F493409
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1370 | 548 | 1349 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_100307401|Ga0307415_1003074013 |
| Length | 176 |
| Sequence | MPPPGPNSYRHEVRSFGPCIRSTGSLMKTFSPTPSDLHHDWHVVDAAGVPLGRLASHVAQLIRGKHKPTFAPHMDGGDFVIVINASQVKFTGRKLDQKTYFKHTGYMGHESHVAARDMLAKHPDRVIEKAVFGMLPKTSLARQDLRGKLKVYANAEHPHAAQQPKPYSVTSEKVKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 2 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 3 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 4 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 5 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 6 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 7 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 8 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 9 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 10 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 11 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 12 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 13 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 14 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 15 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 16 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 17 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 18 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 19 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 20 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 21 | 3300001426 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 | Metagenome | Rhizosphere |
| 22 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 25 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 26 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 36 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 40 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 41 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 45 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 116 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 117 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 118 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 119 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 251 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 257 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 259 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 262 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 264 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 265 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 268 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 294 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 295 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 296 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 297 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 298 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 299 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 300 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 301 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 302 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 303 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 309 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 311 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 312 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 313 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 314 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 315 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 316 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 317 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 318 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 319 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 320 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 321 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 322 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 323 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 324 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 325 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 326 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 327 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 328 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 371 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 372 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 373 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 374 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 375 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 376 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 377 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 378 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 388 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 389 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 390 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 391 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 392 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 393 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 394 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 432 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 433 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 434 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 435 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 436 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 437 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 438 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 439 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 440 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 441 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 442 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 443 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 444 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 446 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 447 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 448 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 449 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 450 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 451 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 452 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 453 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 454 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 455 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 456 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 457 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 458 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 459 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 460 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 461 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 462 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 463 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 464 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 465 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 466 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 467 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 468 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 469 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 470 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 475 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 476 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 477 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 478 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 479 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 480 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 481 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 482 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 483 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 484 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 487 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 488 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 489 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 490 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 491 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 492 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 503 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 504 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 505 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 506 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 547 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 548 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.74 |
| Metatranscriptomes | 10.73 |
| Isolates | 1.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.75 |
| Nodule | 0 |
| Rhizoplane | 2.19 |
| Rhizosphere | 92.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24030J14995_100090 | 3300001426 | Bacteria | 2060 |
| 2 | JGI24034J14986_100111 | 3300001432 | Bacteria | 3633 |
| 3 | JGI24737J22298_10099895 | 3300001990 | Unclassified | 860 |
| 4 | JGI24748J21848_1000002 | 3300002074 | Bacteria | 426946 |
| 5 | JGI24749J21850_1068974 | 3300002076 | Unclassified | 544 |
| 6 | JGI24034J26672_10000004 | 3300002239 | Bacteria | 426946 |
| 7 | JGI24751J29686_10000043 | 3300002459 | Bacteria | 78179 |
| 8 | Ga0006778J45830_1034592 | 3300003162 | Bacteria | 746 |
| 9 | JGI25406J46586_10066683 | 3300003203 | Bacteria | 1142 |
| 10 | JGI25406J46586_10119960 | 3300003203 | Bacteria | 774 |
| 11 | JGI25406J46586_10123520 | 3300003203 | Bacteria | 761 |
| 12 | rootL2_10056321 | 3300003322 | Bacteria | 1672 |
| 13 | Ga0007417J51691_1041585 | 3300003544 | Bacteria | 684 |
| 14 | Ga0007410J51695_1044966 | 3300003574 | Bacteria | 592 |
| 15 | Ga0007416J51690_1041750 | 3300003577 | Bacteria | 616 |
| 16 | Ga0007429J51699_1074031 | 3300003579 | Bacteria | 593 |
| 17 | Ga0006780_1026678 | 3300003735 | Bacteria | 531 |
| 18 | Ga0055532_1000266 | 3300003758 | Bacteria | 34080 |
| 19 | Ga0055536_1028902 | 3300003781 | Bacteria | 1500 |
| 20 | Ga0055541_1012017 | 3300003841 | Bacteria | 1252 |
| 21 | Ga0058861_11574531 | 3300004800 | Bacteria | 757 |
| 22 | Ga0058861_12052293 | 3300004800 | Bacteria | 2429 |
| 23 | Ga0058860_10119785 | 3300004801 | Unclassified | 623 |
| 24 | Ga0058862_10040385 | 3300004803 | Unclassified | 701 |
| 25 | Ga0058862_12335695 | 3300004803 | Bacteria | 764 |
| 26 | Ga0058862_12645996 | 3300004803 | Bacteria | 1998 |
| 27 | Ga0065714_10378440 | 3300005288 | Bacteria | 609 |
| 28 | Ga0065704_10006068 | 3300005289 | Bacteria | 5032 |
| 29 | Ga0065704_10319899 | 3300005289 | Bacteria | 854 |
| 30 | Ga0065712_10004680 | 3300005290 | Bacteria | 4164 |
| 31 | Ga0065712_10033824 | 3300005290 | Bacteria | 1975 |
| 32 | Ga0065712_10067728 | 3300005290 | Bacteria | 178215 |
| 33 | Ga0065712_10321286 | 3300005290 | Unclassified | 787 |
| 34 | Ga0065712_10632539 | 3300005290 | Unclassified | 540 |
| 35 | Ga0065715_10016269 | 3300005293 | Bacteria | 1922 |
| 36 | Ga0065715_10102020 | 3300005293 | Bacteria | 3151 |
| 37 | Ga0065715_10132100 | 3300005293 | Bacteria | 1996 |
| 38 | Ga0065715_10189677 | 3300005293 | Bacteria | 1423 |
| 39 | Ga0065715_10477965 | 3300005293 | Bacteria | 800 |
| 40 | Ga0065715_10497524 | 3300005293 | Unclassified | 782 |
| 41 | Ga0065707_10090144 | 3300005295 | Bacteria | 4201 |
| 42 | Ga0065707_10182165 | 3300005295 | Bacteria | 1412 |
| 43 | Ga0065707_10562132 | 3300005295 | Bacteria | 714 |
| 44 | Ga0065707_10748818 | 3300005295 | Bacteria | 616 |
| 45 | Ga0070683_100202291 | 3300005329 | Bacteria | 1886 |
| 46 | Ga0070690_100082134 | 3300005330 | Bacteria | 2109 |
| 47 | Ga0070690_100251554 | 3300005330 | Bacteria | 1250 |
| 48 | Ga0070690_100267179 | 3300005330 | Bacteria | 1215 |
| 49 | Ga0070690_100297906 | 3300005330 | Bacteria | 1155 |
| 50 | Ga0070690_101219369 | 3300005330 | Bacteria | 600 |
| 51 | Ga0070670_100058808 | 3300005331 | Bacteria | 3300 |
| 52 | Ga0070670_100092380 | 3300005331 | Bacteria | 2602 |
| 53 | Ga0070670_100345033 | 3300005331 | Bacteria | 1307 |
| 54 | Ga0070670_101852565 | 3300005331 | Unclassified | 555 |
| 55 | Ga0070677_10856470 | 3300005333 | Unclassified | 523 |
| 56 | Ga0068869_100042361 | 3300005334 | Bacteria | 3263 |
| 57 | Ga0068869_100091051 | 3300005334 | Bacteria | 2293 |
| 58 | Ga0068869_100100721 | 3300005334 | Bacteria | 2184 |
| 59 | Ga0068869_100327120 | 3300005334 | Bacteria | 1244 |
| 60 | Ga0068869_100391230 | 3300005334 | Bacteria | 1141 |
| 61 | Ga0070666_10042134 | 3300005335 | Bacteria | 3053 |
| 62 | Ga0070666_10275761 | 3300005335 | Bacteria | 1195 |
| 63 | Ga0070680_100007591 | 3300005336 | Bacteria | 8272 |
| 64 | Ga0070680_100034077 | 3300005336 | Bacteria | 4106 |
| 65 | Ga0070680_100114808 | 3300005336 | Bacteria | 2243 |
| 66 | Ga0070680_100422887 | 3300005336 | Bacteria | 1137 |
| 67 | Ga0070680_100786614 | 3300005336 | Bacteria | 820 |
| 68 | Ga0070680_100852988 | 3300005336 | Bacteria | 785 |
| 69 | Ga0070682_100004665 | 3300005337 | Bacteria | 7614 |
| 70 | Ga0070682_100139105 | 3300005337 | Bacteria | 1653 |
| 71 | Ga0070682_100178981 | 3300005337 | Unclassified | 1479 |
| 72 | Ga0070682_101055797 | 3300005337 | Bacteria | 677 |
| 73 | Ga0068868_100024305 | 3300005338 | Bacteria | 4596 |
| 74 | Ga0068868_100471816 | 3300005338 | Bacteria | 1095 |
| 75 | Ga0070660_100234739 | 3300005339 | Bacteria | 1493 |
| 76 | Ga0070689_100005909 | 3300005340 | Bacteria | 8416 |
| 77 | Ga0070689_100106631 | 3300005340 | Bacteria | 2223 |
| 78 | Ga0070689_100323954 | 3300005340 | Bacteria | 1287 |
| 79 | Ga0070689_100497215 | 3300005340 | Bacteria | 1044 |
| 80 | Ga0070691_10173166 | 3300005341 | Bacteria | 1119 |
| 81 | Ga0070691_10297087 | 3300005341 | Bacteria | 881 |
| 82 | Ga0070691_10643157 | 3300005341 | Bacteria | 631 |
| 83 | Ga0070687_100032186 | 3300005343 | Bacteria | 2578 |
| 84 | Ga0070687_100116595 | 3300005343 | Bacteria | 1520 |
| 85 | Ga0070687_100248643 | 3300005343 | Bacteria | 1103 |
| 86 | Ga0070687_100450842 | 3300005343 | Bacteria | 856 |
| 87 | Ga0070687_101078360 | 3300005343 | Bacteria | 586 |
| 88 | Ga0070661_100426703 | 3300005344 | Bacteria | 1052 |
| 89 | Ga0070692_10068274 | 3300005345 | Bacteria | 1888 |
| 90 | Ga0070692_10224172 | 3300005345 | Bacteria | 1113 |
| 91 | Ga0070692_10519847 | 3300005345 | Bacteria | 775 |
| 92 | Ga0070669_100010968 | 3300005353 | Bacteria | 6430 |
| 93 | Ga0070669_100227616 | 3300005353 | Bacteria | 1476 |
| 94 | Ga0070675_100094595 | 3300005354 | Bacteria | 2507 |
| 95 | Ga0070675_100160173 | 3300005354 | Bacteria | 1935 |
| 96 | Ga0070675_100253320 | 3300005354 | Bacteria | 1541 |
| 97 | Ga0070671_100006834 | 3300005355 | Bacteria | 9131 |
| 98 | Ga0070671_100414269 | 3300005355 | Bacteria | 1154 |
| 99 | Ga0070674_100595132 | 3300005356 | Bacteria | 934 |
| 100 | Ga0070674_101311476 | 3300005356 | Bacteria | 646 |
| 101 | Ga0070673_100021596 | 3300005364 | Bacteria | 4671 |
| 102 | Ga0070673_100039470 | 3300005364 | Bacteria | 3613 |
| 103 | Ga0070673_100060363 | 3300005364 | Bacteria | 3004 |
| 104 | Ga0070673_100145891 | 3300005364 | Bacteria | 2000 |
| 105 | Ga0070673_100363237 | 3300005364 | Bacteria | 1287 |
| 106 | Ga0070673_101293892 | 3300005364 | Bacteria | 685 |
| 107 | Ga0070673_101352122 | 3300005364 | Bacteria | 670 |
| 108 | Ga0070673_101732248 | 3300005364 | Bacteria | 591 |
| 109 | Ga0070688_100027695 | 3300005365 | Bacteria | 3376 |
| 110 | Ga0070659_100254240 | 3300005366 | Bacteria | 1457 |
| 111 | Ga0070667_100009924 | 3300005367 | Bacteria | 7893 |
| 112 | Ga0070667_101227983 | 3300005367 | Bacteria | 702 |
| 113 | Ga0070703_10016242 | 3300005406 | Bacteria | 2136 |
| 114 | Ga0070709_10964241 | 3300005434 | Bacteria | 677 |
| 115 | Ga0070709_11555215 | 3300005434 | Unclassified | 538 |
| 116 | Ga0070710_10538173 | 3300005437 | Unclassified | 805 |
| 117 | Ga0070701_10126900 | 3300005438 | Bacteria | 1445 |
| 118 | Ga0070701_10139729 | 3300005438 | Bacteria | 1384 |
| 119 | Ga0070701_10174029 | 3300005438 | Bacteria | 1255 |
| 120 | Ga0070701_10260659 | 3300005438 | Bacteria | 1051 |
| 121 | Ga0070701_10430622 | 3300005438 | Unclassified | 842 |
| 122 | Ga0070701_11077122 | 3300005438 | Unclassified | 564 |
| 123 | Ga0070705_100007700 | 3300005440 | Bacteria | 5314 |
| 124 | Ga0070705_100112461 | 3300005440 | Bacteria | 1742 |
| 125 | Ga0070705_100408288 | 3300005440 | Bacteria | 1008 |
| 126 | Ga0070705_100422749 | 3300005440 | Bacteria | 992 |
| 127 | Ga0070705_100768174 | 3300005440 | Bacteria | 764 |
| 128 | Ga0070705_101360083 | 3300005440 | Unclassified | 590 |
| 129 | Ga0070700_100000266 | 3300005441 | Bacteria | 27903 |
| 130 | Ga0070700_100014593 | 3300005441 | Bacteria | 4437 |
| 131 | Ga0070700_100052147 | 3300005441 | Bacteria | 2550 |
| 132 | Ga0070700_100094620 | 3300005441 | Bacteria | 1956 |
| 133 | Ga0070700_100185277 | 3300005441 | Bacteria | 1451 |
| 134 | Ga0070700_100242128 | 3300005441 | Bacteria | 1289 |
| 135 | Ga0070700_100282791 | 3300005441 | Bacteria | 1203 |
| 136 | Ga0070700_100298186 | 3300005441 | Bacteria | 1175 |
| 137 | Ga0070700_100321158 | 3300005441 | Bacteria | 1137 |
| 138 | Ga0070700_101799189 | 3300005441 | Unclassified | 528 |
| 139 | Ga0070700_102019979 | 3300005441 | Bacteria | 500 |
| 140 | Ga0070694_100048840 | 3300005444 | Bacteria | 2847 |
| 141 | Ga0070694_100070591 | 3300005444 | Bacteria | 2405 |
| 142 | Ga0070694_100089907 | 3300005444 | Bacteria | 2152 |
| 143 | Ga0070694_100093724 | 3300005444 | Bacteria | 2111 |
| 144 | Ga0070694_100147049 | 3300005444 | Bacteria | 1717 |
| 145 | Ga0070694_100152666 | 3300005444 | Bacteria | 1688 |
| 146 | Ga0070694_100269767 | 3300005444 | Bacteria | 1294 |
| 147 | Ga0070694_100374063 | 3300005444 | Unclassified | 1109 |
| 148 | Ga0070694_100482878 | 3300005444 | Unclassified | 983 |
| 149 | Ga0070694_100573966 | 3300005444 | Unclassified | 905 |
| 150 | Ga0070694_100749252 | 3300005444 | Bacteria | 797 |
| 151 | Ga0070694_101402326 | 3300005444 | Bacteria | 590 |
| 152 | Ga0070708_100118953 | 3300005445 | Bacteria | 2435 |
| 153 | Ga0070708_100842177 | 3300005445 | Unclassified | 862 |
| 154 | Ga0070708_101185113 | 3300005445 | Unclassified | 715 |
| 155 | Ga0070708_102226187 | 3300005445 | Bacteria | 506 |
| 156 | Ga0070678_100077740 | 3300005456 | Bacteria | 2504 |
| 157 | Ga0070678_100201921 | 3300005456 | Bacteria | 1641 |
| 158 | Ga0070678_101792635 | 3300005456 | Unclassified | 578 |
| 159 | Ga0070678_102141520 | 3300005456 | Bacteria | 530 |
| 160 | Ga0070662_100021274 | 3300005457 | Bacteria | 4428 |
| 161 | Ga0070662_100221238 | 3300005457 | Unclassified | 1511 |
| 162 | Ga0070681_10000425 | 3300005458 | Bacteria | 34351 |
| 163 | Ga0070681_10005227 | 3300005458 | Bacteria | 12536 |
| 164 | Ga0070681_10072317 | 3300005458 | Bacteria | 3411 |
| 165 | Ga0070681_10421388 | 3300005458 | Bacteria | 1247 |
| 166 | Ga0068867_100039248 | 3300005459 | Bacteria | 3451 |
| 167 | Ga0068867_100058827 | 3300005459 | Unclassified | 2848 |
| 168 | Ga0068867_100134785 | 3300005459 | Bacteria | 1923 |
| 169 | Ga0068867_100174768 | 3300005459 | Bacteria | 1703 |
| 170 | Ga0068867_101750460 | 3300005459 | Unclassified | 583 |
| 171 | Ga0070685_10008724 | 3300005466 | Bacteria | 5220 |
| 172 | Ga0070685_10992291 | 3300005466 | Bacteria | 629 |
| 173 | Ga0070706_100134104 | 3300005467 | Bacteria | 2312 |
| 174 | Ga0070706_100352364 | 3300005467 | Bacteria | 1372 |
| 175 | Ga0070706_100492659 | 3300005467 | Bacteria | 1140 |
| 176 | Ga0070706_102007442 | 3300005467 | Bacteria | 524 |
| 177 | Ga0070707_100149440 | 3300005468 | Bacteria | 2274 |
| 178 | Ga0070707_100395387 | 3300005468 | Bacteria | 1342 |
| 179 | Ga0070707_100432607 | 3300005468 | Bacteria | 1276 |
| 180 | Ga0070707_100453731 | 3300005468 | Bacteria | 1243 |
| 181 | Ga0070707_100817692 | 3300005468 | Bacteria | 896 |
| 182 | Ga0070698_100004560 | 3300005471 | Bacteria | 15214 |
| 183 | Ga0070698_100013809 | 3300005471 | Bacteria | 8544 |
| 184 | Ga0070698_100014111 | 3300005471 | Bacteria | 8448 |
| 185 | Ga0070698_100043199 | 3300005471 | Bacteria | 4622 |
| 186 | Ga0070698_100086453 | 3300005471 | Bacteria | 3122 |
| 187 | Ga0070698_100355978 | 3300005471 | Bacteria | 1395 |
| 188 | Ga0070698_100510250 | 3300005471 | Bacteria | 1140 |
| 189 | Ga0070698_100598680 | 3300005471 | Bacteria | 1043 |
| 190 | Ga0070698_100930291 | 3300005471 | Unclassified | 815 |
| 191 | Ga0070698_101570771 | 3300005471 | Unclassified | 610 |
| 192 | Ga0070699_100031118 | 3300005518 | Bacteria | 4609 |
| 193 | Ga0070699_100053005 | 3300005518 | Bacteria | 3511 |
| 194 | Ga0070699_100060955 | 3300005518 | Bacteria | 3270 |
| 195 | Ga0070699_100147720 | 3300005518 | Bacteria | 2077 |
| 196 | Ga0070699_100206549 | 3300005518 | Bacteria | 1748 |
| 197 | Ga0070699_100390850 | 3300005518 | Bacteria | 1257 |
| 198 | Ga0070699_100601479 | 3300005518 | Bacteria | 1003 |
| 199 | Ga0070679_100000308 | 3300005530 | Bacteria | 41614 |
| 200 | Ga0070679_100051054 | 3300005530 | Bacteria | 4119 |
| 201 | Ga0070684_100107878 | 3300005535 | Bacteria | 2494 |
| 202 | Ga0070697_100021785 | 3300005536 | Bacteria | 5080 |
| 203 | Ga0070697_100036520 | 3300005536 | Bacteria | 3970 |
| 204 | Ga0070697_100041573 | 3300005536 | Bacteria | 3721 |
| 205 | Ga0070697_100076841 | 3300005536 | Bacteria | 2746 |
| 206 | Ga0070697_100106844 | 3300005536 | Bacteria | 2329 |
| 207 | Ga0070697_100134497 | 3300005536 | Bacteria | 2075 |
| 208 | Ga0070697_100918364 | 3300005536 | Unclassified | 777 |
| 209 | Ga0068853_100021364 | 3300005539 | Bacteria | 5396 |
| 210 | Ga0068853_100380667 | 3300005539 | Bacteria | 1318 |
| 211 | Ga0068853_101528034 | 3300005539 | Unclassified | 646 |
| 212 | Ga0070672_100043818 | 3300005543 | Bacteria | 3453 |
| 213 | Ga0070686_100006820 | 3300005544 | Bacteria | 6358 |
| 214 | Ga0070686_100315019 | 3300005544 | Bacteria | 1165 |
| 215 | Ga0070686_101230031 | 3300005544 | Bacteria | 623 |
| 216 | Ga0070695_100051632 | 3300005545 | Bacteria | 2639 |
| 217 | Ga0070695_100057801 | 3300005545 | Bacteria | 2506 |
| 218 | Ga0070695_100192404 | 3300005545 | Bacteria | 1453 |
| 219 | Ga0070695_100225006 | 3300005545 | Bacteria | 1354 |
| 220 | Ga0070695_100230618 | 3300005545 | Bacteria | 1338 |
| 221 | Ga0070695_100323273 | 3300005545 | Bacteria | 1147 |
| 222 | Ga0070695_100350209 | 3300005545 | Bacteria | 1106 |
| 223 | Ga0070695_100389662 | 3300005545 | Bacteria | 1053 |
| 224 | Ga0070695_100393957 | 3300005545 | Bacteria | 1048 |
| 225 | Ga0070695_100529437 | 3300005545 | Bacteria | 916 |
| 226 | Ga0070695_101201775 | 3300005545 | Unclassified | 624 |
| 227 | Ga0070696_100006702 | 3300005546 | Bacteria | 7695 |
| 228 | Ga0070696_100162444 | 3300005546 | Bacteria | 1646 |
| 229 | Ga0070696_100288660 | 3300005546 | Bacteria | 1253 |
| 230 | Ga0070696_100398146 | 3300005546 | Bacteria | 1077 |
| 231 | Ga0070696_100492901 | 3300005546 | Bacteria | 973 |
| 232 | Ga0070696_100681092 | 3300005546 | Unclassified | 836 |
| 233 | Ga0070696_101565582 | 3300005546 | Bacteria | 565 |
| 234 | Ga0070696_101870732 | 3300005546 | Bacteria | 519 |
| 235 | Ga0070693_100003628 | 3300005547 | Bacteria | 7212 |
| 236 | Ga0070693_100009251 | 3300005547 | Bacteria | 4894 |
| 237 | Ga0070693_100345220 | 3300005547 | Bacteria | 1017 |
| 238 | Ga0070693_100364454 | 3300005547 | Bacteria | 992 |
| 239 | Ga0070704_100083694 | 3300005549 | Bacteria | 2356 |
| 240 | Ga0070704_100093388 | 3300005549 | Bacteria | 2248 |
| 241 | Ga0070704_100309990 | 3300005549 | Bacteria | 1318 |
| 242 | Ga0070704_100350304 | 3300005549 | Bacteria | 1246 |
| 243 | Ga0070704_100382999 | 3300005549 | Bacteria | 1195 |
| 244 | Ga0070704_100441416 | 3300005549 | Bacteria | 1119 |
| 245 | Ga0070704_100649124 | 3300005549 | Bacteria | 931 |
| 246 | Ga0070704_101078396 | 3300005549 | Unclassified | 729 |
