F493361

General Info

Members Datasets Scaffolds Average Seq Length
1363 562 2724 67

Family's Representative Sequence

Representative Sequence 3300053120|Ga0500597_123447|Ga0500597_123447_698_940
Length 80
Sequence MTVKTAGIPGDAAVATGTVKWFNATKGYGFIAPQGGGKDVFVHISAVERAGLSSLNEGATVEFDVVPNKGKESAENIKVR

Samples

Sample ID Description Type Environment
1 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
212 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
213 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
219 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
220 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
221 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
255 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
256 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
259 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
260 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
266 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
271 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
272 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
273 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
298 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
299 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
300 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
301 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
302 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
303 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
304 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
305 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
306 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
307 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
308 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
309 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
310 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
322 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
332 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
336 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
337 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
338 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
346 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
347 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
348 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
349 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
350 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
351 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
352 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
353 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
354 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
355 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
356 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
357 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
360 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
361 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
362 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
363 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
364 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
365 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
366 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
367 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
368 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
369 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
375 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
376 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
377 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
378 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
379 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
380 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
381 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
382 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
383 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
384 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
385 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
386 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
387 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
388 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
389 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
390 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
391 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
392 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
393 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
394 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
395 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
404 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
405 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
406 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
407 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
408 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
409 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
410 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
411 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
412 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
413 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
414 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
415 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
416 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
417 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
418 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
419 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
420 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
421 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
422 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
423 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
424 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
425 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
426 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
427 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
428 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
429 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
430 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
431 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
432 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
433 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
434 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
435 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
436 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
437 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
438 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
442 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
443 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
444 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
445 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
446 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
447 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
448 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
449 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
450 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
451 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
452 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
453 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
463 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
464 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
465 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
466 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
467 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
468 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
471 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
479 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
480 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
481 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
482 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
483 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
484 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
485 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
486 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
487 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
488 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
491 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
492 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
493 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
494 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
495 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
496 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
497 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
498 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
499 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
500 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
501 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
502 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
503 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
504 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
505 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
506 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
507 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
508 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
509 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
510 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
511 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
512 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
513 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
514 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
515 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
516 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
517 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
518 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
519 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
520 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
521 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
522 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
523 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
524 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
525 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
526 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
527 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
528 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
529 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
530 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
533 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
534 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
535 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
536 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
537 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
538 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
539 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
540 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
541 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
542 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
543 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
544 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
545 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
546 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
547 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
548 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
549 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
550 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
551 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
560 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
561 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
562 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 2.27
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.43
Nodule 0.37
Rhizoplane 5.87
Rhizosphere 73.81
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500597_123447 3300053120 Bacteria 1121
2 CNAas_1005504 3300000532 Bacteria 811
3 JGI24743J22301_10086017 3300001991 Bacteria 667
4 JGI24750J21931_1011860 3300002070 Bacteria 1150
5 JGI24744J21845_10006633 3300002077 Bacteria 2398
6 JGI24034J26672_10020487 3300002239 Bacteria 1036
7 JGI24034J26672_10069191 3300002239 Bacteria 630
8 JGI25165J46597_1019402 3300003214 Bacteria 896
9 JGI25153J46596_10002140 3300003215 Bacteria 11547
10 JGI25153J46596_10010090 3300003215 Bacteria 4308
11 Ga0006770J48903_1004135 3300003305 Bacteria 531
12 rootL2_10016153 3300003322 Bacteria 3836
13 Ga0006781J51513_1004215 3300003568 Bacteria 917
14 Ga0007410J51695_1002477 3300003574 Bacteria 773
15 JGI25404J52841_10001052 3300003659 Bacteria 4599
16 JGI25404J52841_10009090 3300003659 Bacteria 2125
17 JGI25404J52841_10015398 3300003659 Bacteria 1659
18 JGI25404J52841_10018605 3300003659 Bacteria 1506
19 Ga0032354_1008942 3300003693 Bacteria 787
20 Ga0006780_1003591 3300003735 Bacteria 763
21 Ga0055542_1005196 3300003762 Bacteria 2988
22 Ga0055529_1008414 3300003763 Bacteria 1373
23 JGI25405J52794_10024077 3300003911 Bacteria 1242
24 Ga0065707_10356582 3300005295 Bacteria 880
25 Ga0070658_10157810 3300005327 Bacteria 1902
26 Ga0070676_10107280 3300005328 Bacteria 1734
27 Ga0070676_10578773 3300005328 Bacteria 807
28 Ga0070690_100014486 3300005330 Bacteria 4678
29 Ga0070690_100054344 3300005330 Bacteria 2563
30 Ga0070690_100747517 3300005330 Bacteria 755
31 Ga0070670_100234379 3300005331 Bacteria 1598
32 Ga0070670_101023685 3300005331 Bacteria 751
33 Ga0070677_10249176 3300005333 Bacteria 881
34 Ga0068869_100591799 3300005334 Bacteria 936
