366 Ga0070659_100254240 Ga0070659_1002542403 151
1001 3300005367 Ga0070667_101227983 Ga0070667_1012279831 151
1002 3300005406 Ga0070703_10016242 Ga0070703_100162423 151
1003 3300005434 Ga0070709_10964241 Ga0070709_109642412 151
1004 3300005437 Ga0070710_10538173 Ga0070710_105381732 151
1005 3300005438 Ga0070701_10126900 Ga0070701_101269002 151
1006 3300005438 Ga0070701_10139729 Ga0070701_101397292 151
1007 3300005438 Ga0070701_10174029 Ga0070701_101740293 151
1008 3300005440 Ga0070705_100007700 Ga0070705_1000077002 151
1009 3300005440 Ga0070705_100408288 Ga0070705_1004082881 151
1010 3300005440 Ga0070705_100768174 Ga0070705_1007681742 151
1011 3300005440 Ga0070705_101360083 Ga0070705_1013600831 151
1012 3300005441 Ga0070700_100052147 Ga0070700_1000521473 151
1013 3300005441 Ga0070700_100094620 Ga0070700_1000946202 151
1014 3300005441 Ga0070700_100242128 Ga0070700_1002421282 151
1015 3300005441 Ga0070700_100298186 Ga0070700_1002981862 151
1016 3300005444 Ga0070694_100070591 Ga0070694_1000705912 151
1017 3300005444 Ga0070694_100093724 Ga0070694_1000937241 151
1018 3300005444 Ga0070694_100269767 Ga0070694_1002697672 151
1019 3300005444 Ga0070694_100573966 Ga0070694_1005739662 151
1020 3300005444 Ga0070694_100749252 Ga0070694_1007492521 151
1021 3300005444 Ga0070694_101402326 Ga0070694_1014023261 151
1022 3300005445 Ga0070708_100118953 Ga0070708_1001189532 151
1023 3300005445 Ga0070708_100842177 Ga0070708_1008421772 151
1024 3300005445 Ga0070708_102226187 Ga0070708_1022261871 151
1025 3300005457 Ga0070662_100021274 Ga0070662_1000212743 151
1026 3300005459 Ga0068867_100058827 Ga0068867_1000588273 151
1027 3300005459 Ga0068867_100134785 Ga0068867_1001347853 151
1028 3300005459 Ga0068867_100174768 Ga0068867_1001747681 151
1029 3300005467 Ga0070706_100134104 Ga0070706_1001341043 151
1030 3300005467 Ga0070706_100492659 Ga0070706_1004926591 151
1031 3300005467 Ga0070706_102007442 Ga0070706_1020074421 151
1032 3300005468 Ga0070707_100149440 Ga0070707_1001494403 151
1033 3300005468 Ga0070707_100432607 Ga0070707_1004326071 151
1034 3300005468 Ga0070707_100453731 Ga0070707_1004537311 151
1035 3300005471 Ga0070698_100004560 Ga0070698_10000456017 151
1036 3300005471 Ga0070698_100043199 Ga0070698_1000431995 151
1037 3300005471 Ga0070698_100355978 Ga0070698_1003559781 151
1038 3300005471 Ga0070698_100510250 Ga0070698_1005102501 151
1039 3300005471 Ga0070698_100930291 Ga0070698_1009302911 151
1040 3300005471 Ga0070698_101570771 Ga0070698_1015707711 151
1041 3300005518 Ga0070699_100053005 Ga0070699_1000530054 151
1042 3300005518 Ga0070699_100206549 Ga0070699_1002065491 151
1043 3300005518 Ga0070699_100390850 Ga0070699_1003908502 151
1044 3300005518 Ga0070699_100601479 Ga0070699_1006014792 151
1045 3300005536 Ga0070697_100021785 Ga0070697_1000217855 151
1046 3300005536 Ga0070697_100076841 Ga0070697_1000768413 151
1047 3300005536 Ga0070697_100106844 Ga0070697_1001068443 151
1048 3300005536 Ga0070697_100134497 Ga0070697_1001344971 151
1049 3300005536 Ga0070697_100918364 Ga0070697_1009183641 151