| 247 | Ga0070704_101241523 | 3300005549 | Unclassified | 680 |
| 248 | Ga0068855_100687812 | 3300005563 | Bacteria | 1096 |
| 249 | Ga0070664_100027164 | 3300005564 | Bacteria | 4754 |
| 250 | Ga0070664_100284158 | 3300005564 | Bacteria | 1492 |
| 251 | Ga0070664_100426273 | 3300005564 | Bacteria | 1215 |
| 252 | Ga0070664_100594897 | 3300005564 | Bacteria | 1025 |
| 253 | Ga0070664_100648085 | 3300005564 | Unclassified | 981 |
| 254 | Ga0068857_100224525 | 3300005577 | Bacteria | 1716 |
| 255 | Ga0068857_100457779 | 3300005577 | Bacteria | 1193 |
| 256 | Ga0068854_100017037 | 3300005578 | Bacteria | 4856 |
| 257 | Ga0068854_100152959 | 3300005578 | Bacteria | 1780 |
| 258 | Ga0068854_100270777 | 3300005578 | Bacteria | 1363 |
| 259 | Ga0068854_100810642 | 3300005578 | Bacteria | 817 |
| 260 | Ga0068854_101043847 | 3300005578 | Unclassified | 726 |
| 261 | Ga0068856_100031217 | 3300005614 | Bacteria | 5212 |
| 262 | Ga0068856_100158720 | 3300005614 | Bacteria | 2272 |
| 263 | Ga0068856_100342321 | 3300005614 | Bacteria | 1514 |
| 264 | Ga0068856_100885858 | 3300005614 | Unclassified | 911 |
| 265 | Ga0070702_100020864 | 3300005615 | Bacteria | 3439 |
| 266 | Ga0070702_100022419 | 3300005615 | Bacteria | 3338 |
| 267 | Ga0070702_100056578 | 3300005615 | Bacteria | 2265 |
| 268 | Ga0070702_100159528 | 3300005615 | Bacteria | 1456 |
| 269 | Ga0070702_100202279 | 3300005615 | Bacteria | 1316 |
| 270 | Ga0070702_100300332 | 3300005615 | Bacteria | 1110 |
| 271 | Ga0070702_100304718 | 3300005615 | Bacteria | 1104 |
| 272 | Ga0070702_100581226 | 3300005615 | Bacteria | 837 |
| 273 | Ga0070702_100707420 | 3300005615 | Bacteria | 769 |
| 274 | Ga0068852_100093014 | 3300005616 | Bacteria | 2701 |
| 275 | Ga0068852_100381526 | 3300005616 | Bacteria | 1383 |
| 276 | Ga0068852_100817665 | 3300005616 | Bacteria | 946 |
| 277 | Ga0068859_100017683 | 3300005617 | Bacteria | 7167 |
| 278 | Ga0068859_100046105 | 3300005617 | Bacteria | 4379 |
| 279 | Ga0068859_100147685 | 3300005617 | Bacteria | 2426 |
| 280 | Ga0068859_100205327 | 3300005617 | Bacteria | 2055 |
| 281 | Ga0068859_100240844 | 3300005617 | Bacteria | 1898 |
| 282 | Ga0068859_100271701 | 3300005617 | Bacteria | 1787 |
| 283 | Ga0068859_100573248 | 3300005617 | Bacteria | 1222 |
| 284 | Ga0068859_101344893 | 3300005617 | Unclassified | 787 |
| 285 | Ga0068859_101672418 | 3300005617 | Unclassified | 703 |
| 286 | Ga0068859_101949886 | 3300005617 | Unclassified | 648 |
| 287 | Ga0068859_102682789 | 3300005617 | Unclassified | 548 |
| 288 | Ga0068859_103148907 | 3300005617 | Unclassified | 502 |
| 289 | Ga0068864_100077424 | 3300005618 | Bacteria | 2908 |
| 290 | Ga0068864_100454383 | 3300005618 | Bacteria | 1225 |
| 291 | Ga0068864_100456504 | 3300005618 | Bacteria | 1223 |
| 292 | Ga0068864_100483826 | 3300005618 | Bacteria | 1188 |
| 293 | Ga0068864_100653987 | 3300005618 | Bacteria | 1024 |
| 294 | Ga0068864_100968402 | 3300005618 | Bacteria | 843 |
| 295 | Ga0068864_101485406 | 3300005618 | Bacteria | 680 |
| 296 | Ga0068864_101546933 | 3300005618 | Unclassified | 667 |
| 297 | Ga0068866_10000684 | 3300005718 | Bacteria | 15437 |
| 298 | Ga0068866_10028898 | 3300005718 | Bacteria | 2645 |
| 299 | Ga0068861_100022941 | 3300005719 | Bacteria | 4500 |
| 300 | Ga0068861_100166917 | 3300005719 | Bacteria | 1821 |
| 301 | Ga0068861_100354324 | 3300005719 | Bacteria | 1288 |
| 302 | Ga0068861_101738102 | 3300005719 | Bacteria | 617 |
| 303 | Ga0068851_10016680 | 3300005834 | Bacteria | 3519 |
| 304 | Ga0068870_10224937 | 3300005840 | Bacteria | 1150 |
| 305 | Ga0068870_10507968 | 3300005840 | Bacteria | 804 |
| 306 | Ga0068870_10763273 | 3300005840 | Bacteria | 672 |
| 307 | Ga0068863_100074782 | 3300005841 | Bacteria | 3205 |
| 308 | Ga0068863_100090858 | 3300005841 | Bacteria | 2895 |
| 309 | Ga0068863_100377275 | 3300005841 | Bacteria | 1384 |
| 310 | Ga0068863_100547436 | 3300005841 | Unclassified | 1142 |
| 311 | Ga0068858_100002375 | 3300005842 | Bacteria | 19040 |
| 312 | Ga0068858_100007656 | 3300005842 | Bacteria | 10433 |
| 313 | Ga0068858_100033389 | 3300005842 | Bacteria | 4776 |
| 314 | Ga0068858_100081988 | 3300005842 | Bacteria | 2998 |
| 315 | Ga0068858_100082328 | 3300005842 | Bacteria | 2991 |
| 316 | Ga0068858_100109652 | 3300005842 | Bacteria | 2577 |
| 317 | Ga0068858_100287872 | 3300005842 | Unclassified | 1565 |
| 318 | Ga0068858_102095082 | 3300005842 | Unclassified | 559 |
| 319 | Ga0068858_102276598 | 3300005842 | Unclassified | 536 |
| 320 | Ga0068860_100037964 | 3300005843 | Bacteria | 4609 |
| 321 | Ga0068860_100059819 | 3300005843 | Bacteria | 3621 |
| 322 | Ga0068860_100114135 | 3300005843 | Bacteria | 2583 |
| 323 | Ga0068860_100226405 | 3300005843 | Bacteria | 1816 |
| 324 | Ga0068860_100445817 | 3300005843 | Unclassified | 1286 |
| 325 | Ga0068860_100983996 | 3300005843 | Bacteria | 861 |
| 326 | Ga0068860_101059515 | 3300005843 | Bacteria | 830 |
| 327 | Ga0068860_101723245 | 3300005843 | Unclassified | 648 |
| 328 | Ga0068862_100040680 | 3300005844 | Bacteria | 3952 |
| 329 | Ga0068862_100056661 | 3300005844 | Bacteria | 3358 |
| 330 | Ga0068862_100057688 | 3300005844 | Bacteria | 3330 |
| 331 | Ga0068862_100381212 | 3300005844 | Bacteria | 1315 |
| 332 | Ga0068862_100451050 | 3300005844 | Bacteria | 1213 |
| 333 | Ga0081455_10158880 | 3300005937 | Bacteria | 1735 |
| 334 | Ga0081455_10636649 | 3300005937 | Unclassified | 689 |
| 335 | Ga0081539_10001142 | 3300005985 | Bacteria | 48082 |
| 336 | Ga0081539_10028340 | 3300005985 | Bacteria | 3524 |
| 337 | Ga0081539_10106045 | 3300005985 | Bacteria | 1423 |
| 338 | Ga0081539_10131462 | 3300005985 | Bacteria | 1229 |
| 339 | Ga0075363_100301524 | 3300006048 | Bacteria | 930 |
| 340 | Ga0075364_10085096 | 3300006051 | Bacteria | 2094 |
| 341 | Ga0075432_10073290 | 3300006058 | Bacteria | 1232 |
| 342 | Ga0070715_10140135 | 3300006163 | Bacteria | 1174 |
| 343 | Ga0070715_10169058 | 3300006163 | Bacteria | 1087 |
| 344 | Ga0070716_100164111 | 3300006173 | Bacteria | 1443 |
| 345 | Ga0070716_100220426 | 3300006173 | Bacteria | 1274 |
| 346 | Ga0070716_100290404 | 3300006173 | Bacteria | 1133 |
| 347 | Ga0070712_101121529 | 3300006175 | Bacteria | 683 |
| 348 | Ga0075367_10401214 | 3300006178 | Unclassified | 867 |
| 349 | Ga0075367_10442706 | 3300006178 | Unclassified | 823 |
| 350 | Ga0097621_100010001 | 3300006237 | Bacteria | 6915 |
| 351 | Ga0097621_100010123 | 3300006237 | Bacteria | 6882 |
| 352 | Ga0097621_100364737 | 3300006237 | Bacteria | 1287 |
| 353 | Ga0075370_10300637 | 3300006353 | Bacteria | 954 |
| 354 | Ga0068871_100024423 | 3300006358 | Bacteria | 4687 |
| 355 | Ga0068871_100210249 | 3300006358 | Bacteria | 1682 |
| 356 | Ga0068871_100523066 | 3300006358 | Bacteria | 1071 |
| 357 | Ga0075428_100046558 | 3300006844 | Bacteria | 4764 |
| 358 | Ga0075428_100058800 | 3300006844 | Bacteria | 4209 |
| 359 | Ga0075428_100459402 | 3300006844 | Bacteria | 1363 |
| 360 | Ga0075428_100925272 | 3300006844 | Bacteria | 924 |
| 361 | Ga0075428_101286257 | 3300006844 | Bacteria | 769 |
| 362 | Ga0075430_100144913 | 3300006846 | Bacteria | 1978 |
| 363 | Ga0075430_100203120 | 3300006846 | Bacteria | 1645 |
| 364 | Ga0075430_100434217 | 3300006846 | Bacteria | 1084 |
| 365 | Ga0075431_100004485 | 3300006847 | Bacteria | 13699 |
| 366 | Ga0075431_100023932 | 3300006847 | Bacteria | 6252 |
| 367 | Ga0075431_100440701 | 3300006847 | Bacteria | 1299 |
| 368 | Ga0075433_10008752 | 3300006852 | Bacteria | 8075 |
| 369 | Ga0075433_10037879 | 3300006852 | Bacteria | 4162 |
| 370 | Ga0075433_10142836 | 3300006852 | Bacteria | 2128 |
| 371 | Ga0075433_10240666 | 3300006852 | Bacteria | 1606 |
| 372 | Ga0075433_10264822 | 3300006852 | Bacteria | 1523 |
| 373 | Ga0075433_10353404 | 3300006852 | Bacteria | 1299 |
| 374 | Ga0075433_10385822 | 3300006852 | Bacteria | 1236 |
| 375 | Ga0075433_10580550 | 3300006852 | Bacteria | 985 |
| 376 | Ga0075434_100040176 | 3300006871 | Bacteria | 4634 |
| 377 | Ga0075434_100148013 | 3300006871 | Bacteria | 2368 |
| 378 | Ga0075434_100185361 | 3300006871 | Bacteria | 2101 |
| 379 | Ga0075434_100427194 | 3300006871 | Bacteria | 1346 |
| 380 | Ga0075434_100668646 | 3300006871 | Bacteria | 1056 |
| 381 | Ga0075434_101080720 | 3300006871 | Bacteria | 816 |
| 382 | Ga0075434_101212793 | 3300006871 | Bacteria | 766 |
| 383 | Ga0075434_101493807 | 3300006871 | Unclassified | 685 |
| 384 | Ga0075434_102100241 | 3300006871 | Bacteria | 569 |
| 385 | Ga0075429_100004315 | 3300006880 | Bacteria | 12219 |
| 386 | Ga0075429_100864370 | 3300006880 | Bacteria | 792 |
| 387 | Ga0075429_101810688 | 3300006880 | Bacteria | 530 |
| 388 | Ga0075429_101895462 | 3300006880 | Unclassified | 516 |
| 389 | Ga0068865_100005466 | 3300006881 | Bacteria | 7707 |
| 390 | Ga0068865_100396346 | 3300006881 | Bacteria | 1130 |
| 391 | Ga0068865_100482499 | 3300006881 | Bacteria | 1030 |
| 392 | Ga0068865_100671039 | 3300006881 | Bacteria | 883 |
| 393 | Ga0075436_100000015 | 3300006914 | Bacteria | 174598 |
| 394 | Ga0075436_100013759 | 3300006914 | Bacteria | 5541 |
| 395 | Ga0097620_100017683 | 3300006931 | Bacteria | 7167 |
| 396 | Ga0097620_100046105 | 3300006931 | Bacteria | 4379 |
| 397 | Ga0097620_100147685 | 3300006931 | Bacteria | 2426 |
| 398 | Ga0097620_100205338 | 3300006931 | Bacteria | 2055 |
| 399 | Ga0097620_100240821 | 3300006931 | Bacteria | 1898 |
| 400 | Ga0097620_100271678 | 3300006931 | Bacteria | 1787 |
| 401 | Ga0097620_100573238 | 3300006931 | Bacteria | 1222 |
| 402 | Ga0097620_101344889 | 3300006931 | Unclassified | 787 |
| 403 | Ga0097620_101673160 | 3300006931 | Unclassified | 703 |
| 404 | Ga0097620_101949810 | 3300006931 | Unclassified | 648 |
| 405 | Ga0097620_102682474 | 3300006931 | Unclassified | 548 |
| 406 | Ga0097620_103149039 | 3300006931 | Unclassified | 502 |
| 407 | Ga0075435_100483478 | 3300007076 | Bacteria | 1070 |
| 408 | Ga0075435_100859535 | 3300007076 | Bacteria | 790 |
| 409 | Ga0075435_101725329 | 3300007076 | Bacteria | 549 |
| 410 | Ga0105251_10176467 | 3300009011 | Unclassified | 962 |
| 411 | Ga0105244_10259618 | 3300009036 | Bacteria | 809 |
| 412 | Ga0105240_10023866 | 3300009093 | Bacteria | 8078 |
| 413 | Ga0105240_10106929 | 3300009093 | Bacteria | 3392 |
| 414 | Ga0105240_10323307 | 3300009093 | Bacteria | 1757 |
| 415 | Ga0105240_11624294 | 3300009093 | Bacteria | 676 |
| 416 | Ga0105240_12179640 | 3300009093 | Bacteria | 575 |
| 417 | Ga0111539_10003746 | 3300009094 | Bacteria | 20004 |
| 418 | Ga0111539_10029571 | 3300009094 | Bacteria | 6670 |
| 419 | Ga0111539_10107148 | 3300009094 | Bacteria | 3279 |
| 420 | Ga0111539_10667918 | 3300009094 | Bacteria | 1210 |
| 421 | Ga0111539_11362722 | 3300009094 | Unclassified | 823 |
| 422 | Ga0111539_12169441 | 3300009094 | Bacteria | 644 |
| 423 | Ga0111539_13088412 | 3300009094 | Bacteria | 537 |
| 424 | Ga0105245_10009220 | 3300009098 | Bacteria | 8603 |
| 425 | Ga0105245_10191604 | 3300009098 | Bacteria | 1958 |
| 426 | Ga0105245_11772465 | 3300009098 | Unclassified | 670 |
| 427 | Ga0105247_10000005 | 3300009101 | Bacteria | 426989 |
| 428 | Ga0105247_10209413 | 3300009101 | Bacteria | 1314 |
| 429 | Ga0105247_11167274 | 3300009101 | Bacteria | 611 |
| 430 | Ga0105247_11249209 | 3300009101 | Unclassified | 594 |
| 431 | Ga0105247_11370099 | 3300009101 | Unclassified | 571 |
| 432 | Ga0105247_11467234 | 3300009101 | Unclassified | 555 |
| 433 | Ga0114129_10019427 | 3300009147 | Bacteria | 9673 |
| 434 | Ga0114129_10108251 | 3300009147 | Bacteria | 3837 |
| 435 | Ga0114129_10181912 | 3300009147 | Bacteria | 2860 |
| 436 | Ga0114129_10341075 | 3300009147 | Bacteria | 1987 |
| 437 | Ga0114129_10877672 | 3300009147 | Bacteria | 1138 |
| 438 | Ga0114129_10975810 | 3300009147 | Bacteria | 1069 |
| 439 | Ga0114129_11054672 | 3300009147 | Bacteria | 1020 |
| 440 | Ga0114129_12521563 | 3300009147 | Unclassified | 614 |
| 441 | Ga0105243_10019054 | 3300009148 | Bacteria | 5203 |
| 442 | Ga0105243_10055155 | 3300009148 | Bacteria | 3157 |
| 443 | Ga0105243_10246528 | 3300009148 | Bacteria | 1592 |
| 444 | Ga0105243_10301221 | 3300009148 | Bacteria | 1453 |
| 445 | Ga0105243_10787831 | 3300009148 | Bacteria | 936 |
| 446 | Ga0105243_12227233 | 3300009148 | Unclassified | 585 |
| 447 | Ga0105241_10107226 | 3300009174 | Bacteria | 2231 |
| 448 | Ga0105241_10215505 | 3300009174 | Bacteria | 1611 |
| 449 | Ga0105241_10710659 | 3300009174 | Bacteria | 918 |
| 450 | Ga0105241_11037769 | 3300009174 | Unclassified | 769 |
| 451 | Ga0105241_11230423 | 3300009174 | Bacteria | 710 |
| 452 | Ga0105241_11734091 | 3300009174 | Bacteria | 608 |
| 453 | Ga0105242_10007678 | 3300009176 | Bacteria | 8299 |
| 454 | Ga0105242_10088295 | 3300009176 | Unclassified | 2604 |
| 455 | Ga0105242_10130667 | 3300009176 | Bacteria | 2167 |
| 456 | Ga0105242_10223473 | 3300009176 | Bacteria | 1684 |
| 457 | Ga0105242_10454891 | 3300009176 | Bacteria | 1208 |
| 458 | Ga0105242_10565038 | 3300009176 | Unclassified | 1093 |
| 459 | Ga0105242_12600125 | 3300009176 | Unclassified | 555 |
| 460 | Ga0105248_10014028 | 3300009177 | Bacteria | 8817 |
| 461 | Ga0105248_10091433 | 3300009177 | Bacteria | 3427 |
| 462 | Ga0105248_10179460 | 3300009177 | Bacteria | 2386 |
| 463 | Ga0105248_10489049 | 3300009177 | Bacteria | 1387 |
| 464 | Ga0105248_11113366 | 3300009177 | Bacteria | 893 |
| 465 | Ga0105248_11591229 | 3300009177 | Unclassified | 740 |
| 466 | Ga0105237_10035040 | 3300009545 | Bacteria | 5079 |
| 467 | Ga0105237_10326547 | 3300009545 | Bacteria | 1538 |
| 468 | Ga0105237_10508172 | 3300009545 | Bacteria | 1212 |
| 469 | Ga0105237_10553910 | 3300009545 | Bacteria | 1156 |
| 470 | Ga0105238_10049968 | 3300009551 | Bacteria | 4210 |
| 471 | Ga0105249_10023100 | 3300009553 | Bacteria | 5577 |
| 472 | Ga0105249_10033646 | 3300009553 | Bacteria | 4641 |
| 473 | Ga0105249_10039009 | 3300009553 | Bacteria | 4311 |
| 474 | Ga0105249_10260824 | 3300009553 | Bacteria | 1722 |
| 475 | Ga0105249_11031258 | 3300009553 | Bacteria | 892 |
| 476 | Ga0105249_11739543 | 3300009553 | Bacteria | 696 |
| 477 | Ga0105249_12235555 | 3300009553 | Bacteria | 620 |
| 478 | Ga0105249_12722649 | 3300009553 | Bacteria | 566 |
| 479 | Ga0099796_10025723 | 3300010159 | Bacteria | 1862 |
| 480 | Ga0105239_10017161 | 3300010375 | Bacteria | 8002 |
| 481 | Ga0105239_10227608 | 3300010375 | Bacteria | 2092 |
| 482 | Ga0105239_10537338 | 3300010375 | Bacteria | 1331 |
| 483 | Ga0105239_11648093 | 3300010375 | Unclassified | 742 |
| 484 | Ga0105239_12143442 | 3300010375 | Bacteria | 650 |
| 485 | Ga0105246_10027132 | 3300011119 | Bacteria | 3750 |
| 486 | Ga0105246_10224743 | 3300011119 | Bacteria | 1474 |
| 487 | Ga0105246_10466384 | 3300011119 | Bacteria | 1065 |
| 488 | Ga0157373_10910577 | 3300013100 | Unclassified | 653 |
| 489 | Ga0157373_11065013 | 3300013100 | Unclassified | 605 |
| 490 | Ga0157371_10266907 | 3300013102 | Bacteria | 1235 |
| 491 | Ga0157371_11150040 | 3300013102 | Bacteria | 597 |
| 492 | Ga0157374_10428206 | 3300013296 | Bacteria | 1323 |
| 493 | Ga0157374_10516761 | 3300013296 | Bacteria | 1200 |
| 494 | Ga0157378_10000067 | 3300013297 | Bacteria | 92867 |
| 495 | Ga0157378_10006757 | 3300013297 | Bacteria | 10022 |
| 496 | Ga0157378_10012876 | 3300013297 | Bacteria | 7324 |
| 497 | Ga0157378_10033270 | 3300013297 | Bacteria | 4556 |
| 498 | Ga0157378_10052148 | 3300013297 | Bacteria | 3639 |
| 499 | Ga0157378_10098822 | 3300013297 | Bacteria | 2662 |
| 500 | Ga0157378_10373867 | 3300013297 | Bacteria | 1398 |
| 501 | Ga0157378_10695891 | 3300013297 | Bacteria | 1035 |
| 502 | Ga0157378_10787995 | 3300013297 | Bacteria | 976 |
| 503 | Ga0157378_10860832 | 3300013297 | Bacteria | 935 |
| 504 | Ga0157378_11583504 | 3300013297 | Unclassified | 701 |
| 505 | Ga0163162_10052139 | 3300013306 | Bacteria | 4108 |
| 506 | Ga0163162_10088515 | 3300013306 | Bacteria | 3176 |
| 507 | Ga0163162_10161247 | 3300013306 | Bacteria | 2364 |
| 508 | Ga0163162_10225733 | 3300013306 | Bacteria | 2003 |
| 509 | Ga0163162_10801311 | 3300013306 | Bacteria | 1059 |
| 510 | Ga0163162_11342019 | 3300013306 | Bacteria | 813 |
| 511 | Ga0157372_10560935 | 3300013307 | Bacteria | 1331 |
| 512 | Ga0157372_13347804 | 3300013307 | Unclassified | 510 |
| 513 | Ga0157375_10010135 | 3300013308 | Bacteria | 8289 |
| 514 | Ga0157375_10248965 | 3300013308 | Bacteria | 1937 |
| 515 | Ga0157375_10285952 | 3300013308 | Bacteria | 1812 |
| 516 | Ga0157375_10426331 | 3300013308 | Bacteria | 1492 |
| 517 | Ga0157375_12408685 | 3300013308 | Unclassified | 628 |
| 518 | Ga0157375_12653253 | 3300013308 | Unclassified | 599 |
| 519 | Ga0163163_10010551 | 3300014325 | Bacteria | 8314 |
| 520 | Ga0163163_10181085 | 3300014325 | Unclassified | 2154 |
| 521 | Ga0163163_10536157 | 3300014325 | Bacteria | 1233 |
| 522 | Ga0163163_11400061 | 3300014325 | Bacteria | 761 |
| 523 | Ga0163163_12293797 | 3300014325 | Bacteria | 599 |
| 524 | Ga0163163_13273837 | 3300014325 | Unclassified | 505 |
| 525 | Ga0157380_10006445 | 3300014326 | Bacteria | 8267 |
| 526 | Ga0157380_10008575 | 3300014326 | Bacteria | 7309 |
| 527 | Ga0157380_10262707 | 3300014326 | Bacteria | 1569 |
| 528 | Ga0157380_10285385 | 3300014326 | Unclassified | 1513 |
| 529 | Ga0157380_10459267 | 3300014326 | Bacteria | 1225 |
| 530 | Ga0157380_10920336 | 3300014326 | Bacteria | 902 |
| 531 | Ga0157380_11610301 | 3300014326 | Bacteria | 705 |
| 532 | Ga0157380_12280292 | 3300014326 | Unclassified | 606 |
| 533 | Ga0182008_10327499 | 3300014497 | Unclassified | 807 |
| 534 | Ga0157377_10187065 | 3300014745 | Bacteria | 1306 |
| 535 | Ga0157379_10115483 | 3300014968 | Bacteria | 2413 |
| 536 | Ga0157379_10291413 | 3300014968 | Bacteria | 1486 |
| 537 | Ga0157379_10489485 | 3300014968 | Bacteria | 1139 |
| 538 | Ga0157376_10167934 | 3300014969 | Bacteria | 1995 |
| 539 | Ga0157376_10271213 | 3300014969 | Bacteria | 1594 |
| 540 | Ga0157376_10420225 | 3300014969 | Bacteria | 1297 |
| 541 | Ga0157376_10960923 | 3300014969 | Bacteria | 875 |
| 542 | Ga0182007_10132255 | 3300015262 | Unclassified | 840 |
| 543 | Ga0163161_10039795 | 3300017792 | Bacteria | 3377 |
| 544 | Ga0163161_10652039 | 3300017792 | Bacteria | 872 |
| 545 | Ga0206352_10617335 | 3300020078 | Unclassified | 803 |
| 546 | Ga0206354_11678042 | 3300020081 | Bacteria | 720 |
| 547 | Ga0213876_10112732 | 3300021384 | Bacteria | 1443 |
| 548 | Ga0224712_10017586 | 3300022467 | Bacteria | 2374 |
| 549 | Ga0207672_1000403 | 3300025223 | Bacteria | 5536 |
| 550 | Ga0209566_100273 | 3300025225 | Bacteria | 48159 |
| 551 | Ga0209147_100198 | 3300025229 | Bacteria | 67714 |
| 552 | Ga0209130_1016157 | 3300025284 | Bacteria | 1815 |
| 553 | Ga0209675_1019703 | 3300025291 | Bacteria | 1847 |
| 554 | Ga0209676_1000745 | 3300025292 | Bacteria | 44098 |
| 555 | Ga0207656_10000878 | 3300025321 | Bacteria | 9805 |
| 556 | Ga0207696_1110904 | 3300025711 | Bacteria | 743 |
| 557 | Ga0207713_1080075 | 3300025735 | Unclassified | 1178 |
| 558 | Ga0207653_10002754 | 3300025885 | Bacteria | 5592 |
| 559 | Ga0207682_10072608 | 3300025893 | Unclassified | 1460 |
| 560 | Ga0207692_10343151 | 3300025898 | Unclassified | 919 |
| 561 | Ga0207642_10006933 | 3300025899 | Bacteria | 3797 |
| 562 | Ga0207642_10059505 | 3300025899 | Bacteria | 1767 |
| 563 | Ga0207642_10366178 | 3300025899 | Unclassified | 854 |
| 564 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 565 | Ga0207710_10076290 | 3300025900 | Bacteria | 1546 |
| 566 | Ga0207710_10193559 | 3300025900 | Bacteria | 1002 |
| 567 | Ga0207710_10429959 | 3300025900 | Bacteria | 680 |
| 568 | Ga0207688_10075149 | 3300025901 | Bacteria | 1923 |
| 569 | Ga0207688_10345918 | 3300025901 | Bacteria | 915 |
| 570 | Ga0207688_10450943 | 3300025901 | Bacteria | 802 |
| 571 | Ga0207680_10158946 | 3300025903 | Bacteria | 1513 |
| 572 | Ga0207647_10002003 | 3300025904 | Bacteria | 15586 |
| 573 | Ga0207647_10586971 | 3300025904 | Unclassified | 616 |
| 574 | Ga0207699_10093594 | 3300025906 | Bacteria | 1892 |
| 575 | Ga0207699_10905888 | 3300025906 | Bacteria | 651 |
| 576 | Ga0207645_10113596 | 3300025907 | Bacteria | 1755 |
| 577 | Ga0207645_10253700 | 3300025907 | Bacteria | 1164 |
| 578 | Ga0207643_10456106 | 3300025908 | Unclassified | 814 |
| 579 | Ga0207643_10976486 | 3300025908 | Viruses | 548 |
| 580 | Ga0207684_10057428 | 3300025910 | Bacteria | 3302 |
| 581 | Ga0207684_10098332 | 3300025910 | Bacteria | 2499 |
| 582 | Ga0207684_10255210 | 3300025910 | Bacteria | 1513 |
| 583 | Ga0207654_10215580 | 3300025911 | Bacteria | 1271 |
| 584 | Ga0207654_10259353 | 3300025911 | Bacteria | 1168 |
| 585 | Ga0207654_10941177 | 3300025911 | Bacteria | 627 |
| 586 | Ga0207707_10000016 | 3300025912 | Bacteria | 256002 |
| 587 | Ga0207707_10002220 | 3300025912 | Bacteria | 17547 |
| 588 | Ga0207707_10010480 | 3300025912 | Bacteria | 8043 |
| 589 | Ga0207707_11029920 | 3300025912 | Bacteria | 674 |
| 590 | Ga0207695_10061311 | 3300025913 | Bacteria | 3887 |
| 591 | Ga0207695_10290339 | 3300025913 | Bacteria | 1528 |
| 592 | Ga0207695_10916558 | 3300025913 | Unclassified | 756 |
| 593 | Ga0207671_10340550 | 3300025914 | Bacteria | 1188 |
| 594 | Ga0207660_10052536 | 3300025917 | Bacteria | 2901 |
| 595 | Ga0207660_10072579 | 3300025917 | Bacteria | 2507 |
| 596 | Ga0207660_10073473 | 3300025917 | Bacteria | 2493 |
| 597 | Ga0207660_10452968 | 3300025917 | Bacteria | 1038 |
| 598 | Ga0207662_10029256 | 3300025918 | Bacteria | 3191 |
| 599 | Ga0207662_10093326 | 3300025918 | Bacteria | 1855 |
| 600 | Ga0207662_10201316 | 3300025918 | Bacteria | 1289 |
| 601 | Ga0207662_10219743 | 3300025918 | Bacteria | 1237 |
| 602 | Ga0207662_10253008 | 3300025918 | Unclassified | 1157 |
| 603 | Ga0207662_10656776 | 3300025918 | Unclassified | 733 |
| 604 | Ga0207657_10446216 | 3300025919 | Bacteria | 1015 |
| 605 | Ga0207649_10935990 | 3300025920 | Unclassified | 680 |
| 606 | Ga0207649_11196969 | 3300025920 | Unclassified | 600 |
| 607 | Ga0207652_10000267 | 3300025921 | Bacteria | 54601 |
| 608 | Ga0207652_10014383 | 3300025921 | Bacteria | 6411 |
| 609 | Ga0207646_10010058 | 3300025922 | Bacteria | 9273 |
| 610 | Ga0207646_10011116 | 3300025922 | Bacteria | 8741 |
| 611 | Ga0207646_10029852 | 3300025922 | Bacteria | 4949 |
| 612 | Ga0207646_10129683 | 3300025922 | Bacteria | 2269 |
| 613 | Ga0207646_10364990 | 3300025922 | Bacteria | 1304 |
| 614 | Ga0207646_11273842 | 3300025922 | Bacteria | 643 |
| 615 | Ga0207646_11543974 | 3300025922 | Bacteria | 574 |
| 616 | Ga0207646_11547076 | 3300025922 | Bacteria | 573 |
| 617 | Ga0207681_10025237 | 3300025923 | Bacteria | 3821 |
| 618 | Ga0207681_10152572 | 3300025923 | Bacteria | 1733 |
| 619 | Ga0207681_10296731 | 3300025923 | Bacteria | 1277 |
| 620 | Ga0207694_10008076 | 3300025924 | Bacteria | 7954 |
| 621 | Ga0207650_10000011 | 3300025925 | Bacteria | 450115 |
| 622 | Ga0207650_10058798 | 3300025925 | Bacteria | 2863 |
| 623 | Ga0207650_10061701 | 3300025925 | Bacteria | 2799 |
| 624 | Ga0207650_10071542 | 3300025925 | Bacteria | 2609 |
| 625 | Ga0207650_11185431 | 3300025925 | Bacteria | 650 |
| 626 | Ga0207659_10109170 | 3300025926 | Bacteria | 2100 |
| 627 | Ga0207687_10852988 | 3300025927 | Bacteria | 778 |
| 628 | Ga0207644_10003135 | 3300025931 | Bacteria | 10650 |
| 629 | Ga0207644_10013122 | 3300025931 | Bacteria | 5516 |
| 630 | Ga0207644_10086890 | 3300025931 | Bacteria | 2323 |
| 631 | Ga0207690_10154128 | 3300025932 | Bacteria | 1706 |
| 632 | Ga0207690_10295524 | 3300025932 | Bacteria | 1266 |
| 633 | Ga0207706_10420423 | 3300025933 | Bacteria | 1158 |
| 634 | Ga0207706_10889544 | 3300025933 | Bacteria | 753 |
| 635 | Ga0207686_10005623 | 3300025934 | Bacteria | 6720 |
| 636 | Ga0207686_10055449 | 3300025934 | Unclassified | 2487 |
| 637 | Ga0207686_10172693 | 3300025934 | Bacteria | 1526 |
| 638 | Ga0207686_10296618 | 3300025934 | Bacteria | 1199 |
| 639 | Ga0207686_10336230 | 3300025934 | Bacteria | 1133 |