35 Ga0068869_101174875 3300005334 Bacteria 674
36 Ga0070666_10255579 3300005335 Bacteria 1241
37 Ga0070666_10556109 3300005335 Bacteria 835
38 Ga0070682_100257297 3300005337 Bacteria 1262
39 Ga0068868_100261488 3300005338 Bacteria 1459
40 Ga0068868_102055195 3300005338 Bacteria 543
41 Ga0070660_101374600 3300005339 Bacteria 600
42 Ga0070689_100011365 3300005340 Bacteria 6375
43 Ga0070689_100083460 3300005340 Bacteria 2511
44 Ga0070689_100264441 3300005340 Bacteria 1423
45 Ga0070687_100037609 3300005343 Bacteria 2421
46 Ga0070687_100053260 3300005343 Bacteria 2104
47 Ga0070687_101411732 3300005343 Bacteria 521
48 Ga0070661_100516182 3300005344 Bacteria 958
49 Ga0070661_100516592 3300005344 Bacteria 957
50 Ga0070661_100645552 3300005344 Bacteria 859
51 Ga0070668_100187942 3300005347 Bacteria 1691
52 Ga0070668_100328393 3300005347 Bacteria 1289
53 Ga0070668_100389669 3300005347 Bacteria 1187
54 Ga0070668_101390894 3300005347 Bacteria 640
55 Ga0070669_100079992 3300005353 Bacteria 2431
56 Ga0070669_100482785 3300005353 Bacteria 1026
57 Ga0070669_100514859 3300005353 Bacteria 994
58 Ga0070669_101757113 3300005353 Bacteria 541
59 Ga0070675_100879531 3300005354 Bacteria 821
60 Ga0070675_100978501 3300005354 Bacteria 777
61 Ga0070675_101199172 3300005354 Bacteria 699
62 Ga0070671_100051030 3300005355 Bacteria 3441
63 Ga0070671_100663275 3300005355 Bacteria 904
64 Ga0070674_100049075 3300005356 Bacteria 2900
65 Ga0070674_100052380 3300005356 Bacteria 2815
66 Ga0070674_100053108 3300005356 Bacteria 2796
67 Ga0070673_100250143 3300005364 Bacteria 1544
68 Ga0070673_100379664 3300005364 Bacteria 1260
69 Ga0070673_100978995 3300005364 Bacteria 787
70 Ga0070673_102083664 3300005364 Bacteria 539
71 Ga0070688_100072863 3300005365 Bacteria 2202
72 Ga0070688_100250587 3300005365 Bacteria 1261
73 Ga0070688_100631611 3300005365 Bacteria 823
74 Ga0070659_100443214 3300005366 Bacteria 1100
75 Ga0070659_100966432 3300005366 Bacteria 746
76 Ga0070709_10033715 3300005434 Bacteria 3099
77 Ga0070709_10034132 3300005434 Bacteria 3083
78 Ga0070709_10469603 3300005434 Bacteria 951
79 Ga0070709_10710111 3300005434 Bacteria 783
80 Ga0070714_100089521 3300005435 Bacteria 2694
81 Ga0070714_100430685 3300005435 Bacteria 1251
82 Ga0070714_100664872 3300005435 Bacteria 1003
83 Ga0070713_100155707 3300005436 Bacteria 2036
84 Ga0070713_100160496 3300005436 Bacteria 2006
85 Ga0070713_102291936 3300005436 Bacteria 523
86 Ga0070710_10010559 3300005437 Bacteria 4539
87 Ga0070710_10104521 3300005437 Bacteria 1692
88 Ga0070710_11137971 3300005437 Bacteria 574
89 Ga0070701_10384208 3300005438 Bacteria 886
90 Ga0070711_100016594 3300005439 Bacteria 4677
91 Ga0070711_100406876 3300005439 Bacteria 1106
92 Ga0070711_100421601 3300005439 Bacteria 1088
93 Ga0070711_100664720 3300005439 Bacteria 875
94 Ga0070711_100987821 3300005439 Bacteria 722
95 Ga0070700_100410564 3300005441 Bacteria 1021
96 Ga0070700_100990340 3300005441 Bacteria 690
97 Ga0070663_100265137 3300005455 Bacteria 1364
98 Ga0070663_100504600 3300005455 Bacteria 1005
99 Ga0070678_100085821 3300005456 Bacteria 2400
100 Ga0070678_100631505 3300005456 Bacteria 959
101 Ga0070662_100234813 3300005457 Bacteria 1468
102 Ga0070662_100379096 3300005457 Bacteria 1164
103 Ga0070681_11091239 3300005458 Bacteria 719
104 Ga0068867_101092874 3300005459 Bacteria 728
105 Ga0070685_10300257 3300005466 Bacteria 1082
106 Ga0070685_10884137 3300005466 Bacteria 664
107 Ga0070706_100100870 3300005467 Bacteria 2683
108 Ga0070706_100664098 3300005467 Bacteria 967
109 Ga0070707_100593921 3300005468 Bacteria 1070
110 Ga0070707_101447140 3300005468 Bacteria 654
111 Ga0070679_100153277 3300005530 Bacteria 2280
112 Ga0070679_100949472 3300005530 Bacteria 804
113 Ga0070684_101348708 3300005535 Bacteria 671
114 Ga0070684_101914088 3300005535 Bacteria 560
115 Ga0068853_100744429 3300005539 Bacteria 936
116 Ga0068853_101716085 3300005539 Bacteria 609
117 Ga0070672_100057945 3300005543 Bacteria 3042
118 Ga0070672_100157323 3300005543 Bacteria 1883
119 Ga0070672_100201470 3300005543 Bacteria 1664
120 Ga0070672_100568605 3300005543 Bacteria 985
121 Ga0070686_100178843 3300005544 Bacteria 1506
122 Ga0070686_100637421 3300005544 Bacteria 843
123 Ga0070686_101622692 3300005544 Bacteria 547
124 Ga0070696_100190361 3300005546 Bacteria 1527
125 Ga0070693_100340709 3300005547 Bacteria 1023
126 Ga0070665_100038049 3300005548 Bacteria 4836
127 Ga0070665_101649369 3300005548 Bacteria 649
128 Ga0070665_101759330 3300005548 Bacteria 627
129 Ga0070665_101873722 3300005548 Bacteria 606
130 Ga0068855_100797846 3300005563 Bacteria 1004
131 Ga0068855_100929282 3300005563 Bacteria 917
132 Ga0070664_101454186 3300005564 Bacteria 648
133 Ga0068856_101441545 3300005614 Bacteria 703
134 Ga0070702_100032604 3300005615 Bacteria 2859
135 Ga0070702_101013622 3300005615 Bacteria 658
136 Ga0068852_100292799 3300005616 Bacteria 1573
137 Ga0068852_101473584 3300005616 Bacteria 703
138 Ga0068859_100247315 3300005617 Bacteria 1873
139 Ga0068859_100667255 3300005617 Bacteria 1131
140 Ga0068859_100708856 3300005617 Bacteria 1097
141 Ga0068859_102402636 3300005617 Bacteria 581
142 Ga0068864_100020725 3300005618 Bacteria 5502
143 Ga0068864_100169431 3300005618 Bacteria 1990
144 Ga0068864_100191178 3300005618 Bacteria 1877
145 Ga0068866_10063718 3300005718 Bacteria 1922
146 Ga0068861_101284597 3300005719 Bacteria 711
147 Ga0068870_10253508 3300005840 Bacteria 1092
148 Ga0068870_10279786 3300005840 Bacteria 1046
149 Ga0068870_11160387 3300005840 Bacteria 558
150 Ga0068863_100193114 3300005841 Bacteria 1957
151 Ga0068863_100536184 3300005841 Bacteria 1155
152 Ga0068863_102307007 3300005841 Bacteria 548
153 Ga0068858_100107762 3300005842 Bacteria 2601
154 Ga0068858_100214665 3300005842 Bacteria 1821
155 Ga0068858_100397031 3300005842 Bacteria 1325
156 Ga0068858_100752517 3300005842 Bacteria 949
157 Ga0068858_102586847 3300005842 Bacteria 501
158 Ga0068860_100131677 3300005843 Bacteria 2400
159 Ga0068860_100139914 3300005843 Bacteria 2326
160 Ga0068860_100262185 3300005843 Bacteria 1685
161 Ga0068860_100411374 3300005843 Bacteria 1339
162 Ga0068860_100973313 3300005843 Bacteria 866
163 Ga0068862_100157171 3300005844 Bacteria 2027
164 Ga0068862_100298871 3300005844 Bacteria 1480
165 Ga0068862_100760387 3300005844 Bacteria 943
166 Ga0068862_101215412 3300005844 Bacteria 753
167 Ga0068862_101982150 3300005844 Bacteria 593
168 Ga0081455_10016563 3300005937 Bacteria 7111
169 Ga0081455_10033402 3300005937 Bacteria 4624
170 Ga0081455_10034075 3300005937 Bacteria 4567
171 Ga0081455_10128955 3300005937 Bacteria 1981
172 Ga0081455_10138410 3300005937 Bacteria 1894
173 Ga0081540_1002643 3300005983 Bacteria 14569
174 Ga0081540_1003668 3300005983 Bacteria 12045
175 Ga0081540_1004247 3300005983 Bacteria 11000
176 Ga0081540_1018838 3300005983 Bacteria 4219
177 Ga0081540_1031583 3300005983 Bacteria 2909
178 Ga0081540_1046731 3300005983 Bacteria 2183
179 Ga0081540_1311851 3300005983 Bacteria 540
180 Ga0081539_10394090 3300005985 Bacteria 576
181 Ga0070717_10217896 3300006028 Bacteria 1677
182 Ga0070717_10346302 3300006028 Bacteria 1328
183 Ga0070717_10887499 3300006028 Bacteria 812
184 Ga0070717_10890872 3300006028 Bacteria 810
185 Ga0075368_10198096 3300006042 Bacteria 849
186 Ga0075363_100128500 3300006048 Bacteria 1420
187 Ga0075364_10044125 3300006051 Bacteria 2899
188 Ga0075364_10585543 3300006051 Bacteria 762
189 Ga0075364_10943362 3300006051 Bacteria 587
190 Ga0075432_10235375 3300006058 Bacteria 738
191 Ga0075432_10368483 3300006058 Bacteria 613
192 Ga0070715_10015272 3300006163 Bacteria 2860
193 Ga0070715_10127212 3300006163 Bacteria 1222
194 Ga0070715_10249100 3300006163 Bacteria 928
195 Ga0070715_10982275 3300006163 Bacteria 525
196 Ga0070716_100030610 3300006173 Bacteria 2922
197 Ga0070716_100095755 3300006173 Bacteria 1808
198 Ga0070716_100292627 3300006173 Bacteria 1129
199 Ga0070716_100515859 3300006173 Bacteria 884
200 Ga0070716_100655020 3300006173 Bacteria 797
201 Ga0070712_100030217 3300006175 Bacteria 3639
202 Ga0070712_100212042 3300006175 Bacteria 1528
203 Ga0070712_101487919 3300006175 Bacteria 591
204 Ga0075362_10002782 3300006177 Bacteria 5971
205 Ga0075362_10157715 3300006177 Bacteria 1091
206 Ga0075362_10489714 3300006177 Bacteria 628
207 Ga0075367_10108434 3300006178 Bacteria 1702
208 Ga0075367_10116266 3300006178 Bacteria 1645
209 Ga0075367_10365758 3300006178 Bacteria 911
210 Ga0075367_10433306 3300006178 Bacteria 833
211 Ga0075369_10095943 3300006186 Bacteria 1327
212 Ga0075369_10169370 3300006186 Bacteria 1002
213 Ga0075369_10233015 3300006186 Bacteria 853
214 Ga0075366_10001525 3300006195 Bacteria 11575
215 Ga0075366_10004076 3300006195 Bacteria 7809
216 Ga0075366_10038714 3300006195 Bacteria 2816
217 Ga0075366_10857394 3300006195 Bacteria 565
218 Ga0097621_100195892 3300006237 Bacteria 1752
219 Ga0097621_100679345 3300006237 Bacteria 947
220 Ga0097621_101036947 3300006237 Bacteria 768
221 Ga0097621_101991136 3300006237 Bacteria 555
222 Ga0075370_10154131 3300006353 Bacteria 1347
223 Ga0075370_10534298 3300006353 Bacteria 709
224 Ga0075370_10706601 3300006353 Bacteria 613
225 Ga0068871_100106807 3300006358 Bacteria 2350
226 Ga0068871_100524455 3300006358 Bacteria 1070
227 Ga0068871_101062978 3300006358 Bacteria 756
228 Ga0068871_102384835 3300006358 Bacteria 504
229 Ga0075434_100061863 3300006871 Unclassified 3725
230 Ga0075434_100068500 3300006871 Bacteria 3535
231 Ga0075434_102166881 3300006871 Bacteria 560
232 Ga0075429_100063803 3300006880 Bacteria 3209
233 Ga0075429_101517559 3300006880 Bacteria 583
234 Ga0068865_100077349 3300006881 Bacteria 2377
235 Ga0068865_100394881 3300006881 Bacteria 1131
236 Ga0068865_100674376 3300006881 Bacteria 881
237 Ga0068865_100907474 3300006881 Bacteria 767
238 Ga0068865_100993456 3300006881 Bacteria 734
239 Ga0075436_100984401 3300006914 Bacteria 632
240 Ga0075436_101550072 3300006914 Bacteria 504
241 Ga0097620_100247314 3300006931 Bacteria 1873
242 Ga0097620_100667226 3300006931 Bacteria 1131
243 Ga0097620_100708887 3300006931 Bacteria 1097
244 Ga0097620_102403042 3300006931 Bacteria 581
245 Ga0075435_100356738 3300007076 Bacteria 1254
246 Ga0075435_101694169 3300007076 Bacteria 555
247 Ga0099794_10064167 3300007265 Bacteria 1789
248 Ga0099795_10168008 3300007788 Bacteria 909
249 Ga0105251_10370334 3300009011 Bacteria 655
250 Ga0105250_10126450 3300009092 Bacteria 1053
251 Ga0105240_11943134 3300009093 Bacteria 612
252 Ga0105240_12013630 3300009093 Bacteria 600
253 Ga0111539_11052666 3300009094 Bacteria 946
254 Ga0105245_10868807 3300009098 Bacteria 942
255 Ga0105245_12359647 3300009098 Bacteria 585
256 Ga0105247_10676972 3300009101 Bacteria 774
257 Ga0105247_11048369 3300009101 Bacteria 640
258 Ga0105247_11699887 3300009101 Bacteria 522
259 Ga0114129_10964522 3300009147 Bacteria 1076
260 Ga0114129_11223890 3300009147 Bacteria 934
261 Ga0105243_11044250 3300009148 Bacteria 822
262 Ga0105241_11138202 3300009174 Bacteria 736
263 Ga0105248_10356682 3300009177 Bacteria 1646
264 Ga0105248_10452532 3300009177 Bacteria 1447
265 Ga0105248_10968511 3300009177 Bacteria 961
266 Ga0105237_11343131 3300009545 Bacteria 721
267 Ga0105237_12057461 3300009545 Bacteria 580
268 Ga0105237_12749559 3300009545 Bacteria 503
269 Ga0105238_11692532 3300009551 Bacteria 663
270 Ga0105249_10092872 3300009553 Bacteria 2826
271 Ga0105249_10254004 3300009553 Bacteria 1744
272 Ga0105249_12117931 3300009553 Bacteria 635
273 Ga0099796_10467188 3300010159 Bacteria 563
274 Ga0105239_10063157 3300010375 Bacteria 4066
275 Ga0105239_10128151 3300010375 Bacteria 2822
276 Ga0105246_10120796 3300011119 Bacteria 1941
277 Ga0105246_11347508 3300011119 Bacteria 663
278 Ga0105246_12015610 3300011119 Bacteria 557
279 Ga0105246_12522602 3300011119 Bacteria 506
280 Ga0157335_1048709 3300012492 Bacteria 500
281 Ga0157373_10525021 3300013100 Bacteria 857
282 Ga0157370_10099255 3300013104 Bacteria 2729
283 Ga0157370_10099681 3300013104 Bacteria 2722
284 Ga0157369_10856514 3300013105 Bacteria 933
285 Ga0157378_10528327 3300013297 Bacteria 1182
286 Ga0157378_10983944 3300013297 Bacteria 877
287 Ga0163162_10425135 3300013306 Bacteria 1461
288 Ga0163162_10628412 3300013306 Bacteria 1199
289 Ga0163162_11071737 3300013306 Bacteria 913
290 Ga0163162_12867969 3300013306 Bacteria 555
291 Ga0157375_10618797 3300013308 Bacteria 1241
292 Ga0163163_10663280 3300014325 Bacteria 1107
293 Ga0163163_11015510 3300014325 Bacteria 893
294 Ga0163163_11956756 3300014325 Bacteria 646
295 Ga0157380_10055433 3300014326 Bacteria 3148
296 Ga0157380_11334648 3300014326 Bacteria 766
297 Ga0157380_12549546 3300014326 Bacteria 577
298 Ga0157377_10739326 3300014745 Bacteria 719
299 Ga0157377_10749698 3300014745 Bacteria 714
300 Ga0157377_11159841 3300014745 Bacteria 596
301 Ga0163161_10120658 3300017792 Bacteria 1970
302 Ga0163161_10258850 3300017792 Bacteria 1358
303 Ga0163161_10886438 3300017792 Bacteria 755
304 Ga0163161_12048601 3300017792 Bacteria 509
305 Ga0184601_131220 3300019183 Bacteria 711
306 Ga0184603_138419 3300019192 Bacteria 700
307 Ga0206354_10020402 3300020081 Bacteria 826
308 Ga0206353_10880577 3300020082 Bacteria 898
309 Ga0213872_10111441 3300021361 Bacteria 1215
310 Ga0213874_10053869 3300021377 Bacteria 1242
311 Ga0213876_10289419 3300021384 Bacteria 871
312 Ga0213871_10019928 3300021441 Bacteria 1657
313 Ga0213871_10111906 3300021441 Bacteria 807
314 Ga0213871_10250519 3300021441 Bacteria 563
315 Ga0224712_10609470 3300022467 Bacteria 533
316 Ga0209148_1000321 3300025254 Bacteria 66604
317 Ga0209148_1023478 3300025254 Bacteria 982
318 Ga0209233_1040885 3300025261 Bacteria 1005
319 Ga0209455_1013823 3300025272 Bacteria 1857
320 Ga0209758_1000125 3300025297 Bacteria 189869
321 Ga0209257_1019362 3300025304 Bacteria 2568
322 Ga0209257_1061004 3300025304 Bacteria 1024
323 Ga0207697_10009193 3300025315 Bacteria 4277