1050 3300005539 Ga0068853_101528034 Ga0068853_1015280342 151
1051 3300005544 Ga0070686_100315019 Ga0070686_1003150191 151
1052 3300005545 Ga0070695_100051632 Ga0070695_1000516322 151
1053 3300005545 Ga0070695_100057801 Ga0070695_1000578013 151
1054 3300005545 Ga0070695_100225006 Ga0070695_1002250062 151
1055 3300005545 Ga0070695_100529437 Ga0070695_1005294372 151
1056 3300005545 Ga0070695_101201775 Ga0070695_1012017752 151
1057 3300005546 Ga0070696_100162444 Ga0070696_1001624442 151
1058 3300005546 Ga0070696_100288660 Ga0070696_1002886602 151
1059 3300005546 Ga0070696_100398146 Ga0070696_1003981461 151
1060 3300005546 Ga0070696_100681092 Ga0070696_1006810922 151
1061 3300005547 Ga0070693_100003628 Ga0070693_1000036283 151
1062 3300005547 Ga0070693_100364454 Ga0070693_1003644541 151
1063 3300005549 Ga0070704_100083694 Ga0070704_1000836943 151
1064 3300005549 Ga0070704_100093388 Ga0070704_1000933884 151
1065 3300005549 Ga0070704_100382999 Ga0070704_1003829992 151
1066 3300005549 Ga0070704_100441416 Ga0070704_1004414163 151
1067 3300005549 Ga0070704_100649124 Ga0070704_1006491242 151
1068 3300005549 Ga0070704_101078396 Ga0070704_1010783962 151
1069 3300005563 Ga0068855_100687812 Ga0068855_1006878121 151
1070 3300005564 Ga0070664_100284158 Ga0070664_1002841582 151
1071 3300005564 Ga0070664_100426273 Ga0070664_1004262733 151
1072 3300005577 Ga0068857_100224525 Ga0068857_1002245252 151
1073 3300005577 Ga0068857_100457779 Ga0068857_1004577792 151
1074 3300005578 Ga0068854_100152959 Ga0068854_1001529593 151
1075 3300005578 Ga0068854_100270777 Ga0068854_1002707771 151
1076 3300005578 Ga0068854_100810642 Ga0068854_1008106421 151
1077 3300005578 Ga0068854_101043847 Ga0068854_1010438471 151
1078 3300005614 Ga0068856_100342321 Ga0068856_1003423212 151
1079 3300005615 Ga0070702_100020864 Ga0070702_1000208643 151
1080 3300005615 Ga0070702_100056578 Ga0070702_1000565783 151
1081 3300005615 Ga0070702_100581226 Ga0070702_1005812261 151
1082 3300005615 Ga0070702_100707420 Ga0070702_1007074201 151
1083 3300005616 Ga0068852_100381526 Ga0068852_1003815262 151
1084 3300005617 Ga0068859_100017683 Ga0068859_1000176833 151
1085 3300005617 Ga0068859_100046105 Ga0068859_1000461053 151
1086 3300005617 Ga0068859_100271701 Ga0068859_1002717013 151
1087 3300005617 Ga0068859_101672418 Ga0068859_1016724182 151
1088 3300005617 Ga0068859_102682789 Ga0068859_1026827891 151
1089 3300005618 Ga0068864_100077424 Ga0068864_1000774244 151
1090 3300005618 Ga0068864_100456504 Ga0068864_1004565042 151
1091 3300005618 Ga0068864_100653987 Ga0068864_1006539871 151
1092 3300005618 Ga0068864_100968402 Ga0068864_1009684021 151
1093 3300005618 Ga0068864_101485406 Ga0068864_1014854062 151
1094 3300005718 Ga0068866_10000684 Ga0068866_1000068423 151
1095 3300005719 Ga0068861_100166917 Ga0068861_1001669173 151
1096 3300005719 Ga0068861_100354324 Ga0068861_1003543242 151
1097 3300005834 Ga0068851_10016680 Ga0068851_100166801 151
1098 3300005840 Ga0068870_10224937 Ga0068870_102249372 151