| 640 | Ga0207686_10970124 | 3300025934 | Unclassified | 689 |
| 641 | Ga0207709_10006883 | 3300025935 | Bacteria | 6364 |
| 642 | Ga0207709_10012133 | 3300025935 | Bacteria | 4749 |
| 643 | Ga0207709_10092751 | 3300025935 | Bacteria | 1978 |
| 644 | Ga0207709_10128828 | 3300025935 | Bacteria | 1721 |
| 645 | Ga0207709_10201887 | 3300025935 | Bacteria | 1421 |
| 646 | Ga0207709_10286232 | 3300025935 | Bacteria | 1219 |
| 647 | Ga0207709_10348055 | 3300025935 | Bacteria | 1118 |
| 648 | Ga0207670_10004178 | 3300025936 | Bacteria | 7747 |
| 649 | Ga0207670_10039470 | 3300025936 | Bacteria | 3092 |
| 650 | Ga0207670_10220864 | 3300025936 | Bacteria | 1450 |
| 651 | Ga0207670_10685541 | 3300025936 | Bacteria | 847 |
| 652 | Ga0207704_10015168 | 3300025938 | Bacteria | 3917 |
| 653 | Ga0207704_10987531 | 3300025938 | Bacteria | 711 |
| 654 | Ga0207665_10044010 | 3300025939 | Bacteria | 2987 |
| 655 | Ga0207665_10075933 | 3300025939 | Bacteria | 2303 |
| 656 | Ga0207665_10264166 | 3300025939 | Bacteria | 1276 |
| 657 | Ga0207665_10296770 | 3300025939 | Bacteria | 1207 |
| 658 | Ga0207665_10675538 | 3300025939 | Bacteria | 811 |
| 659 | Ga0207691_10011757 | 3300025940 | Bacteria | 8402 |
| 660 | Ga0207691_10083615 | 3300025940 | Bacteria | 2866 |
| 661 | Ga0207711_10008388 | 3300025941 | Bacteria | 8646 |
| 662 | Ga0207711_10010629 | 3300025941 | Bacteria | 7656 |
| 663 | Ga0207711_10157868 | 3300025941 | Bacteria | 2051 |
| 664 | Ga0207711_10366421 | 3300025941 | Bacteria | 1336 |
| 665 | Ga0207711_11013065 | 3300025941 | Unclassified | 770 |
| 666 | Ga0207689_10030521 | 3300025942 | Bacteria | 4492 |
| 667 | Ga0207689_10089386 | 3300025942 | Bacteria | 2530 |
| 668 | Ga0207689_10125695 | 3300025942 | Bacteria | 2110 |
| 669 | Ga0207689_10138079 | 3300025942 | Bacteria | 2007 |
| 670 | Ga0207689_10196005 | 3300025942 | Bacteria | 1667 |
| 671 | Ga0207661_10197993 | 3300025944 | Bacteria | 1765 |
| 672 | Ga0207679_10014244 | 3300025945 | Bacteria | 5224 |
| 673 | Ga0207679_10088992 | 3300025945 | Bacteria | 2382 |
| 674 | Ga0207679_10988629 | 3300025945 | Bacteria | 771 |
| 675 | Ga0207679_11451951 | 3300025945 | Bacteria | 629 |
| 676 | Ga0207667_10239504 | 3300025949 | Bacteria | 1857 |
| 677 | Ga0207667_10251941 | 3300025949 | Bacteria | 1806 |
| 678 | Ga0207651_10195565 | 3300025960 | Bacteria | 1616 |
| 679 | Ga0207651_10307270 | 3300025960 | Bacteria | 1321 |
| 680 | Ga0207651_10324471 | 3300025960 | Bacteria | 1288 |
| 681 | Ga0207651_10581801 | 3300025960 | Unclassified | 977 |
| 682 | Ga0207651_11172523 | 3300025960 | Bacteria | 689 |
| 683 | Ga0207651_11374073 | 3300025960 | Unclassified | 635 |
| 684 | Ga0207651_11677465 | 3300025960 | Unclassified | 572 |
| 685 | Ga0207712_10010700 | 3300025961 | Bacteria | 5826 |
| 686 | Ga0207712_10029090 | 3300025961 | Bacteria | 3703 |
| 687 | Ga0207712_10031309 | 3300025961 | Bacteria | 3582 |
| 688 | Ga0207712_10167843 | 3300025961 | Bacteria | 1712 |
| 689 | Ga0207712_10178431 | 3300025961 | Bacteria | 1666 |
| 690 | Ga0207712_10787223 | 3300025961 | Unclassified | 835 |
| 691 | Ga0207712_11406653 | 3300025961 | Bacteria | 624 |
| 692 | Ga0207712_12076311 | 3300025961 | Unclassified | 508 |
| 693 | Ga0207640_10022653 | 3300025981 | Bacteria | 3763 |
| 694 | Ga0207640_10385266 | 3300025981 | Bacteria | 1137 |
| 695 | Ga0207640_10746159 | 3300025981 | Unclassified | 843 |
| 696 | Ga0207677_10012110 | 3300026023 | Bacteria | 4944 |
| 697 | Ga0207677_10168987 | 3300026023 | Bacteria | 1708 |
| 698 | Ga0207677_11133000 | 3300026023 | Bacteria | 714 |
| 699 | Ga0207703_10000589 | 3300026035 | Bacteria | 36985 |
| 700 | Ga0207703_10004977 | 3300026035 | Bacteria | 10784 |
| 701 | Ga0207703_10074679 | 3300026035 | Bacteria | 2808 |
| 702 | Ga0207703_10097689 | 3300026035 | Bacteria | 2482 |
| 703 | Ga0207703_10161973 | 3300026035 | Bacteria | 1960 |
| 704 | Ga0207703_10403191 | 3300026035 | Unclassified | 1269 |
| 705 | Ga0207639_10018927 | 3300026041 | Bacteria | 4903 |
| 706 | Ga0207678_10345583 | 3300026067 | Unclassified | 1282 |
| 707 | Ga0207708_10132826 | 3300026075 | Bacteria | 1947 |
| 708 | Ga0207708_10146529 | 3300026075 | Bacteria | 1856 |
| 709 | Ga0207708_11253514 | 3300026075 | Bacteria | 649 |
| 710 | Ga0207702_10160175 | 3300026078 | Bacteria | 2055 |
| 711 | Ga0207641_10012708 | 3300026088 | Bacteria | 6903 |
| 712 | Ga0207641_10043522 | 3300026088 | Bacteria | 3771 |
| 713 | Ga0207641_10358719 | 3300026088 | Bacteria | 1391 |
| 714 | Ga0207641_10550144 | 3300026088 | Bacteria | 1125 |
| 715 | Ga0207641_11369446 | 3300026088 | Unclassified | 708 |
| 716 | Ga0207641_11667011 | 3300026088 | Unclassified | 639 |
| 717 | Ga0207648_10033880 | 3300026089 | Bacteria | 4503 |
| 718 | Ga0207648_10168113 | 3300026089 | Bacteria | 1938 |
| 719 | Ga0207648_10290567 | 3300026089 | Bacteria | 1463 |
| 720 | Ga0207648_10394973 | 3300026089 | Unclassified | 1252 |
| 721 | Ga0207648_11392547 | 3300026089 | Bacteria | 659 |
| 722 | Ga0207676_10059723 | 3300026095 | Bacteria | 3012 |
| 723 | Ga0207676_10097178 | 3300026095 | Bacteria | 2432 |
| 724 | Ga0207676_10375883 | 3300026095 | Bacteria | 1321 |
| 725 | Ga0207676_10974991 | 3300026095 | Unclassified | 834 |
| 726 | Ga0207676_11238212 | 3300026095 | Viruses | 740 |
| 727 | Ga0207676_11845153 | 3300026095 | Unclassified | 603 |
| 728 | Ga0207674_10866817 | 3300026116 | Bacteria | 871 |
| 729 | Ga0207674_11550029 | 3300026116 | Unclassified | 631 |
| 730 | Ga0207675_100017622 | 3300026118 | Bacteria | 6662 |
| 731 | Ga0207675_100039486 | 3300026118 | Bacteria | 4405 |
| 732 | Ga0207675_100108369 | 3300026118 | Bacteria | 2620 |
| 733 | Ga0207675_100274133 | 3300026118 | Bacteria | 1638 |
| 734 | Ga0207675_100638653 | 3300026118 | Bacteria | 1070 |
| 735 | Ga0207675_101615430 | 3300026118 | Unclassified | 669 |
| 736 | Ga0207683_10320888 | 3300026121 | Bacteria | 1419 |
| 737 | Ga0207683_10365711 | 3300026121 | Bacteria | 1325 |
| 738 | Ga0207698_10453615 | 3300026142 | Bacteria | 1238 |
| 739 | Ga0207698_10685147 | 3300026142 | Bacteria | 1019 |
| 740 | Ga0207698_12686907 | 3300026142 | Unclassified | 507 |
| 741 | Ga0209973_1069272 | 3300027252 | Bacteria | 551 |
| 742 | Ga0209969_1000136 | 3300027360 | Bacteria | 9537 |
| 743 | Ga0209996_1023790 | 3300027395 | Bacteria | 871 |
| 744 | Ga0210000_1000292 | 3300027462 | Bacteria | 7188 |
| 745 | Ga0209995_1000462 | 3300027471 | Bacteria | 6215 |
| 746 | Ga0209995_1026906 | 3300027471 | Bacteria | 959 |
| 747 | Ga0209968_1044634 | 3300027526 | Bacteria | 762 |
| 748 | Ga0209999_1000658 | 3300027543 | Bacteria | 5554 |
| 749 | Ga0209999_1006296 | 3300027543 | Bacteria | 2132 |
| 750 | Ga0209999_1024666 | 3300027543 | Bacteria | 1110 |
| 751 | Ga0209982_1005128 | 3300027552 | Bacteria | 1889 |
| 752 | Ga0210002_1031091 | 3300027617 | Bacteria | 888 |
| 753 | Ga0209983_1001263 | 3300027665 | Bacteria | 5623 |
| 754 | Ga0209983_1002782 | 3300027665 | Bacteria | 3788 |
| 755 | Ga0209983_1007161 | 3300027665 | Bacteria | 2290 |
| 756 | Ga0209971_1007936 | 3300027682 | Bacteria | 2519 |
| 757 | Ga0209971_1023765 | 3300027682 | Bacteria | 1462 |
| 758 | Ga0209974_10000335 | 3300027876 | Bacteria | 15422 |
| 759 | Ga0209974_10002524 | 3300027876 | Bacteria | 6638 |
| 760 | Ga0209974_10033146 | 3300027876 | Unclassified | 1713 |
| 761 | Ga0207428_10007924 | 3300027907 | Bacteria | 9653 |
| 762 | Ga0207428_10677873 | 3300027907 | Unclassified | 738 |
| 763 | Ga0207428_10736086 | 3300027907 | Bacteria | 704 |
| 764 | Ga0268265_10034700 | 3300028380 | Bacteria | 3679 |
| 765 | Ga0268265_10352928 | 3300028380 | Bacteria | 1343 |
| 766 | Ga0268265_10452924 | 3300028380 | Bacteria | 1199 |
| 767 | Ga0268265_10580258 | 3300028380 | Bacteria | 1068 |
| 768 | Ga0268265_11392600 | 3300028380 | Bacteria | 703 |
| 769 | Ga0268265_11825074 | 3300028380 | Bacteria | 614 |
| 770 | Ga0268264_10042115 | 3300028381 | Bacteria | 3779 |
| 771 | Ga0268264_10246915 | 3300028381 | Bacteria | 1656 |
| 772 | Ga0268264_10748057 | 3300028381 | Bacteria | 974 |
| 773 | Ga0268264_10776110 | 3300028381 | Bacteria | 956 |
| 774 | Ga0268264_10902994 | 3300028381 | Bacteria | 887 |
| 775 | Ga0268264_11131013 | 3300028381 | Unclassified | 792 |
| 776 | Ga0268264_11277474 | 3300028381 | Bacteria | 744 |
| 777 | Ga0268264_12441711 | 3300028381 | Unclassified | 528 |
| 778 | Ga0265334_10003963 | 3300028573 | Bacteria | 6661 |
| 779 | Ga0265331_10122487 | 3300031250 | Bacteria | 1188 |
| 780 | Ga0265316_10021700 | 3300031344 | Bacteria | 5432 |
| 781 | Ga0307408_100162100 | 3300031548 | Bacteria | 1777 |
| 782 | Ga0307408_100662298 | 3300031548 | Unclassified | 934 |
| 783 | Ga0307408_100691922 | 3300031548 | Bacteria | 915 |
| 784 | Ga0307408_100714237 | 3300031548 | Bacteria | 902 |
| 785 | Ga0307405_10006163 | 3300031731 | Bacteria | 5874 |
| 786 | Ga0307405_10024793 | 3300031731 | Bacteria | 3433 |
| 787 | Ga0307405_10108505 | 3300031731 | Bacteria | 1876 |
| 788 | Ga0307405_10542975 | 3300031731 | Bacteria | 939 |
| 789 | Ga0307405_10682171 | 3300031731 | Bacteria | 849 |
| 790 | Ga0307405_10698647 | 3300031731 | Bacteria | 840 |
| 791 | Ga0307413_10017567 | 3300031824 | Bacteria | 3729 |
| 792 | Ga0307413_10047208 | 3300031824 | Bacteria | 2566 |
| 793 | Ga0307413_10165095 | 3300031824 | Bacteria | 1560 |
| 794 | Ga0307413_10262842 | 3300031824 | Bacteria | 1287 |
| 795 | Ga0307413_10264847 | 3300031824 | Bacteria | 1283 |
| 796 | Ga0307413_10893740 | 3300031824 | Bacteria | 754 |
| 797 | Ga0307410_10065381 | 3300031852 | Bacteria | 2501 |
| 798 | Ga0307410_10089432 | 3300031852 | Bacteria | 2182 |
| 799 | Ga0307410_10109599 | 3300031852 | Bacteria | 1995 |
| 800 | Ga0307410_10116915 | 3300031852 | Bacteria | 1938 |
| 801 | Ga0307410_10173370 | 3300031852 | Bacteria | 1627 |
| 802 | Ga0307410_10215225 | 3300031852 | Bacteria | 1475 |
| 803 | Ga0307410_10514172 | 3300031852 | Bacteria | 987 |
| 804 | Ga0307406_10003940 | 3300031901 | Bacteria | 8062 |
| 805 | Ga0307406_10049725 | 3300031901 | Bacteria | 2654 |
| 806 | Ga0307406_10109486 | 3300031901 | Bacteria | 1899 |
| 807 | Ga0307406_10390168 | 3300031901 | Bacteria | 1100 |
| 808 | Ga0307407_10020430 | 3300031903 | Bacteria | 3394 |
| 809 | Ga0307407_10170574 | 3300031903 | Bacteria | 1432 |
| 810 | Ga0307407_10256679 | 3300031903 | Bacteria | 1200 |
| 811 | Ga0307407_10352877 | 3300031903 | Bacteria | 1042 |
| 812 | Ga0307407_10476523 | 3300031903 | Bacteria | 911 |
| 813 | Ga0307412_10039661 | 3300031911 | Bacteria | 3042 |
| 814 | Ga0307412_10062960 | 3300031911 | Bacteria | 2500 |
| 815 | Ga0307412_10355211 | 3300031911 | Bacteria | 1178 |
| 816 | Ga0307412_10917005 | 3300031911 | Bacteria | 769 |
| 817 | Ga0307412_11238834 | 3300031911 | Bacteria | 669 |
| 818 | Ga0307409_100088713 | 3300031995 | Bacteria | 2526 |
| 819 | Ga0307409_100120720 | 3300031995 | Bacteria | 2219 |
| 820 | Ga0307409_100192694 | 3300031995 | Bacteria | 1816 |
| 821 | Ga0307409_100444702 | 3300031995 | Bacteria | 1249 |
| 822 | Ga0307409_100583498 | 3300031995 | Bacteria | 1102 |
| 823 | Ga0307409_101014651 | 3300031995 | Bacteria | 848 |
| 824 | Ga0307409_101420227 | 3300031995 | Bacteria | 720 |
| 825 | Ga0307416_100030934 | 3300032002 | Bacteria | 4024 |
| 826 | Ga0307416_100034134 | 3300032002 | Bacteria | 3867 |
| 827 | Ga0307416_100069074 | 3300032002 | Bacteria | 2922 |
| 828 | Ga0307416_100105312 | 3300032002 | Bacteria | 2468 |
| 829 | Ga0307416_100803943 | 3300032002 | Bacteria | 1036 |
| 830 | Ga0307416_101048680 | 3300032002 | Bacteria | 919 |
| 831 | Ga0307416_101335414 | 3300032002 | Bacteria | 823 |
| 832 | Ga0307414_10001220 | 3300032004 | Bacteria | 13243 |
| 833 | Ga0307414_10078993 | 3300032004 | Bacteria | 2400 |
| 834 | Ga0307414_10120589 | 3300032004 | Bacteria | 2015 |
| 835 | Ga0307414_10162873 | 3300032004 | Bacteria | 1774 |
| 836 | Ga0307414_10458794 | 3300032004 | Bacteria | 1119 |
| 837 | Ga0307414_10585987 | 3300032004 | Bacteria | 998 |
| 838 | Ga0307414_10849045 | 3300032004 | Bacteria | 835 |
| 839 | Ga0307414_11596361 | 3300032004 | Unclassified | 608 |
| 840 | Ga0307411_10004491 | 3300032005 | Bacteria | 6692 |
| 841 | Ga0307411_10040958 | 3300032005 | Bacteria | 2943 |
| 842 | Ga0307411_10206147 | 3300032005 | Bacteria | 1514 |
| 843 | Ga0307411_10256030 | 3300032005 | Bacteria | 1379 |
| 844 | Ga0307411_10280681 | 3300032005 | Bacteria | 1325 |
| 845 | Ga0307411_10503450 | 3300032005 | Bacteria | 1024 |
| 846 | Ga0307411_10699663 | 3300032005 | Bacteria | 883 |
| 847 | Ga0307411_10756263 | 3300032005 | Bacteria | 852 |
| 848 | Ga0307411_11365327 | 3300032005 | Bacteria | 647 |
| 849 | Ga0307415_100003721 | 3300032126 | Bacteria | 7806 |
| 850 | Ga0307415_100266187 | 3300032126 | Bacteria | 1401 |
| 851 | Ga0307415_100291353 | 3300032126 | Bacteria | 1348 |
| 852 | Ga0307415_100307401 | 3300032126 | Bacteria | 1316 |
| 853 | Ga0307415_101487127 | 3300032126 | Bacteria | 647 |
| 854 | Ga0307415_102055432 | 3300032126 | Bacteria | 557 |
| 855 | Ga0316593_10085680 | 3300032168 | Bacteria | 1104 |
| 856 | Ga0316593_10404949 | 3300032168 | Bacteria | 528 |
| 857 | Ga0316592_1123632 | 3300033524 | Bacteria | 601 |
| 858 | Ga0316592_1149130 | 3300033524 | Bacteria | 551 |
| 859 | Ga0316588_1024200 | 3300033528 | Bacteria | 1396 |
| 860 | Ga0316587_1026396 | 3300033529 | Bacteria | 1012 |
| 861 | Ga0316587_1029176 | 3300033529 | Bacteria | 969 |
| 862 | Ga0316596_1077254 | 3300033541 | Bacteria | 894 |
| 863 | Ga0373951_0000993 | 3300035091 | Bacteria | 7605 |
| 864 | Ga0373951_0016691 | 3300035091 | Bacteria | 1658 |
| 865 | Ga0373952_0074749 | 3300035092 | Unclassified | 854 |
| 866 | Ga0373932_0137063 | 3300035112 | Unclassified | 829 |
| 867 | Ga0373932_0174589 | 3300035112 | Bacteria | 751 |
| 868 | Ga0373932_0286560 | 3300035112 | Unclassified | 611 |
| 869 | Ga0373939_0275552 | 3300035114 | Unclassified | 663 |
| 870 | Ga0373941_0008984 | 3300035115 | Bacteria | 2504 |
| 871 | Ga0373953_0018403 | 3300035117 | Bacteria | 2585 |
| 872 | Ga0373954_0000059 | 3300035118 | Bacteria | 38918 |
| 873 | Ga0373955_0376766 | 3300035172 | Bacteria | 861 |
| 874 | Ga0373942_0031044 | 3300035207 | Bacteria | 1410 |
| 875 | Ga0373961_0012637 | 3300035241 | Unclassified | 2118 |
| 876 | Ga0373962_0095627 | 3300035242 | Bacteria | 921 |
| 877 | Ga0316574_0053390 | 3300035398 | Bacteria | 2523 |
| 878 | Ga0373931_0195668 | 3300035691 | Bacteria | 1205 |
| 879 | Ga0373931_0841339 | 3300035691 | Unclassified | 614 |
| 880 | Ga0373931_0950653 | 3300035691 | Unclassified | 580 |
| 881 | Ga0373933_0019852 | 3300035724 | Bacteria | 3803 |
| 882 | Ga0373933_0494407 | 3300035724 | Unclassified | 801 |
| 883 | Ga0373947_0278960 | 3300035725 | Bacteria | 1111 |
| 884 | Ga0373937_0002664 | 3300036401 | Bacteria | 14883 |
| 885 | Ga0373937_0532011 | 3300036401 | Bacteria | 1117 |
| 886 | Ga0373937_1099284 | 3300036401 | Bacteria | 744 |
| 887 | Ga0373925_1610865 | 3300037068 | Bacteria | 531 |
| 888 | Ga0395899_0028641 | 3300037312 | Bacteria | 4193 |
| 889 | Ga0395899_0210171 | 3300037312 | Bacteria | 1352 |
| 890 | Ga0395900_0725165 | 3300037418 | Bacteria | 926 |
| 891 | Ga0395898_1475873 | 3300037466 | Unclassified | 606 |
| 892 | Ga0395901_1971731 | 3300038443 | Bacteria | 530 |
| 893 | Ga0242419_004777 | 3300038698 | Unclassified | 953 |
| 894 | Ga0400484_20020 | 3300038725 | Bacteria | 11330 |
| 895 | Ga0400484_40509 | 3300038725 | Bacteria | 10975 |
| 896 | Ga0400488_35053 | 3300038741 | Bacteria | 2374 |
| 897 | Ga0400486_28583 | 3300038742 | Bacteria | 22203 |
| 898 | Ga0242420_004643 | 3300038996 | Bacteria | 2087 |
| 899 | Ga0400483_001247 | 3300039062 | Bacteria | 12218 |
| 900 | Ga0400483_146956 | 3300039062 | Bacteria | 16590 |
| 901 | Ga0400483_187740 | 3300039062 | Bacteria | 1618 |
| 902 | Ga0400483_198698 | 3300039062 | Bacteria | 1176 |
| 903 | Ga0400483_213263 | 3300039062 | Bacteria | 16387 |
| 904 | Ga0400483_286518 | 3300039062 | Bacteria | 6875 |
| 905 | Ga0400487_23124 | 3300039110 | Bacteria | 1525 |
| 906 | Ga0436365_1063002 | 3300039437 | Bacteria | 607 |
| 907 | Ga0436365_1244758 | 3300039437 | Bacteria | 10107 |
| 908 | Ga0439436_0075656 | 3300041404 | Bacteria | 938 |
| 909 | Ga0439439_0002283 | 3300041406 | Bacteria | 4042 |
| 910 | Ga0439439_0041887 | 3300041406 | Bacteria | 1189 |
| 911 | Ga0439439_0080318 | 3300041406 | Bacteria | 881 |
| 912 | Ga0439465_0215616 | 3300041413 | Bacteria | 703 |
| 913 | Ga0451795_0900414 | 3300041456 | Bacteria | 1065 |
| 914 | Ga0451798_0094922 | 3300041458 | Bacteria | 856 |
| 915 | Ga0451800_1358168 | 3300041459 | Bacteria | 758 |
| 916 | Ga0451805_090425 | 3300041461 | Bacteria | 629 |
| 917 | Ga0451804_0704316 | 3300041463 | Bacteria | 695 |
| 918 | Ga0451845_0928614 | 3300041501 | Bacteria | 1704 |
| 919 | Ga0451849_0273965 | 3300041505 | Bacteria | 1672 |
| 920 | Ga0439433_0103506 | 3300041999 | Unclassified | 708 |
| 921 | Ga0439443_037385 | 3300042003 | Bacteria | 820 |
| 922 | Ga0439448_0079594 | 3300042005 | Bacteria | 1099 |
| 923 | Ga0439450_110915 | 3300042008 | Bacteria | 702 |
| 924 | Ga0439455_0053784 | 3300042012 | Bacteria | 1056 |
| 925 | Ga0439462_0087082 | 3300042015 | Bacteria | 855 |
| 926 | Ga0450921_006157 | 3300042123 | Bacteria | 926 |
| 927 | Ga0450894_007385 | 3300042131 | Bacteria | 1418 |
| 928 | Ga0450898_009730 | 3300042134 | Bacteria | 1542 |
| 929 | Ga0450910_018809 | 3300042147 | Bacteria | 1034 |
| 930 | Ga0439446_0054111 | 3300042156 | Bacteria | 1203 |
| 931 | Ga0439446_0098330 | 3300042156 | Bacteria | 923 |
| 932 | Ga0439458_0026212 | 3300042157 | Bacteria | 1370 |
| 933 | Ga0439459_0092623 | 3300042438 | Unclassified | 729 |
| 934 | Ga0451577_0017338 | 3300042876 | Bacteria | 6656 |
| 935 | Ga0451577_0788645 | 3300042876 | Bacteria | 858 |
| 936 | Ga0451577_1457282 | 3300042876 | Unclassified | 606 |
| 937 | Ga0453683_0267752 | 3300044673 | Bacteria | 1090 |
| 938 | Ga0453683_0573509 | 3300044673 | Unclassified | 735 |
| 939 | Ga0453684_0003452 | 3300044712 | Bacteria | 35581 |
| 940 | Ga0453684_0066242 | 3300044712 | Bacteria | 4600 |
| 941 | Ga0453684_1667936 | 3300044712 | Unclassified | 652 |
| 942 | Ga0453684_1861800 | 3300044712 | Bacteria | 610 |
| 943 | Ga0451576_0782912 | 3300045051 | Bacteria | 1002 |
| 944 | Ga0451576_1593135 | 3300045051 | Bacteria | 677 |
| 945 | Ga0495629_0549179 | 3300046459 | Unclassified | 775 |
| 946 | Ga0495629_0622841 | 3300046459 | Bacteria | 720 |
| 947 | Ga0495580_0043446 | 3300046472 | Bacteria | 3199 |
| 948 | Ga0495582_0241338 | 3300046473 | Bacteria | 1035 |
| 949 | Ga0495639_0113101 | 3300046475 | Bacteria | 1290 |
| 950 | Ga0495594_0126452 | 3300046499 | Bacteria | 1446 |
| 951 | Ga0495608_0149665 | 3300046511 | Bacteria | 1488 |
| 952 | Ga0495608_0393312 | 3300046511 | Bacteria | 849 |
| 953 | Ga0495618_0009589 | 3300046514 | Bacteria | 5846 |
| 954 | Ga0495628_0178595 | 3300046516 | Bacteria | 1607 |
| 955 | Ga0495630_0060577 | 3300046517 | Bacteria | 2841 |
| 956 | Ga0495630_0209707 | 3300046517 | Bacteria | 1487 |
| 957 | Ga0495663_0062646 | 3300046525 | Bacteria | 1172 |
| 958 | Ga0495666_0025956 | 3300046526 | Bacteria | 2891 |
| 959 | Ga0495652_0468599 | 3300046529 | Unclassified | 879 |
| 960 | Ga0495640_0038941 | 3300046533 | Bacteria | 3340 |
| 961 | Ga0495640_0607224 | 3300046533 | Unclassified | 660 |
| 962 | Ga0495586_0001882 | 3300046535 | Bacteria | 11418 |
| 963 | Ga0495586_0149653 | 3300046535 | Bacteria | 1313 |
| 964 | Ga0495634_0041778 | 3300046642 | Bacteria | 3113 |
| 965 | Ga0495635_0294853 | 3300046663 | Bacteria | 1088 |
| 966 | Ga0495635_0314849 | 3300046663 | Bacteria | 1048 |
| 967 | Ga0495657_0214837 | 3300046675 | Bacteria | 1168 |
| 968 | Ga0495647_0039160 | 3300046681 | Bacteria | 1795 |
| 969 | Ga0495647_0106343 | 3300046681 | Bacteria | 1167 |
| 970 | Ga0495658_0024044 | 3300046683 | Bacteria | 3240 |
| 971 | Ga0495658_0353318 | 3300046683 | Unclassified | 934 |
| 972 | Ga0495613_0048441 | 3300046689 | Bacteria | 3138 |
| 973 | Ga0495613_0278931 | 3300046689 | Bacteria | 1161 |
| 974 | Ga0495624_0103007 | 3300046690 | Bacteria | 1757 |
| 975 | Ga0495600_0173356 | 3300046809 | Bacteria | 1392 |
| 976 | Ga0495581_0181766 | 3300047315 | Bacteria | 1230 |
| 977 | Ga0495581_0463077 | 3300047315 | Unclassified | 738 |
| 978 | Ga0495674_0003864 | 3300047319 | Bacteria | 14553 |
| 979 | Ga0495676_0165594 | 3300047321 | Bacteria | 1560 |
| 980 | Ga0495680_0026186 | 3300047322 | Bacteria | 4813 |
| 981 | Ga0495680_0087918 | 3300047322 | Bacteria | 2336 |
| 982 | Ga0495684_0241561 | 3300047471 | Bacteria | 1317 |
| 983 | Ga0495684_0431556 | 3300047471 | Bacteria | 919 |
| 984 | Ga0496100_0506796 | 3300048903 | Bacteria | 930 |
| 985 | Ga0496101_0600903 | 3300048904 | Bacteria | 870 |
| 986 | Ga0496102_0014942 | 3300048905 | Bacteria | 6756 |
| 987 | Ga0496102_0134390 | 3300048905 | Bacteria | 2317 |
| 988 | Ga0496102_0337884 | 3300048905 | Bacteria | 1419 |
| 989 | Ga0496102_0596375 | 3300048905 | Bacteria | 1028 |
| 990 | Ga0496103_0055914 | 3300048906 | Bacteria | 2449 |
| 991 | Ga0496103_0073160 | 3300048906 | Bacteria | 2147 |
| 992 | Ga0496104_0064013 | 3300048907 | Bacteria | 3489 |
| 993 | Ga0496106_0011284 | 3300048909 | Bacteria | 6612 |
| 994 | Ga0496106_0055981 | 3300048909 | Bacteria | 2982 |
| 995 | Ga0496106_0167336 | 3300048909 | Bacteria | 1741 |
| 996 | Ga0496107_0327116 | 3300048910 | Bacteria | 1141 |
| 997 | Ga0496108_0128393 | 3300048911 | Bacteria | 2178 |
| 998 | Ga0496108_1272203 | 3300048911 | Bacteria | 620 |
| 999 | Ga0496109_0637578 | 3300048912 | Bacteria | 1002 |
| 1000 | Ga0496109_0972430 | 3300048912 | Unclassified | 787 |
| 1001 | Ga0496110_0704198 | 3300048913 | Bacteria | 912 |
| 1002 | Ga0496111_0292601 | 3300048914 | Bacteria | 1208 |
| 1003 | Ga0496112_0214235 | 3300048915 | Bacteria | 1883 |
| 1004 | Ga0496112_0942103 | 3300048915 | Bacteria | 785 |
| 1005 | Ga0496112_1079468 | 3300048915 | Bacteria | 721 |
| 1006 | Ga0496112_1429218 | 3300048915 | Bacteria | 606 |
| 1007 | Ga0496113_0079114 | 3300048916 | Bacteria | 2516 |
| 1008 | Ga0496117_0000124 | 3300048920 | Bacteria | 169701 |
| 1009 | Ga0496118_0271180 | 3300048921 | Bacteria | 950 |
| 1010 | Ga0496119_0000020 | 3300048922 | Bacteria | 285602 |
| 1011 | Ga0496120_0000006 | 3300048923 | Bacteria | 445068 |
| 1012 | Ga0496122_0000040 | 3300048925 | Bacteria | 285095 |
| 1013 | Ga0496122_0002362 | 3300048925 | Bacteria | 27135 |
| 1014 | Ga0496123_0000572 | 3300048926 | Bacteria | 62779 |
| 1015 | Ga0496123_0066153 | 3300048926 | Bacteria | 2291 |
| 1016 | Ga0496124_0335935 | 3300048927 | Bacteria | 1075 |
| 1017 | Ga0496125_0000010 | 3300048928 | Bacteria | 671167 |
| 1018 | Ga0496126_0000210 | 3300048929 | Bacteria | 131214 |
| 1019 | Ga0496126_0001553 | 3300048929 | Bacteria | 35275 |
| 1020 | Ga0496126_0375927 | 3300048929 | Bacteria | 1157 |
| 1021 | Ga0501306_040718 | 3300049127 | Bacteria | 720 |
| 1022 | Ga0501306_099876 | 3300049127 | Unclassified | 518 |
| 1023 | Ga0501308_023743 | 3300049128 | Bacteria | 784 |
| 1024 | Ga0501308_024132 | 3300049128 | Bacteria | 780 |
| 1025 | Ga0501308_045953 | 3300049128 | Bacteria | 627 |
| 1026 | Ga0501308_058322 | 3300049128 | Unclassified | 578 |
| 1027 | Ga0501309_026702 | 3300049129 | Bacteria | 835 |
| 1028 | Ga0501309_056865 | 3300049129 | Bacteria | 623 |
| 1029 | Ga0501310_015178 | 3300049130 | Bacteria | 911 |
| 1030 | Ga0501310_035763 | 3300049130 | Unclassified | 675 |
| 1031 | Ga0501310_048314 | 3300049130 | Bacteria | 610 |
| 1032 | Ga0501343_011884 | 3300049132 | Unclassified | 720 |
| 1033 | Ga0501344_06827 | 3300049133 | Bacteria | 664 |
| 1034 | Ga0501304_005939 | 3300049160 | Unclassified | 971 |
| 1035 | Ga0501304_018785 | 3300049160 | Bacteria | 670 |
| 1036 | Ga0501304_028682 | 3300049160 | Bacteria | 583 |
| 1037 | Ga0501305_016297 | 3300049161 | Bacteria | 1058 |
| 1038 | Ga0501305_025732 | 3300049161 | Bacteria | 894 |
| 1039 | Ga0501305_037827 | 3300049161 | Unclassified | 776 |