324 Ga0207697_10080726 3300025315 Bacteria 1370
325 Ga0207697_10139319 3300025315 Bacteria 1051
326 Ga0207697_10303717 3300025315 Bacteria 708
327 Ga0207696_1154997 3300025711 Bacteria 611
328 Ga0207682_10129393 3300025893 Bacteria 1126
329 Ga0207692_10300699 3300025898 Bacteria 976
330 Ga0207692_10514247 3300025898 Bacteria 761
331 Ga0207642_10073056 3300025899 Bacteria 1639
332 Ga0207642_10315562 3300025899 Bacteria 911
333 Ga0207710_10035362 3300025900 Bacteria 2198
334 Ga0207710_10148135 3300025900 Bacteria 1137
335 Ga0207710_10285129 3300025900 Bacteria 832
336 Ga0207710_10426037 3300025900 Bacteria 683
337 Ga0207688_10023915 3300025901 Bacteria 3349
338 Ga0207688_10080700 3300025901 Bacteria 1857
339 Ga0207688_10468030 3300025901 Bacteria 787
340 Ga0207680_10087821 3300025903 Bacteria 1970
341 Ga0207680_10842590 3300025903 Bacteria 657
342 Ga0207647_10005715 3300025904 Bacteria 9080
343 Ga0207647_10284961 3300025904 Bacteria 942
344 Ga0207685_10119165 3300025905 Bacteria 1156
345 Ga0207685_10216717 3300025905 Bacteria 908
346 Ga0207685_10312379 3300025905 Bacteria 781
347 Ga0207685_10497118 3300025905 Bacteria 641
348 Ga0207685_10664504 3300025905 Bacteria 564
349 Ga0207699_10031047 3300025906 Bacteria 2996
350 Ga0207699_10051570 3300025906 Bacteria 2432
351 Ga0207699_10161118 3300025906 Bacteria 1493
352 Ga0207699_10340964 3300025906 Bacteria 1056
353 Ga0207699_11239545 3300025906 Bacteria 552
354 Ga0207645_10107331 3300025907 Bacteria 1805
355 Ga0207645_10111597 3300025907 Bacteria 1770
356 Ga0207645_10328763 3300025907 Bacteria 1021
357 Ga0207643_10200467 3300025908 Bacteria 1215
358 Ga0207643_10474128 3300025908 Bacteria 798
359 Ga0207643_10856882 3300025908 Bacteria 589
360 Ga0207705_10006176 3300025909 Bacteria 8910
361 Ga0207705_10391858 3300025909 Bacteria 1074
362 Ga0207705_11331398 3300025909 Bacteria 548
363 Ga0207654_10083868 3300025911 Bacteria 1925
364 Ga0207654_10617362 3300025911 Bacteria 775
365 Ga0207654_10809271 3300025911 Bacteria 677
366 Ga0207707_10062398 3300025912 Bacteria 3243
367 Ga0207707_10446309 3300025912 Bacteria 1107
368 Ga0207707_10558665 3300025912 Bacteria 972
369 Ga0207707_11070227 3300025912 Bacteria 659
370 Ga0207695_10064554 3300025913 Bacteria 3768
371 Ga0207671_10381398 3300025914 Bacteria 1120
372 Ga0207671_10502612 3300025914 Bacteria 966
373 Ga0207693_10025189 3300025915 Bacteria 4717
374 Ga0207693_10122936 3300025915 Bacteria 2039
375 Ga0207693_10545068 3300025915 Bacteria 905
376 Ga0207693_10679029 3300025915 Bacteria 799
377 Ga0207663_10037777 3300025916 Bacteria 2913
378 Ga0207663_10063664 3300025916 Bacteria 2350
379 Ga0207663_10165842 3300025916 Bacteria 1564
380 Ga0207663_10507754 3300025916 Bacteria 937
381 Ga0207660_10477251 3300025917 Bacteria 1010
382 Ga0207660_10909211 3300025917 Bacteria 718
383 Ga0207662_10037298 3300025918 Bacteria 2844
384 Ga0207662_10047231 3300025918 Bacteria 2550
385 Ga0207657_10085109 3300025919 Bacteria 2649
386 Ga0207649_10298290 3300025920 Bacteria 1178
387 Ga0207649_11420749 3300025920 Bacteria 549
388 Ga0207652_10083761 3300025921 Bacteria 2793
389 Ga0207652_10216561 3300025921 Bacteria 1725
390 Ga0207652_10818039 3300025921 Bacteria 826
391 Ga0207646_10840462 3300025922 Bacteria 816
392 Ga0207646_11079106 3300025922 Bacteria 707
393 Ga0207681_10240383 3300025923 Bacteria 1409
394 Ga0207681_10331355 3300025923 Bacteria 1213
395 Ga0207681_10382988 3300025923 Bacteria 1132
396 Ga0207681_11712390 3300025923 Bacteria 525
397 Ga0207694_10266182 3300025924 Bacteria 1405
398 Ga0207694_10770924 3300025924 Bacteria 812
399 Ga0207694_11129973 3300025924 Bacteria 663
400 Ga0207694_11263972 3300025924 Bacteria 624
401 Ga0207694_11881292 3300025924 Bacteria 502
402 Ga0207650_10100767 3300025925 Bacteria 2223
403 Ga0207650_10424851 3300025925 Bacteria 1103
404 Ga0207687_10369567 3300025927 Bacteria 1172
405 Ga0207687_10651144 3300025927 Bacteria 891
406 Ga0207687_11003745 3300025927 Bacteria 716
407 Ga0207687_11835544 3300025927 Bacteria 519
408 Ga0207700_10335534 3300025928 Bacteria 1313
409 Ga0207700_10382401 3300025928 Bacteria 1231
410 Ga0207700_10487522 3300025928 Bacteria 1090
411 Ga0207700_11328170 3300025928 Bacteria 640
412 Ga0207664_10304558 3300025929 Bacteria 1403
413 Ga0207664_10644234 3300025929 Bacteria 952
414 Ga0207664_10678835 3300025929 Bacteria 926
415 Ga0207664_10996599 3300025929 Bacteria 751
416 Ga0207644_10028196 3300025931 Bacteria 3885
417 Ga0207644_10033032 3300025931 Bacteria 3614
418 Ga0207644_10574517 3300025931 Bacteria 934
419 Ga0207690_10117745 3300025932 Bacteria 1924
420 Ga0207690_10212144 3300025932 Bacteria 1477
421 Ga0207690_10625745 3300025932 Bacteria 880
422 Ga0207690_11047547 3300025932 Bacteria 679
423 Ga0207706_10023343 3300025933 Bacteria 5555
424 Ga0207706_10484330 3300025933 Bacteria 1069
425 Ga0207706_11677108 3300025933 Bacteria 512
426 Ga0207686_10548650 3300025934 Bacteria 903
427 Ga0207686_10586208 3300025934 Bacteria 876
428 Ga0207709_10023999 3300025935 Bacteria 3478
429 Ga0207709_10076702 3300025935 Bacteria 2140
430 Ga0207709_11212929 3300025935 Bacteria 622
431 Ga0207670_10005994 3300025936 Bacteria 6716
432 Ga0207670_10145887 3300025936 Bacteria 1750
433 Ga0207670_11734092 3300025936 Bacteria 531
434 Ga0207669_10030512 3300025937 Bacteria 2996
435 Ga0207669_10053059 3300025937 Bacteria 2440
436 Ga0207669_10192846 3300025937 Bacteria 1471
437 Ga0207704_10025389 3300025938 Bacteria 3232
438 Ga0207704_10710298 3300025938 Bacteria 833
439 Ga0207704_10783637 3300025938 Bacteria 795
440 Ga0207665_10047516 3300025939 Bacteria 2878
441 Ga0207665_10047757 3300025939 Bacteria 2871
442 Ga0207665_10066144 3300025939 Bacteria 2459
443 Ga0207665_10265159 3300025939 Bacteria 1274
444 Ga0207665_11668762 3300025939 Bacteria 505
445 Ga0207691_10035922 3300025940 Bacteria 4594
446 Ga0207691_10401236 3300025940 Bacteria 1169
447 Ga0207711_10016693 3300025941 Bacteria 6096
448 Ga0207711_10143470 3300025941 Bacteria 2150
449 Ga0207711_10239269 3300025941 Bacteria 1664
450 Ga0207711_10866919 3300025941 Bacteria 840
451 Ga0207711_11041230 3300025941 Bacteria 758
452 Ga0207711_11352534 3300025941 Bacteria 654
453 Ga0207689_10171637 3300025942 Bacteria 1788
454 Ga0207661_11117637 3300025944 Bacteria 725
455 Ga0207661_11460317 3300025944 Bacteria 627
456 Ga0207679_10452684 3300025945 Bacteria 1139
457 Ga0207679_10803813 3300025945 Bacteria 857
458 Ga0207667_10014848 3300025949 Bacteria 8857
459 Ga0207667_10071501 3300025949 Bacteria 3607
460 Ga0207667_11391231 3300025949 Bacteria 675
461 Ga0207651_10163981 3300025960 Bacteria 1745
462 Ga0207651_10366380 3300025960 Bacteria 1218
463 Ga0207651_11659424 3300025960 Bacteria 576
464 Ga0207712_10238461 3300025961 Bacteria 1464
465 Ga0207712_10386705 3300025961 Bacteria 1172
466 Ga0207712_12054090 3300025961 Bacteria 511
467 Ga0207668_10153748 3300025972 Bacteria 1784
468 Ga0207668_10174207 3300025972 Bacteria 1690
469 Ga0207668_10363426 3300025972 Bacteria 1213
470 Ga0207668_10455826 3300025972 Bacteria 1092
471 Ga0207668_11208169 3300025972 Bacteria 679
472 Ga0207668_11221144 3300025972 Bacteria 676
473 Ga0207640_10656639 3300025981 Bacteria 894
474 Ga0207640_11151240 3300025981 Bacteria 688
475 Ga0207658_10244476 3300025986 Bacteria 1522
476 Ga0207658_10355121 3300025986 Bacteria 1277
477 Ga0207658_10390143 3300025986 Bacteria 1221
478 Ga0207658_11140289 3300025986 Bacteria 712
479 Ga0207677_11237551 3300026023 Bacteria 684
480 Ga0207703_10072639 3300026035 Bacteria 2844
481 Ga0207703_10075818 3300026035 Bacteria 2788
482 Ga0207703_10155570 3300026035 Bacteria 1997
483 Ga0207703_10167619 3300026035 Bacteria 1929
484 Ga0207703_10184041 3300026035 Bacteria 1845
485 Ga0207703_10389005 3300026035 Bacteria 1292
486 Ga0207703_10608713 3300026035 Bacteria 1034
487 Ga0207639_10262761 3300026041 Bacteria 1510
488 Ga0207639_10358711 3300026041 Bacteria 1304
489 Ga0207639_10573109 3300026041 Bacteria 1038
490 Ga0207639_11639258 3300026041 Bacteria 603
491 Ga0207639_12068842 3300026041 Bacteria 530
492 Ga0207678_10047576 3300026067 Bacteria 3709
493 Ga0207678_10225478 3300026067 Bacteria 1604
494 Ga0207678_10471182 3300026067 Bacteria 1093
495 Ga0207678_10959460 3300026067 Bacteria 756
496 Ga0207678_11159352 3300026067 Bacteria 684
497 Ga0207708_10461568 3300026075 Bacteria 1059
498 Ga0207708_11384615 3300026075 Bacteria 617
499 Ga0207708_11796022 3300026075 Bacteria 538
500 Ga0207702_10886797 3300026078 Bacteria 884
501 Ga0207641_10035550 3300026088 Bacteria 4152
502 Ga0207641_10588416 3300026088 Bacteria 1088
503 Ga0207641_10749434 3300026088 Bacteria 964
504 Ga0207648_10083791 3300026089 Bacteria 2781
505 Ga0207648_10418801 3300026089 Bacteria 1216
506 Ga0207648_11445595 3300026089 Bacteria 646
507 Ga0207676_10068801 3300026095 Bacteria 2833
508 Ga0207676_10127756 3300026095 Bacteria 2156
509 Ga0207676_10566587 3300026095 Bacteria 1087
510 Ga0207676_11068980 3300026095 Bacteria 797
511 Ga0207674_10070190 3300026116 Bacteria 3522
512 Ga0207674_10184205 3300026116 Bacteria 2038
513 Ga0207674_10926646 3300026116 Bacteria 839
514 Ga0207674_11021541 3300026116 Bacteria 796
515 Ga0207675_100218465 3300026118 Bacteria 1836
516 Ga0207675_100231001 3300026118 Bacteria 1785
517 Ga0207675_101346384 3300026118 Bacteria 734
518 Ga0207675_102686508 3300026118 Bacteria 506
519 Ga0207683_10028565 3300026121 Bacteria 4824
520 Ga0207683_10039006 3300026121 Bacteria 4142
521 Ga0207683_10119501 3300026121 Bacteria 2365
522 Ga0207683_10350591 3300026121 Bacteria 1355
523 Ga0207683_10822902 3300026121 Bacteria 862
524 Ga0207698_10789617 3300026142 Bacteria 951
525 Ga0207698_12045752 3300026142 Bacteria 587
526 Ga0209389_1000034 3300027296 Bacteria 127289
527 Ga0209589_1000038 3300027357 Bacteria 127285
528 Ga0209489_100023 3300027361 Bacteria 198829
529 Ga0209179_1105220 3300027512 Bacteria 629
530 Ga0209813_10036432 3300027866 Bacteria 1478
531 Ga0268266_10006418 3300028379 Bacteria 10775
532 Ga0268266_10475495 3300028379 Bacteria 1190
533 Ga0268266_11163683 3300028379 Bacteria 746
534 Ga0268266_11165076 3300028379 Bacteria 745
535 Ga0268266_11516329 3300028379 Bacteria 646
536 Ga0268266_12081840 3300028379 Bacteria 540
537 Ga0268265_10080420 3300028380 Bacteria 2570
538 Ga0268265_10219493 3300028380 Bacteria 1662
539 Ga0268265_10343317 3300028380 Bacteria 1360
540 Ga0268265_10593419 3300028380 Bacteria 1057
541 Ga0268265_11426959 3300028380 Bacteria 695
542 Ga0268264_10000194 3300028381 Bacteria 125395
543 Ga0268264_10172181 3300028381 Bacteria 1959
544 Ga0268264_10391927 3300028381 Bacteria 1333
545 Ga0268264_10421011 3300028381 Bacteria 1288
546 Ga0268264_10724720 3300028381 Bacteria 989
547 Ga0268264_12165850 3300028381 Bacteria 564
548 Ga0265319_1080633 3300028563 Bacteria 1034
549 Ga0265334_10278992 3300028573 Bacteria 573
550 Ga0265318_10044086 3300028577 Bacteria 1688
551 Ga0265323_10000720 3300028653 Bacteria 17903
552 Ga0265336_10000640 3300028666 Bacteria 19119
553 Ga0307517_10468816 3300028786 Bacteria 648
554 Ga0307517_10509457 3300028786 Bacteria 610
555 Ga0307515_10711495 3300028794 Bacteria 621
556 Ga0265338_10001434 3300028800 Bacteria 38730
557 Ga0265338_10561380 3300028800 Bacteria 798
558 Ga0265324_10001605 3300029957 Bacteria 12590
559 Ga0265762_1043916 3300030760 Bacteria 881
560 Ga0265762_1093671 3300030760 Bacteria 658
561 Ga0265762_1131184 3300030760 Bacteria 581
562 Ga0265775_102827 3300030762 Bacteria 915
563 Ga0265767_106021 3300030836 Bacteria 748
564 Ga0265777_114020 3300030877 Bacteria 616
565 Ga0265769_121512 3300030888 Bacteria 515
566 Ga0265771_1032895 3300031010 Bacteria 504
567 Ga0265760_10129268 3300031090 Bacteria 816
568 Ga0265325_10000126 3300031241 Bacteria 52410
569 Ga0265325_10000470 3300031241 Bacteria 29219
570 Ga0265325_10093811 3300031241 Bacteria 1476
571 Ga0265340_10095479 3300031247 Bacteria 1386
572 Ga0265339_10172626 3300031249 Bacteria 1081
573 Ga0265339_10322841 3300031249 Bacteria 732
574 Ga0265327_10120506 3300031251 Bacteria 1243
575 Ga0265327_10509724 3300031251 Bacteria 518
576 Ga0265316_10196971 3300031344 Bacteria 1495
577 Ga0307513_10276584 3300031456 Bacteria 1459
578 Ga0307509_10947770 3300031507 Bacteria 526
579 Ga0310117_121285 3300031592 Bacteria 647
580 Ga0307508_10278611 3300031616 Bacteria 1265
581 Ga0307508_10316059 3300031616 Bacteria 1154
582 Ga0265314_10017036 3300031711 Bacteria 5713
583 Ga0265342_10089626 3300031712 Bacteria 1765
584 Ga0265342_10491021 3300031712 Bacteria 627
585 Ga0307406_10942930 3300031901 Bacteria 737
586 Ga0307407_10357590 3300031903 Bacteria 1036
587 Ga0307409_101208794 3300031995 Bacteria 779
588 Ga0307409_101541459 3300031995 Bacteria 692
589 Ga0307416_101374241 3300032002 Bacteria 812
590 Ga0307416_101598931 3300032002 Bacteria 757
591 Ga0307416_102314245 3300032002 Bacteria 638
592 Ga0307414_10405696 3300032004 Bacteria 1185
593 Ga0307414_11592044 3300032004 Bacteria 609
594 Ga0307411_10057196 3300032005 Bacteria 2575
595 Ga0307415_100385194 3300032126 Bacteria 1192
596 Ga0307507_10325907 3300033179 Bacteria 921
597 Ga0373948_0205085 3300034817 Bacteria 516
598 Ga0373938_0044796 3300034957 Bacteria 994
599 Ga0373926_0028112 3300035083 Bacteria 1973
600 Ga0373926_0423326 3300035083 Bacteria 527
601 Ga0373926_0454273 3300035083 Bacteria 509
602 Ga0373929_0033882 3300035085 Bacteria 1106
603 Ga0373934_0020498 3300035086 Bacteria 2540
604 Ga0373944_0049719 3300035089 Bacteria 1318
605 Ga0373949_0017442 3300035090 Bacteria 1619
606 Ga0373949_0129113 3300035090 Bacteria 716
607 Ga0373952_0012840 3300035092 Bacteria 1654
608 Ga0373952_0051555 3300035092 Bacteria 983
609 Ga0373952_0170343 3300035092 Bacteria 622
610 Ga0373923_0004214 3300035111 Bacteria 4748
611 Ga0373932_0015356 3300035112 Bacteria 1940
612 Ga0373932_0038954 3300035112 Bacteria 1361
613 Ga0373932_0156678 3300035112 Bacteria 785
614 Ga0373936_0018243 3300035113 Bacteria 2708
615 Ga0373936_0042601 3300035113 Bacteria 1823
616 Ga0373936_0457532 3300035113 Bacteria 590
617 Ga0373939_0082617 3300035114 Bacteria 1070
618 Ga0373939_0400481 3300035114 Bacteria 569
619 Ga0373945_0015924 3300035116 Bacteria 2533
620 Ga0373945_0053511 3300035116 Bacteria 1490
621 Ga0373953_0029700 3300035117 Bacteria 2116
622 Ga0373954_0040683 3300035118 Bacteria 2166
623 Ga0373956_0129241 3300035119 Bacteria 1182
624 Ga0373957_0063649 3300035120 Bacteria 1433
625 Ga0373943_0094530 3300035170 Bacteria 1553
626 Ga0373943_0295351 3300035170 Bacteria 919
627 Ga0373946_0041154 3300035171 Bacteria 1894
628 Ga0373946_0104020 3300035171 Bacteria 1277
629 Ga0373946_0190840 3300035171 Bacteria 977
630 Ga0373955_0173360 3300035172 Bacteria 1277
631 Ga0373942_0116036 3300035207 Bacteria 832
632 Ga0373961_0243167 3300035241 Bacteria 649
633 Ga0373962_0076787 3300035242 Bacteria 1008
634 Ga0373924_0075521 3300035410 Bacteria 1426
635 Ga0373924_0221097 3300035410 Bacteria 837
636 Ga0373931_0012673 3300035691 Bacteria 4088
637 Ga0373931_0262031 3300035691 Bacteria 1055
638 Ga0373931_0402488 3300035691 Bacteria 867
639 Ga0373931_1056126 3300035691 Bacteria 551
640 Ga0373935_0008303 3300035692 Bacteria 6213
641 Ga0373935_0212024 3300035692 Bacteria 1342
642 Ga0373935_0548796 3300035692 Bacteria 842
643 Ga0373935_0695297 3300035692 Bacteria 748
644 Ga0373927_0042629 3300035695 Bacteria 2940
645 Ga0373927_0048081 3300035695 Bacteria 2758
646 Ga0373927_0431383 3300035695 Bacteria 870
647 Ga0373927_0631216 3300035695 Bacteria 708
648 Ga0373927_1163135 3300035695 Bacteria 509
649 Ga0373933_0257013 3300035724 Bacteria 1126
650 Ga0373947_0016229 3300035725 Bacteria 4280
651 Ga0373947_0996504 3300035725 Bacteria 571
652 Ga0373947_1111872 3300035725 Bacteria 539
653 Ga0373937_0029238 3300036401 Bacteria 4990
654 Ga0373937_0065822 3300036401 Bacteria 3337
655 Ga0373937_0066365 3300036401 Bacteria 3323
656 Ga0265778_067364 3300036457 Bacteria 505
657 Ga0373925_0065401 3300037068 Bacteria 2739
658 Ga0373925_0132097 3300037068 Bacteria 1947
659 Ga0373925_0323039 3300037068 Bacteria 1249
660 Ga0373925_0328877 3300037068 Bacteria 1238
661 Ga0373925_0486669 3300037068 Bacteria 1012
662 Ga0373925_1336576 3300037068 Bacteria 588
663 Ga0395899_0435588 3300037312 Bacteria 861
664 Ga0395900_0304918 3300037418 Bacteria 1577
665 Ga0395900_1046107 3300037418 Bacteria 735
666 Ga0395898_0012221 3300037466 Bacteria 8877
667 Ga0395898_0050374 3300037466 Bacteria 4076
668 Ga0395898_0494678 3300037466 Bacteria 1163
669 Ga0395898_0508197 3300037466 Bacteria 1146
670 Ga0395905_1367532 3300037471 Bacteria 612
671 Ga0395905_1379564 3300037471 Bacteria 609
672 Ga0395905_1859113 3300037471 Bacteria 508
673 Ga0436364_0036886 3300037853 Bacteria 597
674 Ga0436364_0315770 3300037853 Bacteria 1023
675 Ga0436364_1186832 3300037853 Bacteria 1205
676 Ga0436364_1233691 3300037853 Bacteria 975
677 Ga0436364_1286138 3300037853 Bacteria 1134
678 Ga0436364_1474561 3300037853 Bacteria 619
679 Ga0436364_1516960 3300037853 Bacteria 2108
680 Ga0436364_1531434 3300037853 Bacteria 1435
681 Ga0395901_0041272 3300038443 Bacteria 4781
682 Ga0395901_0383425 3300038443 Bacteria 1446
683 Ga0395901_0722658 3300038443 Bacteria 991
684 Ga0400483_289328 3300039062 Bacteria 3270
685 Ga0436365_0160999 3300039437 Bacteria 760
686 Ga0436365_0703944 3300039437 Bacteria 21999
687 Ga0436365_0900444 3300039437 Bacteria 1100
688 Ga0436365_1141253 3300039437 Bacteria 1345
689 Ga0436365_1491242 3300039437 Bacteria 529
690 Ga0436360_0097049 3300039438 Bacteria 1219
691 Ga0436360_0547363 3300039438 Bacteria 1946
692 Ga0436360_0855640 3300039438 Bacteria 1164
693 Ga0436360_0918467 3300039438 Bacteria 701
694 Ga0436360_1151401 3300039438 Bacteria 2548
695 Ga0436361_0021799 3300039447 Bacteria 614
696 Ga0436361_0044782 3300039447 Bacteria 1222
697 Ga0436361_0250690 3300039447 Bacteria 682
698 Ga0436361_0690845 3300039447 Bacteria 1382
699 Ga0436361_0720097 3300039447 Bacteria 2359
700 Ga0436363_0154853 3300039450 Bacteria 639
701 Ga0436363_0211976 3300039450 Bacteria 1158
702 Ga0436363_0965241 3300039450 Bacteria 723
703 Ga0436363_1109504 3300039450 Bacteria 634
704 Ga0436363_1262652 3300039450 Bacteria 1263
705 Ga0436363_1322015 3300039450 Bacteria 756
706 Ga0436363_1502120 3300039450 Bacteria 3893
707 Ga0436362_0421234 3300039453 Bacteria 8413
708 Ga0436362_0869632 3300039453 Bacteria 1069
709 Ga0451789_0350328 3300041443 Bacteria 858
710 Ga0451794_41682 3300041446 Bacteria 536
711 Ga0451793_0188671 3300041452 Bacteria 612
712 Ga0451797_0893948 3300041453 Bacteria 702
713 Ga0451795_0161699 3300041456 Bacteria 674
714 Ga0451795_0986905 3300041456 Bacteria 547
715 Ga0451798_0884644 3300041458 Bacteria 601
716 Ga0451800_0165008 3300041459 Bacteria 531
717 Ga0451800_1521909 3300041459 Bacteria 614
718 Ga0451802_0364258 3300041460 Bacteria 519
719 Ga0451805_034073 3300041461 Bacteria 676
720 Ga0451804_0197570 3300041463 Bacteria 719
721 Ga0451837_1526070 3300041494 Bacteria 654
722 Ga0451839_0615464 3300041496 Bacteria 638
723 Ga0451839_1009338 3300041496 Bacteria 1237
724 Ga0451841_0002499 3300041498 Bacteria 503
725 Ga0451841_0696736 3300041498 Bacteria 675
726 Ga0439459_0021955 3300042438 Bacteria 1231
727 Ga0451577_0073171 3300042876 Bacteria 3058
728 Ga0466969_0309758 3300044656 Bacteria 715
729 Ga0466969_0608483 3300044656 Bacteria 502
730 Ga0466972_0000053 3300044658 Bacteria 112876
731 Ga0466972_0014315 3300044658 Bacteria 3974
732 Ga0453683_0163048 3300044673 Bacteria 1411
733 Ga0453683_0917818 3300044673 Bacteria 579
734 Ga0453683_1126951 3300044673 Bacteria 524
735 Ga0466966_0000322 3300044684 Bacteria 30928
736 Ga0466966_0353867 3300044684 Bacteria 882
737 Ga0466961_0002390 3300044693 Bacteria 11659
738 Ga0466961_0449315 3300044693 Bacteria 780
739 Ga0466961_0672400 3300044693 Bacteria 621
740 Ga0466963_0005897 3300044694 Bacteria 7217
741 Ga0466963_0012246 3300044694 Bacteria 5245
742 Ga0466963_0431621 3300044694 Bacteria 929
743 Ga0466964_0029953 3300044706 Bacteria 2152
744 Ga0466964_0241002 3300044706 Bacteria 887
745 Ga0466964_0402475 3300044706 Bacteria 715
746 Ga0466964_0737687 3300044706 Bacteria 552
747 Ga0453684_0409847 3300044712 Bacteria 1516
748 Ga0453684_0781325 3300044712 Bacteria 1031
749 Ga0466971_0112315 3300044719 Bacteria 1258
750 Ga0466968_0021394 3300044735 Bacteria 2619
751 Ga0466968_0082883 3300044735 Bacteria 1412
752 Ga0466968_0401330 3300044735 Bacteria 672
753 Ga0466968_0574764 3300044735 Bacteria 567
754 Ga0466970_0015654 3300044765 Bacteria 3904
755 Ga0466970_0182060 3300044765 Bacteria 1166
756 Ga0466970_0219397 3300044765 Bacteria 1061
757 Ga0466957_0163208 3300044842 Bacteria 1448
758 Ga0466957_0392950 3300044842 Bacteria 947
759 Ga0466957_1408171 3300044842 Bacteria 507
760 Ga0466960_0000619 3300044901 Bacteria 12265
761 Ga0466960_0558741 3300044901 Bacteria 676
762 Ga0466959_0045817 3300045049 Bacteria 3220
763 Ga0466959_0053003 3300045049 Bacteria 2968
764 Ga0466959_0098485 3300045049 Bacteria 2095
765 Ga0466959_0171755 3300045049 Bacteria 1520
766 Ga0466959_0419679 3300045049 Bacteria 908
767 Ga0451576_0000094 3300045051 Bacteria 225875
768 Ga0466958_0558197 3300045836 Bacteria 744
769 Ga0466958_0953609 3300045836 Bacteria 560
770 Ga0466967_0065989 3300045976 Bacteria 3224
771 Ga0466967_0091722 3300045976 Bacteria 2761
772 Ga0466967_0263682 3300045976 Bacteria 1649
773 Ga0466967_0337186 3300045976 Bacteria 1457
774 Ga0466967_0347323 3300045976 Bacteria 1435
775 Ga0466967_1118636 3300045976 Bacteria 785
776 Ga0466967_2385499 3300045976 Bacteria 524
777 Ga0495627_116590 3300046453 Bacteria 756
778 Ga0495592_0437132 3300046454 Bacteria 822
779 Ga0495603_0000617 3300046455 Bacteria 19921
780 Ga0495603_0019971 3300046455 Bacteria 4059
781 Ga0495590_0066232 3300046457 Bacteria 1265
782 Ga0495590_0076182 3300046457 Bacteria 1180
783 Ga0495590_0279095 3300046457 Bacteria 625
784 Ga0495590_0351195 3300046457 Bacteria 560
785 Ga0495629_0034001 3300046459 Bacteria 3605
786 Ga0495638_0013781 3300046460 Bacteria 5489
787 Ga0495638_0026784 3300046460 Bacteria 3735
788 Ga0495638_0069617 3300046460 Bacteria 2156
789 Ga0495638_0109890 3300046460 Bacteria 1639
790 Ga0495638_0481729 3300046460 Bacteria 628
791 Ga0495638_0510988 3300046460 Bacteria 603
792 Ga0495641_0264045 3300046461 Bacteria 775
793 Ga0495651_0039889 3300046462 Bacteria 3653
794 Ga0495651_0208178 3300046462 Bacteria 1363
795 Ga0495651_0252604 3300046462 Bacteria 1203
796 Ga0495653_0144636 3300046463 Bacteria 1668
797 Ga0495653_0522517 3300046463 Bacteria 738
798 Ga0495653_0789965 3300046463 Bacteria 571
799 Ga0495650_0001155 3300046471 Bacteria 28394
800 Ga0495580_0005741 3300046472 Bacteria 10196
801 Ga0495580_0854374 3300046472 Bacteria 587
802 Ga0495582_0006702 3300046473 Bacteria 6399
803 Ga0495582_0422337 3300046473 Bacteria 769
804 Ga0495582_0876641 3300046473 Bacteria 519
805 Ga0495605_0032176 3300046474 Bacteria 2672
806 Ga0495605_0034972 3300046474 Bacteria 2541
807 Ga0495605_0044915 3300046474 Bacteria 2181
808 Ga0495639_0011908 3300046475 Bacteria 3751
809 Ga0495639_0067301 3300046475 Bacteria 1649
810 Ga0495639_0103625 3300046475 Bacteria 1345
811 Ga0495639_0311761 3300046475 Bacteria 786
812 Ga0495639_0568903 3300046475 Bacteria 581
813 Ga0495662_0020580 3300046476 Bacteria 3193
814 Ga0495662_0058065 3300046476 Bacteria 1869
815 Ga0495664_0005513 3300046477 Bacteria 6951
816 Ga0495664_0049584 3300046477 Bacteria 2492
817 Ga0495664_0116722 3300046477 Bacteria 1613
818 Ga0495584_0017189 3300046491 Bacteria 3686
819 Ga0495584_0028785 3300046491 Bacteria 2816
820 Ga0495585_0064045 3300046492 Bacteria 2016
821 Ga0495585_0069895 3300046492 Bacteria 1916
822 Ga0495585_0276396 3300046492 Bacteria 831
823 Ga0495585_0287695 3300046492 Bacteria 811
824 Ga0495585_0428849 3300046492 Bacteria 634
825 Ga0495585_0514745 3300046492 Bacteria 568
826 Ga0495594_0233679 3300046499 Bacteria 1048
827 Ga0495594_0242601 3300046499 Bacteria 1027
828 Ga0495594_0262121 3300046499 Bacteria 984
829 Ga0495594_0550869 3300046499 Bacteria 654
830 Ga0495596_0228189 3300046500 Bacteria 723
831 Ga0495607_0008857 3300046501 Bacteria 6853
832 Ga0495607_0090305 3300046501 Bacteria 1661
833 Ga0495607_0251067 3300046501 Bacteria 851
834 Ga0495607_0253965 3300046501 Bacteria 845
835 Ga0495607_0394482 3300046501 Bacteria 631
836 Ga0495583_0070481 3300046506 Bacteria 1537
837 Ga0495583_0078227 3300046506 Bacteria 1441
838 Ga0495583_0368032 3300046506 Bacteria 566
839 Ga0495606_0001566 3300046507 Bacteria 29975
840 Ga0495606_0012761 3300046507 Bacteria 6699
841 Ga0495606_0034333 3300046507 Bacteria 3483
842 Ga0495606_0039871 3300046507 Bacteria 3159
843 Ga0495606_0075267 3300046507 Bacteria 2113
844 Ga0495606_0154197 3300046507 Bacteria 1345
845 Ga0495606_0510765 3300046507 Bacteria 605
846 Ga0495606_0622683 3300046507 Bacteria 526
847 Ga0495608_0082922 3300046511 Bacteria 2082
848 Ga0495608_0096243 3300046511 Bacteria 1912
849 Ga0495608_0271644 3300046511 Bacteria 1054
850 Ga0495610_0078453 3300046512 Bacteria 1522
851 Ga0495616_0045289 3300046513 Bacteria 2227
852 Ga0495616_0153229 3300046513 Bacteria 1041
853 Ga0495618_0292532 3300046514 Bacteria 1013
854 Ga0495618_0626160 3300046514 Bacteria 638
855 Ga0495620_0353824 3300046515 Bacteria 557
856 Ga0495620_0389075 3300046515 Bacteria 528
857 Ga0495628_0208129 3300046516 Bacteria 1472
858 Ga0495630_0064559 3300046517 Bacteria 2751
859 Ga0495630_0241928 3300046517 Bacteria 1379
860 Ga0495631_0016371 3300046518 Bacteria 3537
861 Ga0495631_0093831 3300046518 Bacteria 1292
862 Ga0495631_0120100 3300046518 Bacteria 1130
863 Ga0495631_0205675 3300046518 Bacteria 841
864 Ga0495631_0265885 3300046518 Bacteria 731
865 Ga0495631_0320169 3300046518 Bacteria 660
866 Ga0495632_0017675 3300046519 Bacteria 3931
867 Ga0495632_0118175 3300046519 Bacteria 1240
868 Ga0495632_0342218 3300046519 Bacteria 658
869 Ga0495637_0036160 3300046520 Bacteria 2153
870 Ga0495643_0011150 3300046522 Bacteria 5492
871 Ga0495643_0326024 3300046522 Bacteria 693
872 Ga0495643_0389680 3300046522 Bacteria 616
873 Ga0495644_0091621 3300046523 Bacteria 1147
874 Ga0495644_0271393 3300046523 Bacteria 661
875 Ga0495644_0277466 3300046523 Bacteria 653
876 Ga0495644_0367660 3300046523 Bacteria 567
877 Ga0495648_0029624 3300046524 Bacteria 3630
878 Ga0495648_0173823 3300046524 Bacteria 1101
879 Ga0495648_0420033 3300046524 Bacteria 592
880 Ga0495663_0313484 3300046525 Bacteria 567
881 Ga0495663_0323900 3300046525 Bacteria 558
882 Ga0495666_0034619 3300046526 Bacteria 2464
883 Ga0495666_0158746 3300046526 Bacteria 1049
884 Ga0495666_0319879 3300046526 Bacteria 700
885 Ga0495666_0489021 3300046526 Bacteria 550
886 Ga0495642_0508511 3300046528 Bacteria 533
887 Ga0495652_0017151 3300046529 Bacteria 6466
888 Ga0495652_0057203 3300046529 Bacteria 3308
889 Ga0495652_0089438 3300046529 Bacteria 2521
890 Ga0495652_0816282 3300046529 Bacteria 620
891 Ga0495654_0015853 3300046530 Bacteria 3995
892 Ga0495654_0159228 3300046530 Bacteria 992
893 Ga0495654_0387415 3300046530 Bacteria 557
894 Ga0495665_0005603 3300046531 Bacteria 6766
895 Ga0495665_0135346 3300046531 Bacteria 1289
896 Ga0495640_0005237 3300046533 Bacteria 10312
897 Ga0495640_0732680 3300046533 Bacteria 592
898 Ga0495586_0118068 3300046535 Bacteria 1480
899 Ga0495587_0052305 3300046536 Bacteria 2410
900 Ga0495587_0082496 3300046536 Bacteria 1863
901 Ga0495587_0364677 3300046536 Bacteria 804
902 Ga0495609_0019411 3300046538 Bacteria 3145
903 Ga0495609_0087339 3300046538 Bacteria 1358
904 Ga0495609_0194033 3300046538 Bacteria 851
905 Ga0495609_0244400 3300046538 Bacteria 740
906 Ga0495609_0342483 3300046538 Bacteria 604
907 Ga0495621_0027947 3300046539 Bacteria 1914
908 Ga0495621_0318831 3300046539 Bacteria 647
909 Ga0495621_0525150 3300046539 Bacteria 512
910 Ga0495597_0072862 3300046542 Bacteria 1477
911 Ga0495645_0001939 3300046543 Bacteria 14042
912 Ga0495645_0010968 3300046543 Bacteria 6363
913 Ga0495645_0074893 3300046543 Bacteria 2437
914 Ga0495645_0217539 3300046543 Bacteria 1287
915 Ga0495645_0586280 3300046543 Bacteria 687
916 Ga0495622_0229507 3300046557 Bacteria 821
917 Ga0495633_0314727 3300046558 Bacteria 710
918 Ga0495667_0028020 3300046559 Bacteria 3793
919 Ga0495667_0086796 3300046559 Bacteria 2029
920 Ga0495667_0167633 3300046559 Bacteria 1412
921 Ga0495656_0026864 3300046615 Bacteria 2295
922 Ga0495656_0046559 3300046615 Bacteria 1836
923 Ga0495656_0074179 3300046615 Bacteria 1519
924 Ga0495656_0090614 3300046615 Bacteria 1397
925 Ga0495656_0153921 3300046615 Bacteria 1112
926 Ga0495668_0013946 3300046616 Bacteria 4725
927 Ga0495668_0047101 3300046616 Bacteria 2394
928 Ga0495668_0270412 3300046616 Bacteria 931
929 Ga0495668_0460986 3300046616 Bacteria 699
930 Ga0495634_0746574 3300046642 Bacteria 560
931 Ga0495611_0091070 3300046648 Bacteria 1409
932 Ga0495611_0222139 3300046648 Bacteria 879
933 Ga0495611_0484364 3300046648 Bacteria 562
934 Ga0495625_0035568 3300046660 Bacteria 3670
935 Ga0495625_0138370 3300046660 Bacteria 1644
936 Ga0495625_0260799 3300046660 Bacteria 1121
937 Ga0495625_0307221 3300046660 Bacteria 1013
938 Ga0495625_0722439 3300046660 Bacteria 586
939 Ga0495635_0037964 3300046663 Bacteria 3334
940 Ga0495659_0043372 3300046664 Bacteria 1613
941 Ga0495659_0393263 3300046664 Bacteria 597
942 Ga0495661_0165205 3300046665 Bacteria 1185
943 Ga0495661_0235255 3300046665 Bacteria 942
944 Ga0495588_0030445 3300046674 Bacteria 2713
945 Ga0495588_0073237 3300046674 Bacteria 1783
946 Ga0495588_0120965 3300046674 Bacteria 1380
947 Ga0495657_0091606 3300046675 Bacteria 1949
948 Ga0495657_0789688 3300046675 Bacteria 543
949 Ga0495599_0060792 3300046678 Bacteria 2362
950 Ga0495599_0415426 3300046678 Bacteria 800
951 Ga0495623_0071142 3300046679 Bacteria 2165
952 Ga0495623_0674509 3300046679 Bacteria 531
953 Ga0495647_0300216 3300046681 Bacteria 724
954 Ga0495658_0010407 3300046683 Bacteria 4654
955 Ga0495658_0939970 3300046683 Bacteria 552
956 Ga0495669_0171418 3300046684 Bacteria 1032
957 Ga0495669_0201378 3300046684 Bacteria 951
958 Ga0495669_0205324 3300046684 Bacteria 942
959 Ga0495669_0277193 3300046684 Bacteria 806
960 Ga0495669_0629960 3300046684 Bacteria 521
961 Ga0495613_0109070 3300046689 Bacteria 1996
962 Ga0495613_0390683 3300046689 Bacteria 950
963 Ga0495624_0019628 3300046690 Bacteria 4508
964 Ga0495624_0235282 3300046690 Bacteria 1109
965 Ga0495670_0085054 3300046691 Bacteria 1614
966 Ga0495670_0097664 3300046691 Bacteria 1509
967 Ga0495670_0387931 3300046691 Bacteria 754
968 Ga0495671_0213271 3300046692 Bacteria 935
969 Ga0495671_0227131 3300046692 Bacteria 903
970 Ga0495671_0281844 3300046692 Bacteria 800
971 Ga0495671_0307717 3300046692 Bacteria 762
972 Ga0495671_0379050 3300046692 Bacteria 678
973 Ga0495671_0425340 3300046692 Bacteria 635
974 Ga0495649_0062122 3300046694 Bacteria 2008
975 Ga0495649_0223410 3300046694 Bacteria 973
976 Ga0495649_0306035 3300046694 Bacteria 808
977 Ga0495649_0518042 3300046694 Bacteria 592
978 Ga0495649_0648524 3300046694 Bacteria 519
979 Ga0495589_0011378 3300046794 Bacteria 4621
980 Ga0495589_0095519 3300046794 Bacteria 1442
981 Ga0495589_0123180 3300046794 Bacteria 1248
982 Ga0495589_0371791 3300046794 Bacteria 657
983 Ga0495589_0474871 3300046794 Bacteria 571
984 Ga0495600_0069308 3300046809 Bacteria 2305
985 Ga0495600_0833438 3300046809 Bacteria 548
986 Ga0495660_0216541 3300046810 Bacteria 905
987 Ga0495660_0453147 3300046810 Bacteria 554
988 Ga0495581_0011373 3300047315 Bacteria 5150
989 Ga0495581_0073400 3300047315 Bacteria 1980
990 Ga0495581_0077939 3300047315 Bacteria 1918
991 Ga0495604_0138184 3300047317 Bacteria 1744
992 Ga0495604_0180476 3300047317 Bacteria 1477
993 Ga0495636_0518154 3300047318 Bacteria 578
994 Ga0495636_0520336 3300047318 Bacteria 576
995 Ga0495674_0001989 3300047319 Bacteria 20095
996 Ga0495674_0114150 3300047319 Bacteria 2287
997 Ga0495674_0521353 3300047319 Bacteria 949
998 Ga0495674_1342913 3300047319 Bacteria 535
999 Ga0495672_0121391 3300047320 Bacteria 1388
1000 Ga0495672_0189891 3300047320 Bacteria 1034
1001 Ga0495676_0250239 3300047321 Bacteria 1209
1002 Ga0495676_0307204 3300047321 Bacteria 1068
1003 Ga0495676_0330065 3300047321 Bacteria 1023
1004 Ga0495676_0375024 3300047321 Bacteria 947
1005 Ga0495680_0028837 3300047322 Bacteria 4549
1006 Ga0495680_0329372 3300047322 Bacteria 1067
1007 Ga0495680_0533299 3300047322 Bacteria 793
1008 Ga0495683_0017557 3300047323 Bacteria 3708
1009 Ga0495683_0336560 3300047323 Bacteria 640
1010 Ga0495687_020352 3300047443 Bacteria 3234
1011 Ga0495675_0343313 3300047444 Bacteria 879
1012 Ga0495677_0132549 3300047445 Bacteria 954
1013 Ga0495677_0171566 3300047445 Bacteria 839
1014 Ga0495679_082617 3300047446 Bacteria 910
1015 Ga0495679_129092 3300047446 Bacteria 687
1016 Ga0495673_0132158 3300047469 Bacteria 980
1017 Ga0495673_0148558 3300047469 Bacteria 908
1018 Ga0495673_0259376 3300047469 Bacteria 632
1019 Ga0495673_0323495 3300047469 Bacteria 549
1020 Ga0495681_0273396 3300047470 Bacteria 661
1021 Ga0495684_0004921 3300047471 Bacteria 10429
1022 Ga0495684_0176305 3300047471 Bacteria 1587
1023 Ga0495686_0081319 3300047472 Bacteria 1979
1024 Ga0495686_0163246 3300047472 Bacteria 1300
1025 Ga0495686_0169662 3300047472 Bacteria 1270
1026 Ga0495686_0301112 3300047472 Bacteria 885
1027 Ga0495686_0558241 3300047472 Bacteria 597
1028 Ga0495593_0115467 3300047673 Bacteria 1368
1029 Ga0495602_0280084 3300048088 Bacteria 1229
1030 Ga0495602_0418278 3300048088 Bacteria 952
1031 Ga0495614_0203513 3300048089 Bacteria 896
1032 Ga0495615_0152132 3300048090 Bacteria 689
1033 Ga0495626_0095969 3300048091 Bacteria 1298
1034 Ga0495626_0440159 3300048091 Bacteria 501
1035 Ga0496100_0352046 3300048903 Bacteria 1112
1036 Ga0496100_0526155 3300048903 Bacteria 913
1037 Ga0496100_0916657 3300048903 Bacteria 688
1038 Ga0496100_1151080 3300048903 Bacteria 612
1039 Ga0496101_0052463 3300048904 Bacteria 2940
1040 Ga0496101_0560693 3300048904 Bacteria 903
1041 Ga0496101_0880246 3300048904 Bacteria 705
1042 Ga0496102_0003175 3300048905 Bacteria 13938
1043 Ga0496102_0351511 3300048905 Bacteria 1388
1044 Ga0496102_0994313 3300048905 Bacteria 759
1045 Ga0496102_1673601 3300048905 Bacteria 554
1046 Ga0496103_0024988 3300048906 Bacteria 3607
1047 Ga0496103_0466512 3300048906 Bacteria 809
1048 Ga0496103_0491165 3300048906 Bacteria 786
1049 Ga0496104_0054701 3300048907 Bacteria 3772
1050 Ga0496104_0071290 3300048907 Bacteria 3303
1051 Ga0496104_0167266 3300048907 Bacteria 2108
1052 Ga0496104_0559707 3300048907 Bacteria 1054
1053 Ga0496104_0933093 3300048907 Bacteria 773
1054 Ga0496105_0023165 3300048908 Bacteria 5035
1055 Ga0496105_0043187 3300048908 Bacteria 3717
1056 Ga0496105_0062157 3300048908 Bacteria 3082
1057 Ga0496105_0913986 3300048908 Bacteria 661
1058 Ga0496106_0039537 3300048909 Bacteria 3533
1059 Ga0496106_0435815 3300048909 Bacteria 1053
1060 Ga0496106_0492430 3300048909 Bacteria 985
1061 Ga0496106_0537320 3300048909 Bacteria 938
1062 Ga0496106_1481734 3300048909 Bacteria 522
1063 Ga0496107_0027047 3300048910 Bacteria 4072
1064 Ga0496107_0083697 3300048910 Bacteria 2327
1065 Ga0496107_0631163 3300048910 Bacteria 790
1066 Ga0496107_0998515 3300048910 Bacteria 607
1067 Ga0496108_0049151 3300048911 Bacteria 3528
1068 Ga0496108_0106154 3300048911 Bacteria 2398
1069 Ga0496108_0286660 3300048911 Bacteria 1434
1070 Ga0496108_0301255 3300048911 Bacteria 1396
1071 Ga0496108_1163312 3300048911 Bacteria 653
1072 Ga0496109_0025925 3300048912 Bacteria 5224
1073 Ga0496109_0060765 3300048912 Bacteria 3454
1074 Ga0496109_0432040 3300048912 Bacteria 1244
1075 Ga0496109_0634531 3300048912 Bacteria 1005
1076 Ga0496109_1047145 3300048912 Bacteria 753
1077 Ga0496109_1086224 3300048912 Bacteria 737
1078 Ga0496110_0038811 3300048913 Bacteria 4145
1079 Ga0496110_0069002 3300048913 Bacteria 3129
1080 Ga0496110_0523976 3300048913 Bacteria 1078
1081 Ga0496110_0747209 3300048913 Bacteria 881
1082 Ga0496111_0041412 3300048914 Bacteria 3305
1083 Ga0496111_0043022 3300048914 Bacteria 3245
1084 Ga0496111_0089098 3300048914 Bacteria 2260
1085 Ga0496111_1070947 3300048914 Bacteria 575
1086 Ga0496112_0000018 3300048915 Bacteria 188820
1087 Ga0496112_0001958 3300048915 Bacteria 16269
1088 Ga0496112_0173931 3300048915 Bacteria 2118
1089 Ga0496112_0357325 3300048915 Bacteria 1403
1090 Ga0496112_0455136 3300048915 Bacteria 1217
1091 Ga0496112_1666590 3300048915 Bacteria 550
1092 Ga0496113_0780927 3300048916 Bacteria 759
1093 Ga0496113_1180533 3300048916 Bacteria 598
1094 Ga0496113_1204054 3300048916 Bacteria 591
1095 Ga0496114_0034614 3300048917 Bacteria 4168
1096 Ga0496114_0039299 3300048917 Bacteria 3915
1097 Ga0496114_1335562 3300048917 Bacteria 604
1098 Ga0496115_0070966 3300048918 Bacteria 2824
1099 Ga0496115_0358527 3300048918 Bacteria 1188
1100 Ga0496115_0450856 3300048918 Bacteria 1039
1101 Ga0496115_1280224 3300048918 Bacteria 547
1102 Ga0496115_1449207 3300048918 Bacteria 505
1103 Ga0496116_0076148 3300048919 Bacteria 2103
1104 Ga0496116_0352428 3300048919 Bacteria 673
1105 Ga0496117_0022310 3300048920 Bacteria 5081
1106 Ga0496117_0067196 3300048920 Bacteria 2427
1107 Ga0496117_0378397 3300048920 Bacteria 722
1108 Ga0496118_0018395 3300048921 Bacteria 6308
1109 Ga0496118_0068579 3300048921 Bacteria 2575
1110 Ga0496118_0141924 3300048921 Bacteria 1520
1111 Ga0496119_0012507 3300048922 Bacteria 6886
1112 Ga0496119_0037823 3300048922 Bacteria 3128
1113 Ga0496119_0158132 3300048922 Bacteria 1208
1114 Ga0496119_0504467 3300048922 Bacteria 562
1115 Ga0496120_0143214 3300048923 Bacteria 1211
1116 Ga0496120_0222928 3300048923 Bacteria 900
1117 Ga0496121_0001046 3300048924 Bacteria 49319
1118 Ga0496121_0047732 3300048924 Bacteria 3650
1119 Ga0496121_0051267 3300048924 Bacteria 3477
1120 Ga0496121_0059293 3300048924 Bacteria 3157
1121 Ga0496121_0071614 3300048924 Bacteria 2787
1122 Ga0496121_0071682 3300048924 Bacteria 2785
1123 Ga0496121_0249867 3300048924 Bacteria 1230
1124 Ga0496121_0323593 3300048924 Bacteria 1037
1125 Ga0496121_0400013 3300048924 Bacteria 900
1126 Ga0496121_0573616 3300048924 Bacteria 701
1127 Ga0496122_0081810 3300048925 Bacteria 2246
1128 Ga0496122_0131235 3300048925 Bacteria 1591
1129 Ga0496122_0144541 3300048925 Bacteria 1481
1130 Ga0496123_0481154 3300048926 Bacteria 546
1131 Ga0496124_0013092 3300048927 Bacteria 8124
1132 Ga0496124_0022005 3300048927 Bacteria 5860
1133 Ga0496124_0281883 3300048927 Bacteria 1211
1134 Ga0496124_0318201 3300048927 Bacteria 1115
1135 Ga0496124_0827992 3300048927 Bacteria 570
1136 Ga0496125_0032864 3300048928 Bacteria 4602
1137 Ga0496125_0043837 3300048928 Bacteria 3791
1138 Ga0496125_0162034 3300048928 Bacteria 1517
1139 Ga0496125_0247778 3300048928 Bacteria 1126
1140 Ga0496126_0011825 3300048929 Bacteria 8981
1141 Ga0496126_0015601 3300048929 Bacteria 7634
1142 Ga0496126_0020176 3300048929 Bacteria 6540
1143 Ga0496126_0031303 3300048929 Bacteria 5029
1144 Ga0496126_0060458 3300048929 Bacteria 3407
1145 Ga0496126_0061824 3300048929 Bacteria 3362
1146 Ga0496126_0063195 3300048929 Bacteria 3319
1147 Ga0496126_0122996 3300048929 Bacteria 2248
1148 Ga0496126_0182744 3300048929 Bacteria 1780
1149 Ga0496126_0231407 3300048929 Bacteria 1548
1150 Ga0496126_0430252 3300048929 Bacteria 1065
1151 Ga0496126_0518849 3300048929 Bacteria 950
1152 Ga0496126_0944773 3300048929 Bacteria 651
1153 Ga0496126_0950196 3300048929 Bacteria 648
1154 Ga0495678_188501 3300049459 Bacteria 642
1155 Ga0495678_218048 3300049459 Bacteria 580
1156 Ga0495682_0006058 3300049460 Bacteria 4932
1157 Ga0501031_1072633 3300049568 Bacteria 514
1158 Ga0501033_0206964 3300049570 Bacteria 1400
1159 Ga0501034_0354444 3300049571 Bacteria 1395
1160 Ga0501036_0234466 3300049572 Bacteria 1540
1161 Ga0501036_0579441 3300049572 Bacteria 932
1162 Ga0501039_1507062 3300049575 Bacteria 517
1163 Ga0501046_0044071 3300049580 Bacteria 3549
1164 Ga0501047_0036466 3300049581 Bacteria 4752
1165 Ga0501048_0277370 3300049582 Bacteria 1192
1166 Ga0501067_0051257 3300049583 Bacteria 2288
1167 Ga0501067_0083249 3300049583 Bacteria 1775
1168 Ga0501069_0207786 3300049585 Bacteria 1136
1169 Ga0501070_0602816 3300049586 Bacteria 875
1170 Ga0501073_0043738 3300049589 Bacteria 3158
1171 Ga0501073_0621624 3300049589 Bacteria 746
1172 Ga0501074_0203085 3300049590 Bacteria 1412
1173 Ga0501080_0004617 3300049742 Bacteria 12269
1174 Ga0501080_0077138 3300049742 Bacteria 3099
1175 Ga0501083_0000632 3300049744 Bacteria 22782
1176 Ga0501083_1124227 3300049744 Bacteria 511
1177 Ga0501044_0022102 3300049823 Bacteria 6783
1178 Ga0501044_0039142 3300049823 Bacteria 4947
1179 Ga0501044_0896085 3300049823 Bacteria 762
1180 nmdc:mga03683_187787_c1 3300050489 Bacteria 945
1181 nmdc:mga03683_2734_c1 3300050489 Bacteria 5532
1182 nmdc:mga03683_457893_c1 3300050489 Bacteria 614
1183 nmdc:mga03683_63046_c2 3300050489 Bacteria 1258
1184 nmdc:mga03683_672932_c1 3300050489 Bacteria 511
1185 nmdc:mga03n38_193888_c1 3300050490 Bacteria 1048
1186 nmdc:mga03n38_54633_c1 3300050490 Bacteria 1796
1187 nmdc:mga03n38_64485_c1 3300050490 Bacteria 1677
1188 nmdc:mga03n38_769283_c1 3300050490 Bacteria 559
1189 nmdc:mga00v17_136770_c1 3300050491 Bacteria 1569
1190 nmdc:mga00v17_155235_c1 3300050491 Bacteria 1472
1191 nmdc:mga00v17_170831_c1 3300050491 Bacteria 1402
1192 nmdc:mga00v17_239999_c1 3300050491 Bacteria 1175
1193 nmdc:mga0yw44_147116_c1 3300050492 Bacteria 1535
1194 nmdc:mga0yw44_94650_c1 3300050492 Bacteria 1894
1195 nmdc:mga0k408_17656_c1 3300050493 Bacteria 2771
1196 nmdc:mga0k408_23559_c1 3300050493 Bacteria 3475
1197 nmdc:mga0k408_29709_c1 3300050493 Bacteria 3113
1198 nmdc:mga0k408_4373_c1 3300050493 Bacteria 7499
1199 nmdc:mga0k408_626141_c1 3300050493 Bacteria 634
1200 nmdc:mga0k408_7136_c1 3300050493 Bacteria 5970
1201 nmdc:mga06z11_14951_c1 3300050494 Bacteria 3452
1202 nmdc:mga06z11_188765_c1 3300050494 Bacteria 1192
1203 nmdc:mga06z11_242167_c1 3300050494 Bacteria 1060
1204 nmdc:mga06z11_302132_c1 3300050494 Bacteria 952
1205 nmdc:mga06z11_842591_c1 3300050494 Bacteria 559
1206 nmdc:mga06z11_97371_c1 3300050494 Bacteria 1608
1207 nmdc:mga04h51_43506_c1 3300050495 Bacteria 1478
1208 nmdc:mga07m45_141055_c1 3300050496 Bacteria 1396
1209 nmdc:mga07m45_150986_c1 3300050496 Bacteria 1347
1210 nmdc:mga07m45_34912_c1 3300050496 Bacteria 2796
1211 nmdc:mga07m45_397757_c1 3300050496 Bacteria 800
1212 nmdc:mga07m45_616766_c1 3300050496 Bacteria 626
1213 nmdc:mga07m45_63917_c1 3300050496 Bacteria 2088
1214 nmdc:mga05p37_2115491_c1 3300050507 Bacteria 527
1215 nmdc:mga05p37_962769_c1 3300050507 Bacteria 912
1216 nmdc:mga08y16_1792193_c1 3300050511 Bacteria 567
1217 nmdc:mga0n895_361327_c1 3300050512 Bacteria 1470
1218 nmdc:mga0n895_63525_c1 3300050512 Bacteria 3651
1219 nmdc:mga0n895_66805_c1 3300050512 Bacteria 3560
1220 nmdc:mga0rr50_200099_c1 3300050513 Bacteria 1641
1221 nmdc:mga0rr50_368928_c1 3300050513 Bacteria 1209
1222 nmdc:mga08x19_1118757_c1 3300050514 Bacteria 559
1223 nmdc:mga08x19_89222_c1 3300050514 Bacteria 1096
1224 nmdc:mga0a205_503770_c1 3300050515 Bacteria 1067
1225 nmdc:mga0sz30_233865_c1 3300050516 Bacteria 818
1226 nmdc:mga0sz30_35554_c1 3300050516 Bacteria 874
1227 nmdc:mga0sz30_45811_c1 3300050516 Bacteria 1845
1228 nmdc:mga0sz30_47732_c1 3300050516 Bacteria 1810
1229 nmdc:mga0sz30_89167_c1 3300050516 Bacteria 1341
1230 Ga0495601_0000314 3300053077 Bacteria 25703
1231 Ga0495601_0026148 3300053077 Bacteria 3602
1232 Ga0495612_0025187 3300053078 Bacteria 2389
1233 Ga0495612_0047401 3300053078 Bacteria 1761
1234 Ga0495612_0343866 3300053078 Bacteria 673
1235 Ga0500635_0112271 3300053080 Bacteria 1013
1236 Ga0500635_0196002 3300053080 Bacteria 784
1237 Ga0495655_0033945 3300053083 Bacteria 1259
1238 Ga0495655_0052353 3300053083 Bacteria 1085
1239 Ga0495655_0119009 3300053083 Bacteria 802
1240 Ga0495655_0322488 3300053083 Bacteria 535
1241 Ga0495619_0001337 3300053085 Bacteria 16150
1242 Ga0495619_0345653 3300053085 Bacteria 1029
1243 Ga0495619_1187970 3300053085 Bacteria 505
1244 Ga0500578_0177698 3300053086 Bacteria 1313
1245 Ga0500578_0246355 3300053086 Bacteria 1078
1246 Ga0500578_0362677 3300053086 Bacteria 844
1247 Ga0500643_050691 3300053087 Bacteria 1187
1248 Ga0500644_0228380 3300053088 Bacteria 778
1249 Ga0500646_0013502 3300053090 Bacteria 2114
1250 Ga0500646_0046263 3300053090 Bacteria 1241
1251 Ga0500646_0097416 3300053090 Bacteria 919
1252 Ga0500646_0322521 3300053090 Bacteria 558
1253 Ga0500646_0366957 3300053090 Bacteria 527
1254 Ga0500647_0033748 3300053091 Bacteria 2442
1255 Ga0500647_0337116 3300053091 Bacteria 632
1256 Ga0500647_0429657 3300053091 Bacteria 528
1257 Ga0500583_0362710 3300053092 Bacteria 700
1258 Ga0500651_0064955 3300053093 Bacteria 2275
1259 Ga0500566_0000191 3300053094 Bacteria 31941
1260 Ga0500566_0013266 3300053094 Bacteria 4853
1261 Ga0500566_0132105 3300053094 Bacteria 1334
1262 Ga0500566_0165307 3300053094 Bacteria 1149
1263 Ga0500566_0179786 3300053094 Bacteria 1086
1264 Ga0500640_000328 3300053095 Bacteria 10942
1265 Ga0500641_0022750 3300053096 Bacteria 2404
1266 Ga0500641_0150043 3300053096 Bacteria 1006
1267 Ga0500641_0203834 3300053096 Bacteria 843
1268 Ga0500648_180438 3300053097 Bacteria 1087
1269 Ga0500648_352558 3300053097 Bacteria 599
1270 Ga0500650_0001278 3300053098 Bacteria 7435
1271 Ga0500654_122720 3300053099 Bacteria 1015
1272 Ga0500554_048990 3300053102 Bacteria 1323
1273 Ga0500555_167427 3300053103 Bacteria 534
1274 Ga0500556_0000095 3300053104 Bacteria 82300
1275 Ga0500556_0142750 3300053104 Bacteria 942
1276 Ga0500558_277070 3300053106 Bacteria 536
1277 Ga0500562_106402 3300053108 Bacteria 764
1278 Ga0500562_164934 3300053108 Bacteria 602
1279 Ga0500569_040695 3300053109 Bacteria 1360
1280 Ga0500569_315674 3300053109 Bacteria 524
1281 Ga0500572_000153 3300053111 Bacteria 23968
1282 Ga0500572_000739 3300053111 Bacteria 10541
1283 Ga0500591_222088 3300053115 Bacteria 623
1284 Ga0500592_019178 3300053116 Bacteria 1098
1285 Ga0500593_084377 3300053117 Bacteria 1354
1286 Ga0500594_0020980 3300053118 Bacteria 1634
1287 Ga0500594_0077410 3300053118 Bacteria 989
1288 Ga0500595_000863 3300053119 Bacteria 17312
1289 Ga0500595_015387 3300053119 Bacteria 2874
1290 Ga0500595_016281 3300053119 Bacteria 2773
1291 Ga0500595_231862 3300053119 Bacteria 506
1292 Ga0500608_092904 3300053122 Bacteria 1408
1293 Ga0500614_007288 3300053123 Bacteria 2330
1294 Ga0500628_191896 3300053129 Bacteria 587
1295 Ga0500642_0247733 3300053130 Bacteria 819
1296 Ga0500642_0325251 3300053130 Bacteria 688
1297 Ga0500655_002239 3300053133 Bacteria 3553
1298 Ga0500655_113949 3300053133 Bacteria 571
1299 Ga0500658_0234229 3300053134 Bacteria 843
1300 Ga0500658_0289686 3300053134 Bacteria 752
1301 Ga0500559_0000299 3300053136 Bacteria 38041
1302 Ga0500559_0000585 3300053136 Bacteria 24994
1303 Ga0500559_0010824 3300053136 Bacteria 3911
1304 Ga0500559_0017076 3300053136 Bacteria 3065
1305 Ga0500559_0117444 3300053136 Bacteria 1235
1306 Ga0500561_0158082 3300053137 Bacteria 707
1307 Ga0500568_0026201 3300053139 Bacteria 2449
1308 Ga0500568_0073513 3300053139 Bacteria 1306
1309 Ga0500568_0078005 3300053139 Bacteria 1260
1310 Ga0500573_0308853 3300053140 Bacteria 786
1311 Ga0500577_0318774 3300053142 Bacteria 679
1312 Ga0500577_0327468 3300053142 Bacteria 669
1313 Ga0500588_0230347 3300053146 Bacteria 692
1314 Ga0500589_031633 3300053147 Bacteria 2466
1315 Ga0500590_201570 3300053148 Bacteria 841
1316 Ga0500603_001431 3300053150 Bacteria 5452
1317 Ga0500603_090077 3300053150 Bacteria 900
1318 Ga0500604_0048410 3300053151 Bacteria 1305
1319 Ga0500616_0045212 3300053153 Bacteria 2347
1320 Ga0500616_0395270 3300053153 Bacteria 553
1321 Ga0500622_0000791 3300053156 Bacteria 27348
1322 Ga0500622_0065143 3300053156 Bacteria 1852
1323 Ga0500622_0244066 3300053156 Bacteria 792
1324 Ga0500630_003340 3300053159 Bacteria 7775
1325 Ga0500633_0311366 3300053160 Bacteria 578
1326 Ga0500634_0153385 3300053161 Bacteria 1073
1327 Ga0500634_0407464 3300053161 Bacteria 500
1328 Ga0500638_090362 3300053162 Bacteria 1442
1329 Ga0500638_170194 3300053162 Bacteria 949
1330 Ga0500639_000477 3300053163 Bacteria 19965
1331 Ga0500639_004935 3300053163 Bacteria 6799
1332 Ga0500639_049860 3300053163 Bacteria 2183
1333 Ga0500636_0436409 3300053177 Bacteria 596
1334 Ga0500637_0003263 3300053178 Bacteria 7448
1335 Ga0500637_0030501 3300053178 Bacteria 3001
1336 Ga0500637_0174840 3300053178 Bacteria 1232
1337 Ga0500567_251040 3300053723 Bacteria 525
1338 Ga0500570_225740 3300053724 Bacteria 529
1339 Ga0500576_022052 3300053725 Bacteria 2907
1340 Ga0500611_086488 3300053727 Bacteria 791
1341 Ga0500657_164981 3300053728 Bacteria 796
1342 Ga0500645_086458 3300053730 Bacteria 892
1343 Ga0500609_049086 3300053731 Bacteria 586
1344 Ga0500656_040579 3300053732 Bacteria 650
1345 Ga0500552_003598 3300053733 Bacteria 1584
1346 Ga0500596_001682 3300053735 Bacteria 4476
1347 Ga0500596_002529 3300053735 Bacteria 3598
1348 Ga0500596_008742 3300053735 Bacteria 1607
1349 Ga0500661_007864 3300055283 Bacteria 1966
1350 Ga0587084_083580 3300059477 Bacteria 622
1351 Ga0587066_118947 3300059490 Bacteria 622
1352 Ga0587073_0176763 3300059492 Bacteria 624
1353 Ga0587080_030213 3300059503 Bacteria 940
1354 Ga0587088_207040 3300059508 Bacteria 504
1355 Ga0587099_067117 3300059622 Bacteria 504
1356 Ga0587076_173006 3300059645 Bacteria 539
1357 Ga0587111_0260638 3300060346 Bacteria 516
1358 Ga0466962_0022598 3300061719 Bacteria 3023
1359 Ga0466962_0256782 3300061719 Bacteria 859
1360 2597870970 2597489889 Bacteria 6297495
1361 2958174469 2958172287 Bacteria 6716688
1362 2977978113 2977971508 Bacteria 7472917
1363 Ga0500597_123447
1364 CNAas_1005504
1365 JGI24743J22301_10086017
1366 JGI24750J21931_1011860
1367 JGI24744J21845_10006633
1368 JGI24034J26672_10020487
1369 JGI24034J26672_10069191
1370 JGI25165J46597_1019402
1371 JGI25153J46596_10002140
1372 JGI25153J46596_10010090
1373 Ga0006770J48903_1004135
1374 rootL2_10016153
1375 Ga0006781J51513_1004215
1376 Ga0007410J51695_1002477
1377 JGI25404J52841_10001052
1378 JGI25404J52841_10009090
1379 JGI25404J52841_10015398
1380 JGI25404J52841_10018605
1381 Ga0032354_1008942
1382 Ga0006780_1003591
1383 Ga0055542_1005196
1384 Ga0055529_1008414
1385 JGI25405J52794_10024077
1386 Ga0065707_10356582
1387 Ga0070658_10157810
1388 Ga0070676_10107280
1389 Ga0070676_10578773
1390 Ga0070690_100014486
1391 Ga0070690_100054344
1392 Ga0070690_100747517
1393 Ga0070670_100234379
1394 Ga0070670_101023685
1395 Ga0070677_10249176
1396 Ga0068869_100591799
1397 Ga0068869_101174875
1398 Ga0070666_10255579
1399 Ga0070666_10556109
1400 Ga0070682_100257297
1401 Ga0068868_100261488
1402 Ga0068868_102055195
1403 Ga0070660_101374600
1404 Ga0070689_100011365
1405 Ga0070689_100083460
1406 Ga0070689_100264441
1407 Ga0070687_100037609
1408 Ga0070687_100053260
1409 Ga0070687_101411732
1410 Ga0070661_100516182
1411 Ga0070661_100516592
1412 Ga0070661_100645552
1413 Ga0070668_100187942
1414 Ga0070668_100328393
1415 Ga0070668_100389669
1416 Ga0070668_101390894
1417 Ga0070669_100079992
1418 Ga0070669_100482785
1419 Ga0070669_100514859
1420 Ga0070669_101757113
1421 Ga0070675_100879531
1422 Ga0070675_100978501
1423 Ga0070675_101199172
1424 Ga0070671_100051030
1425 Ga0070671_100663275
1426 Ga0070674_100049075
1427 Ga0070674_100052380
1428 Ga0070674_100053108
1429 Ga0070673_100250143
1430 Ga0070673_100379664
1431 Ga0070673_100978995
1432 Ga0070673_102083664
1433 Ga0070688_100072863
1434 Ga0070688_100250587
1435 Ga0070688_100631611
1436 Ga0070659_100443214
1437 Ga0070659_100966432
1438 Ga0070709_10033715
1439 Ga0070709_10034132
1440 Ga0070709_10469603
1441 Ga0070709_10710111
1442 Ga0070714_100089521
1443 Ga0070714_100430685
1444 Ga0070714_100664872
1445 Ga0070713_100155707
1446 Ga0070713_100160496
1447 Ga0070713_102291936
1448 Ga0070710_10010559
1449 Ga0070710_10104521
1450 Ga0070710_11137971
1451 Ga0070701_10384208
1452 Ga0070711_100016594
1453 Ga0070711_100406876
1454 Ga0070711_100421601
1455 Ga0070711_100664720
1456 Ga0070711_100987821
1457 Ga0070700_100410564
1458 Ga0070700_100990340
1459 Ga0070663_100265137
1460 Ga0070663_100504600
1461 Ga0070678_100085821
1462 Ga0070678_100631505
1463 Ga0070662_100234813
1464 Ga0070662_100379096
1465 Ga0070681_11091239
1466 Ga0068867_101092874
1467 Ga0070685_10300257
1468 Ga0070685_10884137
1469 Ga0070706_100100870
1470 Ga0070706_100664098
1471 Ga0070707_100593921
1472 Ga0070707_101447140
1473 Ga0070679_100153277
1474 Ga0070679_100949472
1475 Ga0070684_101348708
1476 Ga0070684_101914088
1477 Ga0068853_100744429
1478 Ga0068853_101716085
1479 Ga0070672_100057945
1480 Ga0070672_100157323
1481 Ga0070672_100201470
1482 Ga0070672_100568605
1483 Ga0070686_100178843
1484 Ga0070686_100637421
1485 Ga0070686_101622692
1486 Ga0070696_100190361
1487 Ga0070693_100340709
1488 Ga0070665_100038049
1489 Ga0070665_101649369
1490 Ga0070665_101759330
1491 Ga0070665_101873722
1492 Ga0068855_100797846
1493 Ga0068855_100929282
1494 Ga0070664_101454186
1495 Ga0068856_101441545
1496 Ga0070702_100032604
1497 Ga0070702_101013622
1498 Ga0068852_100292799
1499 Ga0068852_101473584
1500 Ga0068859_100247315
1501 Ga0068859_100667255
1502 Ga0068859_100708856
1503 Ga0068859_102402636
1504 Ga0068864_100020725
1505 Ga0068864_100169431
1506 Ga0068864_100191178
1507 Ga0068866_10063718
1508 Ga0068861_101284597
1509 Ga0068870_10253508
1510 Ga0068870_10279786
1511 Ga0068870_11160387
1512 Ga0068863_100193114
1513 Ga0068863_100536184
1514 Ga0068863_102307007
1515 Ga0068858_100107762
1516 Ga0068858_100214665
1517 Ga0068858_100397031
1518 Ga0068858_100752517
1519 Ga0068858_102586847
1520 Ga0068860_100131677
1521 Ga0068860_100139914
1522 Ga0068860_100262185
1523 Ga0068860_100411374
1524 Ga0068860_100973313
1525 Ga0068862_100157171
1526 Ga0068862_100298871
1527 Ga0068862_100760387
1528 Ga0068862_101215412
1529 Ga0068862_101982150
1530 Ga0081455_10016563
1531 Ga0081455_10033402
1532 Ga0081455_10034075
1533 Ga0081455_10128955
1534 Ga0081455_10138410
1535 Ga0081540_1002643
1536 Ga0081540_1003668
1537 Ga0081540_1004247
1538 Ga0081540_1018838
1539 Ga0081540_1031583
1540 Ga0081540_1046731
1541 Ga0081540_1311851
1542 Ga0081539_10394090
1543 Ga0070717_10217896
1544 Ga0070717_10346302
1545 Ga0070717_10887499
1546 Ga0070717_10890872
1547 Ga0075368_10198096
1548 Ga0075363_100128500
1549 Ga0075364_10044125
1550 Ga0075364_10585543
1551 Ga0075364_10943362
1552 Ga0075432_10235375
1553 Ga0075432_10368483
1554 Ga0070715_10015272
1555 Ga0070715_10127212
1556 Ga0070715_10249100
1557 Ga0070715_10982275
1558 Ga0070716_100030610
1559 Ga0070716_100095755
1560 Ga0070716_100292627
1561 Ga0070716_100515859
1562 Ga0070716_100655020
1563 Ga0070712_100030217
1564 Ga0070712_100212042
1565 Ga0070712_101487919
1566 Ga0075362_10002782
1567 Ga0075362_10157715
1568 Ga0075362_10489714
1569 Ga0075367_10108434
1570 Ga0075367_10116266
1571 Ga0075367_10365758
1572 Ga0075367_10433306
1573 Ga0075369_10095943
1574 Ga0075369_10169370
1575 Ga0075369_10233015
1576 Ga0075366_10001525
1577 Ga0075366_10004076
1578 Ga0075366_10038714
1579 Ga0075366_10857394
1580 Ga0097621_100195892
1581 Ga0097621_100679345
1582 Ga0097621_101036947
1583 Ga0097621_101991136
1584 Ga0075370_10154131
1585 Ga0075370_10534298
1586 Ga0075370_10706601
1587 Ga0068871_100106807
1588 Ga0068871_100524455
1589 Ga0068871_101062978
1590 Ga0068871_102384835
1591 Ga0075434_100061863
1592 Ga0075434_100068500
1593 Ga0075434_102166881
1594 Ga0075429_100063803
1595 Ga0075429_101517559
1596 Ga0068865_100077349
1597 Ga0068865_100394881
1598 Ga0068865_100674376
1599 Ga0068865_100907474
1600 Ga0068865_100993456
1601 Ga0075436_100984401
1602 Ga0075436_101550072
1603 Ga0097620_100247314
1604 Ga0097620_100667226
1605 Ga0097620_100708887
1606 Ga0097620_102403042
1607 Ga0075435_100356738
1608 Ga0075435_101694169
1609 Ga0099794_10064167
1610 Ga0099795_10168008
1611 Ga0105251_10370334
1612 Ga0105250_10126450
1613 Ga0105240_11943134
1614 Ga0105240_12013630
1615 Ga0111539_11052666
1616 Ga0105245_10868807
1617 Ga0105245_12359647
1618 Ga0105247_10676972
1619 Ga0105247_11048369
1620 Ga0105247_11699887
1621 Ga0114129_10964522
1622 Ga0114129_11223890
1623 Ga0105243_11044250
1624 Ga0105241_11138202
1625 Ga0105248_10356682
1626 Ga0105248_10452532
1627 Ga0105248_10968511
1628 Ga0105237_11343131
1629 Ga0105237_12057461
1630 Ga0105237_12749559
1631 Ga0105238_11692532
1632 Ga0105249_10092872
1633 Ga0105249_10254004
1634 Ga0105249_12117931
1635 Ga0099796_10467188
1636 Ga0105239_10063157
1637 Ga0105239_10128151
1638 Ga0105246_10120796
1639 Ga0105246_11347508
1640 Ga0105246_12015610
1641 Ga0105246_12522602
1642 Ga0157335_1048709
1643 Ga0157373_10525021
1644 Ga0157370_10099255
1645 Ga0157370_10099681
1646 Ga0157369_10856514
1647 Ga0157378_10528327
1648 Ga0157378_10983944
1649 Ga0163162_10425135
1650 Ga0163162_10628412
1651 Ga0163162_11071737
1652 Ga0163162_12867969
1653 Ga0157375_10618797
1654 Ga0163163_10663280
1655 Ga0163163_11015510
1656 Ga0163163_11956756
1657 Ga0157380_10055433
1658 Ga0157380_11334648
1659 Ga0157380_12549546
1660 Ga0157377_10739326
1661 Ga0157377_10749698
1662 Ga0157377_11159841
1663 Ga0163161_10120658
1664 Ga0163161_10258850
1665 Ga0163161_10886438
1666 Ga0163161_12048601
1667 Ga0184601_131220
1668 Ga0184603_138419
1669 Ga0206354_10020402
1670 Ga0206353_10880577
1671 Ga0213872_10111441
1672 Ga0213874_10053869
1673 Ga0213876_10289419
1674 Ga0213871_10019928
1675 Ga0213871_10111906
1676 Ga0213871_10250519
1677 Ga0224712_10609470
1678 Ga0209148_1000321
1679 Ga0209148_1023478
1680 Ga0209233_1040885
1681 Ga0209455_1013823
1682 Ga0209758_1000125
1683 Ga0209257_1019362
1684 Ga0209257_1061004
1685 Ga0207697_10009193
1686 Ga0207697_10080726
1687 Ga0207697_10139319
1688 Ga0207697_10303717
1689 Ga0207696_1154997
1690 Ga0207682_10129393
1691 Ga0207692_10300699
1692 Ga0207692_10514247
1693 Ga0207642_10073056
1694 Ga0207642_10315562
1695 Ga0207710_10035362
1696 Ga0207710_10148135
1697 Ga0207710_10285129
1698 Ga0207710_10426037
1699 Ga0207688_10023915
1700 Ga0207688_10080700
1701 Ga0207688_10468030
1702 Ga0207680_10087821
1703 Ga0207680_10842590
1704 Ga0207647_10005715
1705 Ga0207647_10284961
1706 Ga0207685_10119165
1707 Ga0207685_10216717
1708 Ga0207685_10312379
1709 Ga0207685_10497118
1710 Ga0207685_10664504
1711 Ga0207699_10031047
1712 Ga0207699_10051570
1713 Ga0207699_10161118
1714 Ga0207699_10340964
1715 Ga0207699_11239545
1716 Ga0207645_10107331
1717 Ga0207645_10111597
1718 Ga0207645_10328763
1719 Ga0207643_10200467
1720 Ga0207643_10474128
1721 Ga0207643_10856882
1722 Ga0207705_10006176
1723 Ga0207705_10391858
1724 Ga0207705_11331398
1725 Ga0207654_10083868
1726 Ga0207654_10617362
1727 Ga0207654_10809271
1728 Ga0207707_10062398
1729 Ga0207707_10446309
1730 Ga0207707_10558665
1731 Ga0207707_11070227
1732 Ga0207695_10064554
1733 Ga0207671_10381398
1734 Ga0207671_10502612
1735 Ga0207693_10025189
1736 Ga0207693_10122936
1737 Ga0207693_10545068
1738 Ga0207693_10679029
1739 Ga0207663_10037777
1740 Ga0207663_10063664
1741 Ga0207663_10165842
1742 Ga0207663_10507754
1743 Ga0207660_10477251
1744 Ga0207660_10909211
1745 Ga0207662_10037298
1746 Ga0207662_10047231
1747 Ga0207657_10085109
1748 Ga0207649_10298290
1749 Ga0207649_11420749
1750 Ga0207652_10083761
1751 Ga0207652_10216561
1752 Ga0207652_10818039
1753 Ga0207646_10840462
1754 Ga0207646_11079106
1755 Ga0207681_10240383
1756 Ga0207681_10331355
1757 Ga0207681_10382988
1758 Ga0207681_11712390
1759 Ga0207694_10266182
1760 Ga0207694_10770924
1761 Ga0207694_11129973
1762 Ga0207694_11263972
1763 Ga0207694_11881292
1764 Ga0207650_10100767
1765 Ga0207650_10424851
1766 Ga0207687_10369567
1767 Ga0207687_10651144
1768 Ga0207687_11003745
1769 Ga0207687_11835544
1770 Ga0207700_10335534
1771 Ga0207700_10382401
1772 Ga0207700_10487522
1773 Ga0207700_11328170
1774 Ga0207664_10304558
1775 Ga0207664_10644234
1776 Ga0207664_10678835
1777 Ga0207664_10996599
1778 Ga0207644_10028196
1779 Ga0207644_10033032
1780 Ga0207644_10574517
1781 Ga0207690_10117745
1782 Ga0207690_10212144
1783 Ga0207690_10625745
1784 Ga0207690_11047547
1785 Ga0207706_10023343
1786 Ga0207706_10484330
1787 Ga0207706_11677108
1788 Ga0207686_10548650
1789 Ga0207686_10586208
1790 Ga0207709_10023999
1791 Ga0207709_10076702
1792 Ga0207709_11212929
1793 Ga0207670_10005994
1794 Ga0207670_10145887
1795 Ga0207670_11734092
1796 Ga0207669_10030512
1797 Ga0207669_10053059
1798 Ga0207669_10192846
1799 Ga0207704_10025389
1800 Ga0207704_10710298
1801 Ga0207704_10783637
1802 Ga0207665_10047516
1803 Ga0207665_10047757
1804 Ga0207665_10066144
1805 Ga0207665_10265159
1806 Ga0207665_11668762
1807 Ga0207691_10035922
1808 Ga0207691_10401236
1809 Ga0207711_10016693
1810 Ga0207711_10143470
1811 Ga0207711_10239269
1812 Ga0207711_10866919
1813 Ga0207711_11041230
1814 Ga0207711_11352534
1815 Ga0207689_10171637
1816 Ga0207661_11117637
1817 Ga0207661_11460317
1818 Ga0207679_10452684
1819 Ga0207679_10803813
1820 Ga0207667_10014848
1821 Ga0207667_10071501
1822 Ga0207667_11391231
1823 Ga0207651_10163981
1824 Ga0207651_10366380
1825 Ga0207651_11659424
1826 Ga0207712_10238461
1827 Ga0207712_10386705
1828 Ga0207712_12054090
1829 Ga0207668_10153748
1830 Ga0207668_10174207
1831 Ga0207668_10363426
1832 Ga0207668_10455826
1833 Ga0207668_11208169
1834 Ga0207668_11221144
1835 Ga0207640_10656639
1836 Ga0207640_11151240
1837 Ga0207658_10244476
1838 Ga0207658_10355121
1839 Ga0207658_10390143
1840 Ga0207658_11140289
1841 Ga0207677_11237551
1842 Ga0207703_10072639
1843 Ga0207703_10075818
1844 Ga0207703_10155570
1845 Ga0207703_10167619
1846 Ga0207703_10184041
1847 Ga0207703_10389005
1848 Ga0207703_10608713
1849 Ga0207639_10262761
1850 Ga0207639_10358711
1851 Ga0207639_10573109
1852 Ga0207639_11639258
1853 Ga0207639_12068842
1854 Ga0207678_10047576
1855 Ga0207678_10225478
1856 Ga0207678_10471182
1857 Ga0207678_10959460
1858 Ga0207678_11159352
1859 Ga0207708_10461568
1860 Ga0207708_11384615
1861 Ga0207708_11796022
1862 Ga0207702_10886797
1863 Ga0207641_10035550
1864 Ga0207641_10588416
1865 Ga0207641_10749434
1866 Ga0207648_10083791
1867 Ga0207648_10418801
1868 Ga0207648_11445595
1869 Ga0207676_10068801
1870 Ga0207676_10127756
1871 Ga0207676_10566587
1872 Ga0207676_11068980
1873 Ga0207674_10070190
1874 Ga0207674_10184205
1875 Ga0207674_10926646
1876 Ga0207674_11021541
1877 Ga0207675_100218465
1878 Ga0207675_100231001
1879 Ga0207675_101346384
1880 Ga0207675_102686508
1881 Ga0207683_10028565
1882 Ga0207683_10039006
1883 Ga0207683_10119501
1884 Ga0207683_10350591
1885 Ga0207683_10822902
1886 Ga0207698_10789617
1887 Ga0207698_12045752
1888 Ga0209389_1000034
1889 Ga0209589_1000038
1890 Ga0209489_100023
1891 Ga0209179_1105220
1892 Ga0209813_10036432
1893 Ga0268266_10006418
1894 Ga0268266_10475495
1895 Ga0268266_11163683
1896 Ga0268266_11165076
1897 Ga0268266_11516329
1898 Ga0268266_12081840
1899 Ga0268265_10080420
1900 Ga0268265_10219493
1901 Ga0268265_10343317
1902 Ga0268265_10593419
1903 Ga0268265_11426959
1904 Ga0268264_10000194
1905 Ga0268264_10172181
1906 Ga0268264_10391927
1907 Ga0268264_10421011
1908 Ga0268264_10724720
1909 Ga0268264_12165850
1910 Ga0265319_1080633
1911 Ga0265334_10278992
1912 Ga0265318_10044086
1913 Ga0265323_10000720
1914 Ga0265336_10000640
1915 Ga0307517_10468816
1916 Ga0307517_10509457
1917 Ga0307515_10711495
1918 Ga0265338_10001434
1919 Ga0265338_10561380
1920 Ga0265324_10001605
1921 Ga0265762_1043916
1922 Ga0265762_1093671
1923 Ga0265762_1131184
1924 Ga0265775_102827
1925 Ga0265767_106021
1926 Ga0265777_114020
1927 Ga0265769_121512
1928 Ga0265771_1032895
1929 Ga0265760_10129268
1930 Ga0265325_10000126
1931 Ga0265325_10000470
1932 Ga0265325_10093811
1933 Ga0265340_10095479
1934 Ga0265339_10172626
1935 Ga0265339_10322841
1936 Ga0265327_10120506
1937 Ga0265327_10509724
1938 Ga0265316_10196971
1939 Ga0307513_10276584
1940 Ga0307509_10947770
1941 Ga0310117_121285
1942 Ga0307508_10278611
1943 Ga0307508_10316059
1944 Ga0265314_10017036
1945 Ga0265342_10089626
1946 Ga0265342_10491021
1947 Ga0307406_10942930
1948 Ga0307407_10357590
1949 Ga0307409_101208794
1950 Ga0307409_101541459
1951 Ga0307416_101374241
1952 Ga0307416_101598931
1953 Ga0307416_102314245
1954 Ga0307414_10405696
1955 Ga0307414_11592044
1956 Ga0307411_10057196
1957 Ga0307415_100385194
1958 Ga0307507_10325907
1959 Ga0373948_0205085
1960 Ga0373938_0044796
1961 Ga0373926_0028112
1962 Ga0373926_0423326
1963 Ga0373926_0454273
1964 Ga0373929_0033882
1965 Ga0373934_0020498
1966 Ga0373944_0049719
1967 Ga0373949_0017442
1968 Ga0373949_0129113
1969 Ga0373952_0012840
1970 Ga0373952_0051555
1971 Ga0373952_0170343
1972 Ga0373923_0004214
1973 Ga0373932_0015356
1974 Ga0373932_0038954
1975 Ga0373932_0156678
1976 Ga0373936_0018243
1977 Ga0373936_0042601
1978 Ga0373936_0457532
1979 Ga0373939_0082617
1980 Ga0373939_0400481
1981 Ga0373945_0015924
1982 Ga0373945_0053511
1983 Ga0373953_0029700
1984 Ga0373954_0040683
1985 Ga0373956_0129241
1986 Ga0373957_0063649
1987 Ga0373943_0094530
1988 Ga0373943_0295351
1989 Ga0373946_0041154
1990 Ga0373946_0104020
1991 Ga0373946_0190840
1992 Ga0373955_0173360
1993 Ga0373942_0116036
1994 Ga0373961_0243167
1995 Ga0373962_0076787
1996 Ga0373924_0075521
1997 Ga0373924_0221097
1998 Ga0373931_0012673
1999 Ga0373931_0262031
2000 Ga0373931_0402488
2001 Ga0373931_1056126
2002 Ga0373935_0008303
2003 Ga0373935_0212024
2004 Ga0373935_0548796
2005 Ga0373935_0695297
2006 Ga0373927_0042629
2007 Ga0373927_0048081
2008 Ga0373927_0431383
2009 Ga0373927_0631216
2010 Ga0373927_1163135
2011 Ga0373933_0257013
2012 Ga0373947_0016229
2013 Ga0373947_0996504
2014 Ga0373947_1111872
2015 Ga0373937_0029238
2016 Ga0373937_0065822
2017 Ga0373937_0066365
2018 Ga0265778_067364
2019 Ga0373925_0065401
2020 Ga0373925_0132097
2021 Ga0373925_0323039
2022 Ga0373925_0328877
2023 Ga0373925_0486669
2024 Ga0373925_1336576
2025 Ga0395899_0435588
2026 Ga0395900_0304918
2027 Ga0395900_1046107
2028 Ga0395898_0012221
2029 Ga0395898_0050374
2030 Ga0395898_0494678
2031 Ga0395898_0508197
2032 Ga0395905_1367532
2033 Ga0395905_1379564
2034 Ga0395905_1859113
2035 Ga0436364_0036886
2036 Ga0436364_0315770
2037 Ga0436364_1186832
2038 Ga0436364_1233691
2039 Ga0436364_1286138
2040 Ga0436364_1474561
2041 Ga0436364_1516960
2042 Ga0436364_1531434
2043 Ga0395901_0041272
2044 Ga0395901_0383425
2045 Ga0395901_0722658
2046 Ga0400483_289328
2047 Ga0436365_0160999
2048 Ga0436365_0703944
2049 Ga0436365_0900444
2050 Ga0436365_1141253
2051 Ga0436365_1491242
2052 Ga0436360_0097049
2053 Ga0436360_0547363
2054 Ga0436360_0855640
2055 Ga0436360_0918467
2056 Ga0436360_1151401
2057 Ga0436361_0021799
2058 Ga0436361_0044782
2059 Ga0436361_0250690
2060 Ga0436361_0690845
2061 Ga0436361_0720097
2062 Ga0436363_0154853
2063 Ga0436363_0211976
2064 Ga0436363_0965241
2065 Ga0436363_1109504
2066 Ga0436363_1262652
2067 Ga0436363_1322015
2068 Ga0436363_1502120
2069 Ga0436362_0421234
2070 Ga0436362_0869632
2071 Ga0451789_0350328
2072 Ga0451794_41682
2073 Ga0451793_0188671
2074 Ga0451797_0893948
2075 Ga0451795_0161699
2076 Ga0451795_0986905
2077 Ga0451798_0884644
2078 Ga0451800_0165008
2079 Ga0451800_1521909
2080 Ga0451802_0364258
2081 Ga0451805_034073
2082 Ga0451804_0197570
2083 Ga0451837_1526070
2084 Ga0451839_0615464
2085 Ga0451839_1009338
2086 Ga0451841_0002499
2087 Ga0451841_0696736
2088 Ga0439459_0021955
2089 Ga0451577_0073171
2090 Ga0466969_0309758
2091 Ga0466969_0608483
2092 Ga0466972_0000053
2093 Ga0466972_0014315
2094 Ga0453683_0163048
2095 Ga0453683_0917818
2096 Ga0453683_1126951
2097 Ga0466966_0000322
2098 Ga0466966_0353867
2099 Ga0466961_0002390
2100 Ga0466961_0449315
2101 Ga0466961_0672400
2102 Ga0466963_0005897
2103 Ga0466963_0012246
2104 Ga0466963_0431621
2105 Ga0466964_0029953
2106 Ga0466964_0241002
2107 Ga0466964_0402475
2108 Ga0466964_0737687
2109 Ga0453684_0409847
2110 Ga0453684_0781325
2111 Ga0466971_0112315
2112 Ga0466968_0021394
2113 Ga0466968_0082883
2114 Ga0466968_0401330
2115 Ga0466968_0574764
2116 Ga0466970_0015654
2117 Ga0466970_0182060
2118 Ga0466970_0219397
2119 Ga0466957_0163208
2120 Ga0466957_0392950
2121 Ga0466957_1408171
2122 Ga0466960_0000619
2123 Ga0466960_0558741
2124 Ga0466959_0045817
2125 Ga0466959_0053003
2126 Ga0466959_0098485
2127 Ga0466959_0171755
2128 Ga0466959_0419679
2129 Ga0451576_0000094
2130 Ga0466958_0558197
2131 Ga0466958_0953609
2132 Ga0466967_0065989
2133 Ga0466967_0091722
2134 Ga0466967_0263682
2135 Ga0466967_0337186
2136 Ga0466967_0347323
2137 Ga0466967_1118636
2138 Ga0466967_2385499
2139 Ga0495627_116590
2140 Ga0495592_0437132
2141 Ga0495603_0000617
2142 Ga0495603_0019971
2143 Ga0495590_0066232
2144 Ga0495590_0076182
2145 Ga0495590_0279095
2146 Ga0495590_0351195
2147 Ga0495629_0034001
2148 Ga0495638_0013781
2149 Ga0495638_0026784
2150 Ga0495638_0069617
2151 Ga0495638_0109890
2152 Ga0495638_0481729
2153 Ga0495638_0510988
2154 Ga0495641_0264045
2155 Ga0495651_0039889
2156 Ga0495651_0208178
2157 Ga0495651_0252604
2158 Ga0495653_0144636
2159 Ga0495653_0522517
2160 Ga0495653_0789965
2161 Ga0495650_0001155
2162 Ga0495580_0005741
2163 Ga0495580_0854374
2164 Ga0495582_0006702
2165 Ga0495582_0422337
2166 Ga0495582_0876641
2167 Ga0495605_0032176
2168 Ga0495605_0034972
2169 Ga0495605_0044915
2170 Ga0495639_0011908
2171 Ga0495639_0067301
2172 Ga0495639_0103625
2173 Ga0495639_0311761
2174 Ga0495639_0568903
2175 Ga0495662_0020580
2176 Ga0495662_0058065
2177 Ga0495664_0005513
2178 Ga0495664_0049584
2179 Ga0495664_0116722
2180 Ga0495584_0017189
2181 Ga0495584_0028785
2182 Ga0495585_0064045
2183 Ga0495585_0069895
2184 Ga0495585_0276396
2185 Ga0495585_0287695
2186 Ga0495585_0428849
2187 Ga0495585_0514745
2188 Ga0495594_0233679
2189 Ga0495594_0242601
2190 Ga0495594_0262121
2191 Ga0495594_0550869
2192 Ga0495596_0228189
2193 Ga0495607_0008857
2194 Ga0495607_0090305
2195 Ga0495607_0251067
2196 Ga0495607_0253965
2197 Ga0495607_0394482
2198 Ga0495583_0070481
2199 Ga0495583_0078227
2200 Ga0495583_0368032
2201 Ga0495606_0001566
2202 Ga0495606_0012761
2203 Ga0495606_0034333
2204 Ga0495606_0039871
2205 Ga0495606_0075267
2206 Ga0495606_0154197
2207 Ga0495606_0510765
2208 Ga0495606_0622683
2209 Ga0495608_0082922
2210 Ga0495608_0096243
2211 Ga0495608_0271644
2212 Ga0495610_0078453
2213 Ga0495616_0045289
2214 Ga0495616_0153229
2215 Ga0495618_0292532
2216 Ga0495618_0626160
2217 Ga0495620_0353824
2218 Ga0495620_0389075
2219 Ga0495628_0208129
2220 Ga0495630_0064559
2221 Ga0495630_0241928
2222 Ga0495631_0016371
2223 Ga0495631_0093831
2224 Ga0495631_0120100
2225 Ga0495631_0205675
2226 Ga0495631_0265885
2227 Ga0495631_0320169
2228 Ga0495632_0017675
2229 Ga0495632_0118175
2230 Ga0495632_0342218
2231 Ga0495637_0036160
2232 Ga0495643_0011150
2233 Ga0495643_0326024
2234 Ga0495643_0389680
2235 Ga0495644_0091621
2236 Ga0495644_0271393
2237 Ga0495644_0277466
2238 Ga0495644_0367660
2239 Ga0495648_0029624
2240 Ga0495648_0173823
2241 Ga0495648_0420033
2242 Ga0495663_0313484
2243 Ga0495663_0323900
2244 Ga0495666_0034619
2245 Ga0495666_0158746
2246 Ga0495666_0319879
2247 Ga0495666_0489021
2248 Ga0495642_0508511
2249 Ga0495652_0017151
2250 Ga0495652_0057203
2251 Ga0495652_0089438
2252 Ga0495652_0816282
2253 Ga0495654_0015853
2254 Ga0495654_0159228
2255 Ga0495654_0387415
2256 Ga0495665_0005603
2257 Ga0495665_0135346
2258 Ga0495640_0005237
2259 Ga0495640_0732680
2260 Ga0495586_0118068
2261 Ga0495587_0052305
2262 Ga0495587_0082496
2263 Ga0495587_0364677
2264 Ga0495609_0019411
2265 Ga0495609_0087339
2266 Ga0495609_0194033
2267 Ga0495609_0244400
2268 Ga0495609_0342483
2269 Ga0495621_0027947
2270 Ga0495621_0318831
2271 Ga0495621_0525150
2272 Ga0495597_0072862
2273 Ga0495645_0001939
2274 Ga0495645_0010968
2275 Ga0495645_0074893
2276 Ga0495645_0217539
2277 Ga0495645_0586280
2278 Ga0495622_0229507
2279 Ga0495633_0314727
2280 Ga0495667_0028020
2281 Ga0495667_0086796
2282 Ga0495667_0167633
2283 Ga0495656_0026864
2284 Ga0495656_0046559
2285 Ga0495656_0074179
2286 Ga0495656_0090614
2287 Ga0495656_0153921
2288 Ga0495668_0013946
2289 Ga0495668_0047101
2290 Ga0495668_0270412
2291 Ga0495668_0460986
2292 Ga0495634_0746574
2293 Ga0495611_0091070
2294 Ga0495611_0222139
2295 Ga0495611_0484364
2296 Ga0495625_0035568
2297 Ga0495625_0138370
2298 Ga0495625_0260799
2299 Ga0495625_0307221
2300 Ga0495625_0722439
2301 Ga0495635_0037964
2302 Ga0495659_0043372
2303 Ga0495659_0393263
2304 Ga0495661_0165205
2305 Ga0495661_0235255
2306 Ga0495588_0030445
2307 Ga0495588_0073237
2308 Ga0495588_0120965
2309 Ga0495657_0091606
2310 Ga0495657_0789688
2311 Ga0495599_0060792
2312 Ga0495599_0415426
2313 Ga0495623_0071142
2314 Ga0495623_0674509
2315 Ga0495647_0300216
2316 Ga0495658_0010407
2317 Ga0495658_0939970
2318 Ga0495669_0171418
2319 Ga0495669_0201378
2320 Ga0495669_0205324
2321 Ga0495669_0277193
2322 Ga0495669_0629960
2323 Ga0495613_0109070
2324 Ga0495613_0390683
2325 Ga0495624_0019628
2326 Ga0495624_0235282
2327 Ga0495670_0085054
2328 Ga0495670_0097664
2329 Ga0495670_0387931
2330 Ga0495671_0213271
2331 Ga0495671_0227131
2332 Ga0495671_0281844
2333 Ga0495671_0307717
2334 Ga0495671_0379050
2335 Ga0495671_0425340
2336 Ga0495649_0062122
2337 Ga0495649_0223410
2338 Ga0495649_0306035
2339 Ga0495649_0518042
2340 Ga0495649_0648524
2341 Ga0495589_0011378
2342 Ga0495589_0095519
2343 Ga0495589_0123180
2344 Ga0495589_0371791
2345 Ga0495589_0474871
2346 Ga0495600_0069308
2347 Ga0495600_0833438
2348 Ga0495660_0216541
2349 Ga0495660_0453147
2350 Ga0495581_0011373
2351 Ga0495581_0073400
2352 Ga0495581_0077939
2353 Ga0495604_0138184
2354 Ga0495604_0180476
2355 Ga0495636_0518154
2356 Ga0495636_0520336
2357 Ga0495674_0001989
2358 Ga0495674_0114150
2359 Ga0495674_0521353
2360 Ga0495674_1342913
2361 Ga0495672_0121391
2362 Ga0495672_0189891
2363 Ga0495676_0250239
2364 Ga0495676_0307204
2365 Ga0495676_0330065
2366 Ga0495676_0375024
2367 Ga0495680_0028837
2368 Ga0495680_0329372
2369 Ga0495680_0533299
2370 Ga0495683_0017557
2371 Ga0495683_0336560
2372 Ga0495687_020352
2373 Ga0495675_0343313
2374 Ga0495677_0132549
2375 Ga0495677_0171566
2376 Ga0495679_082617
2377 Ga0495679_129092
2378 Ga0495673_0132158
2379 Ga0495673_0148558
2380 Ga0495673_0259376
2381 Ga0495673_0323495
2382 Ga0495681_0273396
2383 Ga0495684_0004921
2384 Ga0495684_0176305
2385 Ga0495686_0081319
2386 Ga0495686_0163246
2387 Ga0495686_0169662
2388 Ga0495686_0301112
2389 Ga0495686_0558241
2390 Ga0495593_0115467
2391 Ga0495602_0280084
2392 Ga0495602_0418278
2393 Ga0495614_0203513
2394 Ga0495615_0152132
2395 Ga0495626_0095969
2396 Ga0495626_0440159
2397 Ga0496100_0352046
2398 Ga0496100_0526155
2399 Ga0496100_0916657
2400 Ga0496100_1151080
2401 Ga0496101_0052463
2402 Ga0496101_0560693
2403 Ga0496101_0880246
2404 Ga0496102_0003175
2405 Ga0496102_0351511
2406 Ga0496102_0994313
2407 Ga0496102_1673601
2408 Ga0496103_0024988
2409 Ga0496103_0466512
2410 Ga0496103_0491165
2411 Ga0496104_0054701
2412 Ga0496104_0071290
2413 Ga0496104_0167266
2414 Ga0496104_0559707
2415 Ga0496104_0933093
2416 Ga0496105_0023165
2417 Ga0496105_0043187
2418 Ga0496105_0062157
2419 Ga0496105_0913986
2420 Ga0496106_0039537
2421 Ga0496106_0435815
2422 Ga0496106_0492430
2423 Ga0496106_0537320
2424 Ga0496106_1481734
2425 Ga0496107_0027047
2426 Ga0496107_0083697
2427 Ga0496107_0631163
2428 Ga0496107_0998515
2429 Ga0496108_0049151
2430 Ga0496108_0106154
2431 Ga0496108_0286660
2432 Ga0496108_0301255
2433 Ga0496108_1163312
2434 Ga0496109_0025925
2435 Ga0496109_0060765
2436 Ga0496109_0432040
2437 Ga0496109_0634531
2438 Ga0496109_1047145
2439 Ga0496109_1086224
2440 Ga0496110_0038811
2441 Ga0496110_0069002
2442 Ga0496110_0523976
2443 Ga0496110_0747209
2444 Ga0496111_0041412
2445 Ga0496111_0043022
2446 Ga0496111_0089098
2447 Ga0496111_1070947
2448 Ga0496112_0000018
2449 Ga0496112_0001958
2450 Ga0496112_0173931
2451 Ga0496112_0357325
2452 Ga0496112_0455136
2453 Ga0496112_1666590
2454 Ga0496113_0780927
2455 Ga0496113_1180533
2456 Ga0496113_1204054
2457 Ga0496114_0034614
2458 Ga0496114_0039299
2459 Ga0496114_1335562
2460 Ga0496115_0070966
2461 Ga0496115_0358527
2462 Ga0496115_0450856
2463 Ga0496115_1280224
2464 Ga0496115_1449207
2465 Ga0496116_0076148
2466 Ga0496116_0352428
2467 Ga0496117_0022310
2468 Ga0496117_0067196
2469 Ga0496117_0378397
2470 Ga0496118_0018395
2471 Ga0496118_0068579
2472 Ga0496118_0141924
2473 Ga0496119_0012507
2474 Ga0496119_0037823
2475 Ga0496119_0158132
2476 Ga0496119_0504467
2477 Ga0496120_0143214
2478 Ga0496120_0222928
2479 Ga0496121_0001046
2480 Ga0496121_0047732
2481 Ga0496121_0051267
2482 Ga0496121_0059293
2483 Ga0496121_0071614
2484 Ga0496121_0071682
2485 Ga0496121_0249867
2486 Ga0496121_0323593
2487 Ga0496121_0400013
2488 Ga0496121_0573616
2489 Ga0496122_0081810
2490 Ga0496122_0131235
2491 Ga0496122_0144541
2492 Ga0496123_0481154
2493 Ga0496124_0013092
2494 Ga0496124_0022005
2495 Ga0496124_0281883
2496 Ga0496124_0318201
2497 Ga0496124_0827992
2498 Ga0496125_0032864
2499 Ga0496125_0043837
2500 Ga0496125_0162034
2501 Ga0496125_0247778
2502 Ga0496126_0011825
2503 Ga0496126_0015601
2504 Ga0496126_0020176
2505 Ga0496126_0031303
2506 Ga0496126_0060458
2507 Ga0496126_0061824
2508 Ga0496126_0063195
2509 Ga0496126_0122996
2510 Ga0496126_0182744
2511 Ga0496126_0231407
2512 Ga0496126_0430252
2513 Ga0496126_0518849
2514 Ga0496126_0944773
2515 Ga0496126_0950196
2516 Ga0495678_188501
2517 Ga0495678_218048
2518 Ga0495682_0006058
2519 Ga0501031_1072633
2520 Ga0501033_0206964
2521 Ga0501034_0354444
2522 Ga0501036_0234466
2523 Ga0501036_0579441
2524 Ga0501039_1507062
2525 Ga0501046_0044071
2526 Ga0501047_0036466
2527 Ga0501048_0277370
2528 Ga0501067_0051257
2529 Ga0501067_0083249
2530 Ga0501069_0207786
2531 Ga0501070_0602816
2532 Ga0501073_0043738
2533 Ga0501073_0621624
2534 Ga0501074_0203085
2535 Ga0501080_0004617
2536 Ga0501080_0077138
2537 Ga0501083_0000632
2538 Ga0501083_1124227
2539 Ga0501044_0022102
2540 Ga0501044_0039142
2541 Ga0501044_0896085
2542 nmdc:mga03683_187787_c1
2543 nmdc:mga03683_2734_c1
2544 nmdc:mga03683_457893_c1
2545 nmdc:mga03683_63046_c2
2546 nmdc:mga03683_672932_c1
2547 nmdc:mga03n38_193888_c1
2548 nmdc:mga03n38_54633_c1
2549 nmdc:mga03n38_64485_c1
2550 nmdc:mga03n38_769283_c1
2551 nmdc:mga00v17_136770_c1
2552 nmdc:mga00v17_155235_c1
2553 nmdc:mga00v17_170831_c1
2554 nmdc:mga00v17_239999_c1
2555 nmdc:mga0yw44_147116_c1
2556 nmdc:mga0yw44_94650_c1
2557 nmdc:mga0k408_17656_c1
2558 nmdc:mga0k408_23559_c1
2559 nmdc:mga0k408_29709_c1
2560 nmdc:mga0k408_4373_c1
2561 nmdc:mga0k408_626141_c1
2562 nmdc:mga0k408_7136_c1
2563 nmdc:mga06z11_14951_c1
2564 nmdc:mga06z11_188765_c1
2565 nmdc:mga06z11_242167_c1
2566 nmdc:mga06z11_302132_c1
2567 nmdc:mga06z11_842591_c1
2568 nmdc:mga06z11_97371_c1
2569 nmdc:mga04h51_43506_c1
2570 nmdc:mga07m45_141055_c1
2571 nmdc:mga07m45_150986_c1
2572 nmdc:mga07m45_34912_c1
2573 nmdc:mga07m45_397757_c1
2574 nmdc:mga07m45_616766_c1
2575 nmdc:mga07m45_63917_c1
2576 nmdc:mga05p37_2115491_c1
2577 nmdc:mga05p37_962769_c1
2578 nmdc:mga08y16_1792193_c1
2579 nmdc:mga0n895_361327_c1
2580 nmdc:mga0n895_63525_c1
2581 nmdc:mga0n895_66805_c1
2582 nmdc:mga0rr50_200099_c1
2583 nmdc:mga0rr50_368928_c1
2584 nmdc:mga08x19_1118757_c1
2585 nmdc:mga08x19_89222_c1
2586 nmdc:mga0a205_503770_c1
2587 nmdc:mga0sz30_233865_c1
2588 nmdc:mga0sz30_35554_c1
2589 nmdc:mga0sz30_45811_c1
2590 nmdc:mga0sz30_47732_c1
2591 nmdc:mga0sz30_89167_c1
2592 Ga0495601_0000314
2593 Ga0495601_0026148
2594 Ga0495612_0025187
2595 Ga0495612_0047401
2596 Ga0495612_0343866
2597 Ga0500635_0112271
2598 Ga0500635_0196002
2599 Ga0495655_0033945
2600 Ga0495655_0052353
2601 Ga0495655_0119009
2602 Ga0495655_0322488
2603 Ga0495619_0001337
2604 Ga0495619_0345653
2605 Ga0495619_1187970
2606 Ga0500578_0177698
2607 Ga0500578_0246355
2608 Ga0500578_0362677
2609 Ga0500643_050691
2610 Ga0500644_0228380
2611 Ga0500646_0013502
2612 Ga0500646_0046263
2613 Ga0500646_0097416
2614 Ga0500646_0322521
2615 Ga0500646_0366957
2616 Ga0500647_0033748
2617 Ga0500647_0337116
2618 Ga0500647_0429657
2619 Ga0500583_0362710
2620 Ga0500651_0064955
2621 Ga0500566_0000191
2622 Ga0500566_0013266
2623 Ga0500566_0132105
2624 Ga0500566_0165307
2625 Ga0500566_0179786
2626 Ga0500640_000328
2627 Ga0500641_0022750
2628 Ga0500641_0150043
2629 Ga0500641_0203834
2630 Ga0500648_180438
2631 Ga0500648_352558
2632 Ga0500650_0001278
2633 Ga0500654_122720
2634 Ga0500554_048990
2635 Ga0500555_167427
2636 Ga0500556_0000095
2637 Ga0500556_0142750
2638 Ga0500558_277070
2639 Ga0500562_106402
2640 Ga0500562_164934
2641 Ga0500569_040695
2642 Ga0500569_315674
2643 Ga0500572_000153
2644 Ga0500572_000739
2645 Ga0500591_222088
2646 Ga0500592_019178
2647 Ga0500593_084377
2648 Ga0500594_0020980
2649 Ga0500594_0077410
2650 Ga0500595_000863
2651 Ga0500595_015387
2652 Ga0500595_016281
2653 Ga0500595_231862
2654 Ga0500608_092904
2655 Ga0500614_007288
2656 Ga0500628_191896
2657 Ga0500642_0247733
2658 Ga0500642_0325251
2659 Ga0500655_002239
2660 Ga0500655_113949
2661 Ga0500658_0234229
2662 Ga0500658_0289686
2663 Ga0500559_0000299
2664 Ga0500559_0000585
2665 Ga0500559_0010824
2666 Ga0500559_0017076
2667 Ga0500559_0117444
2668 Ga0500561_0158082
2669 Ga0500568_0026201
2670 Ga0500568_0073513
2671 Ga0500568_0078005
2672 Ga0500573_0308853
2673 Ga0500577_0318774
2674 Ga0500577_0327468
2675 Ga0500588_0230347
2676 Ga0500589_031633
2677 Ga0500590_201570
2678 Ga0500603_001431
2679 Ga0500603_090077
2680 Ga0500604_0048410
2681 Ga0500616_0045212
2682 Ga0500616_0395270
2683 Ga0500622_0000791
2684 Ga0500622_0065143
2685 Ga0500622_0244066
2686 Ga0500630_003340
2687 Ga0500633_0311366
2688 Ga0500634_0153385
2689 Ga0500634_0407464
2690 Ga0500638_090362
2691 Ga0500638_170194
2692 Ga0500639_000477
2693 Ga0500639_004935
2694 Ga0500639_049860
2695 Ga0500636_0436409
2696 Ga0500637_0003263
2697 Ga0500637_0030501
2698 Ga0500637_0174840
2699 Ga0500567_251040
2700 Ga0500570_225740
2701 Ga0500576_022052
2702 Ga0500611_086488
2703 Ga0500657_164981
2704 Ga0500645_086458
2705 Ga0500609_049086
2706 Ga0500656_040579
2707 Ga0500552_003598
2708 Ga0500596_001682
2709 Ga0500596_002529
2710 Ga0500596_008742
2711 Ga0500661_007864
2712 Ga0587084_083580
2713 Ga0587066_118947
2714 Ga0587073_0176763
2715 Ga0587080_030213
2716 Ga0587088_207040
2717 Ga0587099_067117
2718 Ga0587076_173006
2719 Ga0587111_0260638
2720 Ga0466962_0022598
2721 Ga0466962_0256782
2722 2597870970
2723 2958174469
2724 2977978113

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

15

80

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9201 2 64
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9157 2 66
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9117 1 67
2lss-assembly1.cif.gz_A solution structure of the r. rickettsii cold shock-like protein 0.903 3 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9015 1 66
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9296 2 65 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9192 2 64 2.40.50.140
2lssA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.903 3 67 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8961 2 65 2.40.50.140
af_Q4DCA9_18_92_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8911 3 64 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2F0AKQ6-F1-model_v4 Cold-shock protein 1.004 1 66 GO:0003676
GO:0005829
AF-A0A2E7RF98-F1-model_v4 Cold-shock protein 1.003 1 66 GO:0003676
GO:0005829
AF-A0A085FQU9-F1-model_v4 Cold shock protein (Beta-ribbon, CspA family) 1.001 2 66 GO:0003676
GO:0005829
AF-A0A7Y4H5I2-F1-model_v4 Cold shock domain-containing protein 0.9994 1 66 GO:0003676
GO:0005829
AF-A0A1M7M1X0-F1-model_v4 Cold shock protein (Beta-ribbon, CspA family) 0.9982 2 67 GO:0003676
GO:0005829

Map