1099 3300005840 Ga0068870_10507968 Ga0068870_105079682 151
1100 3300005841 Ga0068863_100377275 Ga0068863_1003772751 151
1101 3300005841 Ga0068863_100547436 Ga0068863_1005474362 151
1102 3300005842 Ga0068858_100002375 Ga0068858_10000237518 151
1103 3300005842 Ga0068858_100081988 Ga0068858_1000819881 151
1104 3300005842 Ga0068858_102276598 Ga0068858_1022765981 151
1105 3300005843 Ga0068860_100059819 Ga0068860_1000598193 151
1106 3300005843 Ga0068860_100226405 Ga0068860_1002264053 151
1107 3300005843 Ga0068860_100445817 Ga0068860_1004458172 151
1108 3300005843 Ga0068860_101059515 Ga0068860_1010595151 151
1109 3300005844 Ga0068862_100040680 Ga0068862_1000406807 151
1110 3300005844 Ga0068862_100057688 Ga0068862_1000576883 151
1111 3300005937 Ga0081455_10636649 Ga0081455_106366492 151
1112 3300005985 Ga0081539_10106045 Ga0081539_101060451 151
1113 3300005985 Ga0081539_10131462 Ga0081539_101314621 151
1114 3300006163 Ga0070715_10140135 Ga0070715_101401351 151
1115 3300006173 Ga0070716_100164111 Ga0070716_1001641113 151
1116 3300006173 Ga0070716_100290404 Ga0070716_1002904042 151
1117 3300006237 Ga0097621_100010123 Ga0097621_1000101234 151
1118 3300006358 Ga0068871_100210249 Ga0068871_1002102492 151
1119 3300006844 Ga0075428_100459402 Ga0075428_1004594022 151
1120 3300006844 Ga0075428_101286257 Ga0075428_1012862571 151
1121 3300006846 Ga0075430_100144913 Ga0075430_1001449132 151
1122 3300006847 Ga0075431_100004485 Ga0075431_10000448515 151
1123 3300006852 Ga0075433_10385822 Ga0075433_103858222 151
1124 3300006871 Ga0075434_100040176 Ga0075434_1000401764 151
1125 3300006871 Ga0075434_100668646 Ga0075434_1006686463 151
1126 3300006871 Ga0075434_101080720 Ga0075434_1010807202 151
1127 3300006871 Ga0075434_101493807 Ga0075434_1014938072 151
1128 3300006880 Ga0075429_100864370 Ga0075429_1008643701 151
1129 3300006880 Ga0075429_101895462 Ga0075429_1018954621 151
1130 3300006881 Ga0068865_100396346 Ga0068865_1003963461 151
1131 3300006881 Ga0068865_100671039 Ga0068865_1006710391 151
1132 3300006914 Ga0075436_100000015 Ga0075436_1000000152 151
1133 3300006914 Ga0075436_100013759 Ga0075436_1000137596 151
1134 3300006931 Ga0097620_100017683 Ga0097620_1000176833 151
1135 3300006931 Ga0097620_100046105 Ga0097620_1000461054 151
1136 3300006931 Ga0097620_100271678 Ga0097620_1002716783 151
1137 3300006931 Ga0097620_101673160 Ga0097620_1016731602 151
1138 3300006931 Ga0097620_102682474 Ga0097620_1026824741 151
1139 3300007076 Ga0075435_100483478 Ga0075435_1004834782 151
1140 3300009093 Ga0105240_10023866 Ga0105240_100238667 151
1141 3300009094 Ga0111539_10029571 Ga0111539_100295716 151
1142 3300009094 Ga0111539_10107148 Ga0111539_101071484 151
1143 3300009094 Ga0111539_11362722 Ga0111539_113627222 151
1144 3300009094 Ga0111539_12169441 Ga0111539_121694411 151
1145 3300009098 Ga0105245_10191604 Ga0105245_101916042 151
1146 3300009101 Ga0105247_10000005 Ga0105247_10000005355 151
1147 3300009147 Ga0114129_10019427 Ga0114129_1001942713 151
1148 3300009147 Ga0114129_10108251 Ga0114129_101082513 151