| 1040 | Ga0501305_052204 | 3300049161 | Bacteria | 688 |
| 1041 | Ga0501305_053400 | 3300049161 | Bacteria | 683 |
| 1042 | Ga0501305_056471 | 3300049161 | Bacteria | 668 |
| 1043 | Ga0501305_066389 | 3300049161 | Bacteria | 628 |
| 1044 | Ga0501307_037061 | 3300049162 | Bacteria | 697 |
| 1045 | Ga0501291_087566 | 3300049514 | Bacteria | 630 |
| 1046 | Ga0501292_033197 | 3300049515 | Bacteria | 873 |
| 1047 | Ga0501292_074768 | 3300049515 | Bacteria | 635 |
| 1048 | Ga0501295_055282 | 3300049518 | Bacteria | 858 |
| 1049 | Ga0501297_024037 | 3300049520 | Unclassified | 777 |
| 1050 | Ga0501298_032456 | 3300049521 | Bacteria | 1031 |
| 1051 | Ga0501298_087216 | 3300049521 | Bacteria | 694 |
| 1052 | Ga0501299_013433 | 3300049522 | Bacteria | 1413 |
| 1053 | Ga0501300_039120 | 3300049523 | Bacteria | 712 |
| 1054 | Ga0501311_014226 | 3300049527 | Bacteria | 1014 |
| 1055 | Ga0501311_043675 | 3300049527 | Bacteria | 686 |
| 1056 | Ga0501312_031210 | 3300049528 | Bacteria | 836 |
| 1057 | Ga0501312_061312 | 3300049528 | Bacteria | 652 |
| 1058 | Ga0501312_090901 | 3300049528 | Bacteria | 563 |
| 1059 | Ga0501313_018888 | 3300049529 | Bacteria | 840 |
| 1060 | Ga0501313_039109 | 3300049529 | Bacteria | 634 |
| 1061 | Ga0501313_053819 | 3300049529 | Bacteria | 561 |
| 1062 | Ga0501313_062270 | 3300049529 | Bacteria | 530 |
| 1063 | Ga0501314_019331 | 3300049530 | Bacteria | 699 |
| 1064 | Ga0501315_017336 | 3300049531 | Bacteria | 941 |
| 1065 | Ga0501316_017891 | 3300049532 | Bacteria | 872 |
| 1066 | Ga0501316_038051 | 3300049532 | Unclassified | 663 |
| 1067 | Ga0501317_001899 | 3300049533 | Bacteria | 1891 |
| 1068 | Ga0501317_028335 | 3300049533 | Bacteria | 800 |
| 1069 | Ga0501317_083258 | 3300049533 | Bacteria | 556 |
| 1070 | Ga0501318_015346 | 3300049534 | Bacteria | 914 |
| 1071 | Ga0501318_054930 | 3300049534 | Bacteria | 600 |
| 1072 | Ga0501319_027394 | 3300049535 | Bacteria | 536 |
| 1073 | Ga0501319_033509 | 3300049535 | Bacteria | 502 |
| 1074 | Ga0501321_055582 | 3300049537 | Unclassified | 588 |
| 1075 | Ga0501321_072315 | 3300049537 | Bacteria | 538 |
| 1076 | Ga0501322_019756 | 3300049538 | Bacteria | 584 |
| 1077 | Ga0501323_010617 | 3300049539 | Bacteria | 1100 |
| 1078 | Ga0501323_061567 | 3300049539 | Bacteria | 587 |
| 1079 | Ga0501325_055035 | 3300049541 | Bacteria | 514 |
| 1080 | Ga0501325_058802 | 3300049541 | Bacteria | 504 |
| 1081 | Ga0501328_03904 | 3300049544 | Bacteria | 707 |
| 1082 | Ga0501336_007859 | 3300049552 | Unclassified | 816 |
| 1083 | Ga0501336_013575 | 3300049552 | Bacteria | 683 |
| 1084 | Ga0501338_17987 | 3300049554 | Bacteria | 516 |
| 1085 | Ga0501031_0713524 | 3300049568 | Bacteria | 644 |
| 1086 | Ga0501032_0138176 | 3300049569 | Bacteria | 1605 |
| 1087 | Ga0501033_0026759 | 3300049570 | Bacteria | 4339 |
| 1088 | Ga0501033_0318417 | 3300049570 | Bacteria | 1093 |
| 1089 | Ga0501033_0506978 | 3300049570 | Bacteria | 834 |
| 1090 | Ga0501034_0001355 | 3300049571 | Bacteria | 33121 |
| 1091 | Ga0501034_0029781 | 3300049571 | Bacteria | 5549 |
| 1092 | Ga0501034_0059419 | 3300049571 | Bacteria | 3840 |
| 1093 | Ga0501034_0180453 | 3300049571 | Bacteria | 2076 |
| 1094 | Ga0501034_0185921 | 3300049571 | Bacteria | 2041 |
| 1095 | Ga0501036_0748652 | 3300049572 | Bacteria | 806 |
| 1096 | Ga0501037_0037626 | 3300049573 | Bacteria | 3567 |
| 1097 | Ga0501037_0078468 | 3300049573 | Bacteria | 2396 |
| 1098 | Ga0501038_0266413 | 3300049574 | Bacteria | 1352 |
| 1099 | Ga0501038_0789812 | 3300049574 | Bacteria | 706 |
| 1100 | Ga0501043_0096873 | 3300049579 | Bacteria | 2319 |
| 1101 | Ga0501046_0049179 | 3300049580 | Bacteria | 3336 |
| 1102 | Ga0501047_0002187 | 3300049581 | Bacteria | 18716 |
| 1103 | Ga0501047_0008012 | 3300049581 | Bacteria | 9964 |
| 1104 | Ga0501048_0460568 | 3300049582 | Bacteria | 911 |
| 1105 | Ga0501067_0001052 | 3300049583 | Bacteria | 14855 |
| 1106 | Ga0501067_0002587 | 3300049583 | Bacteria | 9997 |
| 1107 | Ga0501068_0000171 | 3300049584 | Bacteria | 30356 |
| 1108 | Ga0501068_0011181 | 3300049584 | Bacteria | 5058 |
| 1109 | Ga0501069_0000098 | 3300049585 | Bacteria | 40879 |
| 1110 | Ga0501069_0000278 | 3300049585 | Bacteria | 23255 |
| 1111 | Ga0501070_0000192 | 3300049586 | Bacteria | 57359 |
| 1112 | Ga0501070_0005766 | 3300049586 | Bacteria | 10562 |
| 1113 | Ga0501070_0141834 | 3300049586 | Bacteria | 1984 |
| 1114 | Ga0501071_0000060 | 3300049587 | Bacteria | 37746 |
| 1115 | Ga0501071_0006621 | 3300049587 | Bacteria | 7526 |
| 1116 | Ga0501071_0334751 | 3300049587 | Bacteria | 1151 |
| 1117 | Ga0501072_0000081 | 3300049588 | Bacteria | 70723 |
| 1118 | Ga0501072_0172389 | 3300049588 | Bacteria | 1726 |
| 1119 | Ga0501072_1060246 | 3300049588 | Bacteria | 631 |
| 1120 | Ga0501073_0000699 | 3300049589 | Bacteria | 23637 |
| 1121 | Ga0501073_0022302 | 3300049589 | Bacteria | 4561 |
| 1122 | Ga0501074_0001663 | 3300049590 | Bacteria | 15116 |
| 1123 | Ga0501074_0003209 | 3300049590 | Bacteria | 11537 |
| 1124 | Ga0501074_0443048 | 3300049590 | Bacteria | 921 |
| 1125 | Ga0501074_0540640 | 3300049590 | Bacteria | 825 |
| 1126 | Ga0501075_0065194 | 3300049591 | Bacteria | 2748 |
| 1127 | Ga0501076_0387765 | 3300049592 | Bacteria | 1148 |
| 1128 | Ga0501198_014327 | 3300049649 | Bacteria | 1207 |
| 1129 | Ga0501199_011422 | 3300049650 | Bacteria | 960 |
| 1130 | Ga0501199_034519 | 3300049650 | Bacteria | 635 |
| 1131 | Ga0501201_004663 | 3300049651 | Bacteria | 1274 |
| 1132 | Ga0501201_024820 | 3300049651 | Bacteria | 654 |
| 1133 | Ga0501202_006804 | 3300049652 | Bacteria | 2054 |
| 1134 | Ga0501202_031347 | 3300049652 | Bacteria | 1111 |
| 1135 | Ga0501202_218305 | 3300049652 | Bacteria | 527 |
| 1136 | Ga0501206_022463 | 3300049653 | Bacteria | 905 |
| 1137 | Ga0501206_075402 | 3300049653 | Bacteria | 578 |
| 1138 | Ga0501207_033437 | 3300049654 | Unclassified | 872 |
| 1139 | Ga0501208_098677 | 3300049655 | Bacteria | 623 |
| 1140 | Ga0501209_046355 | 3300049656 | Bacteria | 1170 |
| 1141 | Ga0501214_026930 | 3300049659 | Bacteria | 767 |
| 1142 | Ga0501214_033838 | 3300049659 | Unclassified | 714 |
| 1143 | Ga0501216_004483 | 3300049660 | Bacteria | 2074 |
| 1144 | Ga0501216_153221 | 3300049660 | Bacteria | 549 |
| 1145 | Ga0501217_001688 | 3300049661 | Bacteria | 4202 |
| 1146 | Ga0501217_018391 | 3300049661 | Bacteria | 1622 |
| 1147 | Ga0501217_023195 | 3300049661 | Bacteria | 1477 |
| 1148 | Ga0501217_081198 | 3300049661 | Bacteria | 898 |
| 1149 | Ga0501217_171747 | 3300049661 | Unclassified | 660 |
| 1150 | Ga0501223_006757 | 3300049663 | Bacteria | 2362 |
| 1151 | Ga0501224_002475 | 3300049664 | Bacteria | 2521 |
| 1152 | Ga0501224_029439 | 3300049664 | Bacteria | 822 |
| 1153 | Ga0501227_006471 | 3300049665 | Bacteria | 2518 |
| 1154 | Ga0501227_023203 | 3300049665 | Bacteria | 1441 |
| 1155 | Ga0501227_115432 | 3300049665 | Bacteria | 722 |
| 1156 | Ga0501228_003303 | 3300049666 | Bacteria | 1321 |
| 1157 | Ga0501230_004322 | 3300049667 | Bacteria | 1947 |
| 1158 | Ga0501233_029106 | 3300049668 | Bacteria | 1237 |
| 1159 | Ga0501233_039001 | 3300049668 | Bacteria | 1108 |
| 1160 | Ga0501233_075427 | 3300049668 | Bacteria | 861 |
| 1161 | Ga0501235_001522 | 3300049669 | Bacteria | 4964 |
| 1162 | Ga0501235_013655 | 3300049669 | Bacteria | 1789 |
| 1163 | Ga0501235_019237 | 3300049669 | Bacteria | 1515 |
| 1164 | Ga0501236_018815 | 3300049670 | Bacteria | 1001 |
| 1165 | Ga0501238_036710 | 3300049671 | Bacteria | 716 |
| 1166 | Ga0501239_004726 | 3300049672 | Bacteria | 1349 |
| 1167 | Ga0501239_010235 | 3300049672 | Bacteria | 1030 |
| 1168 | Ga0501239_041565 | 3300049672 | Bacteria | 638 |
| 1169 | Ga0501240_032149 | 3300049673 | Bacteria | 843 |
| 1170 | Ga0501242_036833 | 3300049674 | Bacteria | 680 |
| 1171 | Ga0501243_011673 | 3300049675 | Bacteria | 1380 |
| 1172 | Ga0501243_049379 | 3300049675 | Bacteria | 756 |
| 1173 | Ga0501246_009917 | 3300049676 | Unclassified | 863 |
| 1174 | Ga0501247_000073 | 3300049677 | Bacteria | 5549 |
| 1175 | Ga0501249_108615 | 3300049679 | Bacteria | 669 |
| 1176 | Ga0501249_119467 | 3300049679 | Bacteria | 643 |
| 1177 | Ga0501250_002177 | 3300049680 | Bacteria | 1743 |
| 1178 | Ga0501250_080830 | 3300049680 | Unclassified | 552 |
| 1179 | Ga0501252_007501 | 3300049682 | Bacteria | 1236 |
| 1180 | Ga0501253_025427 | 3300049683 | Bacteria | 1082 |
| 1181 | Ga0501256_009852 | 3300049685 | Bacteria | 906 |
| 1182 | Ga0501257_012072 | 3300049686 | Bacteria | 1974 |
| 1183 | Ga0501258_004870 | 3300049687 | Bacteria | 1283 |
| 1184 | Ga0501260_018696 | 3300049689 | Unclassified | 740 |
| 1185 | Ga0501260_018938 | 3300049689 | Bacteria | 736 |
| 1186 | Ga0501219_006974 | 3300049703 | Unclassified | 813 |
| 1187 | Ga0501221_004593 | 3300049704 | Bacteria | 2288 |
| 1188 | Ga0501221_027066 | 3300049704 | Bacteria | 1170 |
| 1189 | Ga0501221_069436 | 3300049704 | Unclassified | 829 |
| 1190 | Ga0501225_0001628 | 3300049705 | Bacteria | 7020 |
| 1191 | Ga0501225_0079146 | 3300049705 | Bacteria | 942 |
| 1192 | Ga0501225_0117326 | 3300049705 | Bacteria | 788 |
| 1193 | Ga0501234_004052 | 3300049707 | Bacteria | 2300 |
| 1194 | Ga0501245_010568 | 3300049708 | Bacteria | 1335 |
| 1195 | Ga0501245_034195 | 3300049708 | Bacteria | 851 |
| 1196 | Ga0501079_0284538 | 3300049741 | Bacteria | 1293 |
| 1197 | Ga0501079_0674288 | 3300049741 | Bacteria | 814 |
| 1198 | Ga0501080_0000060 | 3300049742 | Bacteria | 71292 |
| 1199 | Ga0501080_0001835 | 3300049742 | Bacteria | 18214 |
| 1200 | Ga0501081_0026798 | 3300049743 | Bacteria | 3889 |
| 1201 | Ga0501081_0420735 | 3300049743 | Bacteria | 990 |
| 1202 | Ga0501083_0005831 | 3300049744 | Bacteria | 8722 |
| 1203 | Ga0501083_0006130 | 3300049744 | Bacteria | 8524 |
| 1204 | Ga0501083_0443158 | 3300049744 | Bacteria | 845 |
| 1205 | Ga0501262_013326 | 3300049759 | Bacteria | 1059 |
| 1206 | Ga0501262_077419 | 3300049759 | Unclassified | 552 |
| 1207 | Ga0501263_021333 | 3300049760 | Bacteria | 873 |
| 1208 | Ga0501267_028592 | 3300049764 | Bacteria | 647 |
| 1209 | Ga0501268_001380 | 3300049765 | Bacteria | 3020 |
| 1210 | Ga0501268_082798 | 3300049765 | Bacteria | 665 |
| 1211 | Ga0501270_004084 | 3300049767 | Bacteria | 1620 |
| 1212 | Ga0501270_102705 | 3300049767 | Bacteria | 599 |
| 1213 | Ga0501272_007118 | 3300049769 | Bacteria | 1207 |
| 1214 | Ga0501273_007298 | 3300049770 | Bacteria | 1298 |
| 1215 | Ga0501276_024520 | 3300049773 | Unclassified | 598 |
| 1216 | Ga0501279_024795 | 3300049775 | Bacteria | 869 |
| 1217 | Ga0501283_004964 | 3300049779 | Bacteria | 1813 |
| 1218 | Ga0501035_0000725 | 3300049822 | Bacteria | 35719 |
| 1219 | Ga0501035_0166130 | 3300049822 | Bacteria | 1908 |
| 1220 | Ga0501035_0269264 | 3300049822 | Bacteria | 1442 |
| 1221 | Ga0501044_0000055 | 3300049823 | Bacteria | 140119 |
| 1222 | Ga0501044_0035643 | 3300049823 | Bacteria | 5209 |
| 1223 | Ga0501044_0038408 | 3300049823 | Bacteria | 4999 |
| 1224 | Ga0501044_0825482 | 3300049823 | Bacteria | 805 |
| 1225 | Ga0501212_034973 | 3300049851 | Bacteria | 819 |
| 1226 | Ga0501226_010581 | 3300049853 | Unclassified | 1022 |
| 1227 | nmdc:mga03n38_289882_c1 | 3300050490 | Bacteria | 876 |
| 1228 | nmdc:mga00v17_182539_c1 | 3300050491 | Bacteria | 1354 |
| 1229 | nmdc:mga06z11_346260_c1 | 3300050494 | Unclassified | 889 |
| 1230 | nmdc:mga06z11_653659_c1 | 3300050494 | Bacteria | 640 |
| 1231 | nmdc:mga07m45_289507_c1 | 3300050496 | Bacteria | 953 |
| 1232 | nmdc:mga07m45_461163_c1 | 3300050496 | Bacteria | 737 |
| 1233 | nmdc:mga05p37_1035569_c1 | 3300050507 | Unclassified | 868 |
| 1234 | nmdc:mga05p37_136331_c2 | 3300050507 | Bacteria | 830 |
| 1235 | nmdc:mga05p37_14945_c1 | 3300050507 | Bacteria | 9319 |
| 1236 | nmdc:mga05p37_273385_c1 | 3300050507 | Bacteria | 2018 |
| 1237 | nmdc:mga05p37_456412_c1 | 3300050507 | Bacteria | 1478 |
| 1238 | nmdc:mga05p37_802723_c1 | 3300050507 | Bacteria | 1029 |
| 1239 | nmdc:mga09592_18806_c1 | 3300050508 | Bacteria | 5668 |
| 1240 | nmdc:mga09592_198902_c1 | 3300050508 | Bacteria | 1735 |
| 1241 | nmdc:mga09592_281705_c1 | 3300050508 | Bacteria | 1442 |
| 1242 | nmdc:mga0qj67_145881_c1 | 3300050509 | Bacteria | 1919 |
| 1243 | nmdc:mga06r32_13980_c2 | 3300050510 | Bacteria | 4159 |
| 1244 | nmdc:mga06r32_26098_c1 | 3300050510 | Bacteria | 5443 |
| 1245 | nmdc:mga06r32_736506_c1 | 3300050510 | Unclassified | 950 |
| 1246 | nmdc:mga08y16_1346998_c1 | 3300050511 | Bacteria | 679 |
| 1247 | nmdc:mga08y16_135276_c1 | 3300050511 | Bacteria | 2562 |
| 1248 | nmdc:mga08y16_276937_c1 | 3300050511 | Bacteria | 1731 |
| 1249 | nmdc:mga08y16_3423_c1 | 3300050511 | Bacteria | 16464 |
| 1250 | nmdc:mga08y16_397281_c1 | 3300050511 | Bacteria | 1411 |
| 1251 | nmdc:mga08y16_466215_c1 | 3300050511 | Bacteria | 1287 |
| 1252 | nmdc:mga08y16_63647_c1 | 3300050511 | Bacteria | 3852 |
| 1253 | nmdc:mga0n895_210958_c1 | 3300050512 | Bacteria | 1972 |
| 1254 | nmdc:mga0n895_3125_c1 | 3300050512 | Bacteria | 13200 |
| 1255 | nmdc:mga0n895_43244_c1 | 3300050512 | Bacteria | 4389 |
| 1256 | nmdc:mga0n895_521573_c1 | 3300050512 | Bacteria | 1196 |
| 1257 | nmdc:mga0n895_597590_c1 | 3300050512 | Bacteria | 1106 |
| 1258 | nmdc:mga0n895_87209_c1 | 3300050512 | Bacteria | 3118 |
| 1259 | nmdc:mga0rr50_1548924_c1 | 3300050513 | Bacteria | 560 |
| 1260 | nmdc:mga0a205_10797_c1 | 3300050515 | Bacteria | 8402 |
| 1261 | nmdc:mga0a205_109324_c1 | 3300050515 | Bacteria | 2663 |
| 1262 | nmdc:mga0a205_209373_c1 | 3300050515 | Bacteria | 1839 |
| 1263 | nmdc:mga0a205_30310_c1 | 3300050515 | Bacteria | 5178 |
| 1264 | nmdc:mga0a205_47953_c1 | 3300050515 | Bacteria | 4122 |
| 1265 | nmdc:mga0a205_57086_c1 | 3300050515 | Bacteria | 2816 |
| 1266 | nmdc:mga0a205_74150_c1 | 3300050515 | Bacteria | 3288 |
| 1267 | nmdc:mga0a205_8297_c1 | 3300050515 | Bacteria | 9446 |
| 1268 | Ga0495601_0442508 | 3300053077 | Bacteria | 841 |
| 1269 | Ga0495619_0158459 | 3300053085 | Bacteria | 1563 |
| 1270 | Ga0500555_019577 | 3300053103 | Bacteria | 1949 |
| 1271 | Ga0500562_053230 | 3300053108 | Bacteria | 1084 |
| 1272 | Ga0500562_061006 | 3300053108 | Bacteria | 1013 |
| 1273 | Ga0500652_293418 | 3300053131 | Bacteria | 631 |
| 1274 | Ga0500568_0009639 | 3300053139 | Bacteria | 4575 |
| 1275 | Ga0501084_0005867 | 3300054114 | Bacteria | 10106 |
| 1276 | Ga0501084_0089052 | 3300054114 | Bacteria | 2590 |
| 1277 | Ga0587084_083359 | 3300059477 | Unclassified | 623 |
| 1278 | Ga0587093_054102 | 3300059478 | Bacteria | 640 |
| 1279 | Ga0587066_036361 | 3300059490 | Bacteria | 906 |
| 1280 | Ga0587070_025959 | 3300059491 | Bacteria | 1026 |
| 1281 | Ga0587070_042562 | 3300059491 | Bacteria | 875 |
| 1282 | Ga0587070_107990 | 3300059491 | Bacteria | 649 |
| 1283 | Ga0587070_217181 | 3300059491 | Bacteria | 516 |
| 1284 | Ga0587073_0115243 | 3300059492 | Bacteria | 718 |
| 1285 | Ga0587073_0166255 | 3300059492 | Unclassified | 636 |
| 1286 | Ga0587077_103973 | 3300059493 | Bacteria | 686 |
| 1287 | Ga0587077_121442 | 3300059493 | Unclassified | 652 |
| 1288 | Ga0587080_079553 | 3300059503 | Unclassified | 670 |
| 1289 | Ga0587082_037531 | 3300059504 | Bacteria | 874 |
| 1290 | Ga0587082_107150 | 3300059504 | Bacteria | 616 |
| 1291 | Ga0587082_107384 | 3300059504 | Unclassified | 616 |
| 1292 | Ga0587083_0008127 | 3300059505 | Bacteria | 1631 |
| 1293 | Ga0587085_081748 | 3300059506 | Unclassified | 652 |
| 1294 | Ga0587085_084110 | 3300059506 | Bacteria | 646 |
| 1295 | Ga0587086_027433 | 3300059507 | Unclassified | 817 |
| 1296 | Ga0587088_051225 | 3300059508 | Bacteria | 809 |
| 1297 | Ga0587089_057413 | 3300059509 | Unclassified | 637 |
| 1298 | Ga0587090_027309 | 3300059510 | Bacteria | 933 |
| 1299 | Ga0587090_060831 | 3300059510 | Bacteria | 716 |
| 1300 | Ga0587090_152475 | 3300059510 | Bacteria | 525 |
| 1301 | Ga0587091_103385 | 3300059511 | Unclassified | 671 |
| 1302 | Ga0587091_175899 | 3300059511 | Bacteria | 560 |
| 1303 | Ga0587092_012250 | 3300059512 | Bacteria | 1207 |
| 1304 | Ga0587092_140704 | 3300059512 | Bacteria | 531 |
| 1305 | Ga0587094_050094 | 3300059513 | Bacteria | 705 |
| 1306 | Ga0587098_093001 | 3300059604 | Unclassified | 517 |
| 1307 | Ga0587106_027033 | 3300059605 | Bacteria | 895 |
| 1308 | Ga0587106_034352 | 3300059605 | Bacteria | 831 |
| 1309 | Ga0587106_148539 | 3300059605 | Unclassified | 520 |
| 1310 | Ga0587125_043802 | 3300059607 | Bacteria | 612 |
| 1311 | Ga0587101_033300 | 3300059623 | Bacteria | 815 |
| 1312 | Ga0587101_142642 | 3300059623 | Unclassified | 513 |
| 1313 | Ga0587109_055645 | 3300059624 | Unclassified | 821 |
| 1314 | Ga0587109_108434 | 3300059624 | Bacteria | 646 |
| 1315 | Ga0587109_129831 | 3300059624 | Bacteria | 606 |
| 1316 | Ga0587115_122583 | 3300059626 | Bacteria | 501 |
| 1317 | Ga0587117_032576 | 3300059627 | Bacteria | 794 |
| 1318 | Ga0587117_102387 | 3300059627 | Bacteria | 547 |
| 1319 | Ga0587128_135202 | 3300059630 | Bacteria | 549 |
| 1320 | Ga0587062_059017 | 3300059639 | Unclassified | 668 |
| 1321 | Ga0587062_087577 | 3300059639 | Unclassified | 588 |
| 1322 | Ga0587067_001767 | 3300059640 | Bacteria | 2426 |
| 1323 | Ga0587067_101685 | 3300059640 | Unclassified | 666 |
| 1324 | Ga0587068_064796 | 3300059641 | Bacteria | 710 |
| 1325 | Ga0587068_073238 | 3300059641 | Unclassified | 679 |
| 1326 | Ga0587072_008811 | 3300059643 | Bacteria | 1605 |
| 1327 | Ga0587072_082714 | 3300059643 | Bacteria | 696 |
| 1328 | Ga0587075_149732 | 3300059644 | Unclassified | 504 |
| 1329 | Ga0587076_014747 | 3300059645 | Bacteria | 1208 |
| 1330 | Ga0587076_088903 | 3300059645 | Bacteria | 672 |
| 1331 | Ga0587076_124797 | 3300059645 | Unclassified | 600 |
| 1332 | Ga0587076_152258 | 3300059645 | Bacteria | 562 |
| 1333 | Ga0587078_013763 | 3300059646 | Bacteria | 962 |
| 1334 | Ga0587078_035794 | 3300059646 | Unclassified | 685 |
| 1335 | Ga0587079_052533 | 3300059647 | Bacteria | 860 |
| 1336 | Ga0587100_012657 | 3300059648 | Unclassified | 741 |
| 1337 | Ga0587100_039100 | 3300059648 | Unclassified | 529 |
| 1338 | Ga0587102_065831 | 3300059649 | Bacteria | 514 |
| 1339 | Ga0587107_033685 | 3300059652 | Unclassified | 794 |
| 1340 | Ga0587124_009956 | 3300059660 | Bacteria | 841 |
| 1341 | Ga0587071_046129 | 3300060344 | Bacteria | 888 |
| 1342 | Ga0587071_049969 | 3300060344 | Bacteria | 862 |
| 1343 | Ga0587111_0070334 | 3300060346 | Bacteria | 815 |
| 1344 | Ga0587111_0104482 | 3300060346 | Bacteria | 710 |
| 1345 | Ga0501082_0001299 | 3300060353 | Bacteria | 21903 |
| 1346 | Ga0501082_0032717 | 3300060353 | Bacteria | 4485 |
| 1347 | Ga0530510_0043032 | 3300061734 | Bacteria | 3262 |
| 1348 | Ga0530510_0175054 | 3300061734 | Bacteria | 1590 |
| 1349 | Ga0530510_0562287 | 3300061734 | Bacteria | 867 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0788645 | Ga0451577_0788645_344_802 | 125 |
| 2 | 3300044712 | Ga0453684_0066242 | Ga0453684_0066242_801_1259 | 125 |
| 3 | 3300046459 | Ga0495629_0549179 | Ga0495629_0549179_366_743 | 125 |
| 4 | iso_pu_bacteria | 2565956521 | 2566035421 | 138 |
| 5 | 3300037312 | Ga0395899_0028641 | Ga0395899_0028641_121_543 | 140 |
| 6 | 3300037312 | Ga0395899_0210171 | Ga0395899_0210171_426_848 | 140 |
| 7 | 3300049161 | Ga0501305_025732 | Ga0501305_025732_91_513 | 140 |
| 8 | 3300049161 | Ga0501305_066389 | Ga0501305_066389_116_538 | 140 |
| 9 | 3300049529 | Ga0501313_018888 | Ga0501313_018888_337_759 | 140 |
| 10 | 3300049529 | Ga0501313_039109 | Ga0501313_039109_127_549 | 140 |
| 11 | 3300049529 | Ga0501313_053819 | Ga0501313_053819_55_477 | 140 |
| 12 | 3300049531 | Ga0501315_017336 | Ga0501315_017336_91_513 | 140 |
| 13 | 3300049532 | Ga0501316_017891 | Ga0501316_017891_96_518 | 140 |
| 14 | 3300049533 | Ga0501317_028335 | Ga0501317_028335_38_460 | 140 |
| 15 | 3300049534 | Ga0501318_015346 | Ga0501318_015346_402_824 | 140 |
| 16 | 3300049535 | Ga0501319_033509 | Ga0501319_033509_58_480 | 140 |
| 17 | 3300049538 | Ga0501322_019756 | Ga0501322_019756_82_504 | 140 |
| 18 | 3300049539 | Ga0501323_061567 | Ga0501323_061567_85_507 | 140 |
| 19 | 3300049544 | Ga0501328_03904 | Ga0501328_03904_229_651 | 140 |
| 20 | 3300049554 | Ga0501338_17987 | Ga0501338_17987_65_487 | 140 |
| 21 | 3300026089 | Ga0207648_10290567 | Ga0207648_102905672 | 141 |
| 22 | 3300031903 | Ga0307407_10476523 | Ga0307407_104765231 | 141 |
| 23 | 3300032005 | Ga0307411_10699663 | Ga0307411_106996632 | 141 |
| 24 | 3300049741 | Ga0501079_0674288 | Ga0501079_0674288_71_508 | 141 |
| 25 | iso_pu_bacteria | 2585428059 | 2587744046 | 141 |
| 26 | iso_pu_bacteria | 2593339131 | 2595092408 | 141 |
| 27 | iso_pu_bacteria | 2643221676 | 2644424465 | 141 |
| 28 | iso_pu_bacteria | 2738543017 | 2739271720 | 141 |
| 29 | iso_pu_bacteria | 2757320391 | 2757568934 | 141 |
| 30 | iso_pu_bacteria | 2775507177 | 2777764181 | 141 |
| 31 | iso_pu_bacteria | 2775507192 | 2777837256 | 141 |
| 32 | iso_pu_bacteria | 2818991459 | 2819676127 | 141 |
| 33 | iso_pu_bacteria | 2857453340 | 2857460130 | 141 |
| 34 | iso_pu_bacteria | 2857586860 | 2857590928 | 141 |
| 35 | iso_pu_bacteria | 2857609550 | 2857613449 | 141 |
| 36 | iso_pu_bacteria | 2904755435 | 2904755646 | 141 |
| 37 | iso_pu_bacteria | 2919425241 | 2919432438 | 141 |
| 38 | iso_pu_bacteria | 2936340661 | 2936343087 | 141 |
| 39 | iso_pu_bacteria | 2971410472 | 2971410955 | 141 |
| 40 | iso_pu_bacteria | 3001267043 | 3001271906 | 141 |
| 41 | iso_pu_bacteria | 3001272096 | 3001275992 | 141 |
| 42 | iso_pu_bacteria | 3006984091 | 3006988318 | 141 |
| 43 | iso_pu_bacteria | 3006988479 | 3006993178 | 141 |
| 44 | iso_pu_bacteria | 8056533031 | 8056535582 | 141 |
| 45 | 3300005336 | Ga0070680_100852988 | Ga0070680_1008529881 | 142 |
| 46 | 3300005441 | Ga0070700_102019979 | Ga0070700_1020199791 | 142 |
| 47 | 3300006844 | Ga0075428_100925272 | Ga0075428_1009252722 | 142 |
| 48 | 3300006846 | Ga0075430_100434217 | Ga0075430_1004342171 | 142 |
| 49 | 3300009176 | Ga0105242_10223473 | Ga0105242_102234733 | 142 |
| 50 | 3300027252 | Ga0209973_1069272 | Ga0209973_10692721 | 142 |
| 51 | 3300027360 | Ga0209969_1000136 | Ga0209969_10001369 | 142 |
| 52 | 3300027462 | Ga0210000_1000292 | Ga0210000_10002929 | 142 |
| 53 | 3300027471 | Ga0209995_1000462 | Ga0209995_10004622 | 142 |
| 54 | 3300027526 | Ga0209968_1044634 | Ga0209968_10446342 | 142 |
| 55 | 3300027543 | Ga0209999_1000658 | Ga0209999_10006586 | 142 |
| 56 | 3300027543 | Ga0209999_1024666 | Ga0209999_10246661 | 142 |
| 57 | 3300027617 | Ga0210002_1031091 | Ga0210002_10310912 | 142 |
| 58 | 3300027665 | Ga0209983_1002782 | Ga0209983_10027823 | 142 |
| 59 | 3300027665 | Ga0209983_1007161 | Ga0209983_10071613 | 142 |
| 60 | 3300027682 | Ga0209971_1007936 | Ga0209971_10079364 | 142 |
| 61 | 3300027876 | Ga0209974_10000335 | Ga0209974_1000033510 | 142 |
| 62 | 3300031344 | Ga0265316_10021700 | Ga0265316_100217004 | 142 |
| 63 | 3300032168 | Ga0316593_10085680 | Ga0316593_100856801 | 142 |
| 64 | 3300032168 | Ga0316593_10404949 | Ga0316593_104049492 | 142 |
| 65 | 3300033528 | Ga0316588_1024200 | Ga0316588_10242001 | 142 |
| 66 | 3300033529 | Ga0316587_1026396 | Ga0316587_10263962 | 142 |
| 67 | 3300033529 | Ga0316587_1029176 | Ga0316587_10291763 | 142 |
| 68 | 3300033541 | Ga0316596_1077254 | Ga0316596_10772541 | 142 |
| 69 | 3300035117 | Ga0373953_0018403 | Ga0373953_0018403_2067_2495 | 142 |
| 70 | 3300035118 | Ga0373954_0000059 | Ga0373954_0000059_30721_31149 | 142 |
| 71 | 3300035398 | Ga0316574_0053390 | Ga0316574_0053390_73_501 | 142 |
| 72 | 3300035724 | Ga0373933_0019852 | Ga0373933_0019852_841_1269 | 142 |
| 73 | 3300036401 | Ga0373937_0002664 | Ga0373937_0002664_6384_6812 | 142 |
| 74 | 3300038725 | Ga0400484_20020 | Ga0400484_20020_5266_5694 | 142 |
| 75 | 3300038725 | Ga0400484_40509 | Ga0400484_40509_7371_7799 | 142 |
| 76 | 3300038741 | Ga0400488_35053 | Ga0400488_35053_62_490 | 142 |
| 77 | 3300038742 | Ga0400486_28583 | Ga0400486_28583_624_1052 | 142 |
| 78 | 3300039062 | Ga0400483_001247 | Ga0400483_001247_8768_9196 | 142 |
| 79 | 3300039062 | Ga0400483_146956 | Ga0400483_146956_5874_6302 | 142 |
| 80 | 3300039062 | Ga0400483_187740 | Ga0400483_187740_634_1062 | 142 |
| 81 | 3300039062 | Ga0400483_198698 | Ga0400483_198698_559_987 | 142 |
| 82 | 3300039062 | Ga0400483_213263 | Ga0400483_213263_8126_8554 | 142 |
| 83 | 3300039062 | Ga0400483_286518 | Ga0400483_286518_19_447 | 142 |
| 84 | 3300039110 | Ga0400487_23124 | Ga0400487_23124_103_531 | 142 |
| 85 | 3300041456 | Ga0451795_0900414 | Ga0451795_0900414_33_461 | 142 |
| 86 | 3300042156 | Ga0439446_0098330 | Ga0439446_0098330_33_461 | 142 |
| 87 | 3300042876 | Ga0451577_0017338 | Ga0451577_0017338_1355_1813 | 142 |
| 88 | 3300044712 | Ga0453684_0003452 | Ga0453684_0003452_4496_4954 | 142 |
| 89 | 3300044712 | Ga0453684_1667936 | Ga0453684_1667936_128_556 | 142 |
| 90 | 3300044712 | Ga0453684_1861800 | Ga0453684_1861800_155_583 | 142 |
| 91 | 3300045051 | Ga0451576_1593135 | Ga0451576_1593135_68_496 | 142 |
| 92 | 3300046511 | Ga0495608_0149665 | Ga0495608_0149665_191_619 | 142 |
| 93 | 3300046675 | Ga0495657_0214837 | Ga0495657_0214837_237_665 | 142 |
| 94 | 3300049129 | Ga0501309_056865 | Ga0501309_056865_120_548 | 142 |
| 95 | 3300049130 | Ga0501310_015178 | Ga0501310_015178_178_615 | 142 |
| 96 | 3300049160 | Ga0501304_005939 | Ga0501304_005939_93_536 | 142 |
| 97 | 3300049161 | Ga0501305_016297 | Ga0501305_016297_433_876 | 142 |
| 98 | 3300049535 | Ga0501319_027394 | Ga0501319_027394_65_502 | 142 |
| 99 | 3300049539 | Ga0501323_010617 | Ga0501323_010617_409_846 | 142 |
| 100 | 3300049569 | Ga0501032_0138176 | Ga0501032_0138176_983_1411 | 142 |
| 101 | 3300049570 | Ga0501033_0026759 | Ga0501033_0026759_237_665 | 142 |
| 102 | 3300049570 | Ga0501033_0318417 | Ga0501033_0318417_217_645 | 142 |
| 103 | 3300049570 | Ga0501033_0506978 | Ga0501033_0506978_86_514 | 142 |
| 104 | 3300049571 | Ga0501034_0029781 | Ga0501034_0029781_2760_3188 | 142 |
| 105 | 3300049571 | Ga0501034_0180453 | Ga0501034_0180453_77_505 | 142 |
| 106 | 3300049572 | Ga0501036_0748652 | Ga0501036_0748652_217_645 | 142 |
| 107 | 3300049573 | Ga0501037_0037626 | Ga0501037_0037626_2217_2645 | 142 |
| 108 | 3300049573 | Ga0501037_0078468 | Ga0501037_0078468_1755_2183 | 142 |
| 109 | 3300049574 | Ga0501038_0266413 | Ga0501038_0266413_249_677 | 142 |
| 110 | 3300049574 | Ga0501038_0789812 | Ga0501038_0789812_82_510 | 142 |
| 111 | 3300049579 | Ga0501043_0096873 | Ga0501043_0096873_1562_1990 | 142 |
| 112 | 3300049580 | Ga0501046_0049179 | Ga0501046_0049179_2583_3011 | 142 |
| 113 | 3300049581 | Ga0501047_0002187 | Ga0501047_0002187_18037_18465 | 142 |
| 114 | 3300049581 | Ga0501047_0008012 | Ga0501047_0008012_5165_5593 | 142 |
| 115 | 3300049582 | Ga0501048_0460568 | Ga0501048_0460568_316_744 | 142 |
| 116 | 3300049586 | Ga0501070_0141834 | Ga0501070_0141834_1241_1669 | 142 |
| 117 | 3300049587 | Ga0501071_0334751 | Ga0501071_0334751_681_1109 | 142 |
| 118 | 3300049590 | Ga0501074_0540640 | Ga0501074_0540640_87_515 | 142 |
| 119 | 3300049744 | Ga0501083_0443158 | Ga0501083_0443158_308_736 | 142 |
| 120 | 3300049822 | Ga0501035_0000725 | Ga0501035_0000725_28482_28910 | 142 |
| 121 | 3300049822 | Ga0501035_0166130 | Ga0501035_0166130_1275_1703 | 142 |
| 122 | 3300049822 | Ga0501035_0269264 | Ga0501035_0269264_359_862 | 142 |
| 123 | 3300049823 | Ga0501044_0000055 | Ga0501044_0000055_75856_76359 | 142 |
| 124 | 3300049823 | Ga0501044_0035643 | Ga0501044_0035643_613_1041 | 142 |
| 125 | 3300049823 | Ga0501044_0038408 | Ga0501044_0038408_272_700 | 142 |
| 126 | 3300049823 | Ga0501044_0825482 | Ga0501044_0825482_292_720 | 142 |
| 127 | 3300006844 | Ga0075428_100058800 | Ga0075428_1000588004 | 143 |
| 128 | 3300006846 | Ga0075430_100203120 | Ga0075430_1002031203 | 143 |
| 129 | 3300006847 | Ga0075431_100440701 | Ga0075431_1004407012 | 143 |
| 130 | 3300027395 | Ga0209996_1023790 | Ga0209996_10237902 | 143 |
| 131 | 3300027543 | Ga0209999_1006296 | Ga0209999_10062964 | 143 |
| 132 | 3300031731 | Ga0307405_10698647 | Ga0307405_106986472 | 143 |
| 133 | 3300031824 | Ga0307413_10893740 | Ga0307413_108937402 | 143 |
| 134 | 3300031852 | Ga0307410_10514172 | Ga0307410_105141721 | 143 |
| 135 | 3300031903 | Ga0307407_10352877 | Ga0307407_103528771 | 143 |
| 136 | 3300031911 | Ga0307412_10917005 | Ga0307412_109170051 | 143 |
| 137 | 3300031995 | Ga0307409_100583498 | Ga0307409_1005834981 | 143 |
| 138 | 3300032002 | Ga0307416_100803943 | Ga0307416_1008039432 | 143 |
| 139 | 3300032002 | Ga0307416_101048680 | Ga0307416_1010486802 | 143 |
| 140 | 3300032002 | Ga0307416_101335414 | Ga0307416_1013354142 | 143 |
| 141 | 3300032005 | Ga0307411_10256030 | Ga0307411_102560302 | 143 |
| 142 | 3300032005 | Ga0307411_10503450 | Ga0307411_105034503 | 143 |
| 143 | 3300032005 | Ga0307411_10756263 | Ga0307411_107562632 | 143 |
| 144 | 3300032126 | Ga0307415_102055432 | Ga0307415_1020554321 | 143 |
| 145 | 3300049523 | Ga0501300_039120 | Ga0501300_039120_144_578 | 143 |
| 146 | 3300049541 | Ga0501325_058802 | Ga0501325_058802_37_468 | 143 |
| 147 | 3300049568 | Ga0501031_0713524 | Ga0501031_0713524_165_596 | 143 |
| 148 | 3300049661 | Ga0501217_081198 | Ga0501217_081198_343_774 | 143 |
| 149 | 3300049668 | Ga0501233_075427 | Ga0501233_075427_329_760 | 143 |
| 150 | 3300049679 | Ga0501249_119467 | Ga0501249_119467_113_547 | 143 |
| 151 | 3300050510 | nmdc:mga06r32_13980_c2 | nmdc:mga06r32_13980_c2_317_748 | 143 |
| 152 | 3300053108 | Ga0500562_061006 | Ga0500562_061006_425_862 | 143 |
| 153 | 3300053139 | Ga0500568_0009639 | Ga0500568_0009639_2637_3074 | 143 |
| 154 | 3300003758 | Ga0055532_1000266 | Ga0055532_100026635 | 144 |
| 155 | 3300003781 | Ga0055536_1028902 | Ga0055536_10289022 | 144 |
| 156 | 3300003841 | Ga0055541_1012017 | Ga0055541_10120172 | 144 |
| 157 | 3300005337 | Ga0070682_100139105 | Ga0070682_1001391052 | 144 |
| 158 | 3300005340 | Ga0070689_100497215 | Ga0070689_1004972152 | 144 |
| 159 | 3300005445 | Ga0070708_101185113 | Ga0070708_1011851131 | 144 |
| 160 | 3300005467 | Ga0070706_100352364 | Ga0070706_1003523641 | 144 |
| 161 | 3300005468 | Ga0070707_100395387 | Ga0070707_1003953872 | 144 |
| 162 | 3300005471 | Ga0070698_100086453 | Ga0070698_1000864533 | 144 |
| 163 | 3300005614 | Ga0068856_100885858 | Ga0068856_1008858582 | 144 |
| 164 | 3300005617 | Ga0068859_100240844 | Ga0068859_1002408443 | 144 |
| 165 | 3300005842 | Ga0068858_102095082 | Ga0068858_1020950822 | 144 |
| 166 | 3300006048 | Ga0075363_100301524 | Ga0075363_1003015242 | 144 |
| 167 | 3300006163 | Ga0070715_10169058 | Ga0070715_101690581 | 144 |
| 168 | 3300006847 | Ga0075431_100023932 | Ga0075431_1000239328 | 144 |
| 169 | 3300006852 | Ga0075433_10142836 | Ga0075433_101428362 | 144 |
| 170 | 3300006871 | Ga0075434_100185361 | Ga0075434_1001853613 | 144 |
| 171 | 3300006880 | Ga0075429_100004315 | Ga0075429_1000043154 | 144 |
| 172 | 3300006931 | Ga0097620_100240821 | Ga0097620_1002408213 | 144 |
| 173 | 3300009094 | Ga0111539_13088412 | Ga0111539_130884121 | 144 |
| 174 | 3300014325 | Ga0163163_11400061 | Ga0163163_114000611 | 144 |
| 175 | 3300014326 | Ga0157380_10920336 | Ga0157380_109203361 | 144 |
| 176 | 3300014969 | Ga0157376_10271213 | Ga0157376_102712132 | 144 |
| 177 | 3300014969 | Ga0157376_10960923 | Ga0157376_109609232 | 144 |
| 178 | 3300025225 | Ga0209566_100273 | Ga0209566_10027313 | 144 |
| 179 | 3300025229 | Ga0209147_100198 | Ga0209147_10019864 | 144 |
| 180 | 3300025284 | Ga0209130_1016157 | Ga0209130_10161572 | 144 |
| 181 | 3300025291 | Ga0209675_1019703 | Ga0209675_10197032 | 144 |
| 182 | 3300025292 | Ga0209676_1000745 | Ga0209676_100074530 | 144 |
| 183 | 3300025922 | Ga0207646_10364990 | Ga0207646_103649903 | 144 |
| 184 | 3300028573 | Ga0265334_10003963 | Ga0265334_100039634 | 144 |
| 185 | 3300031250 | Ga0265331_10122487 | Ga0265331_101224872 | 144 |
| 186 | 3300033524 | Ga0316592_1123632 | Ga0316592_11236321 | 144 |
| 187 | 3300033524 | Ga0316592_1149130 | Ga0316592_11491301 | 144 |
| 188 | 3300035172 | Ga0373955_0376766 | Ga0373955_0376766_25_459 | 144 |
| 189 | 3300036401 | Ga0373937_0532011 | Ga0373937_0532011_166_603 | 144 |
| 190 | 3300037418 | Ga0395900_0725165 | Ga0395900_0725165_466_903 | 144 |
| 191 | 3300038443 | Ga0395901_1971731 | Ga0395901_1971731_65_502 | 144 |
| 192 | 3300041463 | Ga0451804_0704316 | Ga0451804_0704316_215_649 | 144 |
| 193 | 3300044673 | Ga0453683_0573509 | Ga0453683_0573509_12_446 | 144 |
| 194 | 3300046459 | Ga0495629_0622841 | Ga0495629_0622841_221_658 | 144 |
| 195 | 3300046472 | Ga0495580_0043446 | Ga0495580_0043446_2461_2898 | 144 |
| 196 | 3300046473 | Ga0495582_0241338 | Ga0495582_0241338_198_635 | 144 |
| 197 | 3300046475 | Ga0495639_0113101 | Ga0495639_0113101_364_801 | 144 |
| 198 | 3300046499 | Ga0495594_0126452 | Ga0495594_0126452_210_647 | 144 |
| 199 | 3300046511 | Ga0495608_0393312 | Ga0495608_0393312_79_516 | 144 |
| 200 | 3300046514 | Ga0495618_0009589 | Ga0495618_0009589_2659_3096 | 144 |
| 201 | 3300046516 | Ga0495628_0178595 | Ga0495628_0178595_237_674 | 144 |
| 202 | 3300046517 | Ga0495630_0060577 | Ga0495630_0060577_926_1363 | 144 |
| 203 | 3300046526 | Ga0495666_0025956 | Ga0495666_0025956_2036_2473 | 144 |
| 204 | 3300046533 | Ga0495640_0038941 | Ga0495640_0038941_2603_3040 | 144 |
| 205 | 3300046535 | Ga0495586_0001882 | Ga0495586_0001882_9709_10146 | 144 |
| 206 | 3300046642 | Ga0495634_0041778 | Ga0495634_0041778_744_1181 | 144 |
| 207 | 3300046663 | Ga0495635_0294853 | Ga0495635_0294853_265_702 | 144 |
| 208 | 3300046681 | Ga0495647_0039160 | Ga0495647_0039160_391_828 | 144 |
| 209 | 3300046683 | Ga0495658_0024044 | Ga0495658_0024044_978_1415 | 144 |
| 210 | 3300046683 | Ga0495658_0353318 | Ga0495658_0353318_115_549 | 144 |
| 211 | 3300046689 | Ga0495613_0048441 | Ga0495613_0048441_2647_3084 | 144 |
| 212 | 3300046690 | Ga0495624_0103007 | Ga0495624_0103007_377_814 | 144 |
| 213 | 3300047315 | Ga0495581_0181766 | Ga0495581_0181766_259_696 | 144 |
| 214 | 3300047315 | Ga0495581_0463077 | Ga0495581_0463077_260_694 | 144 |
| 215 | 3300047319 | Ga0495674_0003864 | Ga0495674_0003864_2605_3042 | 144 |
| 216 | 3300047321 | Ga0495676_0165594 | Ga0495676_0165594_263_700 | 144 |
| 217 | 3300047322 | Ga0495680_0026186 | Ga0495680_0026186_1487_1921 | 144 |
| 218 | 3300047322 | Ga0495680_0087918 | Ga0495680_0087918_708_1145 | 144 |
| 219 | 3300047471 | Ga0495684_0431556 | Ga0495684_0431556_67_504 | 144 |
| 220 | 3300048905 | Ga0496102_0014942 | Ga0496102_0014942_5947_6384 | 144 |
| 221 | 3300048906 | Ga0496103_0055914 | Ga0496103_0055914_398_835 | 144 |
| 222 | 3300048920 | Ga0496117_0000124 | Ga0496117_0000124_68635_69069 | 144 |
| 223 | 3300048921 | Ga0496118_0271180 | Ga0496118_0271180_283_717 | 144 |
| 224 | 3300048922 | Ga0496119_0000020 | Ga0496119_0000020_87388_87822 | 144 |
| 225 | 3300048923 | Ga0496120_0000006 | Ga0496120_0000006_228113_228547 | 144 |
| 226 | 3300048925 | Ga0496122_0000040 | Ga0496122_0000040_122482_122916 | 144 |
| 227 | 3300048925 | Ga0496122_0002362 | Ga0496122_0002362_4311_4745 | 144 |
| 228 | 3300048926 | Ga0496123_0000572 | Ga0496123_0000572_39344_39778 | 144 |
| 229 | 3300048926 | Ga0496123_0066153 | Ga0496123_0066153_1188_1622 | 144 |
| 230 | 3300048927 | Ga0496124_0335935 | Ga0496124_0335935_421_855 | 144 |
| 231 | 3300048928 | Ga0496125_0000010 | Ga0496125_0000010_171902_172336 | 144 |
| 232 | 3300048929 | Ga0496126_0000210 | Ga0496126_0000210_122482_122916 | 144 |
| 233 | 3300048929 | Ga0496126_0001553 | Ga0496126_0001553_27465_27899 | 144 |
| 234 | 3300048929 | Ga0496126_0375927 | Ga0496126_0375927_336_770 | 144 |
| 235 | 3300049128 | Ga0501308_023743 | Ga0501308_023743_195_713 | 144 |
| 236 | 3300049128 | Ga0501308_024132 | Ga0501308_024132_11_445 | 144 |
| 237 | 3300049133 | Ga0501344_06827 | Ga0501344_06827_40_477 | 144 |
| 238 | 3300049527 | Ga0501311_043675 | Ga0501311_043675_97_534 | 144 |
| 239 | 3300049528 | Ga0501312_031210 | Ga0501312_031210_119_556 | 144 |
| 240 | 3300049552 | Ga0501336_013575 | Ga0501336_013575_228_665 | 144 |
| 241 | 3300049588 | Ga0501072_1060246 | Ga0501072_1060246_22_579 | 144 |
| 242 | 3300050490 | nmdc:mga03n38_289882_c1 | nmdc:mga03n38_289882_c1_346_780 | 144 |
| 243 | 3300050508 | nmdc:mga09592_18806_c1 | nmdc:mga09592_18806_c1_2410_2847 | 144 |
| 244 | 3300050510 | nmdc:mga06r32_26098_c1 | nmdc:mga06r32_26098_c1_56_493 | 144 |
| 245 | 3300050512 | nmdc:mga0n895_3125_c1 | nmdc:mga0n895_3125_c1_806_1243 | 144 |
| 246 | 3300050515 | nmdc:mga0a205_57086_c1 | nmdc:mga0a205_57086_c1_135_572 | 144 |
| 247 | 3300053077 | Ga0495601_0442508 | Ga0495601_0442508_150_587 | 144 |
| 248 | 3300053085 | Ga0495619_0158459 | Ga0495619_0158459_552_989 | 144 |
| 249 | 3300053103 | Ga0500555_019577 | Ga0500555_019577_1167_1601 | 144 |
| 250 | 3300053131 | Ga0500652_293418 | Ga0500652_293418_77_511 | 144 |
| 251 | 3300059504 | Ga0587082_037531 | Ga0587082_037531_338_775 | 144 |
| 252 | 3300059505 | Ga0587083_0008127 | Ga0587083_0008127_403_840 | 144 |
| 253 | 3300059605 | Ga0587106_034352 | Ga0587106_034352_379_816 | 144 |
| 254 | 3300059640 | Ga0587067_001767 | Ga0587067_001767_451_888 | 144 |
| 255 | 3300059643 | Ga0587072_008811 | Ga0587072_008811_403_840 | 144 |
| 256 | 3300059645 | Ga0587076_014747 | Ga0587076_014747_369_806 | 144 |
| 257 | 3300059646 | Ga0587078_013763 | Ga0587078_013763_108_545 | 144 |
| 258 | 3300003162 | Ga0006778J45830_1034592 | Ga0006778J45830_10345921 | 145 |
| 259 | 3300003322 | rootL2_10056321 | rootL2_100563212 | 145 |
| 260 | 3300003544 | Ga0007417J51691_1041585 | Ga0007417J51691_10415851 | 145 |
| 261 | 3300003574 | Ga0007410J51695_1044966 | Ga0007410J51695_10449661 | 145 |
| 262 | 3300003577 | Ga0007416J51690_1041750 | Ga0007416J51690_10417501 | 145 |
| 263 | 3300003579 | Ga0007429J51699_1074031 | Ga0007429J51699_10740311 | 145 |
| 264 | 3300003735 | Ga0006780_1026678 | Ga0006780_10266781 | 145 |
| 265 | 3300004800 | Ga0058861_11574531 | Ga0058861_115745312 | 145 |
| 266 | 3300004803 | Ga0058862_12335695 | Ga0058862_123356951 | 145 |
| 267 | 3300005336 | Ga0070680_100034077 | Ga0070680_1000340776 | 145 |
| 268 | 3300005458 | Ga0070681_10072317 | Ga0070681_100723173 | 145 |
| 269 | 3300005530 | Ga0070679_100051054 | Ga0070679_1000510544 | 145 |
| 270 | 3300005547 | Ga0070693_100345220 | Ga0070693_1003452202 | 145 |
| 271 | 3300006051 | Ga0075364_10085096 | Ga0075364_100850962 | 145 |
| 272 | 3300006178 | Ga0075367_10401214 | Ga0075367_104012142 | 145 |
| 273 | 3300006178 | Ga0075367_10442706 | Ga0075367_104427062 | 145 |
| 274 | 3300025912 | Ga0207707_10002220 | Ga0207707_1000222011 | 145 |
| 275 | 3300025917 | Ga0207660_10073473 | Ga0207660_100734733 | 145 |
| 276 | 3300025921 | Ga0207652_10014383 | Ga0207652_100143833 | 145 |
| 277 | 3300025935 | Ga0207709_10201887 | Ga0207709_102018872 | 145 |
| 278 | 3300031911 | Ga0307412_10039661 | Ga0307412_100396612 | 145 |
| 279 | 3300036401 | Ga0373937_1099284 | Ga0373937_1099284_124_567 | 145 |
| 280 | 3300039437 | Ga0436365_1063002 | Ga0436365_1063002_11_451 | 145 |
| 281 | 3300049530 | Ga0501314_019331 | Ga0501314_019331_178_621 | 145 |
| 282 | 3300049534 | Ga0501318_054930 | Ga0501318_054930_35_478 | 145 |
| 283 | 3300049571 | Ga0501034_0059419 | Ga0501034_0059419_2797_3258 | 145 |
| 284 | 3300049583 | Ga0501067_0002587 | Ga0501067_0002587_7909_8370 | 145 |
| 285 | 3300049584 | Ga0501068_0000171 | Ga0501068_0000171_29413_29874 | 145 |
| 286 | 3300049585 | Ga0501069_0000278 | Ga0501069_0000278_658_1119 | 145 |
| 287 | 3300049586 | Ga0501070_0005766 | Ga0501070_0005766_2615_3076 | 145 |
| 288 | 3300049587 | Ga0501071_0006621 | Ga0501071_0006621_6529_6990 | 145 |
| 289 | 3300049588 | Ga0501072_0172389 | Ga0501072_0172389_614_1075 | 145 |
| 290 | 3300049589 | Ga0501073_0000699 | Ga0501073_0000699_17647_18108 | 145 |
| 291 | 3300049590 | Ga0501074_0003209 | Ga0501074_0003209_617_1078 | 145 |
| 292 | 3300049742 | Ga0501080_0001835 | Ga0501080_0001835_1308_1769 | 145 |
| 293 | 3300049743 | Ga0501081_0420735 | Ga0501081_0420735_511_960 | 145 |
| 294 | 3300049744 | Ga0501083_0005831 | Ga0501083_0005831_576_1037 | 145 |
| 295 | 3300050491 | nmdc:mga00v17_182539_c1 | nmdc:mga00v17_182539_c1_31_468 | 145 |
| 296 | 3300050494 | nmdc:mga06z11_346260_c1 | nmdc:mga06z11_346260_c1_13_450 | 145 |
| 297 | 3300054114 | Ga0501084_0089052 | Ga0501084_0089052_574_1035 | 145 |
| 298 | 3300060353 | Ga0501082_0032717 | Ga0501082_0032717_659_1120 | 145 |
| 299 | 3300061734 | Ga0530510_0175054 | Ga0530510_0175054_658_1119 | 145 |
| 300 | 3300005293 | Ga0065715_10132100 | Ga0065715_101321002 | 146 |
| 301 | 3300005329 | Ga0070683_100202291 | Ga0070683_1002022912 | 146 |
| 302 | 3300005444 | Ga0070694_100147049 | Ga0070694_1001470491 | 146 |
| 303 | 3300005444 | Ga0070694_100152666 | Ga0070694_1001526663 | 146 |
| 304 | 3300005458 | Ga0070681_10421388 | Ga0070681_104213882 | 146 |
| 305 | 3300005471 | Ga0070698_100013809 | Ga0070698_1000138096 | 146 |
| 306 | 3300005518 | Ga0070699_100031118 | Ga0070699_1000311184 | 146 |
| 307 | 3300005536 | Ga0070697_100036520 | Ga0070697_1000365204 | 146 |
| 308 | 3300005545 | Ga0070695_100230618 | Ga0070695_1002306182 | 146 |
| 309 | 3300005545 | Ga0070695_100393957 | Ga0070695_1003939572 | 146 |
| 310 | 3300005546 | Ga0070696_100006702 | Ga0070696_1000067025 | 146 |
| 311 | 3300005549 | Ga0070704_100350304 | Ga0070704_1003503042 | 146 |
| 312 | 3300005564 | Ga0070664_100027164 | Ga0070664_1000271643 | 146 |
| 313 | 3300005614 | Ga0068856_100158720 | Ga0068856_1001587203 | 146 |
| 314 | 3300005842 | Ga0068858_100007656 | Ga0068858_1000076569 | 146 |
| 315 | 3300005842 | Ga0068858_100109652 | Ga0068858_1001096523 | 146 |
| 316 | 3300005843 | Ga0068860_100983996 | Ga0068860_1009839962 | 146 |
| 317 | 3300006173 | Ga0070716_100220426 | Ga0070716_1002204263 | 146 |
| 318 | 3300006175 | Ga0070712_101121529 | Ga0070712_1011215292 | 146 |
| 319 | 3300006353 | Ga0075370_10300637 | Ga0075370_103006371 | 146 |
| 320 | 3300006852 | Ga0075433_10008752 | Ga0075433_100087524 | 146 |
| 321 | 3300006871 | Ga0075434_100427194 | Ga0075434_1004271942 | 146 |
| 322 | 3300009147 | Ga0114129_10975810 | Ga0114129_109758102 | 146 |
| 323 | 3300009147 | Ga0114129_11054672 | Ga0114129_110546721 | 146 |
| 324 | 3300009545 | Ga0105237_10508172 | Ga0105237_105081722 | 146 |
| 325 | 3300010375 | Ga0105239_10017161 | Ga0105239_100171619 | 146 |
| 326 | 3300014968 | Ga0157379_10115483 | Ga0157379_101154833 | 146 |
| 327 | 3300020081 | Ga0206354_11678042 | Ga0206354_116780421 | 146 |
| 328 | 3300021384 | Ga0213876_10112732 | Ga0213876_101127322 | 146 |
| 329 | 3300022467 | Ga0224712_10017586 | Ga0224712_100175861 | 146 |
| 330 | 3300025910 | Ga0207684_10255210 | Ga0207684_102552101 | 146 |
| 331 | 3300025939 | Ga0207665_10264166 | Ga0207665_102641663 | 146 |
| 332 | 3300025944 | Ga0207661_10197993 | Ga0207661_101979932 | 146 |
| 333 | 3300025945 | Ga0207679_10014244 | Ga0207679_100142444 | 146 |
| 334 | 3300025949 | Ga0207667_10251941 | Ga0207667_102519413 | 146 |
| 335 | 3300026035 | Ga0207703_10004977 | Ga0207703_100049778 | 146 |
| 336 | 3300026035 | Ga0207703_10074679 | Ga0207703_100746792 | 146 |
| 337 | 3300026078 | Ga0207702_10160175 | Ga0207702_101601753 | 146 |
| 338 | 3300027471 | Ga0209995_1026906 | Ga0209995_10269062 | 146 |
| 339 | 3300027552 | Ga0209982_1005128 | Ga0209982_10051281 | 146 |
| 340 | 3300027665 | Ga0209983_1001263 | Ga0209983_10012635 | 146 |
| 341 | 3300027682 | Ga0209971_1023765 | Ga0209971_10237654 | 146 |
| 342 | 3300027876 | Ga0209974_10002524 | Ga0209974_100025242 | 146 |
| 343 | 3300027876 | Ga0209974_10033146 | Ga0209974_100331461 | 146 |
| 344 | 3300028381 | Ga0268264_10748057 | Ga0268264_107480571 | 146 |
| 345 | 3300031548 | Ga0307408_100162100 | Ga0307408_1001621003 | 146 |
| 346 | 3300031548 | Ga0307408_100691922 | Ga0307408_1006919222 | 146 |
| 347 | 3300031731 | Ga0307405_10006163 | Ga0307405_100061638 | 146 |
| 348 | 3300031731 | Ga0307405_10108505 | Ga0307405_101085053 | 146 |
| 349 | 3300031731 | Ga0307405_10682171 | Ga0307405_106821712 | 146 |
| 350 | 3300031824 | Ga0307413_10017567 | Ga0307413_100175673 | 146 |
| 351 | 3300031824 | Ga0307413_10047208 | Ga0307413_100472083 | 146 |
| 352 | 3300031824 | Ga0307413_10262842 | Ga0307413_102628422 | 146 |
| 353 | 3300031824 | Ga0307413_10264847 | Ga0307413_102648472 | 146 |
| 354 | 3300031852 | Ga0307410_10065381 | Ga0307410_100653814 | 146 |
| 355 | 3300031852 | Ga0307410_10089432 | Ga0307410_100894323 | 146 |
| 356 | 3300031852 | Ga0307410_10109599 | Ga0307410_101095993 | 146 |
| 357 | 3300031852 | Ga0307410_10116915 | Ga0307410_101169153 | 146 |
| 358 | 3300031852 | Ga0307410_10173370 | Ga0307410_101733702 | 146 |
| 359 | 3300031852 | Ga0307410_10215225 | Ga0307410_102152253 | 146 |
| 360 | 3300031901 | Ga0307406_10049725 | Ga0307406_100497253 | 146 |
| 361 | 3300031901 | Ga0307406_10109486 | Ga0307406_101094862 | 146 |
| 362 | 3300031901 | Ga0307406_10390168 | Ga0307406_103901682 | 146 |
| 363 | 3300031903 | Ga0307407_10020430 | Ga0307407_100204304 | 146 |
| 364 | 3300031903 | Ga0307407_10170574 | Ga0307407_101705741 | 146 |
| 365 | 3300031911 | Ga0307412_10355211 | Ga0307412_103552112 | 146 |
| 366 | 3300031911 | Ga0307412_11238834 | Ga0307412_112388342 | 146 |
| 367 | 3300031995 | Ga0307409_100088713 | Ga0307409_1000887133 | 146 |
| 368 | 3300031995 | Ga0307409_100120720 | Ga0307409_1001207203 | 146 |
| 369 | 3300031995 | Ga0307409_100192694 | Ga0307409_1001926943 | 146 |
| 370 | 3300031995 | Ga0307409_100444702 | Ga0307409_1004447021 | 146 |
| 371 | 3300031995 | Ga0307409_101014651 | Ga0307409_1010146512 | 146 |
| 372 | 3300031995 | Ga0307409_101420227 | Ga0307409_1014202271 | 146 |
| 373 | 3300032002 | Ga0307416_100030934 | Ga0307416_1000309343 | 146 |
| 374 | 3300032002 | Ga0307416_100034134 | Ga0307416_1000341342 | 146 |
| 375 | 3300032002 | Ga0307416_100069074 | Ga0307416_1000690743 | 146 |
| 376 | 3300032004 | Ga0307414_10078993 | Ga0307414_100789933 | 146 |
| 377 | 3300032004 | Ga0307414_10120589 | Ga0307414_101205893 | 146 |
| 378 | 3300032004 | Ga0307414_10162873 | Ga0307414_101628731 | 146 |
| 379 | 3300032004 | Ga0307414_10458794 | Ga0307414_104587941 | 146 |
| 380 | 3300032004 | Ga0307414_10585987 | Ga0307414_105859872 | 146 |
| 381 | 3300032005 | Ga0307411_10004491 | Ga0307411_100044914 | 146 |
| 382 | 3300032005 | Ga0307411_10206147 | Ga0307411_102061473 | 146 |
| 383 | 3300032005 | Ga0307411_10280681 | Ga0307411_102806812 | 146 |
| 384 | 3300032005 | Ga0307411_11365327 | Ga0307411_113653271 | 146 |
| 385 | 3300032126 | Ga0307415_100266187 | Ga0307415_1002661873 | 146 |
| 386 | 3300032126 | Ga0307415_100307401 | Ga0307415_1003074013 | 146 |
| 387 | 3300032126 | Ga0307415_101487127 | Ga0307415_1014871272 | 146 |
| 388 | 3300035724 | Ga0373933_0494407 | Ga0373933_0494407_82_522 | 146 |
| 389 | 3300037068 | Ga0373925_1610865 | Ga0373925_1610865_21_479 | 146 |
| 390 | 3300039437 | Ga0436365_1244758 | Ga0436365_1244758_8206_8646 | 146 |
| 391 | 3300041404 | Ga0439436_0075656 | Ga0439436_0075656_48_500 | 146 |
| 392 | 3300041406 | Ga0439439_0002283 | Ga0439439_0002283_2060_2512 | 146 |
| 393 | 3300041406 | Ga0439439_0041887 | Ga0439439_0041887_593_1045 | 146 |
| 394 | 3300041406 | Ga0439439_0080318 | Ga0439439_0080318_416_868 | 146 |
| 395 | 3300041413 | Ga0439465_0215616 | Ga0439465_0215616_180_662 | 146 |
| 396 | 3300042015 | Ga0439462_0087082 | Ga0439462_0087082_252_704 | 146 |
| 397 | 3300042123 | Ga0450921_006157 | Ga0450921_006157_456_908 | 146 |
| 398 | 3300042131 | Ga0450894_007385 | Ga0450894_007385_16_468 | 146 |
| 399 | 3300042134 | Ga0450898_009730 | Ga0450898_009730_598_1050 | 146 |
| 400 | 3300042147 | Ga0450910_018809 | Ga0450910_018809_305_757 | 146 |
| 401 | 3300042156 | Ga0439446_0054111 | Ga0439446_0054111_532_984 | 146 |
| 402 | 3300046681 | Ga0495647_0106343 | Ga0495647_0106343_124_576 | 146 |
| 403 | 3300048905 | Ga0496102_0134390 | Ga0496102_0134390_201_653 | 146 |