1149 3300009147 Ga0114129_10341075 Ga0114129_103410752 151
1150 3300009147 Ga0114129_12521563 Ga0114129_125215631 151
1151 3300009148 Ga0105243_10019054 Ga0105243_100190546 151
1152 3300009148 Ga0105243_10246528 Ga0105243_102465283 151
1153 3300009148 Ga0105243_10787831 Ga0105243_107878311 151
1154 3300009174 Ga0105241_10107226 Ga0105241_101072262 151
1155 3300009174 Ga0105241_11734091 Ga0105241_117340911 151
1156 3300009176 Ga0105242_10088295 Ga0105242_100882952 151
1157 3300009176 Ga0105242_10130667 Ga0105242_101306673 151
1158 3300009176 Ga0105242_10454891 Ga0105242_104548912 151
1159 3300009545 Ga0105237_10035040 Ga0105237_100350402 151
1160 3300009553 Ga0105249_10260824 Ga0105249_102608241 151
1161 3300010159 Ga0099796_10025723 Ga0099796_100257233 151
1162 3300010375 Ga0105239_11648093 Ga0105239_116480931 151
1163 3300010375 Ga0105239_12143442 Ga0105239_121434421 151
1164 3300011119 Ga0105246_10224743 Ga0105246_102247433 151
1165 3300013102 Ga0157371_10266907 Ga0157371_102669072 151
1166 3300013296 Ga0157374_10428206 Ga0157374_104282061 151
1167 3300013297 Ga0157378_10000067 Ga0157378_100000673 151
1168 3300013297 Ga0157378_10012876 Ga0157378_100128768 151
1169 3300013297 Ga0157378_10033270 Ga0157378_100332705 151
1170 3300013297 Ga0157378_10052148 Ga0157378_100521482 151
1171 3300013297 Ga0157378_10373867 Ga0157378_103738672 151
1172 3300013297 Ga0157378_10695891 Ga0157378_106958912 151
1173 3300013297 Ga0157378_11583504 Ga0157378_115835041 151
1174 3300013306 Ga0163162_10052139 Ga0163162_100521392 151
1175 3300013306 Ga0163162_10225733 Ga0163162_102257332 151
1176 3300013306 Ga0163162_10801311 Ga0163162_108013112 151
1177 3300013308 Ga0157375_10010135 Ga0157375_100101358 151
1178 3300013308 Ga0157375_10285952 Ga0157375_102859522 151
1179 3300013308 Ga0157375_10426331 Ga0157375_104263311 151
1180 3300013308 Ga0157375_12408685 Ga0157375_124086851 151
1181 3300014325 Ga0163163_10181085 Ga0163163_101810852 151
1182 3300014325 Ga0163163_10536157 Ga0163163_105361571 151
1183 3300014326 Ga0157380_10008575 Ga0157380_1000857511 151
1184 3300014326 Ga0157380_10262707 Ga0157380_102627072 151
1185 3300014326 Ga0157380_10285385 Ga0157380_102853852 151
1186 3300014326 Ga0157380_10459267 Ga0157380_104592672 151
1187 3300014969 Ga0157376_10420225 Ga0157376_104202253 151
1188 3300020078 Ga0206352_10617335 Ga0206352_106173351 151
1189 3300025223 Ga0207672_1000403 Ga0207672_10004037 151
1190 3300025321 Ga0207656_10000878 Ga0207656_100008781 151
1191 3300025711 Ga0207696_1110904 Ga0207696_11109041 151
1192 3300025735 Ga0207713_1080075 Ga0207713_10800751 151
1193 3300025885 Ga0207653_10002754 Ga0207653_100027543 151
1194 3300025893 Ga0207682_10072608 Ga0207682_100726082 151
1195 3300025898 Ga0207692_10343151 Ga0207692_103431511 151
1196 3300025899 Ga0207642_10006933 Ga0207642_100069332 151
1197 3300025900 Ga0207710_10000004 Ga0207710_10000004353 151
1198 3300025901 Ga0207688_10345918 Ga0207688_103459182 151
1199 3300025901 Ga0207688_10450943 Ga0207688_104509431 151
1200 3300025906 Ga0207699_10093594 Ga0207699_100935945 151
1201 3300025906 Ga0207699_10905888 Ga0207699_109058881 151
1202 3300025907 Ga0207645_10113596 Ga0207645_101135962 151
1203 3300025907 Ga0207645_10253700 Ga0207645_102537001 151
1204 3300025910 Ga0207684_10057428 Ga0207684_100574285 151
1205 3300025910 Ga0207684_10098332 Ga0207684_100983327 151
1206 3300025912 Ga0207707_11029920 Ga0207707_110299201 151
1207 3300025913 Ga0207695_10290339 Ga0207695_102903393 151
1208 3300025917 Ga0207660_10052536 Ga0207660_100525364 151
1209 3300025917 Ga0207660_10452968 Ga0207660_104529682 151
1210 3300025918 Ga0207662_10219743 Ga0207662_102197431 151
1211 3300025918 Ga0207662_10253008 Ga0207662_102530082 151
1212 3300025918 Ga0207662_10656776 Ga0207662_106567762 151
1213 3300025919 Ga0207657_10446216 Ga0207657_104462161 151
1214 3300025922 Ga0207646_10010058 Ga0207646_100100588 151
1215 3300025922 Ga0207646_10011116 Ga0207646_100111165 151
1216 3300025922 Ga0207646_10029852 Ga0207646_100298526 151
1217 3300025922 Ga0207646_10129683 Ga0207646_101296833 151
1218 3300025922 Ga0207646_11273842 Ga0207646_112738421 151
1219 3300025922 Ga0207646_11547076 Ga0207646_115470761 151
1220 3300025923 Ga0207681_10152572 Ga0207681_101525721 151
1221 3300025923 Ga0207681_10296731 Ga0207681_102967313 151
1222 3300025925 Ga0207650_10058798 Ga0207650_100587982 151
1223 3300025925 Ga0207650_10061701 Ga0207650_100617013 151
1224 3300025925 Ga0207650_11185431 Ga0207650_111854312 151
1225 3300025926 Ga0207659_10109170 Ga0207659_101091703 151
1226 3300025931 Ga0207644_10003135 Ga0207644_1000313510 151
1227 3300025932 Ga0207690_10295524 Ga0207690_102955243 151
1228 3300025933 Ga0207706_10420423 Ga0207706_104204232 151
1229 3300025933 Ga0207706_10889544 Ga0207706_108895442 151
1230 3300025934 Ga0207686_10055449 Ga0207686_100554492 151
1231 3300025934 Ga0207686_10172693 Ga0207686_101726932 151
1232 3300025934 Ga0207686_10336230 Ga0207686_103362302 151
1233 3300025934 Ga0207686_10970124 Ga0207686_109701241 151
1234 3300025935 Ga0207709_10006883 Ga0207709_100068835 151
1235 3300025935 Ga0207709_10012133 Ga0207709_100121333 151
1236 3300025935 Ga0207709_10348055 Ga0207709_103480552 151
1237 3300025936 Ga0207670_10004178 Ga0207670_100041789 151
1238 3300025938 Ga0207704_10987531 Ga0207704_109875312 151
1239 3300025939 Ga0207665_10044010 Ga0207665_100440101 151
1240 3300025939 Ga0207665_10075933 Ga0207665_100759334 151
1241 3300025939 Ga0207665_10296770 Ga0207665_102967702 151
1242 3300025939 Ga0207665_10675538 Ga0207665_106755382 151
1243 3300025942 Ga0207689_10089386 Ga0207689_100893864 151
1244 3300025942 Ga0207689_10138079 Ga0207689_101380793 151
1245 3300025945 Ga0207679_10088992 Ga0207679_100889921 151
1246 3300025945 Ga0207679_10988629 Ga0207679_109886291 151
1247 3300025949 Ga0207667_10239504 Ga0207667_102395043 151
1248 3300025960 Ga0207651_10307270 Ga0207651_103072703 151
1249 3300025960 Ga0207651_11172523 Ga0207651_111725231 151
1250 3300025960 Ga0207651_11374073 Ga0207651_113740731 151
1251 3300025961 Ga0207712_10167843 Ga0207712_101678433 151
1252 3300025961 Ga0207712_10787223 Ga0207712_107872232 151
1253 3300025961 Ga0207712_12076311 Ga0207712_120763111 151
1254 3300025981 Ga0207640_10385266 Ga0207640_103852662 151
1255 3300025981 Ga0207640_10746159 Ga0207640_107461592 151
1256 3300026023 Ga0207677_10168987 Ga0207677_101689873 151
1257 3300026035 Ga0207703_10000589 Ga0207703_1000058935 151
1258 3300026035 Ga0207703_10097689 Ga0207703_100976892 151
1259 3300026075 Ga0207708_10146529 Ga0207708_101465292 151
1260 3300026088 Ga0207641_10012708 Ga0207641_100127089 151
1261 3300026088 Ga0207641_10550144 Ga0207641_105501442 151
1262 3300026088 Ga0207641_11369446 Ga0207641_113694461 151
1263 3300026088 Ga0207641_11667011 Ga0207641_116670112 151
1264 3300026089 Ga0207648_10033880 Ga0207648_100338804 151
1265 3300026089 Ga0207648_10168113 Ga0207648_101681132 151
1266 3300026089 Ga0207648_10394973 Ga0207648_103949731 151
1267 3300026095 Ga0207676_10059723 Ga0207676_100597233 151
1268 3300026095 Ga0207676_10375883 Ga0207676_103758833 151
1269 3300026116 Ga0207674_11550029 Ga0207674_115500291 151
1270 3300026118 Ga0207675_100039486 Ga0207675_1000394863 151
1271 3300026118 Ga0207675_100274133 Ga0207675_1002741333 151
1272 3300026118 Ga0207675_101615430 Ga0207675_1016154301 151
1273 3300026142 Ga0207698_10453615 Ga0207698_104536151 151
1274 3300027907 Ga0207428_10677873 Ga0207428_106778731 151
1275 3300027907 Ga0207428_10736086 Ga0207428_107360861 151
1276 3300028380 Ga0268265_10034700 Ga0268265_100347001 151
1277 3300028380 Ga0268265_10352928 Ga0268265_103529283 151
1278 3300028380 Ga0268265_11825074 Ga0268265_118250741 151
1279 3300028381 Ga0268264_10902994 Ga0268264_109029941 151
1280 3300028381 Ga0268264_11131013 Ga0268264_111310132 151
1281 3300028381 Ga0268264_11277474 Ga0268264_112774742 151
1282 3300028381 Ga0268264_12441711 Ga0268264_124417111 151
1283 3300031548 Ga0307408_100714237 Ga0307408_1007142372 151
1284 3300031731 Ga0307405_10542975 Ga0307405_105429752 151
1285 3300032004 Ga0307414_10849045 Ga0307414_108490451 151
1286 3300032004 Ga0307414_11596361 Ga0307414_115963611 151
1287 3300035091 Ga0373951_0000993 Ga0373951_0000993_960_1415 151
1288 3300038698 Ga0242419_004777 Ga0242419_004777_289_744 151
1289 3300041999 Ga0439433_0103506 Ga0439433_0103506_172_627 151
1290 3300042008 Ga0439450_110915 Ga0439450_110915_169_624 151
1291 3300044673 Ga0453683_0267752 Ga0453683_0267752_585_1040 151
1292 3300048903 Ga0496100_0506796 Ga0496100_0506796_29_484 151
1293 3300048904 Ga0496101_0600903 Ga0496101_0600903_126_581 151
1294 3300048905 Ga0496102_0596375 Ga0496102_0596375_484_939 151
1295 3300048909 Ga0496106_0011284 Ga0496106_0011284_973_1428 151
1296 3300048910 Ga0496107_0327116 Ga0496107_0327116_507_962 151
1297 3300048911 Ga0496108_1272203 Ga0496108_1272203_130_585 151
1298 3300048916 Ga0496113_0079114 Ga0496113_0079114_307_762 151
1299 3300049127 Ga0501306_040718 Ga0501306_040718_192_647 151
1300 3300049128 Ga0501308_045953 Ga0501308_045953_151_606 151
1301 3300049128 Ga0501308_058322 Ga0501308_058322_49_504 151
1302 3300049129 Ga0501309_026702 Ga0501309_026702_363_818 151
1303 3300049130 Ga0501310_048314 Ga0501310_048314_19_474 151
1304 3300049160 Ga0501304_018785 Ga0501304_018785_185_640 151
1305 3300049161 Ga0501305_053400 Ga0501305_053400_33_488 151
1306 3300049514 Ga0501291_087566 Ga0501291_087566_158_613 151
1307 3300049515 Ga0501292_074768 Ga0501292_074768_111_566 151
1308 3300049518 Ga0501295_055282 Ga0501295_055282_123_578 151
1309 3300049521 Ga0501298_087216 Ga0501298_087216_226_681 151
1310 3300049533 Ga0501317_083258 Ga0501317_083258_79_534 151
1311 3300049650 Ga0501199_034519 Ga0501199_034519_16_471 151
1312 3300049653 Ga0501206_075402 Ga0501206_075402_59_514 151
1313 3300049660 Ga0501216_004483 Ga0501216_004483_582_1037 151
1314 3300049661 Ga0501217_018391 Ga0501217_018391_1013_1468 151
1315 3300049664 Ga0501224_029439 Ga0501224_029439_197_652 151
1316 3300049665 Ga0501227_023203 Ga0501227_023203_264_719 151
1317 3300049665 Ga0501227_115432 Ga0501227_115432_53_508 151
1318 3300049667 Ga0501230_004322 Ga0501230_004322_1351_1806 151
1319 3300049669 Ga0501235_019237 Ga0501235_019237_818_1273 151
1320 3300049671 Ga0501238_036710 Ga0501238_036710_122_577 151
1321 3300049672 Ga0501239_004726 Ga0501239_004726_882_1337 151
1322 3300049672 Ga0501239_041565 Ga0501239_041565_49_504 151
1323 3300049680 Ga0501250_002177 Ga0501250_002177_424_879 151
1324 3300049686 Ga0501257_012072 Ga0501257_012072_171_626 151
1325 3300049689 Ga0501260_018938 Ga0501260_018938_158_613 151
1326 3300049704 Ga0501221_004593 Ga0501221_004593_126_581 151
1327 3300049705 Ga0501225_0079146 Ga0501225_0079146_352_807 151
1328 3300049705 Ga0501225_0117326 Ga0501225_0117326_171_626 151
1329 3300049708 Ga0501245_034195 Ga0501245_034195_69_524 151
1330 3300049759 Ga0501262_077419 Ga0501262_077419_48_503 151
1331 3300049764 Ga0501267_028592 Ga0501267_028592_27_482 151
1332 3300049773 Ga0501276_024520 Ga0501276_024520_40_495 151
1333 3300049775 Ga0501279_024795 Ga0501279_024795_350_805 151
1334 3300049851 Ga0501212_034973 Ga0501212_034973_159_614 151
1335 3300050507 nmdc:mga05p37_1035569_c1 nmdc:mga05p37_1035569_c1_37_492 151
1336 3300050507 nmdc:mga05p37_136331_c2 nmdc:mga05p37_136331_c2_143_598 151
1337 3300050507 nmdc:mga05p37_14945_c1 nmdc:mga05p37_14945_c1_277_732 151
1338 3300050507 nmdc:mga05p37_456412_c1 nmdc:mga05p37_456412_c1_965_1420 151
1339 3300050508 nmdc:mga09592_198902_c1 nmdc:mga09592_198902_c1_1054_1509 151
1340 3300050508 nmdc:mga09592_281705_c1 nmdc:mga09592_281705_c1_129_584 151
1341 3300050509 nmdc:mga0qj67_145881_c1 nmdc:mga0qj67_145881_c1_824_1279 151
1342 3300050510 nmdc:mga06r32_736506_c1 nmdc:mga06r32_736506_c1_252_707 151
1343 3300050511 nmdc:mga08y16_135276_c1 nmdc:mga08y16_135276_c1_917_1372 151
1344 3300050511 nmdc:mga08y16_466215_c1 nmdc:mga08y16_466215_c1_154_609 151
1345 3300050511 nmdc:mga08y16_63647_c1 nmdc:mga08y16_63647_c1_1228_1683 151
1346 3300050512 nmdc:mga0n895_597590_c1 nmdc:mga0n895_597590_c1_637_1092 151
1347 3300050512 nmdc:mga0n895_87209_c1 nmdc:mga0n895_87209_c1_2306_2761 151
1348 3300050515 nmdc:mga0a205_10797_c1 nmdc:mga0a205_10797_c1_6361_6816 151
1349 3300050515 nmdc:mga0a205_209373_c1 nmdc:mga0a205_209373_c1_1294_1749 151
1350 3300059491 Ga0587070_107990 Ga0587070_107990_177_632 151
1351 3300059491 Ga0587070_217181 Ga0587070_217181_29_484 151
1352 3300059492 Ga0587073_0115243 Ga0587073_0115243_81_536 151
1353 3300059503 Ga0587080_079553 Ga0587080_079553_46_504 151
1354 3300059504 Ga0587082_107150 Ga0587082_107150_21_476 151
1355 3300059506 Ga0587085_084110 Ga0587085_084110_170_625 151
1356 3300059508 Ga0587088_051225 Ga0587088_051225_12_467 151
1357 3300059513 Ga0587094_050094 Ga0587094_050094_22_477 151
1358 3300059607 Ga0587125_043802 Ga0587125_043802_13_468 151
1359 3300059623 Ga0587101_033300 Ga0587101_033300_347_802 151
1360 3300059624 Ga0587109_055645 Ga0587109_055645_83_538 151
1361 3300059624 Ga0587109_108434 Ga0587109_108434_41_496 151
1362 3300059627 Ga0587117_102387 Ga0587117_102387_49_504 151
1363 3300059645 Ga0587076_088903 Ga0587076_088903_196_651 151
1364 3300059645 Ga0587076_124797 Ga0587076_124797_132_587 151
1365 3300059645 Ga0587076_152258 Ga0587076_152258_58_519 151
1366 3300059646 Ga0587078_035794 Ga0587078_035794_92_547 151
1367 3300059647 Ga0587079_052533 Ga0587079_052533_332_787 151
1368 3300059648 Ga0587100_039100 Ga0587100_039100_52_507 151
1369 3300059649 Ga0587102_065831 Ga0587102_065831_46_501 151
1370 3300061734 Ga0530510_0043032 Ga0530510_0043032_1772_2227 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

39

158

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.971 1 144
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9702 2 144
8fn2-assembly1.cif.gz_L the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9669 2 142
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9668 14 145
7asp-assembly1.cif.gz_H staphylococcus aureus 70s after 50 minutes incubation at 37c 0.9651 2 144
ID Description Score Start End Superfamily
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9708 14 148 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9654 1 144 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9622 14 151 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9587 1 144 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9488 14 151 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A7J6ZN07-F1-model_v4 deleted 0.9942 14 143
AF-A0A2H5VM49-F1-model_v4 Large ribosomal subunit protein uL13 0.9873 1 144 GO:0003729
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0017148
GO:1990904
AF-G9XS70-F1-model_v4 Large ribosomal subunit protein uL13 0.9872 1 145 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A0N0TKS2-F1-model_v4 deleted 0.9869 1 145
AF-A0A7Y5LT23-F1-model_v4 Large ribosomal subunit protein uL13 0.9865 5 144 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Feature Viewer

pLDDT pTM Quality
89.68 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map