| 404 | 3300048909 | Ga0496106_0167336 | Ga0496106_0167336_534_986 | 146 |
| 405 | 3300049160 | Ga0501304_028682 | Ga0501304_028682_58_510 | 146 |
| 406 | 3300049161 | Ga0501305_052204 | Ga0501305_052204_18_470 | 146 |
| 407 | 3300049161 | Ga0501305_056471 | Ga0501305_056471_36_488 | 146 |
| 408 | 3300049515 | Ga0501292_033197 | Ga0501292_033197_209_661 | 146 |
| 409 | 3300049522 | Ga0501299_013433 | Ga0501299_013433_328_780 | 146 |
| 410 | 3300049528 | Ga0501312_090901 | Ga0501312_090901_62_514 | 146 |
| 411 | 3300049529 | Ga0501313_062270 | Ga0501313_062270_12_464 | 146 |
| 412 | 3300049537 | Ga0501321_072315 | Ga0501321_072315_11_463 | 146 |
| 413 | 3300049541 | Ga0501325_055035 | Ga0501325_055035_45_497 | 146 |
| 414 | 3300049571 | Ga0501034_0001355 | Ga0501034_0001355_14517_14969 | 146 |
| 415 | 3300049583 | Ga0501067_0001052 | Ga0501067_0001052_8618_9070 | 146 |
| 416 | 3300049584 | Ga0501068_0011181 | Ga0501068_0011181_3992_4444 | 146 |
| 417 | 3300049585 | Ga0501069_0000098 | Ga0501069_0000098_7699_8151 | 146 |
| 418 | 3300049586 | Ga0501070_0000192 | Ga0501070_0000192_56268_56720 | 146 |
| 419 | 3300049587 | Ga0501071_0000060 | Ga0501071_0000060_36758_37210 | 146 |
| 420 | 3300049588 | Ga0501072_0000081 | Ga0501072_0000081_37377_37829 | 146 |
| 421 | 3300049589 | Ga0501073_0022302 | Ga0501073_0022302_659_1111 | 146 |
| 422 | 3300049590 | Ga0501074_0001663 | Ga0501074_0001663_9805_10257 | 146 |
| 423 | 3300049590 | Ga0501074_0443048 | Ga0501074_0443048_194_646 | 146 |
| 424 | 3300049591 | Ga0501075_0065194 | Ga0501075_0065194_2188_2670 | 146 |
| 425 | 3300049592 | Ga0501076_0387765 | Ga0501076_0387765_332_784 | 146 |
| 426 | 3300049650 | Ga0501199_011422 | Ga0501199_011422_130_582 | 146 |
| 427 | 3300049651 | Ga0501201_004663 | Ga0501201_004663_370_822 | 146 |
| 428 | 3300049651 | Ga0501201_024820 | Ga0501201_024820_186_638 | 146 |
| 429 | 3300049652 | Ga0501202_031347 | Ga0501202_031347_70_522 | 146 |
| 430 | 3300049653 | Ga0501206_022463 | Ga0501206_022463_18_470 | 146 |
| 431 | 3300049655 | Ga0501208_098677 | Ga0501208_098677_152_604 | 146 |
| 432 | 3300049656 | Ga0501209_046355 | Ga0501209_046355_177_629 | 146 |
| 433 | 3300049659 | Ga0501214_026930 | Ga0501214_026930_196_648 | 146 |
| 434 | 3300049660 | Ga0501216_153221 | Ga0501216_153221_67_519 | 146 |
| 435 | 3300049661 | Ga0501217_023195 | Ga0501217_023195_693_1145 | 146 |
| 436 | 3300049666 | Ga0501228_003303 | Ga0501228_003303_223_675 | 146 |
| 437 | 3300049668 | Ga0501233_029106 | Ga0501233_029106_622_1074 | 146 |
| 438 | 3300049669 | Ga0501235_013655 | Ga0501235_013655_832_1284 | 146 |
| 439 | 3300049670 | Ga0501236_018815 | Ga0501236_018815_343_795 | 146 |
| 440 | 3300049672 | Ga0501239_010235 | Ga0501239_010235_339_791 | 146 |
| 441 | 3300049673 | Ga0501240_032149 | Ga0501240_032149_215_667 | 146 |
| 442 | 3300049674 | Ga0501242_036833 | Ga0501242_036833_130_582 | 146 |
| 443 | 3300049675 | Ga0501243_011673 | Ga0501243_011673_288_740 | 146 |
| 444 | 3300049675 | Ga0501243_049379 | Ga0501243_049379_95_547 | 146 |
| 445 | 3300049677 | Ga0501247_000073 | Ga0501247_000073_903_1355 | 146 |
| 446 | 3300049682 | Ga0501252_007501 | Ga0501252_007501_210_662 | 146 |
| 447 | 3300049683 | Ga0501253_025427 | Ga0501253_025427_454_906 | 146 |
| 448 | 3300049687 | Ga0501258_004870 | Ga0501258_004870_232_684 | 146 |
| 449 | 3300049704 | Ga0501221_027066 | Ga0501221_027066_197_649 | 146 |
| 450 | 3300049708 | Ga0501245_010568 | Ga0501245_010568_71_523 | 146 |
| 451 | 3300049741 | Ga0501079_0284538 | Ga0501079_0284538_431_883 | 146 |
| 452 | 3300049742 | Ga0501080_0000060 | Ga0501080_0000060_54809_55261 | 146 |
| 453 | 3300049743 | Ga0501081_0026798 | Ga0501081_0026798_2604_3056 | 146 |
| 454 | 3300049744 | Ga0501083_0006130 | Ga0501083_0006130_7834_8286 | 146 |
| 455 | 3300049759 | Ga0501262_013326 | Ga0501262_013326_281_733 | 146 |
| 456 | 3300049760 | Ga0501263_021333 | Ga0501263_021333_297_749 | 146 |
| 457 | 3300049765 | Ga0501268_001380 | Ga0501268_001380_2291_2743 | 146 |
| 458 | 3300049765 | Ga0501268_082798 | Ga0501268_082798_162_614 | 146 |
| 459 | 3300049767 | Ga0501270_004084 | Ga0501270_004084_782_1234 | 146 |
| 460 | 3300049769 | Ga0501272_007118 | Ga0501272_007118_134_586 | 146 |
| 461 | 3300049770 | Ga0501273_007298 | Ga0501273_007298_284_736 | 146 |
| 462 | 3300049779 | Ga0501283_004964 | Ga0501283_004964_678_1130 | 146 |
| 463 | 3300050494 | nmdc:mga06z11_653659_c1 | nmdc:mga06z11_653659_c1_16_462 | 146 |
| 464 | 3300050496 | nmdc:mga07m45_289507_c1 | nmdc:mga07m45_289507_c1_210_650 | 146 |
| 465 | 3300050496 | nmdc:mga07m45_461163_c1 | nmdc:mga07m45_461163_c1_210_668 | 146 |
| 466 | 3300050507 | nmdc:mga05p37_802723_c1 | nmdc:mga05p37_802723_c1_398_850 | 146 |
| 467 | 3300050512 | nmdc:mga0n895_210958_c1 | nmdc:mga0n895_210958_c1_685_1137 | 146 |
| 468 | 3300050515 | nmdc:mga0a205_74150_c1 | nmdc:mga0a205_74150_c1_2246_2698 | 146 |
| 469 | 3300053108 | Ga0500562_053230 | Ga0500562_053230_90_530 | 146 |
| 470 | 3300054114 | Ga0501084_0005867 | Ga0501084_0005867_2005_2457 | 146 |
| 471 | 3300059491 | Ga0587070_042562 | Ga0587070_042562_137_589 | 146 |
| 472 | 3300059511 | Ga0587091_175899 | Ga0587091_175899_41_493 | 146 |
| 473 | 3300059512 | Ga0587092_140704 | Ga0587092_140704_30_482 | 146 |
| 474 | 3300059626 | Ga0587115_122583 | Ga0587115_122583_11_463 | 146 |
| 475 | 3300059641 | Ga0587068_064796 | Ga0587068_064796_227_679 | 146 |
| 476 | 3300060346 | Ga0587111_0104482 | Ga0587111_0104482_40_492 | 146 |
| 477 | 3300060353 | Ga0501082_0001299 | Ga0501082_0001299_659_1111 | 146 |
| 478 | 3300061734 | Ga0530510_0562287 | Ga0530510_0562287_293_745 | 146 |
| 479 | 3300005343 | Ga0070687_101078360 | Ga0070687_1010783601 | 147 |
| 480 | 3300005438 | Ga0070701_10430622 | Ga0070701_104306221 | 147 |
| 481 | 3300005545 | Ga0070695_100350209 | Ga0070695_1003502092 | 147 |
| 482 | 3300009094 | Ga0111539_10667918 | Ga0111539_106679182 | 147 |
| 483 | 3300009177 | Ga0105248_11113366 | Ga0105248_111133662 | 147 |
| 484 | 3300013297 | Ga0157378_10098822 | Ga0157378_100988221 | 147 |
| 485 | 3300014326 | Ga0157380_12280292 | Ga0157380_122802922 | 147 |
| 486 | 3300041458 | Ga0451798_0094922 | Ga0451798_0094922_297_758 | 147 |
| 487 | 3300041459 | Ga0451800_1358168 | Ga0451800_1358168_87_548 | 147 |
| 488 | 3300041461 | Ga0451805_090425 | Ga0451805_090425_27_488 | 147 |
| 489 | 3300041501 | Ga0451845_0928614 | Ga0451845_0928614_745_1206 | 147 |
| 490 | 3300041505 | Ga0451849_0273965 | Ga0451849_0273965_425_886 | 147 |
| 491 | 3300049571 | Ga0501034_0185921 | Ga0501034_0185921_583_1041 | 147 |
| 492 | 3300050511 | nmdc:mga08y16_397281_c1 | nmdc:mga08y16_397281_c1_321_767 | 147 |
| 493 | 3300005331 | Ga0070670_100058808 | Ga0070670_1000588084 | 148 |
| 494 | 3300005444 | Ga0070694_100482878 | Ga0070694_1004828782 | 148 |
| 495 | 3300005456 | Ga0070678_101792635 | Ga0070678_1017926351 | 148 |
| 496 | 3300005459 | Ga0068867_101750460 | Ga0068867_1017504601 | 148 |
| 497 | 3300005539 | Ga0068853_100380667 | Ga0068853_1003806671 | 148 |
| 498 | 3300005545 | Ga0070695_100389662 | Ga0070695_1003896622 | 148 |
| 499 | 3300005614 | Ga0068856_100031217 | Ga0068856_1000312173 | 148 |
| 500 | 3300005618 | Ga0068864_101546933 | Ga0068864_1015469331 | 148 |
| 501 | 3300005985 | Ga0081539_10028340 | Ga0081539_100283403 | 148 |
| 502 | 3300006852 | Ga0075433_10240666 | Ga0075433_102406661 | 148 |
| 503 | 3300006871 | Ga0075434_102100241 | Ga0075434_1021002411 | 148 |
| 504 | 3300009093 | Ga0105240_10323307 | Ga0105240_103233073 | 148 |
| 505 | 3300009101 | Ga0105247_11167274 | Ga0105247_111672741 | 148 |
| 506 | 3300009148 | Ga0105243_10301221 | Ga0105243_103012212 | 148 |
| 507 | 3300009174 | Ga0105241_11037769 | Ga0105241_110377691 | 148 |
| 508 | 3300009545 | Ga0105237_10553910 | Ga0105237_105539102 | 148 |
| 509 | 3300009553 | Ga0105249_10039009 | Ga0105249_100390095 | 148 |
| 510 | 3300010375 | Ga0105239_10227608 | Ga0105239_102276082 | 148 |
| 511 | 3300013297 | Ga0157378_10860832 | Ga0157378_108608322 | 148 |
| 512 | 3300013306 | Ga0163162_10161247 | Ga0163162_101612474 | 148 |
| 513 | 3300013307 | Ga0157372_10560935 | Ga0157372_105609352 | 148 |
| 514 | 3300025908 | Ga0207643_10976486 | Ga0207643_109764861 | 148 |
| 515 | 3300025925 | Ga0207650_10071542 | Ga0207650_100715422 | 148 |
| 516 | 3300025935 | Ga0207709_10128828 | Ga0207709_101288281 | 148 |
| 517 | 3300025942 | Ga0207689_10125695 | Ga0207689_101256951 | 148 |
| 518 | 3300025961 | Ga0207712_10029090 | Ga0207712_100290902 | 148 |
| 519 | 3300026095 | Ga0207676_11238212 | Ga0207676_112382122 | 148 |
| 520 | 3300038996 | Ga0242420_004643 | Ga0242420_004643_56_502 | 148 |
| 521 | 3300048905 | Ga0496102_0337884 | Ga0496102_0337884_200_646 | 148 |
| 522 | 3300048906 | Ga0496103_0073160 | Ga0496103_0073160_152_598 | 148 |
| 523 | 3300048907 | Ga0496104_0064013 | Ga0496104_0064013_2754_3200 | 148 |
| 524 | 3300048909 | Ga0496106_0055981 | Ga0496106_0055981_774_1220 | 148 |
| 525 | 3300048911 | Ga0496108_0128393 | Ga0496108_0128393_1688_2134 | 148 |
| 526 | 3300048912 | Ga0496109_0637578 | Ga0496109_0637578_506_952 | 148 |
| 527 | 3300048913 | Ga0496110_0704198 | Ga0496110_0704198_244_690 | 148 |
| 528 | 3300048915 | Ga0496112_1429218 | Ga0496112_1429218_104_550 | 148 |
| 529 | 3300049533 | Ga0501317_001899 | Ga0501317_001899_146_613 | 148 |
| 530 | 3300050513 | nmdc:mga0rr50_1548924_c1 | nmdc:mga0rr50_1548924_c1_73_519 | 148 |
| 531 | 3300050515 | nmdc:mga0a205_30310_c1 | nmdc:mga0a205_30310_c1_142_588 | 148 |
| 532 | 3300004800 | Ga0058861_12052293 | Ga0058861_120522932 | 149 |
| 533 | 3300004803 | Ga0058862_12645996 | Ga0058862_126459961 | 149 |
| 534 | 3300005289 | Ga0065704_10319899 | Ga0065704_103198991 | 149 |
| 535 | 3300005290 | Ga0065712_10004680 | Ga0065712_100046804 | 149 |
| 536 | 3300005293 | Ga0065715_10102020 | Ga0065715_101020202 | 149 |
| 537 | 3300005295 | Ga0065707_10748818 | Ga0065707_107488181 | 149 |
| 538 | 3300005330 | Ga0070690_101219369 | Ga0070690_1012193691 | 149 |
| 539 | 3300005334 | Ga0068869_100042361 | Ga0068869_1000423614 | 149 |
| 540 | 3300005335 | Ga0070666_10042134 | Ga0070666_100421343 | 149 |
| 541 | 3300005336 | Ga0070680_100007591 | Ga0070680_1000075912 | 149 |
| 542 | 3300005338 | Ga0068868_100024305 | Ga0068868_1000243053 | 149 |
| 543 | 3300005340 | Ga0070689_100323954 | Ga0070689_1003239542 | 149 |
| 544 | 3300005353 | Ga0070669_100227616 | Ga0070669_1002276162 | 149 |
| 545 | 3300005354 | Ga0070675_100094595 | Ga0070675_1000945953 | 149 |
| 546 | 3300005355 | Ga0070671_100006834 | Ga0070671_1000068343 | 149 |
| 547 | 3300005355 | Ga0070671_100414269 | Ga0070671_1004142692 | 149 |
| 548 | 3300005364 | Ga0070673_100039470 | Ga0070673_1000394703 | 149 |
| 549 | 3300005365 | Ga0070688_100027695 | Ga0070688_1000276951 | 149 |
| 550 | 3300005367 | Ga0070667_100009924 | Ga0070667_1000099242 | 149 |
| 551 | 3300005438 | Ga0070701_10260659 | Ga0070701_102606592 | 149 |
| 552 | 3300005441 | Ga0070700_100014593 | Ga0070700_1000145933 | 149 |
| 553 | 3300005444 | Ga0070694_100048840 | Ga0070694_1000488402 | 149 |
| 554 | 3300005456 | Ga0070678_100077740 | Ga0070678_1000777403 | 149 |
| 555 | 3300005456 | Ga0070678_102141520 | Ga0070678_1021415201 | 149 |
| 556 | 3300005458 | Ga0070681_10000425 | Ga0070681_1000042510 | 149 |
| 557 | 3300005459 | Ga0068867_100039248 | Ga0068867_1000392482 | 149 |
| 558 | 3300005466 | Ga0070685_10008724 | Ga0070685_100087242 | 149 |
| 559 | 3300005468 | Ga0070707_100817692 | Ga0070707_1008176921 | 149 |
| 560 | 3300005471 | Ga0070698_100014111 | Ga0070698_1000141114 | 149 |
| 561 | 3300005471 | Ga0070698_100598680 | Ga0070698_1005986802 | 149 |
| 562 | 3300005518 | Ga0070699_100147720 | Ga0070699_1001477203 | 149 |
| 563 | 3300005530 | Ga0070679_100000308 | Ga0070679_1000003081 | 149 |
| 564 | 3300005535 | Ga0070684_100107878 | Ga0070684_1001078783 | 149 |
| 565 | 3300005536 | Ga0070697_100041573 | Ga0070697_1000415732 | 149 |
| 566 | 3300005543 | Ga0070672_100043818 | Ga0070672_1000438182 | 149 |
| 567 | 3300005544 | Ga0070686_100006820 | Ga0070686_1000068202 | 149 |
| 568 | 3300005544 | Ga0070686_101230031 | Ga0070686_1012300311 | 149 |
| 569 | 3300005545 | Ga0070695_100192404 | Ga0070695_1001924042 | 149 |
| 570 | 3300005546 | Ga0070696_101565582 | Ga0070696_1015655821 | 149 |
| 571 | 3300005546 | Ga0070696_101870732 | Ga0070696_1018707321 | 149 |
| 572 | 3300005549 | Ga0070704_101241523 | Ga0070704_1012415232 | 149 |
| 573 | 3300005564 | Ga0070664_100648085 | Ga0070664_1006480852 | 149 |
| 574 | 3300005578 | Ga0068854_100017037 | Ga0068854_1000170377 | 149 |
| 575 | 3300005615 | Ga0070702_100304718 | Ga0070702_1003047182 | 149 |
| 576 | 3300005616 | Ga0068852_100093014 | Ga0068852_1000930144 | 149 |
| 577 | 3300005617 | Ga0068859_100573248 | Ga0068859_1005732482 | 149 |
| 578 | 3300005618 | Ga0068864_100483826 | Ga0068864_1004838261 | 149 |
| 579 | 3300005718 | Ga0068866_10028898 | Ga0068866_100288983 | 149 |
| 580 | 3300005719 | Ga0068861_100022941 | Ga0068861_1000229414 | 149 |
| 581 | 3300005841 | Ga0068863_100074782 | Ga0068863_1000747823 | 149 |
| 582 | 3300005842 | Ga0068858_100082328 | Ga0068858_1000823282 | 149 |
| 583 | 3300005843 | Ga0068860_100037964 | Ga0068860_1000379643 | 149 |
| 584 | 3300005844 | Ga0068862_100056661 | Ga0068862_1000566612 | 149 |
| 585 | 3300005844 | Ga0068862_100381212 | Ga0068862_1003812122 | 149 |
| 586 | 3300006237 | Ga0097621_100010001 | Ga0097621_1000100016 | 149 |
| 587 | 3300006358 | Ga0068871_100024423 | Ga0068871_1000244232 | 149 |
| 588 | 3300006844 | Ga0075428_100046558 | Ga0075428_1000465582 | 149 |
| 589 | 3300006852 | Ga0075433_10353404 | Ga0075433_103534042 | 149 |
| 590 | 3300006852 | Ga0075433_10580550 | Ga0075433_105805501 | 149 |
| 591 | 3300006871 | Ga0075434_101212793 | Ga0075434_1012127931 | 149 |
| 592 | 3300006880 | Ga0075429_101810688 | Ga0075429_1018106881 | 149 |
| 593 | 3300006881 | Ga0068865_100005466 | Ga0068865_1000054668 | 149 |
| 594 | 3300006931 | Ga0097620_100573238 | Ga0097620_1005732382 | 149 |
| 595 | 3300007076 | Ga0075435_100859535 | Ga0075435_1008595351 | 149 |
| 596 | 3300007076 | Ga0075435_101725329 | Ga0075435_1017253291 | 149 |
| 597 | 3300009036 | Ga0105244_10259618 | Ga0105244_102596181 | 149 |
| 598 | 3300009093 | Ga0105240_12179640 | Ga0105240_121796401 | 149 |
| 599 | 3300009098 | Ga0105245_10009220 | Ga0105245_100092208 | 149 |
| 600 | 3300009101 | Ga0105247_10209413 | Ga0105247_102094133 | 149 |
| 601 | 3300009148 | Ga0105243_10055155 | Ga0105243_100551552 | 149 |
| 602 | 3300009174 | Ga0105241_10215505 | Ga0105241_102155052 | 149 |
| 603 | 3300009176 | Ga0105242_10007678 | Ga0105242_100076788 | 149 |
| 604 | 3300009177 | Ga0105248_10014028 | Ga0105248_100140288 | 149 |
| 605 | 3300009553 | Ga0105249_10033646 | Ga0105249_100336463 | 149 |
| 606 | 3300009553 | Ga0105249_11739543 | Ga0105249_117395432 | 149 |
| 607 | 3300009553 | Ga0105249_12722649 | Ga0105249_127226491 | 149 |
| 608 | 3300011119 | Ga0105246_10027132 | Ga0105246_100271326 | 149 |
| 609 | 3300013102 | Ga0157371_11150040 | Ga0157371_111500401 | 149 |
| 610 | 3300013296 | Ga0157374_10516761 | Ga0157374_105167612 | 149 |
| 611 | 3300013297 | Ga0157378_10006757 | Ga0157378_100067578 | 149 |
| 612 | 3300013306 | Ga0163162_10088515 | Ga0163162_100885153 | 149 |
| 613 | 3300013306 | Ga0163162_11342019 | Ga0163162_113420191 | 149 |
| 614 | 3300013308 | Ga0157375_10248965 | Ga0157375_102489652 | 149 |
| 615 | 3300014325 | Ga0163163_10010551 | Ga0163163_100105513 | 149 |
| 616 | 3300014326 | Ga0157380_10006445 | Ga0157380_100064452 | 149 |
| 617 | 3300014326 | Ga0157380_11610301 | Ga0157380_116103011 | 149 |
| 618 | 3300014745 | Ga0157377_10187065 | Ga0157377_101870652 | 149 |
| 619 | 3300014969 | Ga0157376_10167934 | Ga0157376_101679342 | 149 |
| 620 | 3300017792 | Ga0163161_10039795 | Ga0163161_100397953 | 149 |
| 621 | 3300025899 | Ga0207642_10059505 | Ga0207642_100595052 | 149 |
| 622 | 3300025900 | Ga0207710_10193559 | Ga0207710_101935592 | 149 |
| 623 | 3300025901 | Ga0207688_10075149 | Ga0207688_100751493 | 149 |
| 624 | 3300025903 | Ga0207680_10158946 | Ga0207680_101589461 | 149 |
| 625 | 3300025911 | Ga0207654_10259353 | Ga0207654_102593532 | 149 |
| 626 | 3300025912 | Ga0207707_10000016 | Ga0207707_1000001638 | 149 |
| 627 | 3300025917 | Ga0207660_10072579 | Ga0207660_100725792 | 149 |
| 628 | 3300025918 | Ga0207662_10201316 | Ga0207662_102013162 | 149 |
| 629 | 3300025921 | Ga0207652_10000267 | Ga0207652_1000026731 | 149 |
| 630 | 3300025922 | Ga0207646_11543974 | Ga0207646_115439741 | 149 |
| 631 | 3300025923 | Ga0207681_10025237 | Ga0207681_100252372 | 149 |
| 632 | 3300025931 | Ga0207644_10013122 | Ga0207644_100131226 | 149 |
| 633 | 3300025931 | Ga0207644_10086890 | Ga0207644_100868901 | 149 |
| 634 | 3300025934 | Ga0207686_10005623 | Ga0207686_100056236 | 149 |
| 635 | 3300025935 | Ga0207709_10092751 | Ga0207709_100927512 | 149 |
| 636 | 3300025936 | Ga0207670_10220864 | Ga0207670_102208642 | 149 |
| 637 | 3300025936 | Ga0207670_10685541 | Ga0207670_106855411 | 149 |
| 638 | 3300025938 | Ga0207704_10015168 | Ga0207704_100151682 | 149 |
| 639 | 3300025940 | Ga0207691_10011757 | Ga0207691_100117572 | 149 |
| 640 | 3300025942 | Ga0207689_10030521 | Ga0207689_100305211 | 149 |
| 641 | 3300025960 | Ga0207651_10195565 | Ga0207651_101955652 | 149 |
| 642 | 3300025961 | Ga0207712_10031309 | Ga0207712_100313094 | 149 |
| 643 | 3300025961 | Ga0207712_11406653 | Ga0207712_114066531 | 149 |
| 644 | 3300025981 | Ga0207640_10022653 | Ga0207640_100226533 | 149 |
| 645 | 3300026023 | Ga0207677_10012110 | Ga0207677_100121103 | 149 |
| 646 | 3300026035 | Ga0207703_10161973 | Ga0207703_101619732 | 149 |
| 647 | 3300026075 | Ga0207708_10132826 | Ga0207708_101328261 | 149 |
| 648 | 3300026088 | Ga0207641_10043522 | Ga0207641_100435224 | 149 |
| 649 | 3300026089 | Ga0207648_11392547 | Ga0207648_113925471 | 149 |
| 650 | 3300026095 | Ga0207676_10097178 | Ga0207676_100971783 | 149 |
| 651 | 3300026118 | Ga0207675_100017622 | Ga0207675_1000176222 | 149 |
| 652 | 3300026121 | Ga0207683_10320888 | Ga0207683_103208881 | 149 |
| 653 | 3300028380 | Ga0268265_10452924 | Ga0268265_104529242 | 149 |
| 654 | 3300028380 | Ga0268265_10580258 | Ga0268265_105802582 | 149 |
| 655 | 3300028381 | Ga0268264_10246915 | Ga0268264_102469152 | 149 |
| 656 | 3300035691 | Ga0373931_0841339 | Ga0373931_0841339_104_553 | 149 |
| 657 | 3300045051 | Ga0451576_0782912 | Ga0451576_0782912_496_945 | 149 |
| 658 | 3300048915 | Ga0496112_0942103 | Ga0496112_0942103_56_505 | 149 |
| 659 | 3300048915 | Ga0496112_1079468 | Ga0496112_1079468_95_544 | 149 |
| 660 | 3300050511 | nmdc:mga08y16_276937_c1 | nmdc:mga08y16_276937_c1_1252_1701 | 149 |
| 661 | 3300050512 | nmdc:mga0n895_521573_c1 | nmdc:mga0n895_521573_c1_638_1087 | 149 |
| 662 | 3300001990 | JGI24737J22298_10099895 | JGI24737J22298_100998951 | 150 |
| 663 | 3300002076 | JGI24749J21850_1068974 | JGI24749J21850_10689741 | 150 |
| 664 | 3300002459 | JGI24751J29686_10000043 | JGI24751J29686_1000004344 | 150 |
| 665 | 3300003203 | JGI25406J46586_10066683 | JGI25406J46586_100666832 | 150 |
| 666 | 3300003203 | JGI25406J46586_10119960 | JGI25406J46586_101199601 | 150 |
| 667 | 3300003203 | JGI25406J46586_10123520 | JGI25406J46586_101235201 | 150 |
| 668 | 3300004801 | Ga0058860_10119785 | Ga0058860_101197851 | 150 |
| 669 | 3300004803 | Ga0058862_10040385 | Ga0058862_100403852 | 150 |
| 670 | 3300005288 | Ga0065714_10378440 | Ga0065714_103784401 | 150 |
| 671 | 3300005289 | Ga0065704_10006068 | Ga0065704_100060681 | 150 |
| 672 | 3300005290 | Ga0065712_10033824 | Ga0065712_100338241 | 150 |
| 673 | 3300005290 | Ga0065712_10321286 | Ga0065712_103212861 | 150 |
| 674 | 3300005293 | Ga0065715_10016269 | Ga0065715_100162693 | 150 |
| 675 | 3300005293 | Ga0065715_10477965 | Ga0065715_104779651 | 150 |
| 676 | 3300005293 | Ga0065715_10497524 | Ga0065715_104975241 | 150 |
| 677 | 3300005295 | Ga0065707_10090144 | Ga0065707_100901441 | 150 |
| 678 | 3300005295 | Ga0065707_10182165 | Ga0065707_101821652 | 150 |
| 679 | 3300005330 | Ga0070690_100267179 | Ga0070690_1002671792 | 150 |
| 680 | 3300005330 | Ga0070690_100297906 | Ga0070690_1002979062 | 150 |
| 681 | 3300005331 | Ga0070670_100092380 | Ga0070670_1000923802 | 150 |
| 682 | 3300005331 | Ga0070670_101852565 | Ga0070670_1018525651 | 150 |
| 683 | 3300005333 | Ga0070677_10856470 | Ga0070677_108564701 | 150 |
| 684 | 3300005334 | Ga0068869_100327120 | Ga0068869_1003271201 | 150 |
| 685 | 3300005334 | Ga0068869_100391230 | Ga0068869_1003912301 | 150 |
| 686 | 3300005335 | Ga0070666_10275761 | Ga0070666_102757612 | 150 |
| 687 | 3300005336 | Ga0070680_100422887 | Ga0070680_1004228872 | 150 |
| 688 | 3300005337 | Ga0070682_100178981 | Ga0070682_1001789812 | 150 |
| 689 | 3300005337 | Ga0070682_101055797 | Ga0070682_1010557972 | 150 |
| 690 | 3300005340 | Ga0070689_100106631 | Ga0070689_1001066313 | 150 |
| 691 | 3300005341 | Ga0070691_10173166 | Ga0070691_101731662 | 150 |
| 692 | 3300005343 | Ga0070687_100116595 | Ga0070687_1001165952 | 150 |
| 693 | 3300005344 | Ga0070661_100426703 | Ga0070661_1004267031 | 150 |
| 694 | 3300005345 | Ga0070692_10068274 | Ga0070692_100682743 | 150 |
| 695 | 3300005354 | Ga0070675_100253320 | Ga0070675_1002533202 | 150 |
| 696 | 3300005356 | Ga0070674_100595132 | Ga0070674_1005951322 | 150 |
| 697 | 3300005364 | Ga0070673_100060363 | Ga0070673_1000603632 | 150 |
| 698 | 3300005364 | Ga0070673_100145891 | Ga0070673_1001458913 | 150 |
| 699 | 3300005364 | Ga0070673_100363237 | Ga0070673_1003632371 | 150 |
| 700 | 3300005434 | Ga0070709_11555215 | Ga0070709_115552151 | 150 |
| 701 | 3300005438 | Ga0070701_11077122 | Ga0070701_110771221 | 150 |
| 702 | 3300005440 | Ga0070705_100112461 | Ga0070705_1001124612 | 150 |
| 703 | 3300005440 | Ga0070705_100422749 | Ga0070705_1004227491 | 150 |
| 704 | 3300005441 | Ga0070700_100000266 | Ga0070700_10000026629 | 150 |
| 705 | 3300005441 | Ga0070700_100185277 | Ga0070700_1001852772 | 150 |
| 706 | 3300005441 | Ga0070700_100282791 | Ga0070700_1002827911 | 150 |
| 707 | 3300005441 | Ga0070700_100321158 | Ga0070700_1003211581 | 150 |
| 708 | 3300005441 | Ga0070700_101799189 | Ga0070700_1017991891 | 150 |
| 709 | 3300005444 | Ga0070694_100089907 | Ga0070694_1000899073 | 150 |
| 710 | 3300005444 | Ga0070694_100374063 | Ga0070694_1003740632 | 150 |
| 711 | 3300005456 | Ga0070678_100201921 | Ga0070678_1002019211 | 150 |
| 712 | 3300005457 | Ga0070662_100221238 | Ga0070662_1002212382 | 150 |
| 713 | 3300005458 | Ga0070681_10005227 | Ga0070681_100052276 | 150 |
| 714 | 3300005466 | Ga0070685_10992291 | Ga0070685_109922911 | 150 |
| 715 | 3300005518 | Ga0070699_100060955 | Ga0070699_1000609552 | 150 |
| 716 | 3300005539 | Ga0068853_100021364 | Ga0068853_1000213645 | 150 |
| 717 | 3300005545 | Ga0070695_100323273 | Ga0070695_1003232731 | 150 |
| 718 | 3300005546 | Ga0070696_100492901 | Ga0070696_1004929012 | 150 |
| 719 | 3300005547 | Ga0070693_100009251 | Ga0070693_1000092514 | 150 |
| 720 | 3300005549 | Ga0070704_100309990 | Ga0070704_1003099902 | 150 |
| 721 | 3300005564 | Ga0070664_100594897 | Ga0070664_1005948971 | 150 |
| 722 | 3300005615 | Ga0070702_100022419 | Ga0070702_1000224193 | 150 |
| 723 | 3300005615 | Ga0070702_100159528 | Ga0070702_1001595283 | 150 |
| 724 | 3300005615 | Ga0070702_100202279 | Ga0070702_1002022792 | 150 |
| 725 | 3300005615 | Ga0070702_100300332 | Ga0070702_1003003322 | 150 |
| 726 | 3300005616 | Ga0068852_100817665 | Ga0068852_1008176651 | 150 |
| 727 | 3300005617 | Ga0068859_100147685 | Ga0068859_1001476853 | 150 |
| 728 | 3300005617 | Ga0068859_100205327 | Ga0068859_1002053274 | 150 |
| 729 | 3300005617 | Ga0068859_101344893 | Ga0068859_1013448932 | 150 |
| 730 | 3300005617 | Ga0068859_101949886 | Ga0068859_1019498861 | 150 |
| 731 | 3300005617 | Ga0068859_103148907 | Ga0068859_1031489071 | 150 |
| 732 | 3300005618 | Ga0068864_100454383 | Ga0068864_1004543832 | 150 |
| 733 | 3300005719 | Ga0068861_101738102 | Ga0068861_1017381021 | 150 |
| 734 | 3300005840 | Ga0068870_10763273 | Ga0068870_107632732 | 150 |
| 735 | 3300005841 | Ga0068863_100090858 | Ga0068863_1000908583 | 150 |
| 736 | 3300005842 | Ga0068858_100033389 | Ga0068858_1000333891 | 150 |
| 737 | 3300005842 | Ga0068858_100287872 | Ga0068858_1002878721 | 150 |
| 738 | 3300005843 | Ga0068860_100114135 | Ga0068860_1001141352 | 150 |
| 739 | 3300005843 | Ga0068860_101723245 | Ga0068860_1017232451 | 150 |
| 740 | 3300005844 | Ga0068862_100451050 | Ga0068862_1004510502 | 150 |
| 741 | 3300005937 | Ga0081455_10158880 | Ga0081455_101588802 | 150 |
| 742 | 3300005985 | Ga0081539_10001142 | Ga0081539_1000114250 | 150 |
| 743 | 3300006058 | Ga0075432_10073290 | Ga0075432_100732902 | 150 |
| 744 | 3300006237 | Ga0097621_100364737 | Ga0097621_1003647372 | 150 |
| 745 | 3300006358 | Ga0068871_100523066 | Ga0068871_1005230662 | 150 |
| 746 | 3300006852 | Ga0075433_10037879 | Ga0075433_100378796 | 150 |
| 747 | 3300006852 | Ga0075433_10264822 | Ga0075433_102648223 | 150 |
| 748 | 3300006871 | Ga0075434_100148013 | Ga0075434_1001480133 | 150 |
| 749 | 3300006881 | Ga0068865_100482499 | Ga0068865_1004824992 | 150 |
| 750 | 3300006931 | Ga0097620_100147685 | Ga0097620_1001476853 | 150 |
| 751 | 3300006931 | Ga0097620_100205338 | Ga0097620_1002053384 | 150 |
| 752 | 3300006931 | Ga0097620_101344889 | Ga0097620_1013448892 | 150 |
| 753 | 3300006931 | Ga0097620_101949810 | Ga0097620_1019498101 | 150 |
| 754 | 3300006931 | Ga0097620_103149039 | Ga0097620_1031490391 | 150 |
| 755 | 3300009011 | Ga0105251_10176467 | Ga0105251_101764672 | 150 |
| 756 | 3300009093 | Ga0105240_10106929 | Ga0105240_101069293 | 150 |
| 757 | 3300009093 | Ga0105240_11624294 | Ga0105240_116242941 | 150 |
| 758 | 3300009094 | Ga0111539_10003746 | Ga0111539_1000374613 | 150 |
| 759 | 3300009098 | Ga0105245_11772465 | Ga0105245_117724651 | 150 |
| 760 | 3300009101 | Ga0105247_11249209 | Ga0105247_112492091 | 150 |
| 761 | 3300009101 | Ga0105247_11370099 | Ga0105247_113700991 | 150 |
| 762 | 3300009101 | Ga0105247_11467234 | Ga0105247_114672341 | 150 |
| 763 | 3300009147 | Ga0114129_10181912 | Ga0114129_101819122 | 150 |
| 764 | 3300009147 | Ga0114129_10877672 | Ga0114129_108776723 | 150 |
| 765 | 3300009148 | Ga0105243_12227233 | Ga0105243_122272331 | 150 |
| 766 | 3300009174 | Ga0105241_10710659 | Ga0105241_107106591 | 150 |
| 767 | 3300009174 | Ga0105241_11230423 | Ga0105241_112304232 | 150 |
| 768 | 3300009176 | Ga0105242_10565038 | Ga0105242_105650382 | 150 |
| 769 | 3300009176 | Ga0105242_12600125 | Ga0105242_126001251 | 150 |
| 770 | 3300009177 | Ga0105248_10091433 | Ga0105248_100914333 | 150 |
| 771 | 3300009177 | Ga0105248_10179460 | Ga0105248_101794601 | 150 |
| 772 | 3300009177 | Ga0105248_10489049 | Ga0105248_104890491 | 150 |
| 773 | 3300009177 | Ga0105248_11591229 | Ga0105248_115912291 | 150 |
| 774 | 3300009545 | Ga0105237_10326547 | Ga0105237_103265472 | 150 |
| 775 | 3300009551 | Ga0105238_10049968 | Ga0105238_100499681 | 150 |
| 776 | 3300009553 | Ga0105249_10023100 | Ga0105249_100231005 | 150 |
| 777 | 3300009553 | Ga0105249_11031258 | Ga0105249_110312581 | 150 |
| 778 | 3300009553 | Ga0105249_12235555 | Ga0105249_122355551 | 150 |
| 779 | 3300010375 | Ga0105239_10537338 | Ga0105239_105373382 | 150 |
| 780 | 3300011119 | Ga0105246_10466384 | Ga0105246_104663841 | 150 |
| 781 | 3300013100 | Ga0157373_10910577 | Ga0157373_109105771 | 150 |
| 782 | 3300013100 | Ga0157373_11065013 | Ga0157373_110650131 | 150 |
| 783 | 3300013297 | Ga0157378_10787995 | Ga0157378_107879952 | 150 |
| 784 | 3300013307 | Ga0157372_13347804 | Ga0157372_133478041 | 150 |
| 785 | 3300013308 | Ga0157375_12653253 | Ga0157375_126532531 | 150 |
| 786 | 3300014325 | Ga0163163_12293797 | Ga0163163_122937971 | 150 |
| 787 | 3300014325 | Ga0163163_13273837 | Ga0163163_132738371 | 150 |
| 788 | 3300014497 | Ga0182008_10327499 | Ga0182008_103274991 | 150 |
| 789 | 3300014968 | Ga0157379_10291413 | Ga0157379_102914132 | 150 |
| 790 | 3300014968 | Ga0157379_10489485 | Ga0157379_104894852 | 150 |
| 791 | 3300015262 | Ga0182007_10132255 | Ga0182007_101322551 | 150 |
| 792 | 3300017792 | Ga0163161_10652039 | Ga0163161_106520392 | 150 |
| 793 | 3300025899 | Ga0207642_10366178 | Ga0207642_103661782 | 150 |
| 794 | 3300025900 | Ga0207710_10076290 | Ga0207710_100762901 | 150 |
| 795 | 3300025900 | Ga0207710_10429959 | Ga0207710_104299592 | 150 |
| 796 | 3300025904 | Ga0207647_10002003 | Ga0207647_1000200313 | 150 |
| 797 | 3300025904 | Ga0207647_10586971 | Ga0207647_105869711 | 150 |
| 798 | 3300025908 | Ga0207643_10456106 | Ga0207643_104561061 | 150 |
| 799 | 3300025911 | Ga0207654_10215580 | Ga0207654_102155801 | 150 |
| 800 | 3300025911 | Ga0207654_10941177 | Ga0207654_109411772 | 150 |
| 801 | 3300025912 | Ga0207707_10010480 | Ga0207707_100104809 | 150 |
| 802 | 3300025913 | Ga0207695_10061311 | Ga0207695_100613114 | 150 |
| 803 | 3300025913 | Ga0207695_10916558 | Ga0207695_109165582 | 150 |
| 804 | 3300025914 | Ga0207671_10340550 | Ga0207671_103405502 | 150 |
| 805 | 3300025918 | Ga0207662_10029256 | Ga0207662_100292567 | 150 |
| 806 | 3300025918 | Ga0207662_10093326 | Ga0207662_100933261 | 150 |
| 807 | 3300025920 | Ga0207649_10935990 | Ga0207649_109359902 | 150 |
| 808 | 3300025920 | Ga0207649_11196969 | Ga0207649_111969691 | 150 |
| 809 | 3300025924 | Ga0207694_10008076 | Ga0207694_100080764 | 150 |
| 810 | 3300025925 | Ga0207650_10000011 | Ga0207650_10000011167 | 150 |
| 811 | 3300025927 | Ga0207687_10852988 | Ga0207687_108529882 | 150 |
| 812 | 3300025932 | Ga0207690_10154128 | Ga0207690_101541282 | 150 |
| 813 | 3300025934 | Ga0207686_10296618 | Ga0207686_102966182 | 150 |
| 814 | 3300025935 | Ga0207709_10286232 | Ga0207709_102862322 | 150 |
| 815 | 3300025936 | Ga0207670_10039470 | Ga0207670_100394703 | 150 |
| 816 | 3300025940 | Ga0207691_10083615 | Ga0207691_100836152 | 150 |
| 817 | 3300025941 | Ga0207711_10008388 | Ga0207711_100083888 | 150 |
| 818 | 3300025941 | Ga0207711_10010629 | Ga0207711_100106291 | 150 |
| 819 | 3300025941 | Ga0207711_10157868 | Ga0207711_101578682 | 150 |
| 820 | 3300025941 | Ga0207711_10366421 | Ga0207711_103664212 | 150 |
| 821 | 3300025941 | Ga0207711_11013065 | Ga0207711_110130651 | 150 |
| 822 | 3300025942 | Ga0207689_10196005 | Ga0207689_101960052 | 150 |
| 823 | 3300025945 | Ga0207679_11451951 | Ga0207679_114519512 | 150 |
| 824 | 3300025960 | Ga0207651_10324471 | Ga0207651_103244711 | 150 |
| 825 | 3300025960 | Ga0207651_10581801 | Ga0207651_105818011 | 150 |
| 826 | 3300025960 | Ga0207651_11677465 | Ga0207651_116774651 | 150 |
| 827 | 3300025961 | Ga0207712_10010700 | Ga0207712_100107006 | 150 |
| 828 | 3300025961 | Ga0207712_10178431 | Ga0207712_101784312 | 150 |
| 829 | 3300026023 | Ga0207677_11133000 | Ga0207677_111330002 | 150 |
| 830 | 3300026035 | Ga0207703_10403191 | Ga0207703_104031911 | 150 |
| 831 | 3300026041 | Ga0207639_10018927 | Ga0207639_100189273 | 150 |
| 832 | 3300026067 | Ga0207678_10345583 | Ga0207678_103455832 | 150 |
| 833 | 3300026075 | Ga0207708_11253514 | Ga0207708_112535142 | 150 |
| 834 | 3300026088 | Ga0207641_10358719 | Ga0207641_103587192 | 150 |
| 835 | 3300026095 | Ga0207676_10974991 | Ga0207676_109749911 | 150 |
| 836 | 3300026095 | Ga0207676_11845153 | Ga0207676_118451532 | 150 |
| 837 | 3300026116 | Ga0207674_10866817 | Ga0207674_108668172 | 150 |
| 838 | 3300026118 | Ga0207675_100108369 | Ga0207675_1001083693 | 150 |
| 839 | 3300026118 | Ga0207675_100638653 | Ga0207675_1006386532 | 150 |
| 840 | 3300026121 | Ga0207683_10365711 | Ga0207683_103657113 | 150 |
| 841 | 3300026142 | Ga0207698_10685147 | Ga0207698_106851471 | 150 |
| 842 | 3300026142 | Ga0207698_12686907 | Ga0207698_126869071 | 150 |
| 843 | 3300027907 | Ga0207428_10007924 | Ga0207428_100079249 | 150 |
| 844 | 3300028380 | Ga0268265_11392600 | Ga0268265_113926001 | 150 |
| 845 | 3300028381 | Ga0268264_10042115 | Ga0268264_100421152 | 150 |
| 846 | 3300028381 | Ga0268264_10776110 | Ga0268264_107761102 | 150 |
| 847 | 3300031548 | Ga0307408_100662298 | Ga0307408_1006622982 | 150 |
| 848 | 3300031731 | Ga0307405_10024793 | Ga0307405_100247931 | 150 |
| 849 | 3300031824 | Ga0307413_10165095 | Ga0307413_101650953 | 150 |
| 850 | 3300031901 | Ga0307406_10003940 | Ga0307406_100039404 | 150 |
| 851 | 3300031903 | Ga0307407_10256679 | Ga0307407_102566793 | 150 |
| 852 | 3300031911 | Ga0307412_10062960 | Ga0307412_100629601 | 150 |
| 853 | 3300032002 | Ga0307416_100105312 | Ga0307416_1001053121 | 150 |
| 854 | 3300032004 | Ga0307414_10001220 | Ga0307414_100012206 | 150 |
| 855 | 3300032005 | Ga0307411_10040958 | Ga0307411_100409582 | 150 |
| 856 | 3300032126 | Ga0307415_100003721 | Ga0307415_1000037214 | 150 |
| 857 | 3300032126 | Ga0307415_100291353 | Ga0307415_1002913531 | 150 |
| 858 | 3300035091 | Ga0373951_0016691 | Ga0373951_0016691_414_866 | 150 |
| 859 | 3300035092 | Ga0373952_0074749 | Ga0373952_0074749_266_718 | 150 |
| 860 | 3300035112 | Ga0373932_0137063 | Ga0373932_0137063_89_541 | 150 |
| 861 | 3300035112 | Ga0373932_0174589 | Ga0373932_0174589_129_581 | 150 |
| 862 | 3300035112 | Ga0373932_0286560 | Ga0373932_0286560_25_477 | 150 |
| 863 | 3300035114 | Ga0373939_0275552 | Ga0373939_0275552_16_468 | 150 |
| 864 | 3300035115 | Ga0373941_0008984 | Ga0373941_0008984_66_518 | 150 |
| 865 | 3300035207 | Ga0373942_0031044 | Ga0373942_0031044_437_889 | 150 |
| 866 | 3300035241 | Ga0373961_0012637 | Ga0373961_0012637_1171_1623 | 150 |
| 867 | 3300035242 | Ga0373962_0095627 | Ga0373962_0095627_315_767 | 150 |
| 868 | 3300035691 | Ga0373931_0195668 | Ga0373931_0195668_258_710 | 150 |
| 869 | 3300035691 | Ga0373931_0950653 | Ga0373931_0950653_16_468 | 150 |
| 870 | 3300035725 | Ga0373947_0278960 | Ga0373947_0278960_451_1095 | 150 |
| 871 | 3300037466 | Ga0395898_1475873 | Ga0395898_1475873_65_517 | 150 |
| 872 | 3300042003 | Ga0439443_037385 | Ga0439443_037385_204_656 | 150 |
| 873 | 3300042005 | Ga0439448_0079594 | Ga0439448_0079594_468_920 | 150 |
| 874 | 3300042012 | Ga0439455_0053784 | Ga0439455_0053784_392_844 | 150 |
| 875 | 3300042157 | Ga0439458_0026212 | Ga0439458_0026212_53_505 | 150 |
| 876 | 3300042438 | Ga0439459_0092623 | Ga0439459_0092623_184_636 | 150 |
| 877 | 3300042876 | Ga0451577_1457282 | Ga0451577_1457282_34_486 | 150 |
| 878 | 3300046517 | Ga0495630_0209707 | Ga0495630_0209707_739_1191 | 150 |
| 879 | 3300046525 | Ga0495663_0062646 | Ga0495663_0062646_389_946 | 150 |
| 880 | 3300046529 | Ga0495652_0468599 | Ga0495652_0468599_227_679 | 150 |
| 881 | 3300046533 | Ga0495640_0607224 | Ga0495640_0607224_184_636 | 150 |
| 882 | 3300046535 | Ga0495586_0149653 | Ga0495586_0149653_840_1292 | 150 |
| 883 | 3300046663 | Ga0495635_0314849 | Ga0495635_0314849_517_969 | 150 |
| 884 | 3300046689 | Ga0495613_0278931 | Ga0495613_0278931_83_535 | 150 |
| 885 | 3300046809 | Ga0495600_0173356 | Ga0495600_0173356_311_763 | 150 |
| 886 | 3300047471 | Ga0495684_0241561 | Ga0495684_0241561_697_1149 | 150 |
| 887 | 3300048912 | Ga0496109_0972430 | Ga0496109_0972430_209_661 | 150 |
| 888 | 3300048914 | Ga0496111_0292601 | Ga0496111_0292601_98_550 | 150 |
| 889 | 3300048915 | Ga0496112_0214235 | Ga0496112_0214235_936_1388 | 150 |
| 890 | 3300049127 | Ga0501306_099876 | Ga0501306_099876_55_507 | 150 |
| 891 | 3300049130 | Ga0501310_035763 | Ga0501310_035763_154_606 | 150 |
| 892 | 3300049132 | Ga0501343_011884 | Ga0501343_011884_234_686 | 150 |
| 893 | 3300049161 | Ga0501305_037827 | Ga0501305_037827_19_471 | 150 |
| 894 | 3300049162 | Ga0501307_037061 | Ga0501307_037061_47_499 | 150 |
| 895 | 3300049520 | Ga0501297_024037 | Ga0501297_024037_207_659 | 150 |
| 896 | 3300049521 | Ga0501298_032456 | Ga0501298_032456_562_1014 | 150 |
| 897 | 3300049527 | Ga0501311_014226 | Ga0501311_014226_133_585 | 150 |
| 898 | 3300049528 | Ga0501312_061312 | Ga0501312_061312_183_635 | 150 |
| 899 | 3300049532 | Ga0501316_038051 | Ga0501316_038051_15_467 | 150 |
| 900 | 3300049537 | Ga0501321_055582 | Ga0501321_055582_104_556 | 150 |
| 901 | 3300049552 | Ga0501336_007859 | Ga0501336_007859_50_502 | 150 |
| 902 | 3300049649 | Ga0501198_014327 | Ga0501198_014327_50_502 | 150 |
| 903 | 3300049652 | Ga0501202_006804 | Ga0501202_006804_1244_1696 | 150 |
| 904 | 3300049652 | Ga0501202_218305 | Ga0501202_218305_19_471 | 150 |
| 905 | 3300049654 | Ga0501207_033437 | Ga0501207_033437_57_509 | 150 |
| 906 | 3300049659 | Ga0501214_033838 | Ga0501214_033838_171_623 | 150 |
| 907 | 3300049661 | Ga0501217_001688 | Ga0501217_001688_207_659 | 150 |
| 908 | 3300049661 | Ga0501217_171747 | Ga0501217_171747_160_612 | 150 |
| 909 | 3300049663 | Ga0501223_006757 | Ga0501223_006757_1343_1795 | 150 |
| 910 | 3300049664 | Ga0501224_002475 | Ga0501224_002475_167_619 | 150 |
| 911 | 3300049665 | Ga0501227_006471 | Ga0501227_006471_1860_2312 | 150 |
| 912 | 3300049668 | Ga0501233_039001 | Ga0501233_039001_448_900 | 150 |
| 913 | 3300049669 | Ga0501235_001522 | Ga0501235_001522_120_572 | 150 |
| 914 | 3300049676 | Ga0501246_009917 | Ga0501246_009917_173_625 | 150 |
| 915 | 3300049679 | Ga0501249_108615 | Ga0501249_108615_27_479 | 150 |
| 916 | 3300049680 | Ga0501250_080830 | Ga0501250_080830_54_506 | 150 |
| 917 | 3300049685 | Ga0501256_009852 | Ga0501256_009852_99_551 | 150 |
| 918 | 3300049689 | Ga0501260_018696 | Ga0501260_018696_148_600 | 150 |
| 919 | 3300049703 | Ga0501219_006974 | Ga0501219_006974_134_586 | 150 |
| 920 | 3300049704 | Ga0501221_069436 | Ga0501221_069436_331_783 | 150 |
| 921 | 3300049705 | Ga0501225_0001628 | Ga0501225_0001628_231_683 | 150 |
| 922 | 3300049707 | Ga0501234_004052 | Ga0501234_004052_1532_1984 | 150 |
| 923 | 3300049767 | Ga0501270_102705 | Ga0501270_102705_94_546 | 150 |
| 924 | 3300049853 | Ga0501226_010581 | Ga0501226_010581_291_743 | 150 |
| 925 | 3300050507 | nmdc:mga05p37_273385_c1 | nmdc:mga05p37_273385_c1_543_995 | 150 |
| 926 | 3300050511 | nmdc:mga08y16_1346998_c1 | nmdc:mga08y16_1346998_c1_186_638 | 150 |
| 927 | 3300050511 | nmdc:mga08y16_3423_c1 | nmdc:mga08y16_3423_c1_6058_6510 | 150 |
| 928 | 3300050512 | nmdc:mga0n895_43244_c1 | nmdc:mga0n895_43244_c1_602_1054 | 150 |
| 929 | 3300050515 | nmdc:mga0a205_109324_c1 | nmdc:mga0a205_109324_c1_1079_1531 | 150 |
| 930 | 3300050515 | nmdc:mga0a205_47953_c1 | nmdc:mga0a205_47953_c1_579_1031 | 150 |
| 931 | 3300050515 | nmdc:mga0a205_8297_c1 | nmdc:mga0a205_8297_c1_4629_5081 | 150 |
| 932 | 3300059477 | Ga0587084_083359 | Ga0587084_083359_20_472 | 150 |
| 933 | 3300059478 | Ga0587093_054102 | Ga0587093_054102_45_497 | 150 |
| 934 | 3300059490 | Ga0587066_036361 | Ga0587066_036361_140_592 | 150 |
| 935 | 3300059491 | Ga0587070_025959 | Ga0587070_025959_46_498 | 150 |
| 936 | 3300059492 | Ga0587073_0166255 | Ga0587073_0166255_139_591 | 150 |
| 937 | 3300059493 | Ga0587077_103973 | Ga0587077_103973_223_675 | 150 |
| 938 | 3300059493 | Ga0587077_121442 | Ga0587077_121442_141_593 | 150 |
| 939 | 3300059504 | Ga0587082_107384 | Ga0587082_107384_79_531 | 150 |
| 940 | 3300059506 | Ga0587085_081748 | Ga0587085_081748_183_635 | 150 |
| 941 | 3300059507 | Ga0587086_027433 | Ga0587086_027433_17_469 | 150 |
| 942 | 3300059509 | Ga0587089_057413 | Ga0587089_057413_140_592 | 150 |
| 943 | 3300059510 | Ga0587090_027309 | Ga0587090_027309_468_920 | 150 |
| 944 | 3300059510 | Ga0587090_060831 | Ga0587090_060831_120_572 | 150 |
| 945 | 3300059510 | Ga0587090_152475 | Ga0587090_152475_52_504 | 150 |
| 946 | 3300059511 | Ga0587091_103385 | Ga0587091_103385_20_472 | 150 |
| 947 | 3300059512 | Ga0587092_012250 | Ga0587092_012250_99_551 | 150 |
| 948 | 3300059604 | Ga0587098_093001 | Ga0587098_093001_52_504 | 150 |
| 949 | 3300059605 | Ga0587106_027033 | Ga0587106_027033_315_767 | 150 |
| 950 | 3300059605 | Ga0587106_148539 | Ga0587106_148539_47_499 | 150 |
| 951 | 3300059623 | Ga0587101_142642 | Ga0587101_142642_25_477 | 150 |
| 952 | 3300059624 | Ga0587109_129831 | Ga0587109_129831_32_484 | 150 |
| 953 | 3300059627 | Ga0587117_032576 | Ga0587117_032576_321_773 | 150 |
| 954 | 3300059630 | Ga0587128_135202 | Ga0587128_135202_58_510 | 150 |
| 955 | 3300059639 | Ga0587062_059017 | Ga0587062_059017_16_468 | 150 |
| 956 | 3300059639 | Ga0587062_087577 | Ga0587062_087577_46_498 | 150 |
| 957 | 3300059640 | Ga0587067_101685 | Ga0587067_101685_204_656 | 150 |
| 958 | 3300059641 | Ga0587068_073238 | Ga0587068_073238_115_567 | 150 |
| 959 | 3300059643 | Ga0587072_082714 | Ga0587072_082714_84_536 | 150 |
| 960 | 3300059644 | Ga0587075_149732 | Ga0587075_149732_31_483 | 150 |
| 961 | 3300059648 | Ga0587100_012657 | Ga0587100_012657_204_656 | 150 |
| 962 | 3300059652 | Ga0587107_033685 | Ga0587107_033685_22_474 | 150 |
| 963 | 3300059660 | Ga0587124_009956 | Ga0587124_009956_379_831 | 150 |
| 964 | 3300060344 | Ga0587071_046129 | Ga0587071_046129_369_821 | 150 |
| 965 | 3300060344 | Ga0587071_049969 | Ga0587071_049969_343_795 | 150 |
| 966 | 3300060346 | Ga0587111_0070334 | Ga0587111_0070334_215_667 | 150 |
| 967 | 3300001426 | JGI24030J14995_100090 | JGI24030J14995_1000905 | 151 |
| 968 | 3300001432 | JGI24034J14986_100111 | JGI24034J14986_1001118 | 151 |
| 969 | 3300002074 | JGI24748J21848_1000002 | JGI24748J21848_10000027 | 151 |
| 970 | 3300002239 | JGI24034J26672_10000004 | JGI24034J26672_10000004365 | 151 |
| 971 | 3300005290 | Ga0065712_10067728 | Ga0065712_10067728104 | 151 |
| 972 | 3300005290 | Ga0065712_10632539 | Ga0065712_106325391 | 151 |
| 973 | 3300005293 | Ga0065715_10189677 | Ga0065715_101896771 | 151 |
| 974 | 3300005295 | Ga0065707_10562132 | Ga0065707_105621321 | 151 |
| 975 | 3300005330 | Ga0070690_100082134 | Ga0070690_1000821343 | 151 |
| 976 | 3300005330 | Ga0070690_100251554 | Ga0070690_1002515543 | 151 |
| 977 | 3300005331 | Ga0070670_100345033 | Ga0070670_1003450332 | 151 |
| 978 | 3300005334 | Ga0068869_100091051 | Ga0068869_1000910512 | 151 |
| 979 | 3300005334 | Ga0068869_100100721 | Ga0068869_1001007213 | 151 |
| 980 | 3300005336 | Ga0070680_100114808 | Ga0070680_1001148082 | 151 |
| 981 | 3300005336 | Ga0070680_100786614 | Ga0070680_1007866141 | 151 |
| 982 | 3300005337 | Ga0070682_100004665 | Ga0070682_1000046654 | 151 |
| 983 | 3300005338 | Ga0068868_100471816 | Ga0068868_1004718161 | 151 |
| 984 | 3300005339 | Ga0070660_100234739 | Ga0070660_1002347392 | 151 |
| 985 | 3300005340 | Ga0070689_100005909 | Ga0070689_1000059091 | 151 |
| 986 | 3300005341 | Ga0070691_10297087 | Ga0070691_102970871 | 151 |
| 987 | 3300005341 | Ga0070691_10643157 | Ga0070691_106431571 | 151 |
| 988 | 3300005343 | Ga0070687_100032186 | Ga0070687_1000321863 | 151 |
| 989 | 3300005343 | Ga0070687_100248643 | Ga0070687_1002486431 | 151 |
| 990 | 3300005343 | Ga0070687_100450842 | Ga0070687_1004508422 | 151 |
| 991 | 3300005345 | Ga0070692_10224172 | Ga0070692_102241722 | 151 |
| 992 | 3300005345 | Ga0070692_10519847 | Ga0070692_105198471 | 151 |
| 993 | 3300005353 | Ga0070669_100010968 | Ga0070669_1000109682 | 151 |
| 994 | 3300005354 | Ga0070675_100160173 | Ga0070675_1001601732 | 151 |
| 995 | 3300005356 | Ga0070674_101311476 | Ga0070674_1013114761 | 151 |
| 996 | 3300005364 | Ga0070673_100021596 | Ga0070673_1000215967 | 151 |
| 997 | 3300005364 | Ga0070673_101293892 | Ga0070673_1012938922 | 151 |
| 998 | 3300005364 | Ga0070673_101352122 | Ga0070673_1013521221 | 151 |
| 999 | 3300005364 | Ga0070673_101732248 | Ga0070673_1017322481 | 151 |
| 1000 | 3300005366 | Ga0070659_100254240 | Ga0070659_1002542403 | 151 |
| 1001 | 3300005367 | Ga0070667_101227983 | Ga0070667_1012279831 | 151 |
| 1002 | 3300005406 | Ga0070703_10016242 | Ga0070703_100162423 | 151 |
| 1003 | 3300005434 | Ga0070709_10964241 | Ga0070709_109642412 | 151 |
| 1004 | 3300005437 | Ga0070710_10538173 | Ga0070710_105381732 | 151 |
| 1005 | 3300005438 | Ga0070701_10126900 | Ga0070701_101269002 | 151 |
| 1006 | 3300005438 | Ga0070701_10139729 | Ga0070701_101397292 | 151 |
| 1007 | 3300005438 | Ga0070701_10174029 | Ga0070701_101740293 | 151 |
| 1008 | 3300005440 | Ga0070705_100007700 | Ga0070705_1000077002 | 151 |
| 1009 | 3300005440 | Ga0070705_100408288 | Ga0070705_1004082881 | 151 |
| 1010 | 3300005440 | Ga0070705_100768174 | Ga0070705_1007681742 | 151 |
| 1011 | 3300005440 | Ga0070705_101360083 | Ga0070705_1013600831 | 151 |
| 1012 | 3300005441 | Ga0070700_100052147 | Ga0070700_1000521473 | 151 |
| 1013 | 3300005441 | Ga0070700_100094620 | Ga0070700_1000946202 | 151 |
| 1014 | 3300005441 | Ga0070700_100242128 | Ga0070700_1002421282 | 151 |
| 1015 | 3300005441 | Ga0070700_100298186 | Ga0070700_1002981862 | 151 |
| 1016 | 3300005444 | Ga0070694_100070591 | Ga0070694_1000705912 | 151 |
| 1017 | 3300005444 | Ga0070694_100093724 | Ga0070694_1000937241 | 151 |
| 1018 | 3300005444 | Ga0070694_100269767 | Ga0070694_1002697672 | 151 |
| 1019 | 3300005444 | Ga0070694_100573966 | Ga0070694_1005739662 | 151 |
| 1020 | 3300005444 | Ga0070694_100749252 | Ga0070694_1007492521 | 151 |
| 1021 | 3300005444 | Ga0070694_101402326 | Ga0070694_1014023261 | 151 |
| 1022 | 3300005445 | Ga0070708_100118953 | Ga0070708_1001189532 | 151 |
| 1023 | 3300005445 | Ga0070708_100842177 | Ga0070708_1008421772 | 151 |
| 1024 | 3300005445 | Ga0070708_102226187 | Ga0070708_1022261871 | 151 |
| 1025 | 3300005457 | Ga0070662_100021274 | Ga0070662_1000212743 | 151 |
| 1026 | 3300005459 | Ga0068867_100058827 | Ga0068867_1000588273 | 151 |
| 1027 | 3300005459 | Ga0068867_100134785 | Ga0068867_1001347853 | 151 |
| 1028 | 3300005459 | Ga0068867_100174768 | Ga0068867_1001747681 | 151 |
| 1029 | 3300005467 | Ga0070706_100134104 | Ga0070706_1001341043 | 151 |
| 1030 | 3300005467 | Ga0070706_100492659 | Ga0070706_1004926591 | 151 |
| 1031 | 3300005467 | Ga0070706_102007442 | Ga0070706_1020074421 | 151 |
| 1032 | 3300005468 | Ga0070707_100149440 | Ga0070707_1001494403 | 151 |
| 1033 | 3300005468 | Ga0070707_100432607 | Ga0070707_1004326071 | 151 |
| 1034 | 3300005468 | Ga0070707_100453731 | Ga0070707_1004537311 | 151 |
| 1035 | 3300005471 | Ga0070698_100004560 | Ga0070698_10000456017 | 151 |
| 1036 | 3300005471 | Ga0070698_100043199 | Ga0070698_1000431995 | 151 |
| 1037 | 3300005471 | Ga0070698_100355978 | Ga0070698_1003559781 | 151 |
| 1038 | 3300005471 | Ga0070698_100510250 | Ga0070698_1005102501 | 151 |
| 1039 | 3300005471 | Ga0070698_100930291 | Ga0070698_1009302911 | 151 |
| 1040 | 3300005471 | Ga0070698_101570771 | Ga0070698_1015707711 | 151 |
| 1041 | 3300005518 | Ga0070699_100053005 | Ga0070699_1000530054 | 151 |
| 1042 | 3300005518 | Ga0070699_100206549 | Ga0070699_1002065491 | 151 |
| 1043 | 3300005518 | Ga0070699_100390850 | Ga0070699_1003908502 | 151 |
| 1044 | 3300005518 | Ga0070699_100601479 | Ga0070699_1006014792 | 151 |
| 1045 | 3300005536 | Ga0070697_100021785 | Ga0070697_1000217855 | 151 |
| 1046 | 3300005536 | Ga0070697_100076841 | Ga0070697_1000768413 | 151 |
| 1047 | 3300005536 | Ga0070697_100106844 | Ga0070697_1001068443 | 151 |
| 1048 | 3300005536 | Ga0070697_100134497 | Ga0070697_1001344971 | 151 |
| 1049 | 3300005536 | Ga0070697_100918364 | Ga0070697_1009183641 | 151 |
| 1050 | 3300005539 | Ga0068853_101528034 | Ga0068853_1015280342 | 151 |
| 1051 | 3300005544 | Ga0070686_100315019 | Ga0070686_1003150191 | 151 |
| 1052 | 3300005545 | Ga0070695_100051632 | Ga0070695_1000516322 | 151 |
| 1053 | 3300005545 | Ga0070695_100057801 | Ga0070695_1000578013 | 151 |
| 1054 | 3300005545 | Ga0070695_100225006 | Ga0070695_1002250062 | 151 |
| 1055 | 3300005545 | Ga0070695_100529437 | Ga0070695_1005294372 | 151 |
| 1056 | 3300005545 | Ga0070695_101201775 | Ga0070695_1012017752 | 151 |
| 1057 | 3300005546 | Ga0070696_100162444 | Ga0070696_1001624442 | 151 |
| 1058 | 3300005546 | Ga0070696_100288660 | Ga0070696_1002886602 | 151 |
| 1059 | 3300005546 | Ga0070696_100398146 | Ga0070696_1003981461 | 151 |
| 1060 | 3300005546 | Ga0070696_100681092 | Ga0070696_1006810922 | 151 |
| 1061 | 3300005547 | Ga0070693_100003628 | Ga0070693_1000036283 | 151 |
| 1062 | 3300005547 | Ga0070693_100364454 | Ga0070693_1003644541 | 151 |
| 1063 | 3300005549 | Ga0070704_100083694 | Ga0070704_1000836943 | 151 |
| 1064 | 3300005549 | Ga0070704_100093388 | Ga0070704_1000933884 | 151 |
| 1065 | 3300005549 | Ga0070704_100382999 | Ga0070704_1003829992 | 151 |
| 1066 | 3300005549 | Ga0070704_100441416 | Ga0070704_1004414163 | 151 |
| 1067 | 3300005549 | Ga0070704_100649124 | Ga0070704_1006491242 | 151 |
| 1068 | 3300005549 | Ga0070704_101078396 | Ga0070704_1010783962 | 151 |
| 1069 | 3300005563 | Ga0068855_100687812 | Ga0068855_1006878121 | 151 |
| 1070 | 3300005564 | Ga0070664_100284158 | Ga0070664_1002841582 | 151 |
| 1071 | 3300005564 | Ga0070664_100426273 | Ga0070664_1004262733 | 151 |
| 1072 | 3300005577 | Ga0068857_100224525 | Ga0068857_1002245252 | 151 |
| 1073 | 3300005577 | Ga0068857_100457779 | Ga0068857_1004577792 | 151 |
| 1074 | 3300005578 | Ga0068854_100152959 | Ga0068854_1001529593 | 151 |
| 1075 | 3300005578 | Ga0068854_100270777 | Ga0068854_1002707771 | 151 |
| 1076 | 3300005578 | Ga0068854_100810642 | Ga0068854_1008106421 | 151 |
| 1077 | 3300005578 | Ga0068854_101043847 | Ga0068854_1010438471 | 151 |
| 1078 | 3300005614 | Ga0068856_100342321 | Ga0068856_1003423212 | 151 |
| 1079 | 3300005615 | Ga0070702_100020864 | Ga0070702_1000208643 | 151 |
| 1080 | 3300005615 | Ga0070702_100056578 | Ga0070702_1000565783 | 151 |
| 1081 | 3300005615 | Ga0070702_100581226 | Ga0070702_1005812261 | 151 |
| 1082 | 3300005615 | Ga0070702_100707420 | Ga0070702_1007074201 | 151 |
| 1083 | 3300005616 | Ga0068852_100381526 | Ga0068852_1003815262 | 151 |
| 1084 | 3300005617 | Ga0068859_100017683 | Ga0068859_1000176833 | 151 |
| 1085 | 3300005617 | Ga0068859_100046105 | Ga0068859_1000461053 | 151 |
| 1086 | 3300005617 | Ga0068859_100271701 | Ga0068859_1002717013 | 151 |
| 1087 | 3300005617 | Ga0068859_101672418 | Ga0068859_1016724182 | 151 |
| 1088 | 3300005617 | Ga0068859_102682789 | Ga0068859_1026827891 | 151 |
| 1089 | 3300005618 | Ga0068864_100077424 | Ga0068864_1000774244 | 151 |
| 1090 | 3300005618 | Ga0068864_100456504 | Ga0068864_1004565042 | 151 |
| 1091 | 3300005618 | Ga0068864_100653987 | Ga0068864_1006539871 | 151 |
| 1092 | 3300005618 | Ga0068864_100968402 | Ga0068864_1009684021 | 151 |
| 1093 | 3300005618 | Ga0068864_101485406 | Ga0068864_1014854062 | 151 |
| 1094 | 3300005718 | Ga0068866_10000684 | Ga0068866_1000068423 | 151 |
| 1095 | 3300005719 | Ga0068861_100166917 | Ga0068861_1001669173 | 151 |
| 1096 | 3300005719 | Ga0068861_100354324 | Ga0068861_1003543242 | 151 |
| 1097 | 3300005834 | Ga0068851_10016680 | Ga0068851_100166801 | 151 |
| 1098 | 3300005840 | Ga0068870_10224937 | Ga0068870_102249372 | 151 |
| 1099 | 3300005840 | Ga0068870_10507968 | Ga0068870_105079682 | 151 |
| 1100 | 3300005841 | Ga0068863_100377275 | Ga0068863_1003772751 | 151 |
| 1101 | 3300005841 | Ga0068863_100547436 | Ga0068863_1005474362 | 151 |
| 1102 | 3300005842 | Ga0068858_100002375 | Ga0068858_10000237518 | 151 |
| 1103 | 3300005842 | Ga0068858_100081988 | Ga0068858_1000819881 | 151 |
| 1104 | 3300005842 | Ga0068858_102276598 | Ga0068858_1022765981 | 151 |
| 1105 | 3300005843 | Ga0068860_100059819 | Ga0068860_1000598193 | 151 |
| 1106 | 3300005843 | Ga0068860_100226405 | Ga0068860_1002264053 | 151 |
| 1107 | 3300005843 | Ga0068860_100445817 | Ga0068860_1004458172 | 151 |
| 1108 | 3300005843 | Ga0068860_101059515 | Ga0068860_1010595151 | 151 |
| 1109 | 3300005844 | Ga0068862_100040680 | Ga0068862_1000406807 | 151 |
| 1110 | 3300005844 | Ga0068862_100057688 | Ga0068862_1000576883 | 151 |
| 1111 | 3300005937 | Ga0081455_10636649 | Ga0081455_106366492 | 151 |
| 1112 | 3300005985 | Ga0081539_10106045 | Ga0081539_101060451 | 151 |
| 1113 | 3300005985 | Ga0081539_10131462 | Ga0081539_101314621 | 151 |
| 1114 | 3300006163 | Ga0070715_10140135 | Ga0070715_101401351 | 151 |
| 1115 | 3300006173 | Ga0070716_100164111 | Ga0070716_1001641113 | 151 |
| 1116 | 3300006173 | Ga0070716_100290404 | Ga0070716_1002904042 | 151 |
| 1117 | 3300006237 | Ga0097621_100010123 | Ga0097621_1000101234 | 151 |
| 1118 | 3300006358 | Ga0068871_100210249 | Ga0068871_1002102492 | 151 |
| 1119 | 3300006844 | Ga0075428_100459402 | Ga0075428_1004594022 | 151 |
| 1120 | 3300006844 | Ga0075428_101286257 | Ga0075428_1012862571 | 151 |
| 1121 | 3300006846 | Ga0075430_100144913 | Ga0075430_1001449132 | 151 |
| 1122 | 3300006847 | Ga0075431_100004485 | Ga0075431_10000448515 | 151 |
| 1123 | 3300006852 | Ga0075433_10385822 | Ga0075433_103858222 | 151 |
| 1124 | 3300006871 | Ga0075434_100040176 | Ga0075434_1000401764 | 151 |
| 1125 | 3300006871 | Ga0075434_100668646 | Ga0075434_1006686463 | 151 |
| 1126 | 3300006871 | Ga0075434_101080720 | Ga0075434_1010807202 | 151 |
| 1127 | 3300006871 | Ga0075434_101493807 | Ga0075434_1014938072 | 151 |
| 1128 | 3300006880 | Ga0075429_100864370 | Ga0075429_1008643701 | 151 |
| 1129 | 3300006880 | Ga0075429_101895462 | Ga0075429_1018954621 | 151 |
| 1130 | 3300006881 | Ga0068865_100396346 | Ga0068865_1003963461 | 151 |
| 1131 | 3300006881 | Ga0068865_100671039 | Ga0068865_1006710391 | 151 |
| 1132 | 3300006914 | Ga0075436_100000015 | Ga0075436_1000000152 | 151 |
| 1133 | 3300006914 | Ga0075436_100013759 | Ga0075436_1000137596 | 151 |
| 1134 | 3300006931 | Ga0097620_100017683 | Ga0097620_1000176833 | 151 |
| 1135 | 3300006931 | Ga0097620_100046105 | Ga0097620_1000461054 | 151 |
| 1136 | 3300006931 | Ga0097620_100271678 | Ga0097620_1002716783 | 151 |
| 1137 | 3300006931 | Ga0097620_101673160 | Ga0097620_1016731602 | 151 |
| 1138 | 3300006931 | Ga0097620_102682474 | Ga0097620_1026824741 | 151 |
| 1139 | 3300007076 | Ga0075435_100483478 | Ga0075435_1004834782 | 151 |
| 1140 | 3300009093 | Ga0105240_10023866 | Ga0105240_100238667 | 151 |
| 1141 | 3300009094 | Ga0111539_10029571 | Ga0111539_100295716 | 151 |
| 1142 | 3300009094 | Ga0111539_10107148 | Ga0111539_101071484 | 151 |
| 1143 | 3300009094 | Ga0111539_11362722 | Ga0111539_113627222 | 151 |
| 1144 | 3300009094 | Ga0111539_12169441 | Ga0111539_121694411 | 151 |
| 1145 | 3300009098 | Ga0105245_10191604 | Ga0105245_101916042 | 151 |
| 1146 | 3300009101 | Ga0105247_10000005 | Ga0105247_10000005355 | 151 |
| 1147 | 3300009147 | Ga0114129_10019427 | Ga0114129_1001942713 | 151 |
| 1148 | 3300009147 | Ga0114129_10108251 | Ga0114129_101082513 | 151 |
| 1149 | 3300009147 | Ga0114129_10341075 | Ga0114129_103410752 | 151 |
| 1150 | 3300009147 | Ga0114129_12521563 | Ga0114129_125215631 | 151 |
| 1151 | 3300009148 | Ga0105243_10019054 | Ga0105243_100190546 | 151 |
| 1152 | 3300009148 | Ga0105243_10246528 | Ga0105243_102465283 | 151 |
| 1153 | 3300009148 | Ga0105243_10787831 | Ga0105243_107878311 | 151 |
| 1154 | 3300009174 | Ga0105241_10107226 | Ga0105241_101072262 | 151 |
| 1155 | 3300009174 | Ga0105241_11734091 | Ga0105241_117340911 | 151 |
| 1156 | 3300009176 | Ga0105242_10088295 | Ga0105242_100882952 | 151 |
| 1157 | 3300009176 | Ga0105242_10130667 | Ga0105242_101306673 | 151 |
| 1158 | 3300009176 | Ga0105242_10454891 | Ga0105242_104548912 | 151 |
| 1159 | 3300009545 | Ga0105237_10035040 | Ga0105237_100350402 | 151 |
| 1160 | 3300009553 | Ga0105249_10260824 | Ga0105249_102608241 | 151 |
| 1161 | 3300010159 | Ga0099796_10025723 | Ga0099796_100257233 | 151 |
| 1162 | 3300010375 | Ga0105239_11648093 | Ga0105239_116480931 | 151 |
| 1163 | 3300010375 | Ga0105239_12143442 | Ga0105239_121434421 | 151 |
| 1164 | 3300011119 | Ga0105246_10224743 | Ga0105246_102247433 | 151 |
| 1165 | 3300013102 | Ga0157371_10266907 | Ga0157371_102669072 | 151 |
| 1166 | 3300013296 | Ga0157374_10428206 | Ga0157374_104282061 | 151 |
| 1167 | 3300013297 | Ga0157378_10000067 | Ga0157378_100000673 | 151 |
| 1168 | 3300013297 | Ga0157378_10012876 | Ga0157378_100128768 | 151 |
| 1169 | 3300013297 | Ga0157378_10033270 | Ga0157378_100332705 | 151 |
| 1170 | 3300013297 | Ga0157378_10052148 | Ga0157378_100521482 | 151 |
| 1171 | 3300013297 | Ga0157378_10373867 | Ga0157378_103738672 | 151 |
| 1172 | 3300013297 | Ga0157378_10695891 | Ga0157378_106958912 | 151 |
| 1173 | 3300013297 | Ga0157378_11583504 | Ga0157378_115835041 | 151 |
| 1174 | 3300013306 | Ga0163162_10052139 | Ga0163162_100521392 | 151 |
| 1175 | 3300013306 | Ga0163162_10225733 | Ga0163162_102257332 | 151 |
| 1176 | 3300013306 | Ga0163162_10801311 | Ga0163162_108013112 | 151 |
| 1177 | 3300013308 | Ga0157375_10010135 | Ga0157375_100101358 | 151 |
| 1178 | 3300013308 | Ga0157375_10285952 | Ga0157375_102859522 | 151 |
| 1179 | 3300013308 | Ga0157375_10426331 | Ga0157375_104263311 | 151 |
| 1180 | 3300013308 | Ga0157375_12408685 | Ga0157375_124086851 | 151 |
| 1181 | 3300014325 | Ga0163163_10181085 | Ga0163163_101810852 | 151 |
| 1182 | 3300014325 | Ga0163163_10536157 | Ga0163163_105361571 | 151 |
| 1183 | 3300014326 | Ga0157380_10008575 | Ga0157380_1000857511 | 151 |
| 1184 | 3300014326 | Ga0157380_10262707 | Ga0157380_102627072 | 151 |
| 1185 | 3300014326 | Ga0157380_10285385 | Ga0157380_102853852 | 151 |
| 1186 | 3300014326 | Ga0157380_10459267 | Ga0157380_104592672 | 151 |
| 1187 | 3300014969 | Ga0157376_10420225 | Ga0157376_104202253 | 151 |
| 1188 | 3300020078 | Ga0206352_10617335 | Ga0206352_106173351 | 151 |
| 1189 | 3300025223 | Ga0207672_1000403 | Ga0207672_10004037 | 151 |
| 1190 | 3300025321 | Ga0207656_10000878 | Ga0207656_100008781 | 151 |
| 1191 | 3300025711 | Ga0207696_1110904 | Ga0207696_11109041 | 151 |
| 1192 | 3300025735 | Ga0207713_1080075 | Ga0207713_10800751 | 151 |
| 1193 | 3300025885 | Ga0207653_10002754 | Ga0207653_100027543 | 151 |
| 1194 | 3300025893 | Ga0207682_10072608 | Ga0207682_100726082 | 151 |
| 1195 | 3300025898 | Ga0207692_10343151 | Ga0207692_103431511 | 151 |
| 1196 | 3300025899 | Ga0207642_10006933 | Ga0207642_100069332 | 151 |
| 1197 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004353 | 151 |
| 1198 | 3300025901 | Ga0207688_10345918 | Ga0207688_103459182 | 151 |
| 1199 | 3300025901 | Ga0207688_10450943 | Ga0207688_104509431 | 151 |
| 1200 | 3300025906 | Ga0207699_10093594 | Ga0207699_100935945 | 151 |
| 1201 | 3300025906 | Ga0207699_10905888 | Ga0207699_109058881 | 151 |
| 1202 | 3300025907 | Ga0207645_10113596 | Ga0207645_101135962 | 151 |
| 1203 | 3300025907 | Ga0207645_10253700 | Ga0207645_102537001 | 151 |
| 1204 | 3300025910 | Ga0207684_10057428 | Ga0207684_100574285 | 151 |
| 1205 | 3300025910 | Ga0207684_10098332 | Ga0207684_100983327 | 151 |
| 1206 | 3300025912 | Ga0207707_11029920 | Ga0207707_110299201 | 151 |
| 1207 | 3300025913 | Ga0207695_10290339 | Ga0207695_102903393 | 151 |
| 1208 | 3300025917 | Ga0207660_10052536 | Ga0207660_100525364 | 151 |
| 1209 | 3300025917 | Ga0207660_10452968 | Ga0207660_104529682 | 151 |
| 1210 | 3300025918 | Ga0207662_10219743 | Ga0207662_102197431 | 151 |
| 1211 | 3300025918 | Ga0207662_10253008 | Ga0207662_102530082 | 151 |
| 1212 | 3300025918 | Ga0207662_10656776 | Ga0207662_106567762 | 151 |
| 1213 | 3300025919 | Ga0207657_10446216 | Ga0207657_104462161 | 151 |
| 1214 | 3300025922 | Ga0207646_10010058 | Ga0207646_100100588 | 151 |
| 1215 | 3300025922 | Ga0207646_10011116 | Ga0207646_100111165 | 151 |
| 1216 | 3300025922 | Ga0207646_10029852 | Ga0207646_100298526 | 151 |
| 1217 | 3300025922 | Ga0207646_10129683 | Ga0207646_101296833 | 151 |
| 1218 | 3300025922 | Ga0207646_11273842 | Ga0207646_112738421 | 151 |
| 1219 | 3300025922 | Ga0207646_11547076 | Ga0207646_115470761 | 151 |
| 1220 | 3300025923 | Ga0207681_10152572 | Ga0207681_101525721 | 151 |
| 1221 | 3300025923 | Ga0207681_10296731 | Ga0207681_102967313 | 151 |
| 1222 | 3300025925 | Ga0207650_10058798 | Ga0207650_100587982 | 151 |
| 1223 | 3300025925 | Ga0207650_10061701 | Ga0207650_100617013 | 151 |
| 1224 | 3300025925 | Ga0207650_11185431 | Ga0207650_111854312 | 151 |
| 1225 | 3300025926 | Ga0207659_10109170 | Ga0207659_101091703 | 151 |
| 1226 | 3300025931 | Ga0207644_10003135 | Ga0207644_1000313510 | 151 |
| 1227 | 3300025932 | Ga0207690_10295524 | Ga0207690_102955243 | 151 |
| 1228 | 3300025933 | Ga0207706_10420423 | Ga0207706_104204232 | 151 |
| 1229 | 3300025933 | Ga0207706_10889544 | Ga0207706_108895442 | 151 |
| 1230 | 3300025934 | Ga0207686_10055449 | Ga0207686_100554492 | 151 |
| 1231 | 3300025934 | Ga0207686_10172693 | Ga0207686_101726932 | 151 |
| 1232 | 3300025934 | Ga0207686_10336230 | Ga0207686_103362302 | 151 |
| 1233 | 3300025934 | Ga0207686_10970124 | Ga0207686_109701241 | 151 |
| 1234 | 3300025935 | Ga0207709_10006883 | Ga0207709_100068835 | 151 |
| 1235 | 3300025935 | Ga0207709_10012133 | Ga0207709_100121333 | 151 |
| 1236 | 3300025935 | Ga0207709_10348055 | Ga0207709_103480552 | 151 |
| 1237 | 3300025936 | Ga0207670_10004178 | Ga0207670_100041789 | 151 |
| 1238 | 3300025938 | Ga0207704_10987531 | Ga0207704_109875312 | 151 |
| 1239 | 3300025939 | Ga0207665_10044010 | Ga0207665_100440101 | 151 |
| 1240 | 3300025939 | Ga0207665_10075933 | Ga0207665_100759334 | 151 |
| 1241 | 3300025939 | Ga0207665_10296770 | Ga0207665_102967702 | 151 |
| 1242 | 3300025939 | Ga0207665_10675538 | Ga0207665_106755382 | 151 |
| 1243 | 3300025942 | Ga0207689_10089386 | Ga0207689_100893864 | 151 |
| 1244 | 3300025942 | Ga0207689_10138079 | Ga0207689_101380793 | 151 |
| 1245 | 3300025945 | Ga0207679_10088992 | Ga0207679_100889921 | 151 |
| 1246 | 3300025945 | Ga0207679_10988629 | Ga0207679_109886291 | 151 |
| 1247 | 3300025949 | Ga0207667_10239504 | Ga0207667_102395043 | 151 |
| 1248 | 3300025960 | Ga0207651_10307270 | Ga0207651_103072703 | 151 |
| 1249 | 3300025960 | Ga0207651_11172523 | Ga0207651_111725231 | 151 |
| 1250 | 3300025960 | Ga0207651_11374073 | Ga0207651_113740731 | 151 |
| 1251 | 3300025961 | Ga0207712_10167843 | Ga0207712_101678433 | 151 |
| 1252 | 3300025961 | Ga0207712_10787223 | Ga0207712_107872232 | 151 |
| 1253 | 3300025961 | Ga0207712_12076311 | Ga0207712_120763111 | 151 |
| 1254 | 3300025981 | Ga0207640_10385266 | Ga0207640_103852662 | 151 |
| 1255 | 3300025981 | Ga0207640_10746159 | Ga0207640_107461592 | 151 |
| 1256 | 3300026023 | Ga0207677_10168987 | Ga0207677_101689873 | 151 |
| 1257 | 3300026035 | Ga0207703_10000589 | Ga0207703_1000058935 | 151 |
| 1258 | 3300026035 | Ga0207703_10097689 | Ga0207703_100976892 | 151 |
| 1259 | 3300026075 | Ga0207708_10146529 | Ga0207708_101465292 | 151 |
| 1260 | 3300026088 | Ga0207641_10012708 | Ga0207641_100127089 | 151 |
| 1261 | 3300026088 | Ga0207641_10550144 | Ga0207641_105501442 | 151 |
| 1262 | 3300026088 | Ga0207641_11369446 | Ga0207641_113694461 | 151 |
| 1263 | 3300026088 | Ga0207641_11667011 | Ga0207641_116670112 | 151 |
| 1264 | 3300026089 | Ga0207648_10033880 | Ga0207648_100338804 | 151 |
| 1265 | 3300026089 | Ga0207648_10168113 | Ga0207648_101681132 | 151 |
| 1266 | 3300026089 | Ga0207648_10394973 | Ga0207648_103949731 | 151 |
| 1267 | 3300026095 | Ga0207676_10059723 | Ga0207676_100597233 | 151 |
| 1268 | 3300026095 | Ga0207676_10375883 | Ga0207676_103758833 | 151 |
| 1269 | 3300026116 | Ga0207674_11550029 | Ga0207674_115500291 | 151 |
| 1270 | 3300026118 | Ga0207675_100039486 | Ga0207675_1000394863 | 151 |
| 1271 | 3300026118 | Ga0207675_100274133 | Ga0207675_1002741333 | 151 |
| 1272 | 3300026118 | Ga0207675_101615430 | Ga0207675_1016154301 | 151 |
| 1273 | 3300026142 | Ga0207698_10453615 | Ga0207698_104536151 | 151 |
| 1274 | 3300027907 | Ga0207428_10677873 | Ga0207428_106778731 | 151 |
| 1275 | 3300027907 | Ga0207428_10736086 | Ga0207428_107360861 | 151 |
| 1276 | 3300028380 | Ga0268265_10034700 | Ga0268265_100347001 | 151 |
| 1277 | 3300028380 | Ga0268265_10352928 | Ga0268265_103529283 | 151 |
| 1278 | 3300028380 | Ga0268265_11825074 | Ga0268265_118250741 | 151 |
| 1279 | 3300028381 | Ga0268264_10902994 | Ga0268264_109029941 | 151 |
| 1280 | 3300028381 | Ga0268264_11131013 | Ga0268264_111310132 | 151 |
| 1281 | 3300028381 | Ga0268264_11277474 | Ga0268264_112774742 | 151 |
| 1282 | 3300028381 | Ga0268264_12441711 | Ga0268264_124417111 | 151 |
| 1283 | 3300031548 | Ga0307408_100714237 | Ga0307408_1007142372 | 151 |
| 1284 | 3300031731 | Ga0307405_10542975 | Ga0307405_105429752 | 151 |
| 1285 | 3300032004 | Ga0307414_10849045 | Ga0307414_108490451 | 151 |
| 1286 | 3300032004 | Ga0307414_11596361 | Ga0307414_115963611 | 151 |
| 1287 | 3300035091 | Ga0373951_0000993 | Ga0373951_0000993_960_1415 | 151 |
| 1288 | 3300038698 | Ga0242419_004777 | Ga0242419_004777_289_744 | 151 |
| 1289 | 3300041999 | Ga0439433_0103506 | Ga0439433_0103506_172_627 | 151 |
| 1290 | 3300042008 | Ga0439450_110915 | Ga0439450_110915_169_624 | 151 |
| 1291 | 3300044673 | Ga0453683_0267752 | Ga0453683_0267752_585_1040 | 151 |
| 1292 | 3300048903 | Ga0496100_0506796 | Ga0496100_0506796_29_484 | 151 |
| 1293 | 3300048904 | Ga0496101_0600903 | Ga0496101_0600903_126_581 | 151 |
| 1294 | 3300048905 | Ga0496102_0596375 | Ga0496102_0596375_484_939 | 151 |
| 1295 | 3300048909 | Ga0496106_0011284 | Ga0496106_0011284_973_1428 | 151 |
| 1296 | 3300048910 | Ga0496107_0327116 | Ga0496107_0327116_507_962 | 151 |
| 1297 | 3300048911 | Ga0496108_1272203 | Ga0496108_1272203_130_585 | 151 |
| 1298 | 3300048916 | Ga0496113_0079114 | Ga0496113_0079114_307_762 | 151 |
| 1299 | 3300049127 | Ga0501306_040718 | Ga0501306_040718_192_647 | 151 |
| 1300 | 3300049128 | Ga0501308_045953 | Ga0501308_045953_151_606 | 151 |
| 1301 | 3300049128 | Ga0501308_058322 | Ga0501308_058322_49_504 | 151 |
| 1302 | 3300049129 | Ga0501309_026702 | Ga0501309_026702_363_818 | 151 |
| 1303 | 3300049130 | Ga0501310_048314 | Ga0501310_048314_19_474 | 151 |
| 1304 | 3300049160 | Ga0501304_018785 | Ga0501304_018785_185_640 | 151 |
| 1305 | 3300049161 | Ga0501305_053400 | Ga0501305_053400_33_488 | 151 |
| 1306 | 3300049514 | Ga0501291_087566 | Ga0501291_087566_158_613 | 151 |
| 1307 | 3300049515 | Ga0501292_074768 | Ga0501292_074768_111_566 | 151 |
| 1308 | 3300049518 | Ga0501295_055282 | Ga0501295_055282_123_578 | 151 |
| 1309 | 3300049521 | Ga0501298_087216 | Ga0501298_087216_226_681 | 151 |
| 1310 | 3300049533 | Ga0501317_083258 | Ga0501317_083258_79_534 | 151 |
| 1311 | 3300049650 | Ga0501199_034519 | Ga0501199_034519_16_471 | 151 |
| 1312 | 3300049653 | Ga0501206_075402 | Ga0501206_075402_59_514 | 151 |
| 1313 | 3300049660 | Ga0501216_004483 | Ga0501216_004483_582_1037 | 151 |
| 1314 | 3300049661 | Ga0501217_018391 | Ga0501217_018391_1013_1468 | 151 |
| 1315 | 3300049664 | Ga0501224_029439 | Ga0501224_029439_197_652 | 151 |
| 1316 | 3300049665 | Ga0501227_023203 | Ga0501227_023203_264_719 | 151 |
| 1317 | 3300049665 | Ga0501227_115432 | Ga0501227_115432_53_508 | 151 |
| 1318 | 3300049667 | Ga0501230_004322 | Ga0501230_004322_1351_1806 | 151 |
| 1319 | 3300049669 | Ga0501235_019237 | Ga0501235_019237_818_1273 | 151 |
| 1320 | 3300049671 | Ga0501238_036710 | Ga0501238_036710_122_577 | 151 |
| 1321 | 3300049672 | Ga0501239_004726 | Ga0501239_004726_882_1337 | 151 |
| 1322 | 3300049672 | Ga0501239_041565 | Ga0501239_041565_49_504 | 151 |
| 1323 | 3300049680 | Ga0501250_002177 | Ga0501250_002177_424_879 | 151 |
| 1324 | 3300049686 | Ga0501257_012072 | Ga0501257_012072_171_626 | 151 |
| 1325 | 3300049689 | Ga0501260_018938 | Ga0501260_018938_158_613 | 151 |
| 1326 | 3300049704 | Ga0501221_004593 | Ga0501221_004593_126_581 | 151 |
| 1327 | 3300049705 | Ga0501225_0079146 | Ga0501225_0079146_352_807 | 151 |
| 1328 | 3300049705 | Ga0501225_0117326 | Ga0501225_0117326_171_626 | 151 |
| 1329 | 3300049708 | Ga0501245_034195 | Ga0501245_034195_69_524 | 151 |
| 1330 | 3300049759 | Ga0501262_077419 | Ga0501262_077419_48_503 | 151 |
| 1331 | 3300049764 | Ga0501267_028592 | Ga0501267_028592_27_482 | 151 |
| 1332 | 3300049773 | Ga0501276_024520 | Ga0501276_024520_40_495 | 151 |
| 1333 | 3300049775 | Ga0501279_024795 | Ga0501279_024795_350_805 | 151 |
| 1334 | 3300049851 | Ga0501212_034973 | Ga0501212_034973_159_614 | 151 |
| 1335 | 3300050507 | nmdc:mga05p37_1035569_c1 | nmdc:mga05p37_1035569_c1_37_492 | 151 |
| 1336 | 3300050507 | nmdc:mga05p37_136331_c2 | nmdc:mga05p37_136331_c2_143_598 | 151 |
| 1337 | 3300050507 | nmdc:mga05p37_14945_c1 | nmdc:mga05p37_14945_c1_277_732 | 151 |
| 1338 | 3300050507 | nmdc:mga05p37_456412_c1 | nmdc:mga05p37_456412_c1_965_1420 | 151 |
| 1339 | 3300050508 | nmdc:mga09592_198902_c1 | nmdc:mga09592_198902_c1_1054_1509 | 151 |
| 1340 | 3300050508 | nmdc:mga09592_281705_c1 | nmdc:mga09592_281705_c1_129_584 | 151 |
| 1341 | 3300050509 | nmdc:mga0qj67_145881_c1 | nmdc:mga0qj67_145881_c1_824_1279 | 151 |
| 1342 | 3300050510 | nmdc:mga06r32_736506_c1 | nmdc:mga06r32_736506_c1_252_707 | 151 |
| 1343 | 3300050511 | nmdc:mga08y16_135276_c1 | nmdc:mga08y16_135276_c1_917_1372 | 151 |
| 1344 | 3300050511 | nmdc:mga08y16_466215_c1 | nmdc:mga08y16_466215_c1_154_609 | 151 |
| 1345 | 3300050511 | nmdc:mga08y16_63647_c1 | nmdc:mga08y16_63647_c1_1228_1683 | 151 |
| 1346 | 3300050512 | nmdc:mga0n895_597590_c1 | nmdc:mga0n895_597590_c1_637_1092 | 151 |
| 1347 | 3300050512 | nmdc:mga0n895_87209_c1 | nmdc:mga0n895_87209_c1_2306_2761 | 151 |
| 1348 | 3300050515 | nmdc:mga0a205_10797_c1 | nmdc:mga0a205_10797_c1_6361_6816 | 151 |
| 1349 | 3300050515 | nmdc:mga0a205_209373_c1 | nmdc:mga0a205_209373_c1_1294_1749 | 151 |
| 1350 | 3300059491 | Ga0587070_107990 | Ga0587070_107990_177_632 | 151 |
| 1351 | 3300059491 | Ga0587070_217181 | Ga0587070_217181_29_484 | 151 |
| 1352 | 3300059492 | Ga0587073_0115243 | Ga0587073_0115243_81_536 | 151 |
| 1353 | 3300059503 | Ga0587080_079553 | Ga0587080_079553_46_504 | 151 |
| 1354 | 3300059504 | Ga0587082_107150 | Ga0587082_107150_21_476 | 151 |
| 1355 | 3300059506 | Ga0587085_084110 | Ga0587085_084110_170_625 | 151 |
| 1356 | 3300059508 | Ga0587088_051225 | Ga0587088_051225_12_467 | 151 |
| 1357 | 3300059513 | Ga0587094_050094 | Ga0587094_050094_22_477 | 151 |
| 1358 | 3300059607 | Ga0587125_043802 | Ga0587125_043802_13_468 | 151 |
| 1359 | 3300059623 | Ga0587101_033300 | Ga0587101_033300_347_802 | 151 |
| 1360 | 3300059624 | Ga0587109_055645 | Ga0587109_055645_83_538 | 151 |
| 1361 | 3300059624 | Ga0587109_108434 | Ga0587109_108434_41_496 | 151 |
| 1362 | 3300059627 | Ga0587117_102387 | Ga0587117_102387_49_504 | 151 |
| 1363 | 3300059645 | Ga0587076_088903 | Ga0587076_088903_196_651 | 151 |
| 1364 | 3300059645 | Ga0587076_124797 | Ga0587076_124797_132_587 | 151 |
| 1365 | 3300059645 | Ga0587076_152258 | Ga0587076_152258_58_519 | 151 |
| 1366 | 3300059646 | Ga0587078_035794 | Ga0587078_035794_92_547 | 151 |
| 1367 | 3300059647 | Ga0587079_052533 | Ga0587079_052533_332_787 | 151 |
| 1368 | 3300059648 | Ga0587100_039100 | Ga0587100_039100_52_507 | 151 |
| 1369 | 3300059649 | Ga0587102_065831 | Ga0587102_065831_46_501 | 151 |
| 1370 | 3300061734 | Ga0530510_0043032 | Ga0530510_0043032_1772_2227 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.971 | 1 | 144 |
| 6spb-assembly1.cif.gz_J | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9702 | 2 | 144 |
| 8fn2-assembly1.cif.gz_L | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9669 | 2 | 142 |
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.9668 | 14 | 145 |
| 7asp-assembly1.cif.gz_H | staphylococcus aureus 70s after 50 minutes incubation at 37c | 0.9651 | 2 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9708 | 14 | 148 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9654 | 1 | 144 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9622 | 14 | 151 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9587 | 1 | 144 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9488 | 14 | 151 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J6ZN07-F1-model_v4 | deleted | 0.9942 | 14 | 143 |
|
| AF-A0A2H5VM49-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9873 | 1 | 144 |
GO:0003729
GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0017148 GO:1990904 |
| AF-G9XS70-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9872 | 1 | 145 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A0N0TKS2-F1-model_v4 | deleted | 0.9869 | 1 | 145 |
|
| AF-A0A7Y5LT23-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9865 | 5 | 144 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar