F493361
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1363 | 562 | 2724 | 67 |
Family's Representative Sequence
| Representative Sequence | 3300053120|Ga0500597_123447|Ga0500597_123447_698_940 |
| Length | 80 |
| Sequence | MTVKTAGIPGDAAVATGTVKWFNATKGYGFIAPQGGGKDVFVHISAVERAGLSSLNEGATVEFDVVPNKGKESAENIKVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 139 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 251 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 252 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 255 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 256 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 299 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 306 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 308 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 309 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 310 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 311 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 312 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 313 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 314 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 319 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 320 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 321 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 322 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 428 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 429 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 430 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 431 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 432 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 433 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 436 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 437 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 438 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 442 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 443 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 444 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 445 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 446 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 447 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 448 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 449 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 450 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 451 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 452 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 472 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 475 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 476 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 477 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 478 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 485 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 488 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 491 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 492 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 494 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 495 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 496 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 497 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 498 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 501 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 502 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 504 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 505 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 507 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 508 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 509 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 511 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 512 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 513 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 514 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 515 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 516 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 517 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 518 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 519 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 520 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 523 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 524 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 525 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 526 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 527 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 528 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 529 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 531 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 533 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 534 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 535 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 536 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 537 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 538 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 539 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 540 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 541 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 542 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 543 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 544 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 545 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 546 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 547 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 548 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 549 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 550 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 551 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 560 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 561 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 562 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.51 |
| Metatranscriptomes | 2.27 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.43 |
| Nodule | 0.37 |
| Rhizoplane | 5.87 |
| Rhizosphere | 73.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500597_123447 | 3300053120 | Bacteria | 1121 |
| 2 | CNAas_1005504 | 3300000532 | Bacteria | 811 |
| 3 | JGI24743J22301_10086017 | 3300001991 | Bacteria | 667 |
| 4 | JGI24750J21931_1011860 | 3300002070 | Bacteria | 1150 |
| 5 | JGI24744J21845_10006633 | 3300002077 | Bacteria | 2398 |
| 6 | JGI24034J26672_10020487 | 3300002239 | Bacteria | 1036 |
| 7 | JGI24034J26672_10069191 | 3300002239 | Bacteria | 630 |
| 8 | JGI25165J46597_1019402 | 3300003214 | Bacteria | 896 |
| 9 | JGI25153J46596_10002140 | 3300003215 | Bacteria | 11547 |
| 10 | JGI25153J46596_10010090 | 3300003215 | Bacteria | 4308 |
| 11 | Ga0006770J48903_1004135 | 3300003305 | Bacteria | 531 |
| 12 | rootL2_10016153 | 3300003322 | Bacteria | 3836 |
| 13 | Ga0006781J51513_1004215 | 3300003568 | Bacteria | 917 |
| 14 | Ga0007410J51695_1002477 | 3300003574 | Bacteria | 773 |
| 15 | JGI25404J52841_10001052 | 3300003659 | Bacteria | 4599 |
| 16 | JGI25404J52841_10009090 | 3300003659 | Bacteria | 2125 |
| 17 | JGI25404J52841_10015398 | 3300003659 | Bacteria | 1659 |
| 18 | JGI25404J52841_10018605 | 3300003659 | Bacteria | 1506 |
| 19 | Ga0032354_1008942 | 3300003693 | Bacteria | 787 |
| 20 | Ga0006780_1003591 | 3300003735 | Bacteria | 763 |
| 21 | Ga0055542_1005196 | 3300003762 | Bacteria | 2988 |
| 22 | Ga0055529_1008414 | 3300003763 | Bacteria | 1373 |
| 23 | JGI25405J52794_10024077 | 3300003911 | Bacteria | 1242 |
| 24 | Ga0065707_10356582 | 3300005295 | Bacteria | 880 |
| 25 | Ga0070658_10157810 | 3300005327 | Bacteria | 1902 |
| 26 | Ga0070676_10107280 | 3300005328 | Bacteria | 1734 |
| 27 | Ga0070676_10578773 | 3300005328 | Bacteria | 807 |
| 28 | Ga0070690_100014486 | 3300005330 | Bacteria | 4678 |
| 29 | Ga0070690_100054344 | 3300005330 | Bacteria | 2563 |
| 30 | Ga0070690_100747517 | 3300005330 | Bacteria | 755 |
| 31 | Ga0070670_100234379 | 3300005331 | Bacteria | 1598 |
| 32 | Ga0070670_101023685 | 3300005331 | Bacteria | 751 |
| 33 | Ga0070677_10249176 | 3300005333 | Bacteria | 881 |
| 34 | Ga0068869_100591799 | 3300005334 | Bacteria | 936 |
| 35 | Ga0068869_101174875 | 3300005334 | Bacteria | 674 |
| 36 | Ga0070666_10255579 | 3300005335 | Bacteria | 1241 |
| 37 | Ga0070666_10556109 | 3300005335 | Bacteria | 835 |
| 38 | Ga0070682_100257297 | 3300005337 | Bacteria | 1262 |
| 39 | Ga0068868_100261488 | 3300005338 | Bacteria | 1459 |
| 40 | Ga0068868_102055195 | 3300005338 | Bacteria | 543 |
| 41 | Ga0070660_101374600 | 3300005339 | Bacteria | 600 |
| 42 | Ga0070689_100011365 | 3300005340 | Bacteria | 6375 |
| 43 | Ga0070689_100083460 | 3300005340 | Bacteria | 2511 |
| 44 | Ga0070689_100264441 | 3300005340 | Bacteria | 1423 |
| 45 | Ga0070687_100037609 | 3300005343 | Bacteria | 2421 |
| 46 | Ga0070687_100053260 | 3300005343 | Bacteria | 2104 |
| 47 | Ga0070687_101411732 | 3300005343 | Bacteria | 521 |
| 48 | Ga0070661_100516182 | 3300005344 | Bacteria | 958 |
| 49 | Ga0070661_100516592 | 3300005344 | Bacteria | 957 |
| 50 | Ga0070661_100645552 | 3300005344 | Bacteria | 859 |
| 51 | Ga0070668_100187942 | 3300005347 | Bacteria | 1691 |
| 52 | Ga0070668_100328393 | 3300005347 | Bacteria | 1289 |
| 53 | Ga0070668_100389669 | 3300005347 | Bacteria | 1187 |
| 54 | Ga0070668_101390894 | 3300005347 | Bacteria | 640 |
| 55 | Ga0070669_100079992 | 3300005353 | Bacteria | 2431 |
| 56 | Ga0070669_100482785 | 3300005353 | Bacteria | 1026 |
| 57 | Ga0070669_100514859 | 3300005353 | Bacteria | 994 |
| 58 | Ga0070669_101757113 | 3300005353 | Bacteria | 541 |
| 59 | Ga0070675_100879531 | 3300005354 | Bacteria | 821 |
| 60 | Ga0070675_100978501 | 3300005354 | Bacteria | 777 |
| 61 | Ga0070675_101199172 | 3300005354 | Bacteria | 699 |
| 62 | Ga0070671_100051030 | 3300005355 | Bacteria | 3441 |
| 63 | Ga0070671_100663275 | 3300005355 | Bacteria | 904 |
| 64 | Ga0070674_100049075 | 3300005356 | Bacteria | 2900 |
| 65 | Ga0070674_100052380 | 3300005356 | Bacteria | 2815 |
| 66 | Ga0070674_100053108 | 3300005356 | Bacteria | 2796 |
| 67 | Ga0070673_100250143 | 3300005364 | Bacteria | 1544 |
| 68 | Ga0070673_100379664 | 3300005364 | Bacteria | 1260 |
| 69 | Ga0070673_100978995 | 3300005364 | Bacteria | 787 |
| 70 | Ga0070673_102083664 | 3300005364 | Bacteria | 539 |
| 71 | Ga0070688_100072863 | 3300005365 | Bacteria | 2202 |
| 72 | Ga0070688_100250587 | 3300005365 | Bacteria | 1261 |
| 73 | Ga0070688_100631611 | 3300005365 | Bacteria | 823 |
| 74 | Ga0070659_100443214 | 3300005366 | Bacteria | 1100 |
| 75 | Ga0070659_100966432 | 3300005366 | Bacteria | 746 |
| 76 | Ga0070709_10033715 | 3300005434 | Bacteria | 3099 |
| 77 | Ga0070709_10034132 | 3300005434 | Bacteria | 3083 |
| 78 | Ga0070709_10469603 | 3300005434 | Bacteria | 951 |
| 79 | Ga0070709_10710111 | 3300005434 | Bacteria | 783 |
| 80 | Ga0070714_100089521 | 3300005435 | Bacteria | 2694 |
| 81 | Ga0070714_100430685 | 3300005435 | Bacteria | 1251 |
| 82 | Ga0070714_100664872 | 3300005435 | Bacteria | 1003 |
| 83 | Ga0070713_100155707 | 3300005436 | Bacteria | 2036 |
| 84 | Ga0070713_100160496 | 3300005436 | Bacteria | 2006 |
| 85 | Ga0070713_102291936 | 3300005436 | Bacteria | 523 |
| 86 | Ga0070710_10010559 | 3300005437 | Bacteria | 4539 |
| 87 | Ga0070710_10104521 | 3300005437 | Bacteria | 1692 |
| 88 | Ga0070710_11137971 | 3300005437 | Bacteria | 574 |
| 89 | Ga0070701_10384208 | 3300005438 | Bacteria | 886 |
| 90 | Ga0070711_100016594 | 3300005439 | Bacteria | 4677 |
| 91 | Ga0070711_100406876 | 3300005439 | Bacteria | 1106 |
| 92 | Ga0070711_100421601 | 3300005439 | Bacteria | 1088 |
| 93 | Ga0070711_100664720 | 3300005439 | Bacteria | 875 |
| 94 | Ga0070711_100987821 | 3300005439 | Bacteria | 722 |
| 95 | Ga0070700_100410564 | 3300005441 | Bacteria | 1021 |
| 96 | Ga0070700_100990340 | 3300005441 | Bacteria | 690 |
| 97 | Ga0070663_100265137 | 3300005455 | Bacteria | 1364 |
| 98 | Ga0070663_100504600 | 3300005455 | Bacteria | 1005 |
| 99 | Ga0070678_100085821 | 3300005456 | Bacteria | 2400 |
| 100 | Ga0070678_100631505 | 3300005456 | Bacteria | 959 |
| 101 | Ga0070662_100234813 | 3300005457 | Bacteria | 1468 |
| 102 | Ga0070662_100379096 | 3300005457 | Bacteria | 1164 |
| 103 | Ga0070681_11091239 | 3300005458 | Bacteria | 719 |
| 104 | Ga0068867_101092874 | 3300005459 | Bacteria | 728 |
| 105 | Ga0070685_10300257 | 3300005466 | Bacteria | 1082 |
| 106 | Ga0070685_10884137 | 3300005466 | Bacteria | 664 |
| 107 | Ga0070706_100100870 | 3300005467 | Bacteria | 2683 |
| 108 | Ga0070706_100664098 | 3300005467 | Bacteria | 967 |
| 109 | Ga0070707_100593921 | 3300005468 | Bacteria | 1070 |
| 110 | Ga0070707_101447140 | 3300005468 | Bacteria | 654 |
| 111 | Ga0070679_100153277 | 3300005530 | Bacteria | 2280 |
| 112 | Ga0070679_100949472 | 3300005530 | Bacteria | 804 |
| 113 | Ga0070684_101348708 | 3300005535 | Bacteria | 671 |
| 114 | Ga0070684_101914088 | 3300005535 | Bacteria | 560 |
| 115 | Ga0068853_100744429 | 3300005539 | Bacteria | 936 |
| 116 | Ga0068853_101716085 | 3300005539 | Bacteria | 609 |
| 117 | Ga0070672_100057945 | 3300005543 | Bacteria | 3042 |
| 118 | Ga0070672_100157323 | 3300005543 | Bacteria | 1883 |
| 119 | Ga0070672_100201470 | 3300005543 | Bacteria | 1664 |
| 120 | Ga0070672_100568605 | 3300005543 | Bacteria | 985 |
| 121 | Ga0070686_100178843 | 3300005544 | Bacteria | 1506 |
| 122 | Ga0070686_100637421 | 3300005544 | Bacteria | 843 |
| 123 | Ga0070686_101622692 | 3300005544 | Bacteria | 547 |
| 124 | Ga0070696_100190361 | 3300005546 | Bacteria | 1527 |
| 125 | Ga0070693_100340709 | 3300005547 | Bacteria | 1023 |
| 126 | Ga0070665_100038049 | 3300005548 | Bacteria | 4836 |
| 127 | Ga0070665_101649369 | 3300005548 | Bacteria | 649 |
| 128 | Ga0070665_101759330 | 3300005548 | Bacteria | 627 |
| 129 | Ga0070665_101873722 | 3300005548 | Bacteria | 606 |
| 130 | Ga0068855_100797846 | 3300005563 | Bacteria | 1004 |
| 131 | Ga0068855_100929282 | 3300005563 | Bacteria | 917 |
| 132 | Ga0070664_101454186 | 3300005564 | Bacteria | 648 |
| 133 | Ga0068856_101441545 | 3300005614 | Bacteria | 703 |
| 134 | Ga0070702_100032604 | 3300005615 | Bacteria | 2859 |
| 135 | Ga0070702_101013622 | 3300005615 | Bacteria | 658 |
| 136 | Ga0068852_100292799 | 3300005616 | Bacteria | 1573 |
| 137 | Ga0068852_101473584 | 3300005616 | Bacteria | 703 |
| 138 | Ga0068859_100247315 | 3300005617 | Bacteria | 1873 |
| 139 | Ga0068859_100667255 | 3300005617 | Bacteria | 1131 |
| 140 | Ga0068859_100708856 | 3300005617 | Bacteria | 1097 |
| 141 | Ga0068859_102402636 | 3300005617 | Bacteria | 581 |
| 142 | Ga0068864_100020725 | 3300005618 | Bacteria | 5502 |
| 143 | Ga0068864_100169431 | 3300005618 | Bacteria | 1990 |
| 144 | Ga0068864_100191178 | 3300005618 | Bacteria | 1877 |
| 145 | Ga0068866_10063718 | 3300005718 | Bacteria | 1922 |
| 146 | Ga0068861_101284597 | 3300005719 | Bacteria | 711 |
| 147 | Ga0068870_10253508 | 3300005840 | Bacteria | 1092 |
| 148 | Ga0068870_10279786 | 3300005840 | Bacteria | 1046 |
| 149 | Ga0068870_11160387 | 3300005840 | Bacteria | 558 |
| 150 | Ga0068863_100193114 | 3300005841 | Bacteria | 1957 |
| 151 | Ga0068863_100536184 | 3300005841 | Bacteria | 1155 |
| 152 | Ga0068863_102307007 | 3300005841 | Bacteria | 548 |
| 153 | Ga0068858_100107762 | 3300005842 | Bacteria | 2601 |
| 154 | Ga0068858_100214665 | 3300005842 | Bacteria | 1821 |
| 155 | Ga0068858_100397031 | 3300005842 | Bacteria | 1325 |
| 156 | Ga0068858_100752517 | 3300005842 | Bacteria | 949 |
| 157 | Ga0068858_102586847 | 3300005842 | Bacteria | 501 |
| 158 | Ga0068860_100131677 | 3300005843 | Bacteria | 2400 |
| 159 | Ga0068860_100139914 | 3300005843 | Bacteria | 2326 |
| 160 | Ga0068860_100262185 | 3300005843 | Bacteria | 1685 |
| 161 | Ga0068860_100411374 | 3300005843 | Bacteria | 1339 |
| 162 | Ga0068860_100973313 | 3300005843 | Bacteria | 866 |
| 163 | Ga0068862_100157171 | 3300005844 | Bacteria | 2027 |
| 164 | Ga0068862_100298871 | 3300005844 | Bacteria | 1480 |
| 165 | Ga0068862_100760387 | 3300005844 | Bacteria | 943 |
| 166 | Ga0068862_101215412 | 3300005844 | Bacteria | 753 |
| 167 | Ga0068862_101982150 | 3300005844 | Bacteria | 593 |
| 168 | Ga0081455_10016563 | 3300005937 | Bacteria | 7111 |
| 169 | Ga0081455_10033402 | 3300005937 | Bacteria | 4624 |
| 170 | Ga0081455_10034075 | 3300005937 | Bacteria | 4567 |
| 171 | Ga0081455_10128955 | 3300005937 | Bacteria | 1981 |
| 172 | Ga0081455_10138410 | 3300005937 | Bacteria | 1894 |
| 173 | Ga0081540_1002643 | 3300005983 | Bacteria | 14569 |
| 174 | Ga0081540_1003668 | 3300005983 | Bacteria | 12045 |
| 175 | Ga0081540_1004247 | 3300005983 | Bacteria | 11000 |
| 176 | Ga0081540_1018838 | 3300005983 | Bacteria | 4219 |
| 177 | Ga0081540_1031583 | 3300005983 | Bacteria | 2909 |
| 178 | Ga0081540_1046731 | 3300005983 | Bacteria | 2183 |
| 179 | Ga0081540_1311851 | 3300005983 | Bacteria | 540 |
| 180 | Ga0081539_10394090 | 3300005985 | Bacteria | 576 |
| 181 | Ga0070717_10217896 | 3300006028 | Bacteria | 1677 |
| 182 | Ga0070717_10346302 | 3300006028 | Bacteria | 1328 |
| 183 | Ga0070717_10887499 | 3300006028 | Bacteria | 812 |
| 184 | Ga0070717_10890872 | 3300006028 | Bacteria | 810 |
| 185 | Ga0075368_10198096 | 3300006042 | Bacteria | 849 |
| 186 | Ga0075363_100128500 | 3300006048 | Bacteria | 1420 |
| 187 | Ga0075364_10044125 | 3300006051 | Bacteria | 2899 |
| 188 | Ga0075364_10585543 | 3300006051 | Bacteria | 762 |
| 189 | Ga0075364_10943362 | 3300006051 | Bacteria | 587 |
| 190 | Ga0075432_10235375 | 3300006058 | Bacteria | 738 |
| 191 | Ga0075432_10368483 | 3300006058 | Bacteria | 613 |
| 192 | Ga0070715_10015272 | 3300006163 | Bacteria | 2860 |
| 193 | Ga0070715_10127212 | 3300006163 | Bacteria | 1222 |
| 194 | Ga0070715_10249100 | 3300006163 | Bacteria | 928 |
| 195 | Ga0070715_10982275 | 3300006163 | Bacteria | 525 |
| 196 | Ga0070716_100030610 | 3300006173 | Bacteria | 2922 |
| 197 | Ga0070716_100095755 | 3300006173 | Bacteria | 1808 |
| 198 | Ga0070716_100292627 | 3300006173 | Bacteria | 1129 |
| 199 | Ga0070716_100515859 | 3300006173 | Bacteria | 884 |
| 200 | Ga0070716_100655020 | 3300006173 | Bacteria | 797 |
| 201 | Ga0070712_100030217 | 3300006175 | Bacteria | 3639 |
| 202 | Ga0070712_100212042 | 3300006175 | Bacteria | 1528 |
| 203 | Ga0070712_101487919 | 3300006175 | Bacteria | 591 |
| 204 | Ga0075362_10002782 | 3300006177 | Bacteria | 5971 |
| 205 | Ga0075362_10157715 | 3300006177 | Bacteria | 1091 |
| 206 | Ga0075362_10489714 | 3300006177 | Bacteria | 628 |
| 207 | Ga0075367_10108434 | 3300006178 | Bacteria | 1702 |
| 208 | Ga0075367_10116266 | 3300006178 | Bacteria | 1645 |
| 209 | Ga0075367_10365758 | 3300006178 | Bacteria | 911 |
| 210 | Ga0075367_10433306 | 3300006178 | Bacteria | 833 |
| 211 | Ga0075369_10095943 | 3300006186 | Bacteria | 1327 |
| 212 | Ga0075369_10169370 | 3300006186 | Bacteria | 1002 |
| 213 | Ga0075369_10233015 | 3300006186 | Bacteria | 853 |
| 214 | Ga0075366_10001525 | 3300006195 | Bacteria | 11575 |
| 215 | Ga0075366_10004076 | 3300006195 | Bacteria | 7809 |
| 216 | Ga0075366_10038714 | 3300006195 | Bacteria | 2816 |
| 217 | Ga0075366_10857394 | 3300006195 | Bacteria | 565 |
| 218 | Ga0097621_100195892 | 3300006237 | Bacteria | 1752 |
| 219 | Ga0097621_100679345 | 3300006237 | Bacteria | 947 |
| 220 | Ga0097621_101036947 | 3300006237 | Bacteria | 768 |
| 221 | Ga0097621_101991136 | 3300006237 | Bacteria | 555 |
| 222 | Ga0075370_10154131 | 3300006353 | Bacteria | 1347 |
| 223 | Ga0075370_10534298 | 3300006353 | Bacteria | 709 |
| 224 | Ga0075370_10706601 | 3300006353 | Bacteria | 613 |
| 225 | Ga0068871_100106807 | 3300006358 | Bacteria | 2350 |
| 226 | Ga0068871_100524455 | 3300006358 | Bacteria | 1070 |
| 227 | Ga0068871_101062978 | 3300006358 | Bacteria | 756 |
| 228 | Ga0068871_102384835 | 3300006358 | Bacteria | 504 |
| 229 | Ga0075434_100061863 | 3300006871 | Unclassified | 3725 |
| 230 | Ga0075434_100068500 | 3300006871 | Bacteria | 3535 |
| 231 | Ga0075434_102166881 | 3300006871 | Bacteria | 560 |
| 232 | Ga0075429_100063803 | 3300006880 | Bacteria | 3209 |
| 233 | Ga0075429_101517559 | 3300006880 | Bacteria | 583 |
| 234 | Ga0068865_100077349 | 3300006881 | Bacteria | 2377 |
| 235 | Ga0068865_100394881 | 3300006881 | Bacteria | 1131 |
| 236 | Ga0068865_100674376 | 3300006881 | Bacteria | 881 |
| 237 | Ga0068865_100907474 | 3300006881 | Bacteria | 767 |
| 238 | Ga0068865_100993456 | 3300006881 | Bacteria | 734 |
| 239 | Ga0075436_100984401 | 3300006914 | Bacteria | 632 |
| 240 | Ga0075436_101550072 | 3300006914 | Bacteria | 504 |
| 241 | Ga0097620_100247314 | 3300006931 | Bacteria | 1873 |
| 242 | Ga0097620_100667226 | 3300006931 | Bacteria | 1131 |
| 243 | Ga0097620_100708887 | 3300006931 | Bacteria | 1097 |
| 244 | Ga0097620_102403042 | 3300006931 | Bacteria | 581 |
| 245 | Ga0075435_100356738 | 3300007076 | Bacteria | 1254 |
| 246 | Ga0075435_101694169 | 3300007076 | Bacteria | 555 |
| 247 | Ga0099794_10064167 | 3300007265 | Bacteria | 1789 |
| 248 | Ga0099795_10168008 | 3300007788 | Bacteria | 909 |
| 249 | Ga0105251_10370334 | 3300009011 | Bacteria | 655 |
| 250 | Ga0105250_10126450 | 3300009092 | Bacteria | 1053 |
| 251 | Ga0105240_11943134 | 3300009093 | Bacteria | 612 |
| 252 | Ga0105240_12013630 | 3300009093 | Bacteria | 600 |
| 253 | Ga0111539_11052666 | 3300009094 | Bacteria | 946 |
| 254 | Ga0105245_10868807 | 3300009098 | Bacteria | 942 |
| 255 | Ga0105245_12359647 | 3300009098 | Bacteria | 585 |
| 256 | Ga0105247_10676972 | 3300009101 | Bacteria | 774 |
| 257 | Ga0105247_11048369 | 3300009101 | Bacteria | 640 |
| 258 | Ga0105247_11699887 | 3300009101 | Bacteria | 522 |
| 259 | Ga0114129_10964522 | 3300009147 | Bacteria | 1076 |
| 260 | Ga0114129_11223890 | 3300009147 | Bacteria | 934 |
| 261 | Ga0105243_11044250 | 3300009148 | Bacteria | 822 |
| 262 | Ga0105241_11138202 | 3300009174 | Bacteria | 736 |
| 263 | Ga0105248_10356682 | 3300009177 | Bacteria | 1646 |
| 264 | Ga0105248_10452532 | 3300009177 | Bacteria | 1447 |
| 265 | Ga0105248_10968511 | 3300009177 | Bacteria | 961 |
| 266 | Ga0105237_11343131 | 3300009545 | Bacteria | 721 |
| 267 | Ga0105237_12057461 | 3300009545 | Bacteria | 580 |
| 268 | Ga0105237_12749559 | 3300009545 | Bacteria | 503 |
| 269 | Ga0105238_11692532 | 3300009551 | Bacteria | 663 |
| 270 | Ga0105249_10092872 | 3300009553 | Bacteria | 2826 |
| 271 | Ga0105249_10254004 | 3300009553 | Bacteria | 1744 |
| 272 | Ga0105249_12117931 | 3300009553 | Bacteria | 635 |
| 273 | Ga0099796_10467188 | 3300010159 | Bacteria | 563 |
| 274 | Ga0105239_10063157 | 3300010375 | Bacteria | 4066 |
| 275 | Ga0105239_10128151 | 3300010375 | Bacteria | 2822 |
| 276 | Ga0105246_10120796 | 3300011119 | Bacteria | 1941 |
| 277 | Ga0105246_11347508 | 3300011119 | Bacteria | 663 |
| 278 | Ga0105246_12015610 | 3300011119 | Bacteria | 557 |
| 279 | Ga0105246_12522602 | 3300011119 | Bacteria | 506 |
| 280 | Ga0157335_1048709 | 3300012492 | Bacteria | 500 |
| 281 | Ga0157373_10525021 | 3300013100 | Bacteria | 857 |
| 282 | Ga0157370_10099255 | 3300013104 | Bacteria | 2729 |
| 283 | Ga0157370_10099681 | 3300013104 | Bacteria | 2722 |
| 284 | Ga0157369_10856514 | 3300013105 | Bacteria | 933 |
| 285 | Ga0157378_10528327 | 3300013297 | Bacteria | 1182 |
| 286 | Ga0157378_10983944 | 3300013297 | Bacteria | 877 |
| 287 | Ga0163162_10425135 | 3300013306 | Bacteria | 1461 |
| 288 | Ga0163162_10628412 | 3300013306 | Bacteria | 1199 |
| 289 | Ga0163162_11071737 | 3300013306 | Bacteria | 913 |
| 290 | Ga0163162_12867969 | 3300013306 | Bacteria | 555 |
| 291 | Ga0157375_10618797 | 3300013308 | Bacteria | 1241 |
| 292 | Ga0163163_10663280 | 3300014325 | Bacteria | 1107 |
| 293 | Ga0163163_11015510 | 3300014325 | Bacteria | 893 |
| 294 | Ga0163163_11956756 | 3300014325 | Bacteria | 646 |
| 295 | Ga0157380_10055433 | 3300014326 | Bacteria | 3148 |
| 296 | Ga0157380_11334648 | 3300014326 | Bacteria | 766 |
| 297 | Ga0157380_12549546 | 3300014326 | Bacteria | 577 |
| 298 | Ga0157377_10739326 | 3300014745 | Bacteria | 719 |
| 299 | Ga0157377_10749698 | 3300014745 | Bacteria | 714 |
| 300 | Ga0157377_11159841 | 3300014745 | Bacteria | 596 |
| 301 | Ga0163161_10120658 | 3300017792 | Bacteria | 1970 |
| 302 | Ga0163161_10258850 | 3300017792 | Bacteria | 1358 |
| 303 | Ga0163161_10886438 | 3300017792 | Bacteria | 755 |
| 304 | Ga0163161_12048601 | 3300017792 | Bacteria | 509 |
| 305 | Ga0184601_131220 | 3300019183 | Bacteria | 711 |
| 306 | Ga0184603_138419 | 3300019192 | Bacteria | 700 |
| 307 | Ga0206354_10020402 | 3300020081 | Bacteria | 826 |
| 308 | Ga0206353_10880577 | 3300020082 | Bacteria | 898 |
| 309 | Ga0213872_10111441 | 3300021361 | Bacteria | 1215 |
| 310 | Ga0213874_10053869 | 3300021377 | Bacteria | 1242 |
| 311 | Ga0213876_10289419 | 3300021384 | Bacteria | 871 |
| 312 | Ga0213871_10019928 | 3300021441 | Bacteria | 1657 |
| 313 | Ga0213871_10111906 | 3300021441 | Bacteria | 807 |
| 314 | Ga0213871_10250519 | 3300021441 | Bacteria | 563 |
| 315 | Ga0224712_10609470 | 3300022467 | Bacteria | 533 |
| 316 | Ga0209148_1000321 | 3300025254 | Bacteria | 66604 |
| 317 | Ga0209148_1023478 | 3300025254 | Bacteria | 982 |
| 318 | Ga0209233_1040885 | 3300025261 | Bacteria | 1005 |
| 319 | Ga0209455_1013823 | 3300025272 | Bacteria | 1857 |
| 320 | Ga0209758_1000125 | 3300025297 | Bacteria | 189869 |
| 321 | Ga0209257_1019362 | 3300025304 | Bacteria | 2568 |
| 322 | Ga0209257_1061004 | 3300025304 | Bacteria | 1024 |
| 323 | Ga0207697_10009193 | 3300025315 | Bacteria | 4277 |
| 324 | Ga0207697_10080726 | 3300025315 | Bacteria | 1370 |
| 325 | Ga0207697_10139319 | 3300025315 | Bacteria | 1051 |
| 326 | Ga0207697_10303717 | 3300025315 | Bacteria | 708 |
| 327 | Ga0207696_1154997 | 3300025711 | Bacteria | 611 |
| 328 | Ga0207682_10129393 | 3300025893 | Bacteria | 1126 |
| 329 | Ga0207692_10300699 | 3300025898 | Bacteria | 976 |
| 330 | Ga0207692_10514247 | 3300025898 | Bacteria | 761 |
| 331 | Ga0207642_10073056 | 3300025899 | Bacteria | 1639 |
| 332 | Ga0207642_10315562 | 3300025899 | Bacteria | 911 |
| 333 | Ga0207710_10035362 | 3300025900 | Bacteria | 2198 |
| 334 | Ga0207710_10148135 | 3300025900 | Bacteria | 1137 |
| 335 | Ga0207710_10285129 | 3300025900 | Bacteria | 832 |
| 336 | Ga0207710_10426037 | 3300025900 | Bacteria | 683 |
| 337 | Ga0207688_10023915 | 3300025901 | Bacteria | 3349 |
| 338 | Ga0207688_10080700 | 3300025901 | Bacteria | 1857 |
| 339 | Ga0207688_10468030 | 3300025901 | Bacteria | 787 |
| 340 | Ga0207680_10087821 | 3300025903 | Bacteria | 1970 |
| 341 | Ga0207680_10842590 | 3300025903 | Bacteria | 657 |
| 342 | Ga0207647_10005715 | 3300025904 | Bacteria | 9080 |
| 343 | Ga0207647_10284961 | 3300025904 | Bacteria | 942 |
| 344 | Ga0207685_10119165 | 3300025905 | Bacteria | 1156 |
| 345 | Ga0207685_10216717 | 3300025905 | Bacteria | 908 |
| 346 | Ga0207685_10312379 | 3300025905 | Bacteria | 781 |
| 347 | Ga0207685_10497118 | 3300025905 | Bacteria | 641 |
| 348 | Ga0207685_10664504 | 3300025905 | Bacteria | 564 |
| 349 | Ga0207699_10031047 | 3300025906 | Bacteria | 2996 |
| 350 | Ga0207699_10051570 | 3300025906 | Bacteria | 2432 |
| 351 | Ga0207699_10161118 | 3300025906 | Bacteria | 1493 |
| 352 | Ga0207699_10340964 | 3300025906 | Bacteria | 1056 |
| 353 | Ga0207699_11239545 | 3300025906 | Bacteria | 552 |
| 354 | Ga0207645_10107331 | 3300025907 | Bacteria | 1805 |
| 355 | Ga0207645_10111597 | 3300025907 | Bacteria | 1770 |
| 356 | Ga0207645_10328763 | 3300025907 | Bacteria | 1021 |
| 357 | Ga0207643_10200467 | 3300025908 | Bacteria | 1215 |
| 358 | Ga0207643_10474128 | 3300025908 | Bacteria | 798 |
| 359 | Ga0207643_10856882 | 3300025908 | Bacteria | 589 |
| 360 | Ga0207705_10006176 | 3300025909 | Bacteria | 8910 |
| 361 | Ga0207705_10391858 | 3300025909 | Bacteria | 1074 |
| 362 | Ga0207705_11331398 | 3300025909 | Bacteria | 548 |
| 363 | Ga0207654_10083868 | 3300025911 | Bacteria | 1925 |
| 364 | Ga0207654_10617362 | 3300025911 | Bacteria | 775 |
| 365 | Ga0207654_10809271 | 3300025911 | Bacteria | 677 |
| 366 | Ga0207707_10062398 | 3300025912 | Bacteria | 3243 |
| 367 | Ga0207707_10446309 | 3300025912 | Bacteria | 1107 |
| 368 | Ga0207707_10558665 | 3300025912 | Bacteria | 972 |
| 369 | Ga0207707_11070227 | 3300025912 | Bacteria | 659 |
| 370 | Ga0207695_10064554 | 3300025913 | Bacteria | 3768 |
| 371 | Ga0207671_10381398 | 3300025914 | Bacteria | 1120 |
| 372 | Ga0207671_10502612 | 3300025914 | Bacteria | 966 |
| 373 | Ga0207693_10025189 | 3300025915 | Bacteria | 4717 |
| 374 | Ga0207693_10122936 | 3300025915 | Bacteria | 2039 |
| 375 | Ga0207693_10545068 | 3300025915 | Bacteria | 905 |
| 376 | Ga0207693_10679029 | 3300025915 | Bacteria | 799 |
| 377 | Ga0207663_10037777 | 3300025916 | Bacteria | 2913 |
| 378 | Ga0207663_10063664 | 3300025916 | Bacteria | 2350 |
| 379 | Ga0207663_10165842 | 3300025916 | Bacteria | 1564 |
| 380 | Ga0207663_10507754 | 3300025916 | Bacteria | 937 |
| 381 | Ga0207660_10477251 | 3300025917 | Bacteria | 1010 |
| 382 | Ga0207660_10909211 | 3300025917 | Bacteria | 718 |
| 383 | Ga0207662_10037298 | 3300025918 | Bacteria | 2844 |
| 384 | Ga0207662_10047231 | 3300025918 | Bacteria | 2550 |
| 385 | Ga0207657_10085109 | 3300025919 | Bacteria | 2649 |
| 386 | Ga0207649_10298290 | 3300025920 | Bacteria | 1178 |
| 387 | Ga0207649_11420749 | 3300025920 | Bacteria | 549 |
| 388 | Ga0207652_10083761 | 3300025921 | Bacteria | 2793 |
| 389 | Ga0207652_10216561 | 3300025921 | Bacteria | 1725 |
| 390 | Ga0207652_10818039 | 3300025921 | Bacteria | 826 |
| 391 | Ga0207646_10840462 | 3300025922 | Bacteria | 816 |
| 392 | Ga0207646_11079106 | 3300025922 | Bacteria | 707 |
| 393 | Ga0207681_10240383 | 3300025923 | Bacteria | 1409 |
| 394 | Ga0207681_10331355 | 3300025923 | Bacteria | 1213 |
| 395 | Ga0207681_10382988 | 3300025923 | Bacteria | 1132 |
| 396 | Ga0207681_11712390 | 3300025923 | Bacteria | 525 |
| 397 | Ga0207694_10266182 | 3300025924 | Bacteria | 1405 |
| 398 | Ga0207694_10770924 | 3300025924 | Bacteria | 812 |
| 399 | Ga0207694_11129973 | 3300025924 | Bacteria | 663 |
| 400 | Ga0207694_11263972 | 3300025924 | Bacteria | 624 |
| 401 | Ga0207694_11881292 | 3300025924 | Bacteria | 502 |
| 402 | Ga0207650_10100767 | 3300025925 | Bacteria | 2223 |
| 403 | Ga0207650_10424851 | 3300025925 | Bacteria | 1103 |
| 404 | Ga0207687_10369567 | 3300025927 | Bacteria | 1172 |
| 405 | Ga0207687_10651144 | 3300025927 | Bacteria | 891 |
| 406 | Ga0207687_11003745 | 3300025927 | Bacteria | 716 |
| 407 | Ga0207687_11835544 | 3300025927 | Bacteria | 519 |
| 408 | Ga0207700_10335534 | 3300025928 | Bacteria | 1313 |
| 409 | Ga0207700_10382401 | 3300025928 | Bacteria | 1231 |
| 410 | Ga0207700_10487522 | 3300025928 | Bacteria | 1090 |
| 411 | Ga0207700_11328170 | 3300025928 | Bacteria | 640 |
| 412 | Ga0207664_10304558 | 3300025929 | Bacteria | 1403 |
| 413 | Ga0207664_10644234 | 3300025929 | Bacteria | 952 |
| 414 | Ga0207664_10678835 | 3300025929 | Bacteria | 926 |
| 415 | Ga0207664_10996599 | 3300025929 | Bacteria | 751 |
| 416 | Ga0207644_10028196 | 3300025931 | Bacteria | 3885 |
| 417 | Ga0207644_10033032 | 3300025931 | Bacteria | 3614 |
| 418 | Ga0207644_10574517 | 3300025931 | Bacteria | 934 |
| 419 | Ga0207690_10117745 | 3300025932 | Bacteria | 1924 |
| 420 | Ga0207690_10212144 | 3300025932 | Bacteria | 1477 |
| 421 | Ga0207690_10625745 | 3300025932 | Bacteria | 880 |
| 422 | Ga0207690_11047547 | 3300025932 | Bacteria | 679 |
| 423 | Ga0207706_10023343 | 3300025933 | Bacteria | 5555 |
| 424 | Ga0207706_10484330 | 3300025933 | Bacteria | 1069 |
| 425 | Ga0207706_11677108 | 3300025933 | Bacteria | 512 |
| 426 | Ga0207686_10548650 | 3300025934 | Bacteria | 903 |
| 427 | Ga0207686_10586208 | 3300025934 | Bacteria | 876 |
| 428 | Ga0207709_10023999 | 3300025935 | Bacteria | 3478 |
| 429 | Ga0207709_10076702 | 3300025935 | Bacteria | 2140 |
| 430 | Ga0207709_11212929 | 3300025935 | Bacteria | 622 |
| 431 | Ga0207670_10005994 | 3300025936 | Bacteria | 6716 |
| 432 | Ga0207670_10145887 | 3300025936 | Bacteria | 1750 |
| 433 | Ga0207670_11734092 | 3300025936 | Bacteria | 531 |
| 434 | Ga0207669_10030512 | 3300025937 | Bacteria | 2996 |
| 435 | Ga0207669_10053059 | 3300025937 | Bacteria | 2440 |
| 436 | Ga0207669_10192846 | 3300025937 | Bacteria | 1471 |
| 437 | Ga0207704_10025389 | 3300025938 | Bacteria | 3232 |
| 438 | Ga0207704_10710298 | 3300025938 | Bacteria | 833 |
| 439 | Ga0207704_10783637 | 3300025938 | Bacteria | 795 |
| 440 | Ga0207665_10047516 | 3300025939 | Bacteria | 2878 |
| 441 | Ga0207665_10047757 | 3300025939 | Bacteria | 2871 |
| 442 | Ga0207665_10066144 | 3300025939 | Bacteria | 2459 |
| 443 | Ga0207665_10265159 | 3300025939 | Bacteria | 1274 |
| 444 | Ga0207665_11668762 | 3300025939 | Bacteria | 505 |
| 445 | Ga0207691_10035922 | 3300025940 | Bacteria | 4594 |
| 446 | Ga0207691_10401236 | 3300025940 | Bacteria | 1169 |
| 447 | Ga0207711_10016693 | 3300025941 | Bacteria | 6096 |
| 448 | Ga0207711_10143470 | 3300025941 | Bacteria | 2150 |
| 449 | Ga0207711_10239269 | 3300025941 | Bacteria | 1664 |
| 450 | Ga0207711_10866919 | 3300025941 | Bacteria | 840 |
| 451 | Ga0207711_11041230 | 3300025941 | Bacteria | 758 |
| 452 | Ga0207711_11352534 | 3300025941 | Bacteria | 654 |
| 453 | Ga0207689_10171637 | 3300025942 | Bacteria | 1788 |
| 454 | Ga0207661_11117637 | 3300025944 | Bacteria | 725 |
| 455 | Ga0207661_11460317 | 3300025944 | Bacteria | 627 |
| 456 | Ga0207679_10452684 | 3300025945 | Bacteria | 1139 |
| 457 | Ga0207679_10803813 | 3300025945 | Bacteria | 857 |
| 458 | Ga0207667_10014848 | 3300025949 | Bacteria | 8857 |
| 459 | Ga0207667_10071501 | 3300025949 | Bacteria | 3607 |
| 460 | Ga0207667_11391231 | 3300025949 | Bacteria | 675 |
| 461 | Ga0207651_10163981 | 3300025960 | Bacteria | 1745 |
| 462 | Ga0207651_10366380 | 3300025960 | Bacteria | 1218 |
| 463 | Ga0207651_11659424 | 3300025960 | Bacteria | 576 |
| 464 | Ga0207712_10238461 | 3300025961 | Bacteria | 1464 |
| 465 | Ga0207712_10386705 | 3300025961 | Bacteria | 1172 |
| 466 | Ga0207712_12054090 | 3300025961 | Bacteria | 511 |
| 467 | Ga0207668_10153748 | 3300025972 | Bacteria | 1784 |
| 468 | Ga0207668_10174207 | 3300025972 | Bacteria | 1690 |
| 469 | Ga0207668_10363426 | 3300025972 | Bacteria | 1213 |
| 470 | Ga0207668_10455826 | 3300025972 | Bacteria | 1092 |
| 471 | Ga0207668_11208169 | 3300025972 | Bacteria | 679 |
| 472 | Ga0207668_11221144 | 3300025972 | Bacteria | 676 |
| 473 | Ga0207640_10656639 | 3300025981 | Bacteria | 894 |
| 474 | Ga0207640_11151240 | 3300025981 | Bacteria | 688 |
| 475 | Ga0207658_10244476 | 3300025986 | Bacteria | 1522 |
| 476 | Ga0207658_10355121 | 3300025986 | Bacteria | 1277 |
| 477 | Ga0207658_10390143 | 3300025986 | Bacteria | 1221 |
| 478 | Ga0207658_11140289 | 3300025986 | Bacteria | 712 |
| 479 | Ga0207677_11237551 | 3300026023 | Bacteria | 684 |
| 480 | Ga0207703_10072639 | 3300026035 | Bacteria | 2844 |
| 481 | Ga0207703_10075818 | 3300026035 | Bacteria | 2788 |
| 482 | Ga0207703_10155570 | 3300026035 | Bacteria | 1997 |
| 483 | Ga0207703_10167619 | 3300026035 | Bacteria | 1929 |
| 484 | Ga0207703_10184041 | 3300026035 | Bacteria | 1845 |
| 485 | Ga0207703_10389005 | 3300026035 | Bacteria | 1292 |
| 486 | Ga0207703_10608713 | 3300026035 | Bacteria | 1034 |
| 487 | Ga0207639_10262761 | 3300026041 | Bacteria | 1510 |
| 488 | Ga0207639_10358711 | 3300026041 | Bacteria | 1304 |
| 489 | Ga0207639_10573109 | 3300026041 | Bacteria | 1038 |
| 490 | Ga0207639_11639258 | 3300026041 | Bacteria | 603 |
| 491 | Ga0207639_12068842 | 3300026041 | Bacteria | 530 |
| 492 | Ga0207678_10047576 | 3300026067 | Bacteria | 3709 |
| 493 | Ga0207678_10225478 | 3300026067 | Bacteria | 1604 |
| 494 | Ga0207678_10471182 | 3300026067 | Bacteria | 1093 |
| 495 | Ga0207678_10959460 | 3300026067 | Bacteria | 756 |
| 496 | Ga0207678_11159352 | 3300026067 | Bacteria | 684 |
| 497 | Ga0207708_10461568 | 3300026075 | Bacteria | 1059 |
| 498 | Ga0207708_11384615 | 3300026075 | Bacteria | 617 |
| 499 | Ga0207708_11796022 | 3300026075 | Bacteria | 538 |
| 500 | Ga0207702_10886797 | 3300026078 | Bacteria | 884 |
| 501 | Ga0207641_10035550 | 3300026088 | Bacteria | 4152 |
| 502 | Ga0207641_10588416 | 3300026088 | Bacteria | 1088 |
| 503 | Ga0207641_10749434 | 3300026088 | Bacteria | 964 |
| 504 | Ga0207648_10083791 | 3300026089 | Bacteria | 2781 |
| 505 | Ga0207648_10418801 | 3300026089 | Bacteria | 1216 |
| 506 | Ga0207648_11445595 | 3300026089 | Bacteria | 646 |
| 507 | Ga0207676_10068801 | 3300026095 | Bacteria | 2833 |
| 508 | Ga0207676_10127756 | 3300026095 | Bacteria | 2156 |
| 509 | Ga0207676_10566587 | 3300026095 | Bacteria | 1087 |
| 510 | Ga0207676_11068980 | 3300026095 | Bacteria | 797 |
| 511 | Ga0207674_10070190 | 3300026116 | Bacteria | 3522 |
| 512 | Ga0207674_10184205 | 3300026116 | Bacteria | 2038 |
| 513 | Ga0207674_10926646 | 3300026116 | Bacteria | 839 |
| 514 | Ga0207674_11021541 | 3300026116 | Bacteria | 796 |
| 515 | Ga0207675_100218465 | 3300026118 | Bacteria | 1836 |
| 516 | Ga0207675_100231001 | 3300026118 | Bacteria | 1785 |
| 517 | Ga0207675_101346384 | 3300026118 | Bacteria | 734 |
| 518 | Ga0207675_102686508 | 3300026118 | Bacteria | 506 |
| 519 | Ga0207683_10028565 | 3300026121 | Bacteria | 4824 |
| 520 | Ga0207683_10039006 | 3300026121 | Bacteria | 4142 |
| 521 | Ga0207683_10119501 | 3300026121 | Bacteria | 2365 |
| 522 | Ga0207683_10350591 | 3300026121 | Bacteria | 1355 |
| 523 | Ga0207683_10822902 | 3300026121 | Bacteria | 862 |
| 524 | Ga0207698_10789617 | 3300026142 | Bacteria | 951 |
| 525 | Ga0207698_12045752 | 3300026142 | Bacteria | 587 |
| 526 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 527 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 528 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 529 | Ga0209179_1105220 | 3300027512 | Bacteria | 629 |
| 530 | Ga0209813_10036432 | 3300027866 | Bacteria | 1478 |
| 531 | Ga0268266_10006418 | 3300028379 | Bacteria | 10775 |
| 532 | Ga0268266_10475495 | 3300028379 | Bacteria | 1190 |
| 533 | Ga0268266_11163683 | 3300028379 | Bacteria | 746 |
| 534 | Ga0268266_11165076 | 3300028379 | Bacteria | 745 |
| 535 | Ga0268266_11516329 | 3300028379 | Bacteria | 646 |
| 536 | Ga0268266_12081840 | 3300028379 | Bacteria | 540 |
| 537 | Ga0268265_10080420 | 3300028380 | Bacteria | 2570 |
| 538 | Ga0268265_10219493 | 3300028380 | Bacteria | 1662 |
| 539 | Ga0268265_10343317 | 3300028380 | Bacteria | 1360 |
| 540 | Ga0268265_10593419 | 3300028380 | Bacteria | 1057 |
| 541 | Ga0268265_11426959 | 3300028380 | Bacteria | 695 |
| 542 | Ga0268264_10000194 | 3300028381 | Bacteria | 125395 |
| 543 | Ga0268264_10172181 | 3300028381 | Bacteria | 1959 |
| 544 | Ga0268264_10391927 | 3300028381 | Bacteria | 1333 |
| 545 | Ga0268264_10421011 | 3300028381 | Bacteria | 1288 |
| 546 | Ga0268264_10724720 | 3300028381 | Bacteria | 989 |
| 547 | Ga0268264_12165850 | 3300028381 | Bacteria | 564 |
| 548 | Ga0265319_1080633 | 3300028563 | Bacteria | 1034 |
| 549 | Ga0265334_10278992 | 3300028573 | Bacteria | 573 |
| 550 | Ga0265318_10044086 | 3300028577 | Bacteria | 1688 |
| 551 | Ga0265323_10000720 | 3300028653 | Bacteria | 17903 |
| 552 | Ga0265336_10000640 | 3300028666 | Bacteria | 19119 |
| 553 | Ga0307517_10468816 | 3300028786 | Bacteria | 648 |
| 554 | Ga0307517_10509457 | 3300028786 | Bacteria | 610 |
| 555 | Ga0307515_10711495 | 3300028794 | Bacteria | 621 |
| 556 | Ga0265338_10001434 | 3300028800 | Bacteria | 38730 |
| 557 | Ga0265338_10561380 | 3300028800 | Bacteria | 798 |
| 558 | Ga0265324_10001605 | 3300029957 | Bacteria | 12590 |
| 559 | Ga0265762_1043916 | 3300030760 | Bacteria | 881 |
| 560 | Ga0265762_1093671 | 3300030760 | Bacteria | 658 |
| 561 | Ga0265762_1131184 | 3300030760 | Bacteria | 581 |
| 562 | Ga0265775_102827 | 3300030762 | Bacteria | 915 |
| 563 | Ga0265767_106021 | 3300030836 | Bacteria | 748 |
| 564 | Ga0265777_114020 | 3300030877 | Bacteria | 616 |
| 565 | Ga0265769_121512 | 3300030888 | Bacteria | 515 |
| 566 | Ga0265771_1032895 | 3300031010 | Bacteria | 504 |
| 567 | Ga0265760_10129268 | 3300031090 | Bacteria | 816 |
| 568 | Ga0265325_10000126 | 3300031241 | Bacteria | 52410 |
| 569 | Ga0265325_10000470 | 3300031241 | Bacteria | 29219 |
| 570 | Ga0265325_10093811 | 3300031241 | Bacteria | 1476 |
| 571 | Ga0265340_10095479 | 3300031247 | Bacteria | 1386 |
| 572 | Ga0265339_10172626 | 3300031249 | Bacteria | 1081 |
| 573 | Ga0265339_10322841 | 3300031249 | Bacteria | 732 |
| 574 | Ga0265327_10120506 | 3300031251 | Bacteria | 1243 |
| 575 | Ga0265327_10509724 | 3300031251 | Bacteria | 518 |
| 576 | Ga0265316_10196971 | 3300031344 | Bacteria | 1495 |
| 577 | Ga0307513_10276584 | 3300031456 | Bacteria | 1459 |
| 578 | Ga0307509_10947770 | 3300031507 | Bacteria | 526 |
| 579 | Ga0310117_121285 | 3300031592 | Bacteria | 647 |
| 580 | Ga0307508_10278611 | 3300031616 | Bacteria | 1265 |
| 581 | Ga0307508_10316059 | 3300031616 | Bacteria | 1154 |
| 582 | Ga0265314_10017036 | 3300031711 | Bacteria | 5713 |
| 583 | Ga0265342_10089626 | 3300031712 | Bacteria | 1765 |
| 584 | Ga0265342_10491021 | 3300031712 | Bacteria | 627 |
| 585 | Ga0307406_10942930 | 3300031901 | Bacteria | 737 |
| 586 | Ga0307407_10357590 | 3300031903 | Bacteria | 1036 |
| 587 | Ga0307409_101208794 | 3300031995 | Bacteria | 779 |
| 588 | Ga0307409_101541459 | 3300031995 | Bacteria | 692 |
| 589 | Ga0307416_101374241 | 3300032002 | Bacteria | 812 |
| 590 | Ga0307416_101598931 | 3300032002 | Bacteria | 757 |
| 591 | Ga0307416_102314245 | 3300032002 | Bacteria | 638 |
| 592 | Ga0307414_10405696 | 3300032004 | Bacteria | 1185 |
| 593 | Ga0307414_11592044 | 3300032004 | Bacteria | 609 |
| 594 | Ga0307411_10057196 | 3300032005 | Bacteria | 2575 |
| 595 | Ga0307415_100385194 | 3300032126 | Bacteria | 1192 |
| 596 | Ga0307507_10325907 | 3300033179 | Bacteria | 921 |
| 597 | Ga0373948_0205085 | 3300034817 | Bacteria | 516 |
| 598 | Ga0373938_0044796 | 3300034957 | Bacteria | 994 |
| 599 | Ga0373926_0028112 | 3300035083 | Bacteria | 1973 |
| 600 | Ga0373926_0423326 | 3300035083 | Bacteria | 527 |
| 601 | Ga0373926_0454273 | 3300035083 | Bacteria | 509 |
| 602 | Ga0373929_0033882 | 3300035085 | Bacteria | 1106 |
| 603 | Ga0373934_0020498 | 3300035086 | Bacteria | 2540 |
| 604 | Ga0373944_0049719 | 3300035089 | Bacteria | 1318 |
| 605 | Ga0373949_0017442 | 3300035090 | Bacteria | 1619 |
| 606 | Ga0373949_0129113 | 3300035090 | Bacteria | 716 |
| 607 | Ga0373952_0012840 | 3300035092 | Bacteria | 1654 |
| 608 | Ga0373952_0051555 | 3300035092 | Bacteria | 983 |
| 609 | Ga0373952_0170343 | 3300035092 | Bacteria | 622 |
| 610 | Ga0373923_0004214 | 3300035111 | Bacteria | 4748 |
| 611 | Ga0373932_0015356 | 3300035112 | Bacteria | 1940 |
| 612 | Ga0373932_0038954 | 3300035112 | Bacteria | 1361 |
| 613 | Ga0373932_0156678 | 3300035112 | Bacteria | 785 |
| 614 | Ga0373936_0018243 | 3300035113 | Bacteria | 2708 |
| 615 | Ga0373936_0042601 | 3300035113 | Bacteria | 1823 |
| 616 | Ga0373936_0457532 | 3300035113 | Bacteria | 590 |
| 617 | Ga0373939_0082617 | 3300035114 | Bacteria | 1070 |
| 618 | Ga0373939_0400481 | 3300035114 | Bacteria | 569 |
| 619 | Ga0373945_0015924 | 3300035116 | Bacteria | 2533 |
| 620 | Ga0373945_0053511 | 3300035116 | Bacteria | 1490 |
| 621 | Ga0373953_0029700 | 3300035117 | Bacteria | 2116 |
| 622 | Ga0373954_0040683 | 3300035118 | Bacteria | 2166 |
| 623 | Ga0373956_0129241 | 3300035119 | Bacteria | 1182 |
| 624 | Ga0373957_0063649 | 3300035120 | Bacteria | 1433 |
| 625 | Ga0373943_0094530 | 3300035170 | Bacteria | 1553 |
| 626 | Ga0373943_0295351 | 3300035170 | Bacteria | 919 |
| 627 | Ga0373946_0041154 | 3300035171 | Bacteria | 1894 |
| 628 | Ga0373946_0104020 | 3300035171 | Bacteria | 1277 |
| 629 | Ga0373946_0190840 | 3300035171 | Bacteria | 977 |
| 630 | Ga0373955_0173360 | 3300035172 | Bacteria | 1277 |
| 631 | Ga0373942_0116036 | 3300035207 | Bacteria | 832 |
| 632 | Ga0373961_0243167 | 3300035241 | Bacteria | 649 |
| 633 | Ga0373962_0076787 | 3300035242 | Bacteria | 1008 |
| 634 | Ga0373924_0075521 | 3300035410 | Bacteria | 1426 |
| 635 | Ga0373924_0221097 | 3300035410 | Bacteria | 837 |
| 636 | Ga0373931_0012673 | 3300035691 | Bacteria | 4088 |
| 637 | Ga0373931_0262031 | 3300035691 | Bacteria | 1055 |
| 638 | Ga0373931_0402488 | 3300035691 | Bacteria | 867 |
| 639 | Ga0373931_1056126 | 3300035691 | Bacteria | 551 |
| 640 | Ga0373935_0008303 | 3300035692 | Bacteria | 6213 |
| 641 | Ga0373935_0212024 | 3300035692 | Bacteria | 1342 |
| 642 | Ga0373935_0548796 | 3300035692 | Bacteria | 842 |
| 643 | Ga0373935_0695297 | 3300035692 | Bacteria | 748 |
| 644 | Ga0373927_0042629 | 3300035695 | Bacteria | 2940 |
| 645 | Ga0373927_0048081 | 3300035695 | Bacteria | 2758 |
| 646 | Ga0373927_0431383 | 3300035695 | Bacteria | 870 |
| 647 | Ga0373927_0631216 | 3300035695 | Bacteria | 708 |
| 648 | Ga0373927_1163135 | 3300035695 | Bacteria | 509 |
| 649 | Ga0373933_0257013 | 3300035724 | Bacteria | 1126 |
| 650 | Ga0373947_0016229 | 3300035725 | Bacteria | 4280 |
| 651 | Ga0373947_0996504 | 3300035725 | Bacteria | 571 |
| 652 | Ga0373947_1111872 | 3300035725 | Bacteria | 539 |
| 653 | Ga0373937_0029238 | 3300036401 | Bacteria | 4990 |
| 654 | Ga0373937_0065822 | 3300036401 | Bacteria | 3337 |
| 655 | Ga0373937_0066365 | 3300036401 | Bacteria | 3323 |
| 656 | Ga0265778_067364 | 3300036457 | Bacteria | 505 |
| 657 | Ga0373925_0065401 | 3300037068 | Bacteria | 2739 |
| 658 | Ga0373925_0132097 | 3300037068 | Bacteria | 1947 |
| 659 | Ga0373925_0323039 | 3300037068 | Bacteria | 1249 |
| 660 | Ga0373925_0328877 | 3300037068 | Bacteria | 1238 |
| 661 | Ga0373925_0486669 | 3300037068 | Bacteria | 1012 |
| 662 | Ga0373925_1336576 | 3300037068 | Bacteria | 588 |
| 663 | Ga0395899_0435588 | 3300037312 | Bacteria | 861 |
| 664 | Ga0395900_0304918 | 3300037418 | Bacteria | 1577 |
| 665 | Ga0395900_1046107 | 3300037418 | Bacteria | 735 |
| 666 | Ga0395898_0012221 | 3300037466 | Bacteria | 8877 |
| 667 | Ga0395898_0050374 | 3300037466 | Bacteria | 4076 |
| 668 | Ga0395898_0494678 | 3300037466 | Bacteria | 1163 |
| 669 | Ga0395898_0508197 | 3300037466 | Bacteria | 1146 |
| 670 | Ga0395905_1367532 | 3300037471 | Bacteria | 612 |
| 671 | Ga0395905_1379564 | 3300037471 | Bacteria | 609 |
| 672 | Ga0395905_1859113 | 3300037471 | Bacteria | 508 |
| 673 | Ga0436364_0036886 | 3300037853 | Bacteria | 597 |
| 674 | Ga0436364_0315770 | 3300037853 | Bacteria | 1023 |
| 675 | Ga0436364_1186832 | 3300037853 | Bacteria | 1205 |
| 676 | Ga0436364_1233691 | 3300037853 | Bacteria | 975 |
| 677 | Ga0436364_1286138 | 3300037853 | Bacteria | 1134 |
| 678 | Ga0436364_1474561 | 3300037853 | Bacteria | 619 |
| 679 | Ga0436364_1516960 | 3300037853 | Bacteria | 2108 |
| 680 | Ga0436364_1531434 | 3300037853 | Bacteria | 1435 |
| 681 | Ga0395901_0041272 | 3300038443 | Bacteria | 4781 |
| 682 | Ga0395901_0383425 | 3300038443 | Bacteria | 1446 |
| 683 | Ga0395901_0722658 | 3300038443 | Bacteria | 991 |
| 684 | Ga0400483_289328 | 3300039062 | Bacteria | 3270 |
| 685 | Ga0436365_0160999 | 3300039437 | Bacteria | 760 |
| 686 | Ga0436365_0703944 | 3300039437 | Bacteria | 21999 |
| 687 | Ga0436365_0900444 | 3300039437 | Bacteria | 1100 |
| 688 | Ga0436365_1141253 | 3300039437 | Bacteria | 1345 |
| 689 | Ga0436365_1491242 | 3300039437 | Bacteria | 529 |
| 690 | Ga0436360_0097049 | 3300039438 | Bacteria | 1219 |
| 691 | Ga0436360_0547363 | 3300039438 | Bacteria | 1946 |
| 692 | Ga0436360_0855640 | 3300039438 | Bacteria | 1164 |
| 693 | Ga0436360_0918467 | 3300039438 | Bacteria | 701 |
| 694 | Ga0436360_1151401 | 3300039438 | Bacteria | 2548 |
| 695 | Ga0436361_0021799 | 3300039447 | Bacteria | 614 |
| 696 | Ga0436361_0044782 | 3300039447 | Bacteria | 1222 |
| 697 | Ga0436361_0250690 | 3300039447 | Bacteria | 682 |
| 698 | Ga0436361_0690845 | 3300039447 | Bacteria | 1382 |
| 699 | Ga0436361_0720097 | 3300039447 | Bacteria | 2359 |
| 700 | Ga0436363_0154853 | 3300039450 | Bacteria | 639 |
| 701 | Ga0436363_0211976 | 3300039450 | Bacteria | 1158 |
| 702 | Ga0436363_0965241 | 3300039450 | Bacteria | 723 |
| 703 | Ga0436363_1109504 | 3300039450 | Bacteria | 634 |
| 704 | Ga0436363_1262652 | 3300039450 | Bacteria | 1263 |
| 705 | Ga0436363_1322015 | 3300039450 | Bacteria | 756 |
| 706 | Ga0436363_1502120 | 3300039450 | Bacteria | 3893 |
| 707 | Ga0436362_0421234 | 3300039453 | Bacteria | 8413 |
| 708 | Ga0436362_0869632 | 3300039453 | Bacteria | 1069 |
| 709 | Ga0451789_0350328 | 3300041443 | Bacteria | 858 |
| 710 | Ga0451794_41682 | 3300041446 | Bacteria | 536 |
| 711 | Ga0451793_0188671 | 3300041452 | Bacteria | 612 |
| 712 | Ga0451797_0893948 | 3300041453 | Bacteria | 702 |
| 713 | Ga0451795_0161699 | 3300041456 | Bacteria | 674 |
| 714 | Ga0451795_0986905 | 3300041456 | Bacteria | 547 |
| 715 | Ga0451798_0884644 | 3300041458 | Bacteria | 601 |
| 716 | Ga0451800_0165008 | 3300041459 | Bacteria | 531 |
| 717 | Ga0451800_1521909 | 3300041459 | Bacteria | 614 |
| 718 | Ga0451802_0364258 | 3300041460 | Bacteria | 519 |
| 719 | Ga0451805_034073 | 3300041461 | Bacteria | 676 |
| 720 | Ga0451804_0197570 | 3300041463 | Bacteria | 719 |
| 721 | Ga0451837_1526070 | 3300041494 | Bacteria | 654 |
| 722 | Ga0451839_0615464 | 3300041496 | Bacteria | 638 |
| 723 | Ga0451839_1009338 | 3300041496 | Bacteria | 1237 |
| 724 | Ga0451841_0002499 | 3300041498 | Bacteria | 503 |
| 725 | Ga0451841_0696736 | 3300041498 | Bacteria | 675 |
| 726 | Ga0439459_0021955 | 3300042438 | Bacteria | 1231 |
| 727 | Ga0451577_0073171 | 3300042876 | Bacteria | 3058 |
| 728 | Ga0466969_0309758 | 3300044656 | Bacteria | 715 |
| 729 | Ga0466969_0608483 | 3300044656 | Bacteria | 502 |
| 730 | Ga0466972_0000053 | 3300044658 | Bacteria | 112876 |
| 731 | Ga0466972_0014315 | 3300044658 | Bacteria | 3974 |
| 732 | Ga0453683_0163048 | 3300044673 | Bacteria | 1411 |
| 733 | Ga0453683_0917818 | 3300044673 | Bacteria | 579 |
| 734 | Ga0453683_1126951 | 3300044673 | Bacteria | 524 |
| 735 | Ga0466966_0000322 | 3300044684 | Bacteria | 30928 |
| 736 | Ga0466966_0353867 | 3300044684 | Bacteria | 882 |
| 737 | Ga0466961_0002390 | 3300044693 | Bacteria | 11659 |
| 738 | Ga0466961_0449315 | 3300044693 | Bacteria | 780 |
| 739 | Ga0466961_0672400 | 3300044693 | Bacteria | 621 |
| 740 | Ga0466963_0005897 | 3300044694 | Bacteria | 7217 |
| 741 | Ga0466963_0012246 | 3300044694 | Bacteria | 5245 |
| 742 | Ga0466963_0431621 | 3300044694 | Bacteria | 929 |
| 743 | Ga0466964_0029953 | 3300044706 | Bacteria | 2152 |
| 744 | Ga0466964_0241002 | 3300044706 | Bacteria | 887 |
| 745 | Ga0466964_0402475 | 3300044706 | Bacteria | 715 |
| 746 | Ga0466964_0737687 | 3300044706 | Bacteria | 552 |
| 747 | Ga0453684_0409847 | 3300044712 | Bacteria | 1516 |
| 748 | Ga0453684_0781325 | 3300044712 | Bacteria | 1031 |
| 749 | Ga0466971_0112315 | 3300044719 | Bacteria | 1258 |
| 750 | Ga0466968_0021394 | 3300044735 | Bacteria | 2619 |
| 751 | Ga0466968_0082883 | 3300044735 | Bacteria | 1412 |
| 752 | Ga0466968_0401330 | 3300044735 | Bacteria | 672 |
| 753 | Ga0466968_0574764 | 3300044735 | Bacteria | 567 |
| 754 | Ga0466970_0015654 | 3300044765 | Bacteria | 3904 |
| 755 | Ga0466970_0182060 | 3300044765 | Bacteria | 1166 |
| 756 | Ga0466970_0219397 | 3300044765 | Bacteria | 1061 |
| 757 | Ga0466957_0163208 | 3300044842 | Bacteria | 1448 |
| 758 | Ga0466957_0392950 | 3300044842 | Bacteria | 947 |
| 759 | Ga0466957_1408171 | 3300044842 | Bacteria | 507 |
| 760 | Ga0466960_0000619 | 3300044901 | Bacteria | 12265 |
| 761 | Ga0466960_0558741 | 3300044901 | Bacteria | 676 |
| 762 | Ga0466959_0045817 | 3300045049 | Bacteria | 3220 |
| 763 | Ga0466959_0053003 | 3300045049 | Bacteria | 2968 |
| 764 | Ga0466959_0098485 | 3300045049 | Bacteria | 2095 |
| 765 | Ga0466959_0171755 | 3300045049 | Bacteria | 1520 |
| 766 | Ga0466959_0419679 | 3300045049 | Bacteria | 908 |
| 767 | Ga0451576_0000094 | 3300045051 | Bacteria | 225875 |
| 768 | Ga0466958_0558197 | 3300045836 | Bacteria | 744 |
| 769 | Ga0466958_0953609 | 3300045836 | Bacteria | 560 |
| 770 | Ga0466967_0065989 | 3300045976 | Bacteria | 3224 |
| 771 | Ga0466967_0091722 | 3300045976 | Bacteria | 2761 |
| 772 | Ga0466967_0263682 | 3300045976 | Bacteria | 1649 |
| 773 | Ga0466967_0337186 | 3300045976 | Bacteria | 1457 |
| 774 | Ga0466967_0347323 | 3300045976 | Bacteria | 1435 |
| 775 | Ga0466967_1118636 | 3300045976 | Bacteria | 785 |
| 776 | Ga0466967_2385499 | 3300045976 | Bacteria | 524 |
| 777 | Ga0495627_116590 | 3300046453 | Bacteria | 756 |
| 778 | Ga0495592_0437132 | 3300046454 | Bacteria | 822 |
| 779 | Ga0495603_0000617 | 3300046455 | Bacteria | 19921 |
| 780 | Ga0495603_0019971 | 3300046455 | Bacteria | 4059 |
| 781 | Ga0495590_0066232 | 3300046457 | Bacteria | 1265 |
| 782 | Ga0495590_0076182 | 3300046457 | Bacteria | 1180 |
| 783 | Ga0495590_0279095 | 3300046457 | Bacteria | 625 |
| 784 | Ga0495590_0351195 | 3300046457 | Bacteria | 560 |
| 785 | Ga0495629_0034001 | 3300046459 | Bacteria | 3605 |
| 786 | Ga0495638_0013781 | 3300046460 | Bacteria | 5489 |
| 787 | Ga0495638_0026784 | 3300046460 | Bacteria | 3735 |
| 788 | Ga0495638_0069617 | 3300046460 | Bacteria | 2156 |
| 789 | Ga0495638_0109890 | 3300046460 | Bacteria | 1639 |
| 790 | Ga0495638_0481729 | 3300046460 | Bacteria | 628 |
| 791 | Ga0495638_0510988 | 3300046460 | Bacteria | 603 |
| 792 | Ga0495641_0264045 | 3300046461 | Bacteria | 775 |
| 793 | Ga0495651_0039889 | 3300046462 | Bacteria | 3653 |
| 794 | Ga0495651_0208178 | 3300046462 | Bacteria | 1363 |
| 795 | Ga0495651_0252604 | 3300046462 | Bacteria | 1203 |
| 796 | Ga0495653_0144636 | 3300046463 | Bacteria | 1668 |
| 797 | Ga0495653_0522517 | 3300046463 | Bacteria | 738 |
| 798 | Ga0495653_0789965 | 3300046463 | Bacteria | 571 |
| 799 | Ga0495650_0001155 | 3300046471 | Bacteria | 28394 |
| 800 | Ga0495580_0005741 | 3300046472 | Bacteria | 10196 |
| 801 | Ga0495580_0854374 | 3300046472 | Bacteria | 587 |
| 802 | Ga0495582_0006702 | 3300046473 | Bacteria | 6399 |
| 803 | Ga0495582_0422337 | 3300046473 | Bacteria | 769 |
| 804 | Ga0495582_0876641 | 3300046473 | Bacteria | 519 |
| 805 | Ga0495605_0032176 | 3300046474 | Bacteria | 2672 |
| 806 | Ga0495605_0034972 | 3300046474 | Bacteria | 2541 |
| 807 | Ga0495605_0044915 | 3300046474 | Bacteria | 2181 |
| 808 | Ga0495639_0011908 | 3300046475 | Bacteria | 3751 |
| 809 | Ga0495639_0067301 | 3300046475 | Bacteria | 1649 |
| 810 | Ga0495639_0103625 | 3300046475 | Bacteria | 1345 |
| 811 | Ga0495639_0311761 | 3300046475 | Bacteria | 786 |
| 812 | Ga0495639_0568903 | 3300046475 | Bacteria | 581 |
| 813 | Ga0495662_0020580 | 3300046476 | Bacteria | 3193 |
| 814 | Ga0495662_0058065 | 3300046476 | Bacteria | 1869 |
| 815 | Ga0495664_0005513 | 3300046477 | Bacteria | 6951 |
| 816 | Ga0495664_0049584 | 3300046477 | Bacteria | 2492 |
| 817 | Ga0495664_0116722 | 3300046477 | Bacteria | 1613 |
| 818 | Ga0495584_0017189 | 3300046491 | Bacteria | 3686 |
| 819 | Ga0495584_0028785 | 3300046491 | Bacteria | 2816 |
| 820 | Ga0495585_0064045 | 3300046492 | Bacteria | 2016 |
| 821 | Ga0495585_0069895 | 3300046492 | Bacteria | 1916 |
| 822 | Ga0495585_0276396 | 3300046492 | Bacteria | 831 |
| 823 | Ga0495585_0287695 | 3300046492 | Bacteria | 811 |
| 824 | Ga0495585_0428849 | 3300046492 | Bacteria | 634 |
| 825 | Ga0495585_0514745 | 3300046492 | Bacteria | 568 |
| 826 | Ga0495594_0233679 | 3300046499 | Bacteria | 1048 |
| 827 | Ga0495594_0242601 | 3300046499 | Bacteria | 1027 |
| 828 | Ga0495594_0262121 | 3300046499 | Bacteria | 984 |
| 829 | Ga0495594_0550869 | 3300046499 | Bacteria | 654 |
| 830 | Ga0495596_0228189 | 3300046500 | Bacteria | 723 |
| 831 | Ga0495607_0008857 | 3300046501 | Bacteria | 6853 |
| 832 | Ga0495607_0090305 | 3300046501 | Bacteria | 1661 |
| 833 | Ga0495607_0251067 | 3300046501 | Bacteria | 851 |
| 834 | Ga0495607_0253965 | 3300046501 | Bacteria | 845 |
| 835 | Ga0495607_0394482 | 3300046501 | Bacteria | 631 |
| 836 | Ga0495583_0070481 | 3300046506 | Bacteria | 1537 |
| 837 | Ga0495583_0078227 | 3300046506 | Bacteria | 1441 |
| 838 | Ga0495583_0368032 | 3300046506 | Bacteria | 566 |
| 839 | Ga0495606_0001566 | 3300046507 | Bacteria | 29975 |
| 840 | Ga0495606_0012761 | 3300046507 | Bacteria | 6699 |
| 841 | Ga0495606_0034333 | 3300046507 | Bacteria | 3483 |
| 842 | Ga0495606_0039871 | 3300046507 | Bacteria | 3159 |
| 843 | Ga0495606_0075267 | 3300046507 | Bacteria | 2113 |
| 844 | Ga0495606_0154197 | 3300046507 | Bacteria | 1345 |
| 845 | Ga0495606_0510765 | 3300046507 | Bacteria | 605 |
| 846 | Ga0495606_0622683 | 3300046507 | Bacteria | 526 |
| 847 | Ga0495608_0082922 | 3300046511 | Bacteria | 2082 |
| 848 | Ga0495608_0096243 | 3300046511 | Bacteria | 1912 |
| 849 | Ga0495608_0271644 | 3300046511 | Bacteria | 1054 |
| 850 | Ga0495610_0078453 | 3300046512 | Bacteria | 1522 |
| 851 | Ga0495616_0045289 | 3300046513 | Bacteria | 2227 |
| 852 | Ga0495616_0153229 | 3300046513 | Bacteria | 1041 |
| 853 | Ga0495618_0292532 | 3300046514 | Bacteria | 1013 |
| 854 | Ga0495618_0626160 | 3300046514 | Bacteria | 638 |
| 855 | Ga0495620_0353824 | 3300046515 | Bacteria | 557 |
| 856 | Ga0495620_0389075 | 3300046515 | Bacteria | 528 |
| 857 | Ga0495628_0208129 | 3300046516 | Bacteria | 1472 |
| 858 | Ga0495630_0064559 | 3300046517 | Bacteria | 2751 |
| 859 | Ga0495630_0241928 | 3300046517 | Bacteria | 1379 |
| 860 | Ga0495631_0016371 | 3300046518 | Bacteria | 3537 |
| 861 | Ga0495631_0093831 | 3300046518 | Bacteria | 1292 |
| 862 | Ga0495631_0120100 | 3300046518 | Bacteria | 1130 |
| 863 | Ga0495631_0205675 | 3300046518 | Bacteria | 841 |
| 864 | Ga0495631_0265885 | 3300046518 | Bacteria | 731 |
| 865 | Ga0495631_0320169 | 3300046518 | Bacteria | 660 |
| 866 | Ga0495632_0017675 | 3300046519 | Bacteria | 3931 |
| 867 | Ga0495632_0118175 | 3300046519 | Bacteria | 1240 |
| 868 | Ga0495632_0342218 | 3300046519 | Bacteria | 658 |
| 869 | Ga0495637_0036160 | 3300046520 | Bacteria | 2153 |
| 870 | Ga0495643_0011150 | 3300046522 | Bacteria | 5492 |
| 871 | Ga0495643_0326024 | 3300046522 | Bacteria | 693 |
| 872 | Ga0495643_0389680 | 3300046522 | Bacteria | 616 |
| 873 | Ga0495644_0091621 | 3300046523 | Bacteria | 1147 |
| 874 | Ga0495644_0271393 | 3300046523 | Bacteria | 661 |
| 875 | Ga0495644_0277466 | 3300046523 | Bacteria | 653 |
| 876 | Ga0495644_0367660 | 3300046523 | Bacteria | 567 |
| 877 | Ga0495648_0029624 | 3300046524 | Bacteria | 3630 |
| 878 | Ga0495648_0173823 | 3300046524 | Bacteria | 1101 |
| 879 | Ga0495648_0420033 | 3300046524 | Bacteria | 592 |
| 880 | Ga0495663_0313484 | 3300046525 | Bacteria | 567 |
| 881 | Ga0495663_0323900 | 3300046525 | Bacteria | 558 |
| 882 | Ga0495666_0034619 | 3300046526 | Bacteria | 2464 |
| 883 | Ga0495666_0158746 | 3300046526 | Bacteria | 1049 |
| 884 | Ga0495666_0319879 | 3300046526 | Bacteria | 700 |
| 885 | Ga0495666_0489021 | 3300046526 | Bacteria | 550 |
| 886 | Ga0495642_0508511 | 3300046528 | Bacteria | 533 |
| 887 | Ga0495652_0017151 | 3300046529 | Bacteria | 6466 |
| 888 | Ga0495652_0057203 | 3300046529 | Bacteria | 3308 |
| 889 | Ga0495652_0089438 | 3300046529 | Bacteria | 2521 |
| 890 | Ga0495652_0816282 | 3300046529 | Bacteria | 620 |
| 891 | Ga0495654_0015853 | 3300046530 | Bacteria | 3995 |
| 892 | Ga0495654_0159228 | 3300046530 | Bacteria | 992 |
| 893 | Ga0495654_0387415 | 3300046530 | Bacteria | 557 |
| 894 | Ga0495665_0005603 | 3300046531 | Bacteria | 6766 |
| 895 | Ga0495665_0135346 | 3300046531 | Bacteria | 1289 |
| 896 | Ga0495640_0005237 | 3300046533 | Bacteria | 10312 |
| 897 | Ga0495640_0732680 | 3300046533 | Bacteria | 592 |
| 898 | Ga0495586_0118068 | 3300046535 | Bacteria | 1480 |
| 899 | Ga0495587_0052305 | 3300046536 | Bacteria | 2410 |
| 900 | Ga0495587_0082496 | 3300046536 | Bacteria | 1863 |
| 901 | Ga0495587_0364677 | 3300046536 | Bacteria | 804 |
| 902 | Ga0495609_0019411 | 3300046538 | Bacteria | 3145 |
| 903 | Ga0495609_0087339 | 3300046538 | Bacteria | 1358 |
| 904 | Ga0495609_0194033 | 3300046538 | Bacteria | 851 |
| 905 | Ga0495609_0244400 | 3300046538 | Bacteria | 740 |
| 906 | Ga0495609_0342483 | 3300046538 | Bacteria | 604 |
| 907 | Ga0495621_0027947 | 3300046539 | Bacteria | 1914 |
| 908 | Ga0495621_0318831 | 3300046539 | Bacteria | 647 |
| 909 | Ga0495621_0525150 | 3300046539 | Bacteria | 512 |
| 910 | Ga0495597_0072862 | 3300046542 | Bacteria | 1477 |
| 911 | Ga0495645_0001939 | 3300046543 | Bacteria | 14042 |
| 912 | Ga0495645_0010968 | 3300046543 | Bacteria | 6363 |
| 913 | Ga0495645_0074893 | 3300046543 | Bacteria | 2437 |
| 914 | Ga0495645_0217539 | 3300046543 | Bacteria | 1287 |
| 915 | Ga0495645_0586280 | 3300046543 | Bacteria | 687 |
| 916 | Ga0495622_0229507 | 3300046557 | Bacteria | 821 |
| 917 | Ga0495633_0314727 | 3300046558 | Bacteria | 710 |
| 918 | Ga0495667_0028020 | 3300046559 | Bacteria | 3793 |
| 919 | Ga0495667_0086796 | 3300046559 | Bacteria | 2029 |
| 920 | Ga0495667_0167633 | 3300046559 | Bacteria | 1412 |
| 921 | Ga0495656_0026864 | 3300046615 | Bacteria | 2295 |
| 922 | Ga0495656_0046559 | 3300046615 | Bacteria | 1836 |
| 923 | Ga0495656_0074179 | 3300046615 | Bacteria | 1519 |
| 924 | Ga0495656_0090614 | 3300046615 | Bacteria | 1397 |
| 925 | Ga0495656_0153921 | 3300046615 | Bacteria | 1112 |
| 926 | Ga0495668_0013946 | 3300046616 | Bacteria | 4725 |
| 927 | Ga0495668_0047101 | 3300046616 | Bacteria | 2394 |
| 928 | Ga0495668_0270412 | 3300046616 | Bacteria | 931 |
| 929 | Ga0495668_0460986 | 3300046616 | Bacteria | 699 |
| 930 | Ga0495634_0746574 | 3300046642 | Bacteria | 560 |
| 931 | Ga0495611_0091070 | 3300046648 | Bacteria | 1409 |
| 932 | Ga0495611_0222139 | 3300046648 | Bacteria | 879 |
| 933 | Ga0495611_0484364 | 3300046648 | Bacteria | 562 |
| 934 | Ga0495625_0035568 | 3300046660 | Bacteria | 3670 |
| 935 | Ga0495625_0138370 | 3300046660 | Bacteria | 1644 |
| 936 | Ga0495625_0260799 | 3300046660 | Bacteria | 1121 |
| 937 | Ga0495625_0307221 | 3300046660 | Bacteria | 1013 |
| 938 | Ga0495625_0722439 | 3300046660 | Bacteria | 586 |
| 939 | Ga0495635_0037964 | 3300046663 | Bacteria | 3334 |
| 940 | Ga0495659_0043372 | 3300046664 | Bacteria | 1613 |
| 941 | Ga0495659_0393263 | 3300046664 | Bacteria | 597 |
| 942 | Ga0495661_0165205 | 3300046665 | Bacteria | 1185 |
| 943 | Ga0495661_0235255 | 3300046665 | Bacteria | 942 |
| 944 | Ga0495588_0030445 | 3300046674 | Bacteria | 2713 |
| 945 | Ga0495588_0073237 | 3300046674 | Bacteria | 1783 |
| 946 | Ga0495588_0120965 | 3300046674 | Bacteria | 1380 |
| 947 | Ga0495657_0091606 | 3300046675 | Bacteria | 1949 |
| 948 | Ga0495657_0789688 | 3300046675 | Bacteria | 543 |
| 949 | Ga0495599_0060792 | 3300046678 | Bacteria | 2362 |
| 950 | Ga0495599_0415426 | 3300046678 | Bacteria | 800 |
| 951 | Ga0495623_0071142 | 3300046679 | Bacteria | 2165 |
| 952 | Ga0495623_0674509 | 3300046679 | Bacteria | 531 |
| 953 | Ga0495647_0300216 | 3300046681 | Bacteria | 724 |
| 954 | Ga0495658_0010407 | 3300046683 | Bacteria | 4654 |
| 955 | Ga0495658_0939970 | 3300046683 | Bacteria | 552 |
| 956 | Ga0495669_0171418 | 3300046684 | Bacteria | 1032 |
| 957 | Ga0495669_0201378 | 3300046684 | Bacteria | 951 |
| 958 | Ga0495669_0205324 | 3300046684 | Bacteria | 942 |
| 959 | Ga0495669_0277193 | 3300046684 | Bacteria | 806 |
| 960 | Ga0495669_0629960 | 3300046684 | Bacteria | 521 |
| 961 | Ga0495613_0109070 | 3300046689 | Bacteria | 1996 |
| 962 | Ga0495613_0390683 | 3300046689 | Bacteria | 950 |
| 963 | Ga0495624_0019628 | 3300046690 | Bacteria | 4508 |
| 964 | Ga0495624_0235282 | 3300046690 | Bacteria | 1109 |
| 965 | Ga0495670_0085054 | 3300046691 | Bacteria | 1614 |
| 966 | Ga0495670_0097664 | 3300046691 | Bacteria | 1509 |
| 967 | Ga0495670_0387931 | 3300046691 | Bacteria | 754 |
| 968 | Ga0495671_0213271 | 3300046692 | Bacteria | 935 |
| 969 | Ga0495671_0227131 | 3300046692 | Bacteria | 903 |
| 970 | Ga0495671_0281844 | 3300046692 | Bacteria | 800 |
| 971 | Ga0495671_0307717 | 3300046692 | Bacteria | 762 |
| 972 | Ga0495671_0379050 | 3300046692 | Bacteria | 678 |
| 973 | Ga0495671_0425340 | 3300046692 | Bacteria | 635 |
| 974 | Ga0495649_0062122 | 3300046694 | Bacteria | 2008 |
| 975 | Ga0495649_0223410 | 3300046694 | Bacteria | 973 |
| 976 | Ga0495649_0306035 | 3300046694 | Bacteria | 808 |
| 977 | Ga0495649_0518042 | 3300046694 | Bacteria | 592 |
| 978 | Ga0495649_0648524 | 3300046694 | Bacteria | 519 |
| 979 | Ga0495589_0011378 | 3300046794 | Bacteria | 4621 |
| 980 | Ga0495589_0095519 | 3300046794 | Bacteria | 1442 |
| 981 | Ga0495589_0123180 | 3300046794 | Bacteria | 1248 |
| 982 | Ga0495589_0371791 | 3300046794 | Bacteria | 657 |
| 983 | Ga0495589_0474871 | 3300046794 | Bacteria | 571 |
| 984 | Ga0495600_0069308 | 3300046809 | Bacteria | 2305 |
| 985 | Ga0495600_0833438 | 3300046809 | Bacteria | 548 |
| 986 | Ga0495660_0216541 | 3300046810 | Bacteria | 905 |
| 987 | Ga0495660_0453147 | 3300046810 | Bacteria | 554 |
| 988 | Ga0495581_0011373 | 3300047315 | Bacteria | 5150 |
| 989 | Ga0495581_0073400 | 3300047315 | Bacteria | 1980 |
| 990 | Ga0495581_0077939 | 3300047315 | Bacteria | 1918 |
| 991 | Ga0495604_0138184 | 3300047317 | Bacteria | 1744 |
| 992 | Ga0495604_0180476 | 3300047317 | Bacteria | 1477 |
| 993 | Ga0495636_0518154 | 3300047318 | Bacteria | 578 |
| 994 | Ga0495636_0520336 | 3300047318 | Bacteria | 576 |
| 995 | Ga0495674_0001989 | 3300047319 | Bacteria | 20095 |
| 996 | Ga0495674_0114150 | 3300047319 | Bacteria | 2287 |
| 997 | Ga0495674_0521353 | 3300047319 | Bacteria | 949 |
| 998 | Ga0495674_1342913 | 3300047319 | Bacteria | 535 |
| 999 | Ga0495672_0121391 | 3300047320 | Bacteria | 1388 |
| 1000 | Ga0495672_0189891 | 3300047320 | Bacteria | 1034 |
| 1001 | Ga0495676_0250239 | 3300047321 | Bacteria | 1209 |
| 1002 | Ga0495676_0307204 | 3300047321 | Bacteria | 1068 |
| 1003 | Ga0495676_0330065 | 3300047321 | Bacteria | 1023 |
| 1004 | Ga0495676_0375024 | 3300047321 | Bacteria | 947 |
| 1005 | Ga0495680_0028837 | 3300047322 | Bacteria | 4549 |
| 1006 | Ga0495680_0329372 | 3300047322 | Bacteria | 1067 |
| 1007 | Ga0495680_0533299 | 3300047322 | Bacteria | 793 |
| 1008 | Ga0495683_0017557 | 3300047323 | Bacteria | 3708 |
| 1009 | Ga0495683_0336560 | 3300047323 | Bacteria | 640 |
| 1010 | Ga0495687_020352 | 3300047443 | Bacteria | 3234 |
| 1011 | Ga0495675_0343313 | 3300047444 | Bacteria | 879 |
| 1012 | Ga0495677_0132549 | 3300047445 | Bacteria | 954 |
| 1013 | Ga0495677_0171566 | 3300047445 | Bacteria | 839 |
| 1014 | Ga0495679_082617 | 3300047446 | Bacteria | 910 |
| 1015 | Ga0495679_129092 | 3300047446 | Bacteria | 687 |
| 1016 | Ga0495673_0132158 | 3300047469 | Bacteria | 980 |
| 1017 | Ga0495673_0148558 | 3300047469 | Bacteria | 908 |
| 1018 | Ga0495673_0259376 | 3300047469 | Bacteria | 632 |
| 1019 | Ga0495673_0323495 | 3300047469 | Bacteria | 549 |
| 1020 | Ga0495681_0273396 | 3300047470 | Bacteria | 661 |
| 1021 | Ga0495684_0004921 | 3300047471 | Bacteria | 10429 |
| 1022 | Ga0495684_0176305 | 3300047471 | Bacteria | 1587 |
| 1023 | Ga0495686_0081319 | 3300047472 | Bacteria | 1979 |
| 1024 | Ga0495686_0163246 | 3300047472 | Bacteria | 1300 |
| 1025 | Ga0495686_0169662 | 3300047472 | Bacteria | 1270 |
| 1026 | Ga0495686_0301112 | 3300047472 | Bacteria | 885 |
| 1027 | Ga0495686_0558241 | 3300047472 | Bacteria | 597 |
| 1028 | Ga0495593_0115467 | 3300047673 | Bacteria | 1368 |
| 1029 | Ga0495602_0280084 | 3300048088 | Bacteria | 1229 |
| 1030 | Ga0495602_0418278 | 3300048088 | Bacteria | 952 |
| 1031 | Ga0495614_0203513 | 3300048089 | Bacteria | 896 |
| 1032 | Ga0495615_0152132 | 3300048090 | Bacteria | 689 |
| 1033 | Ga0495626_0095969 | 3300048091 | Bacteria | 1298 |
| 1034 | Ga0495626_0440159 | 3300048091 | Bacteria | 501 |
| 1035 | Ga0496100_0352046 | 3300048903 | Bacteria | 1112 |
| 1036 | Ga0496100_0526155 | 3300048903 | Bacteria | 913 |
| 1037 | Ga0496100_0916657 | 3300048903 | Bacteria | 688 |
| 1038 | Ga0496100_1151080 | 3300048903 | Bacteria | 612 |
| 1039 | Ga0496101_0052463 | 3300048904 | Bacteria | 2940 |
| 1040 | Ga0496101_0560693 | 3300048904 | Bacteria | 903 |
| 1041 | Ga0496101_0880246 | 3300048904 | Bacteria | 705 |
| 1042 | Ga0496102_0003175 | 3300048905 | Bacteria | 13938 |
| 1043 | Ga0496102_0351511 | 3300048905 | Bacteria | 1388 |
| 1044 | Ga0496102_0994313 | 3300048905 | Bacteria | 759 |
| 1045 | Ga0496102_1673601 | 3300048905 | Bacteria | 554 |
| 1046 | Ga0496103_0024988 | 3300048906 | Bacteria | 3607 |
| 1047 | Ga0496103_0466512 | 3300048906 | Bacteria | 809 |
| 1048 | Ga0496103_0491165 | 3300048906 | Bacteria | 786 |
| 1049 | Ga0496104_0054701 | 3300048907 | Bacteria | 3772 |
| 1050 | Ga0496104_0071290 | 3300048907 | Bacteria | 3303 |
| 1051 | Ga0496104_0167266 | 3300048907 | Bacteria | 2108 |
| 1052 | Ga0496104_0559707 | 3300048907 | Bacteria | 1054 |
| 1053 | Ga0496104_0933093 | 3300048907 | Bacteria | 773 |
| 1054 | Ga0496105_0023165 | 3300048908 | Bacteria | 5035 |
| 1055 | Ga0496105_0043187 | 3300048908 | Bacteria | 3717 |
| 1056 | Ga0496105_0062157 | 3300048908 | Bacteria | 3082 |
| 1057 | Ga0496105_0913986 | 3300048908 | Bacteria | 661 |
| 1058 | Ga0496106_0039537 | 3300048909 | Bacteria | 3533 |
| 1059 | Ga0496106_0435815 | 3300048909 | Bacteria | 1053 |
| 1060 | Ga0496106_0492430 | 3300048909 | Bacteria | 985 |
| 1061 | Ga0496106_0537320 | 3300048909 | Bacteria | 938 |
| 1062 | Ga0496106_1481734 | 3300048909 | Bacteria | 522 |
| 1063 | Ga0496107_0027047 | 3300048910 | Bacteria | 4072 |
| 1064 | Ga0496107_0083697 | 3300048910 | Bacteria | 2327 |
| 1065 | Ga0496107_0631163 | 3300048910 | Bacteria | 790 |
| 1066 | Ga0496107_0998515 | 3300048910 | Bacteria | 607 |
| 1067 | Ga0496108_0049151 | 3300048911 | Bacteria | 3528 |
| 1068 | Ga0496108_0106154 | 3300048911 | Bacteria | 2398 |
| 1069 | Ga0496108_0286660 | 3300048911 | Bacteria | 1434 |
| 1070 | Ga0496108_0301255 | 3300048911 | Bacteria | 1396 |
| 1071 | Ga0496108_1163312 | 3300048911 | Bacteria | 653 |
| 1072 | Ga0496109_0025925 | 3300048912 | Bacteria | 5224 |
| 1073 | Ga0496109_0060765 | 3300048912 | Bacteria | 3454 |
| 1074 | Ga0496109_0432040 | 3300048912 | Bacteria | 1244 |
| 1075 | Ga0496109_0634531 | 3300048912 | Bacteria | 1005 |
| 1076 | Ga0496109_1047145 | 3300048912 | Bacteria | 753 |
| 1077 | Ga0496109_1086224 | 3300048912 | Bacteria | 737 |
| 1078 | Ga0496110_0038811 | 3300048913 | Bacteria | 4145 |
| 1079 | Ga0496110_0069002 | 3300048913 | Bacteria | 3129 |
| 1080 | Ga0496110_0523976 | 3300048913 | Bacteria | 1078 |
| 1081 | Ga0496110_0747209 | 3300048913 | Bacteria | 881 |
| 1082 | Ga0496111_0041412 | 3300048914 | Bacteria | 3305 |
| 1083 | Ga0496111_0043022 | 3300048914 | Bacteria | 3245 |
| 1084 | Ga0496111_0089098 | 3300048914 | Bacteria | 2260 |
| 1085 | Ga0496111_1070947 | 3300048914 | Bacteria | 575 |
| 1086 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 1087 | Ga0496112_0001958 | 3300048915 | Bacteria | 16269 |
| 1088 | Ga0496112_0173931 | 3300048915 | Bacteria | 2118 |
| 1089 | Ga0496112_0357325 | 3300048915 | Bacteria | 1403 |
| 1090 | Ga0496112_0455136 | 3300048915 | Bacteria | 1217 |
| 1091 | Ga0496112_1666590 | 3300048915 | Bacteria | 550 |
| 1092 | Ga0496113_0780927 | 3300048916 | Bacteria | 759 |
| 1093 | Ga0496113_1180533 | 3300048916 | Bacteria | 598 |
| 1094 | Ga0496113_1204054 | 3300048916 | Bacteria | 591 |
| 1095 | Ga0496114_0034614 | 3300048917 | Bacteria | 4168 |
| 1096 | Ga0496114_0039299 | 3300048917 | Bacteria | 3915 |
| 1097 | Ga0496114_1335562 | 3300048917 | Bacteria | 604 |
| 1098 | Ga0496115_0070966 | 3300048918 | Bacteria | 2824 |
| 1099 | Ga0496115_0358527 | 3300048918 | Bacteria | 1188 |
| 1100 | Ga0496115_0450856 | 3300048918 | Bacteria | 1039 |
| 1101 | Ga0496115_1280224 | 3300048918 | Bacteria | 547 |
| 1102 | Ga0496115_1449207 | 3300048918 | Bacteria | 505 |
| 1103 | Ga0496116_0076148 | 3300048919 | Bacteria | 2103 |
| 1104 | Ga0496116_0352428 | 3300048919 | Bacteria | 673 |
| 1105 | Ga0496117_0022310 | 3300048920 | Bacteria | 5081 |
| 1106 | Ga0496117_0067196 | 3300048920 | Bacteria | 2427 |
| 1107 | Ga0496117_0378397 | 3300048920 | Bacteria | 722 |
| 1108 | Ga0496118_0018395 | 3300048921 | Bacteria | 6308 |
| 1109 | Ga0496118_0068579 | 3300048921 | Bacteria | 2575 |
| 1110 | Ga0496118_0141924 | 3300048921 | Bacteria | 1520 |
| 1111 | Ga0496119_0012507 | 3300048922 | Bacteria | 6886 |
| 1112 | Ga0496119_0037823 | 3300048922 | Bacteria | 3128 |
| 1113 | Ga0496119_0158132 | 3300048922 | Bacteria | 1208 |
| 1114 | Ga0496119_0504467 | 3300048922 | Bacteria | 562 |
| 1115 | Ga0496120_0143214 | 3300048923 | Bacteria | 1211 |
| 1116 | Ga0496120_0222928 | 3300048923 | Bacteria | 900 |
| 1117 | Ga0496121_0001046 | 3300048924 | Bacteria | 49319 |
| 1118 | Ga0496121_0047732 | 3300048924 | Bacteria | 3650 |
| 1119 | Ga0496121_0051267 | 3300048924 | Bacteria | 3477 |
| 1120 | Ga0496121_0059293 | 3300048924 | Bacteria | 3157 |
| 1121 | Ga0496121_0071614 | 3300048924 | Bacteria | 2787 |
| 1122 | Ga0496121_0071682 | 3300048924 | Bacteria | 2785 |
| 1123 | Ga0496121_0249867 | 3300048924 | Bacteria | 1230 |
| 1124 | Ga0496121_0323593 | 3300048924 | Bacteria | 1037 |
| 1125 | Ga0496121_0400013 | 3300048924 | Bacteria | 900 |
| 1126 | Ga0496121_0573616 | 3300048924 | Bacteria | 701 |
| 1127 | Ga0496122_0081810 | 3300048925 | Bacteria | 2246 |
| 1128 | Ga0496122_0131235 | 3300048925 | Bacteria | 1591 |
| 1129 | Ga0496122_0144541 | 3300048925 | Bacteria | 1481 |
| 1130 | Ga0496123_0481154 | 3300048926 | Bacteria | 546 |
| 1131 | Ga0496124_0013092 | 3300048927 | Bacteria | 8124 |
| 1132 | Ga0496124_0022005 | 3300048927 | Bacteria | 5860 |
| 1133 | Ga0496124_0281883 | 3300048927 | Bacteria | 1211 |
| 1134 | Ga0496124_0318201 | 3300048927 | Bacteria | 1115 |
| 1135 | Ga0496124_0827992 | 3300048927 | Bacteria | 570 |
| 1136 | Ga0496125_0032864 | 3300048928 | Bacteria | 4602 |
| 1137 | Ga0496125_0043837 | 3300048928 | Bacteria | 3791 |
| 1138 | Ga0496125_0162034 | 3300048928 | Bacteria | 1517 |
| 1139 | Ga0496125_0247778 | 3300048928 | Bacteria | 1126 |
| 1140 | Ga0496126_0011825 | 3300048929 | Bacteria | 8981 |
| 1141 | Ga0496126_0015601 | 3300048929 | Bacteria | 7634 |
| 1142 | Ga0496126_0020176 | 3300048929 | Bacteria | 6540 |
| 1143 | Ga0496126_0031303 | 3300048929 | Bacteria | 5029 |
| 1144 | Ga0496126_0060458 | 3300048929 | Bacteria | 3407 |
| 1145 | Ga0496126_0061824 | 3300048929 | Bacteria | 3362 |
| 1146 | Ga0496126_0063195 | 3300048929 | Bacteria | 3319 |
| 1147 | Ga0496126_0122996 | 3300048929 | Bacteria | 2248 |
| 1148 | Ga0496126_0182744 | 3300048929 | Bacteria | 1780 |
| 1149 | Ga0496126_0231407 | 3300048929 | Bacteria | 1548 |
| 1150 | Ga0496126_0430252 | 3300048929 | Bacteria | 1065 |
| 1151 | Ga0496126_0518849 | 3300048929 | Bacteria | 950 |
| 1152 | Ga0496126_0944773 | 3300048929 | Bacteria | 651 |
| 1153 | Ga0496126_0950196 | 3300048929 | Bacteria | 648 |
| 1154 | Ga0495678_188501 | 3300049459 | Bacteria | 642 |
| 1155 | Ga0495678_218048 | 3300049459 | Bacteria | 580 |
| 1156 | Ga0495682_0006058 | 3300049460 | Bacteria | 4932 |
| 1157 | Ga0501031_1072633 | 3300049568 | Bacteria | 514 |
| 1158 | Ga0501033_0206964 | 3300049570 | Bacteria | 1400 |
| 1159 | Ga0501034_0354444 | 3300049571 | Bacteria | 1395 |
| 1160 | Ga0501036_0234466 | 3300049572 | Bacteria | 1540 |
| 1161 | Ga0501036_0579441 | 3300049572 | Bacteria | 932 |
| 1162 | Ga0501039_1507062 | 3300049575 | Bacteria | 517 |
| 1163 | Ga0501046_0044071 | 3300049580 | Bacteria | 3549 |
| 1164 | Ga0501047_0036466 | 3300049581 | Bacteria | 4752 |
| 1165 | Ga0501048_0277370 | 3300049582 | Bacteria | 1192 |
| 1166 | Ga0501067_0051257 | 3300049583 | Bacteria | 2288 |
| 1167 | Ga0501067_0083249 | 3300049583 | Bacteria | 1775 |
| 1168 | Ga0501069_0207786 | 3300049585 | Bacteria | 1136 |
| 1169 | Ga0501070_0602816 | 3300049586 | Bacteria | 875 |
| 1170 | Ga0501073_0043738 | 3300049589 | Bacteria | 3158 |
| 1171 | Ga0501073_0621624 | 3300049589 | Bacteria | 746 |
| 1172 | Ga0501074_0203085 | 3300049590 | Bacteria | 1412 |
| 1173 | Ga0501080_0004617 | 3300049742 | Bacteria | 12269 |
| 1174 | Ga0501080_0077138 | 3300049742 | Bacteria | 3099 |
| 1175 | Ga0501083_0000632 | 3300049744 | Bacteria | 22782 |
| 1176 | Ga0501083_1124227 | 3300049744 | Bacteria | 511 |
| 1177 | Ga0501044_0022102 | 3300049823 | Bacteria | 6783 |
| 1178 | Ga0501044_0039142 | 3300049823 | Bacteria | 4947 |
| 1179 | Ga0501044_0896085 | 3300049823 | Bacteria | 762 |
| 1180 | nmdc:mga03683_187787_c1 | 3300050489 | Bacteria | 945 |
| 1181 | nmdc:mga03683_2734_c1 | 3300050489 | Bacteria | 5532 |
| 1182 | nmdc:mga03683_457893_c1 | 3300050489 | Bacteria | 614 |
| 1183 | nmdc:mga03683_63046_c2 | 3300050489 | Bacteria | 1258 |
| 1184 | nmdc:mga03683_672932_c1 | 3300050489 | Bacteria | 511 |
| 1185 | nmdc:mga03n38_193888_c1 | 3300050490 | Bacteria | 1048 |
| 1186 | nmdc:mga03n38_54633_c1 | 3300050490 | Bacteria | 1796 |
| 1187 | nmdc:mga03n38_64485_c1 | 3300050490 | Bacteria | 1677 |
| 1188 | nmdc:mga03n38_769283_c1 | 3300050490 | Bacteria | 559 |
| 1189 | nmdc:mga00v17_136770_c1 | 3300050491 | Bacteria | 1569 |
| 1190 | nmdc:mga00v17_155235_c1 | 3300050491 | Bacteria | 1472 |
| 1191 | nmdc:mga00v17_170831_c1 | 3300050491 | Bacteria | 1402 |
| 1192 | nmdc:mga00v17_239999_c1 | 3300050491 | Bacteria | 1175 |
| 1193 | nmdc:mga0yw44_147116_c1 | 3300050492 | Bacteria | 1535 |
| 1194 | nmdc:mga0yw44_94650_c1 | 3300050492 | Bacteria | 1894 |
| 1195 | nmdc:mga0k408_17656_c1 | 3300050493 | Bacteria | 2771 |
| 1196 | nmdc:mga0k408_23559_c1 | 3300050493 | Bacteria | 3475 |
| 1197 | nmdc:mga0k408_29709_c1 | 3300050493 | Bacteria | 3113 |
| 1198 | nmdc:mga0k408_4373_c1 | 3300050493 | Bacteria | 7499 |
| 1199 | nmdc:mga0k408_626141_c1 | 3300050493 | Bacteria | 634 |
| 1200 | nmdc:mga0k408_7136_c1 | 3300050493 | Bacteria | 5970 |
| 1201 | nmdc:mga06z11_14951_c1 | 3300050494 | Bacteria | 3452 |
| 1202 | nmdc:mga06z11_188765_c1 | 3300050494 | Bacteria | 1192 |
| 1203 | nmdc:mga06z11_242167_c1 | 3300050494 | Bacteria | 1060 |
| 1204 | nmdc:mga06z11_302132_c1 | 3300050494 | Bacteria | 952 |
| 1205 | nmdc:mga06z11_842591_c1 | 3300050494 | Bacteria | 559 |
| 1206 | nmdc:mga06z11_97371_c1 | 3300050494 | Bacteria | 1608 |
| 1207 | nmdc:mga04h51_43506_c1 | 3300050495 | Bacteria | 1478 |
| 1208 | nmdc:mga07m45_141055_c1 | 3300050496 | Bacteria | 1396 |
| 1209 | nmdc:mga07m45_150986_c1 | 3300050496 | Bacteria | 1347 |
| 1210 | nmdc:mga07m45_34912_c1 | 3300050496 | Bacteria | 2796 |
| 1211 | nmdc:mga07m45_397757_c1 | 3300050496 | Bacteria | 800 |
| 1212 | nmdc:mga07m45_616766_c1 | 3300050496 | Bacteria | 626 |
| 1213 | nmdc:mga07m45_63917_c1 | 3300050496 | Bacteria | 2088 |
| 1214 | nmdc:mga05p37_2115491_c1 | 3300050507 | Bacteria | 527 |
| 1215 | nmdc:mga05p37_962769_c1 | 3300050507 | Bacteria | 912 |
| 1216 | nmdc:mga08y16_1792193_c1 | 3300050511 | Bacteria | 567 |
| 1217 | nmdc:mga0n895_361327_c1 | 3300050512 | Bacteria | 1470 |
| 1218 | nmdc:mga0n895_63525_c1 | 3300050512 | Bacteria | 3651 |
| 1219 | nmdc:mga0n895_66805_c1 | 3300050512 | Bacteria | 3560 |
| 1220 | nmdc:mga0rr50_200099_c1 | 3300050513 | Bacteria | 1641 |
| 1221 | nmdc:mga0rr50_368928_c1 | 3300050513 | Bacteria | 1209 |
| 1222 | nmdc:mga08x19_1118757_c1 | 3300050514 | Bacteria | 559 |
| 1223 | nmdc:mga08x19_89222_c1 | 3300050514 | Bacteria | 1096 |
| 1224 | nmdc:mga0a205_503770_c1 | 3300050515 | Bacteria | 1067 |
| 1225 | nmdc:mga0sz30_233865_c1 | 3300050516 | Bacteria | 818 |
| 1226 | nmdc:mga0sz30_35554_c1 | 3300050516 | Bacteria | 874 |
| 1227 | nmdc:mga0sz30_45811_c1 | 3300050516 | Bacteria | 1845 |
| 1228 | nmdc:mga0sz30_47732_c1 | 3300050516 | Bacteria | 1810 |
| 1229 | nmdc:mga0sz30_89167_c1 | 3300050516 | Bacteria | 1341 |
| 1230 | Ga0495601_0000314 | 3300053077 | Bacteria | 25703 |
| 1231 | Ga0495601_0026148 | 3300053077 | Bacteria | 3602 |
| 1232 | Ga0495612_0025187 | 3300053078 | Bacteria | 2389 |
| 1233 | Ga0495612_0047401 | 3300053078 | Bacteria | 1761 |
| 1234 | Ga0495612_0343866 | 3300053078 | Bacteria | 673 |
| 1235 | Ga0500635_0112271 | 3300053080 | Bacteria | 1013 |
| 1236 | Ga0500635_0196002 | 3300053080 | Bacteria | 784 |
| 1237 | Ga0495655_0033945 | 3300053083 | Bacteria | 1259 |
| 1238 | Ga0495655_0052353 | 3300053083 | Bacteria | 1085 |
| 1239 | Ga0495655_0119009 | 3300053083 | Bacteria | 802 |
| 1240 | Ga0495655_0322488 | 3300053083 | Bacteria | 535 |
| 1241 | Ga0495619_0001337 | 3300053085 | Bacteria | 16150 |
| 1242 | Ga0495619_0345653 | 3300053085 | Bacteria | 1029 |
| 1243 | Ga0495619_1187970 | 3300053085 | Bacteria | 505 |
| 1244 | Ga0500578_0177698 | 3300053086 | Bacteria | 1313 |
| 1245 | Ga0500578_0246355 | 3300053086 | Bacteria | 1078 |
| 1246 | Ga0500578_0362677 | 3300053086 | Bacteria | 844 |
| 1247 | Ga0500643_050691 | 3300053087 | Bacteria | 1187 |
| 1248 | Ga0500644_0228380 | 3300053088 | Bacteria | 778 |
| 1249 | Ga0500646_0013502 | 3300053090 | Bacteria | 2114 |
| 1250 | Ga0500646_0046263 | 3300053090 | Bacteria | 1241 |
| 1251 | Ga0500646_0097416 | 3300053090 | Bacteria | 919 |
| 1252 | Ga0500646_0322521 | 3300053090 | Bacteria | 558 |
| 1253 | Ga0500646_0366957 | 3300053090 | Bacteria | 527 |
| 1254 | Ga0500647_0033748 | 3300053091 | Bacteria | 2442 |
| 1255 | Ga0500647_0337116 | 3300053091 | Bacteria | 632 |
| 1256 | Ga0500647_0429657 | 3300053091 | Bacteria | 528 |
| 1257 | Ga0500583_0362710 | 3300053092 | Bacteria | 700 |
| 1258 | Ga0500651_0064955 | 3300053093 | Bacteria | 2275 |
| 1259 | Ga0500566_0000191 | 3300053094 | Bacteria | 31941 |
| 1260 | Ga0500566_0013266 | 3300053094 | Bacteria | 4853 |
| 1261 | Ga0500566_0132105 | 3300053094 | Bacteria | 1334 |
| 1262 | Ga0500566_0165307 | 3300053094 | Bacteria | 1149 |
| 1263 | Ga0500566_0179786 | 3300053094 | Bacteria | 1086 |
| 1264 | Ga0500640_000328 | 3300053095 | Bacteria | 10942 |
| 1265 | Ga0500641_0022750 | 3300053096 | Bacteria | 2404 |
| 1266 | Ga0500641_0150043 | 3300053096 | Bacteria | 1006 |
| 1267 | Ga0500641_0203834 | 3300053096 | Bacteria | 843 |
| 1268 | Ga0500648_180438 | 3300053097 | Bacteria | 1087 |
| 1269 | Ga0500648_352558 | 3300053097 | Bacteria | 599 |
| 1270 | Ga0500650_0001278 | 3300053098 | Bacteria | 7435 |
| 1271 | Ga0500654_122720 | 3300053099 | Bacteria | 1015 |
| 1272 | Ga0500554_048990 | 3300053102 | Bacteria | 1323 |
| 1273 | Ga0500555_167427 | 3300053103 | Bacteria | 534 |
| 1274 | Ga0500556_0000095 | 3300053104 | Bacteria | 82300 |
| 1275 | Ga0500556_0142750 | 3300053104 | Bacteria | 942 |
| 1276 | Ga0500558_277070 | 3300053106 | Bacteria | 536 |
| 1277 | Ga0500562_106402 | 3300053108 | Bacteria | 764 |
| 1278 | Ga0500562_164934 | 3300053108 | Bacteria | 602 |
| 1279 | Ga0500569_040695 | 3300053109 | Bacteria | 1360 |
| 1280 | Ga0500569_315674 | 3300053109 | Bacteria | 524 |
| 1281 | Ga0500572_000153 | 3300053111 | Bacteria | 23968 |
| 1282 | Ga0500572_000739 | 3300053111 | Bacteria | 10541 |
| 1283 | Ga0500591_222088 | 3300053115 | Bacteria | 623 |
| 1284 | Ga0500592_019178 | 3300053116 | Bacteria | 1098 |
| 1285 | Ga0500593_084377 | 3300053117 | Bacteria | 1354 |
| 1286 | Ga0500594_0020980 | 3300053118 | Bacteria | 1634 |
| 1287 | Ga0500594_0077410 | 3300053118 | Bacteria | 989 |
| 1288 | Ga0500595_000863 | 3300053119 | Bacteria | 17312 |
| 1289 | Ga0500595_015387 | 3300053119 | Bacteria | 2874 |
| 1290 | Ga0500595_016281 | 3300053119 | Bacteria | 2773 |
| 1291 | Ga0500595_231862 | 3300053119 | Bacteria | 506 |
| 1292 | Ga0500608_092904 | 3300053122 | Bacteria | 1408 |
| 1293 | Ga0500614_007288 | 3300053123 | Bacteria | 2330 |
| 1294 | Ga0500628_191896 | 3300053129 | Bacteria | 587 |
| 1295 | Ga0500642_0247733 | 3300053130 | Bacteria | 819 |
| 1296 | Ga0500642_0325251 | 3300053130 | Bacteria | 688 |
| 1297 | Ga0500655_002239 | 3300053133 | Bacteria | 3553 |
| 1298 | Ga0500655_113949 | 3300053133 | Bacteria | 571 |
| 1299 | Ga0500658_0234229 | 3300053134 | Bacteria | 843 |
| 1300 | Ga0500658_0289686 | 3300053134 | Bacteria | 752 |
| 1301 | Ga0500559_0000299 | 3300053136 | Bacteria | 38041 |
| 1302 | Ga0500559_0000585 | 3300053136 | Bacteria | 24994 |
| 1303 | Ga0500559_0010824 | 3300053136 | Bacteria | 3911 |
| 1304 | Ga0500559_0017076 | 3300053136 | Bacteria | 3065 |
| 1305 | Ga0500559_0117444 | 3300053136 | Bacteria | 1235 |
| 1306 | Ga0500561_0158082 | 3300053137 | Bacteria | 707 |
| 1307 | Ga0500568_0026201 | 3300053139 | Bacteria | 2449 |
| 1308 | Ga0500568_0073513 | 3300053139 | Bacteria | 1306 |
| 1309 | Ga0500568_0078005 | 3300053139 | Bacteria | 1260 |
| 1310 | Ga0500573_0308853 | 3300053140 | Bacteria | 786 |
| 1311 | Ga0500577_0318774 | 3300053142 | Bacteria | 679 |
| 1312 | Ga0500577_0327468 | 3300053142 | Bacteria | 669 |
| 1313 | Ga0500588_0230347 | 3300053146 | Bacteria | 692 |
| 1314 | Ga0500589_031633 | 3300053147 | Bacteria | 2466 |
| 1315 | Ga0500590_201570 | 3300053148 | Bacteria | 841 |
| 1316 | Ga0500603_001431 | 3300053150 | Bacteria | 5452 |
| 1317 | Ga0500603_090077 | 3300053150 | Bacteria | 900 |
| 1318 | Ga0500604_0048410 | 3300053151 | Bacteria | 1305 |
| 1319 | Ga0500616_0045212 | 3300053153 | Bacteria | 2347 |
| 1320 | Ga0500616_0395270 | 3300053153 | Bacteria | 553 |
| 1321 | Ga0500622_0000791 | 3300053156 | Bacteria | 27348 |
| 1322 | Ga0500622_0065143 | 3300053156 | Bacteria | 1852 |
| 1323 | Ga0500622_0244066 | 3300053156 | Bacteria | 792 |
| 1324 | Ga0500630_003340 | 3300053159 | Bacteria | 7775 |
| 1325 | Ga0500633_0311366 | 3300053160 | Bacteria | 578 |
| 1326 | Ga0500634_0153385 | 3300053161 | Bacteria | 1073 |
| 1327 | Ga0500634_0407464 | 3300053161 | Bacteria | 500 |
| 1328 | Ga0500638_090362 | 3300053162 | Bacteria | 1442 |
| 1329 | Ga0500638_170194 | 3300053162 | Bacteria | 949 |
| 1330 | Ga0500639_000477 | 3300053163 | Bacteria | 19965 |
| 1331 | Ga0500639_004935 | 3300053163 | Bacteria | 6799 |
| 1332 | Ga0500639_049860 | 3300053163 | Bacteria | 2183 |
| 1333 | Ga0500636_0436409 | 3300053177 | Bacteria | 596 |
| 1334 | Ga0500637_0003263 | 3300053178 | Bacteria | 7448 |
| 1335 | Ga0500637_0030501 | 3300053178 | Bacteria | 3001 |
| 1336 | Ga0500637_0174840 | 3300053178 | Bacteria | 1232 |
| 1337 | Ga0500567_251040 | 3300053723 | Bacteria | 525 |
| 1338 | Ga0500570_225740 | 3300053724 | Bacteria | 529 |
| 1339 | Ga0500576_022052 | 3300053725 | Bacteria | 2907 |
| 1340 | Ga0500611_086488 | 3300053727 | Bacteria | 791 |
| 1341 | Ga0500657_164981 | 3300053728 | Bacteria | 796 |
| 1342 | Ga0500645_086458 | 3300053730 | Bacteria | 892 |
| 1343 | Ga0500609_049086 | 3300053731 | Bacteria | 586 |
| 1344 | Ga0500656_040579 | 3300053732 | Bacteria | 650 |
| 1345 | Ga0500552_003598 | 3300053733 | Bacteria | 1584 |
| 1346 | Ga0500596_001682 | 3300053735 | Bacteria | 4476 |
| 1347 | Ga0500596_002529 | 3300053735 | Bacteria | 3598 |
| 1348 | Ga0500596_008742 | 3300053735 | Bacteria | 1607 |
| 1349 | Ga0500661_007864 | 3300055283 | Bacteria | 1966 |
| 1350 | Ga0587084_083580 | 3300059477 | Bacteria | 622 |
| 1351 | Ga0587066_118947 | 3300059490 | Bacteria | 622 |
| 1352 | Ga0587073_0176763 | 3300059492 | Bacteria | 624 |
| 1353 | Ga0587080_030213 | 3300059503 | Bacteria | 940 |
| 1354 | Ga0587088_207040 | 3300059508 | Bacteria | 504 |
| 1355 | Ga0587099_067117 | 3300059622 | Bacteria | 504 |
| 1356 | Ga0587076_173006 | 3300059645 | Bacteria | 539 |
| 1357 | Ga0587111_0260638 | 3300060346 | Bacteria | 516 |
| 1358 | Ga0466962_0022598 | 3300061719 | Bacteria | 3023 |
| 1359 | Ga0466962_0256782 | 3300061719 | Bacteria | 859 |
| 1360 | 2597870970 | 2597489889 | Bacteria | 6297495 |
| 1361 | 2958174469 | 2958172287 | Bacteria | 6716688 |
| 1362 | 2977978113 | 2977971508 | Bacteria | 7472917 |
| 1363 | Ga0500597_123447 | |||
| 1364 | CNAas_1005504 | |||
| 1365 | JGI24743J22301_10086017 | |||
| 1366 | JGI24750J21931_1011860 | |||
| 1367 | JGI24744J21845_10006633 | |||
| 1368 | JGI24034J26672_10020487 | |||
| 1369 | JGI24034J26672_10069191 | |||
| 1370 | JGI25165J46597_1019402 | |||
| 1371 | JGI25153J46596_10002140 | |||
| 1372 | JGI25153J46596_10010090 | |||
| 1373 | Ga0006770J48903_1004135 | |||
| 1374 | rootL2_10016153 | |||
| 1375 | Ga0006781J51513_1004215 | |||
| 1376 | Ga0007410J51695_1002477 | |||
| 1377 | JGI25404J52841_10001052 | |||
| 1378 | JGI25404J52841_10009090 | |||
| 1379 | JGI25404J52841_10015398 | |||
| 1380 | JGI25404J52841_10018605 | |||
| 1381 | Ga0032354_1008942 | |||
| 1382 | Ga0006780_1003591 | |||
| 1383 | Ga0055542_1005196 | |||
| 1384 | Ga0055529_1008414 | |||
| 1385 | JGI25405J52794_10024077 | |||
| 1386 | Ga0065707_10356582 | |||
| 1387 | Ga0070658_10157810 | |||
| 1388 | Ga0070676_10107280 | |||
| 1389 | Ga0070676_10578773 | |||
| 1390 | Ga0070690_100014486 | |||
| 1391 | Ga0070690_100054344 | |||
| 1392 | Ga0070690_100747517 | |||
| 1393 | Ga0070670_100234379 | |||
| 1394 | Ga0070670_101023685 | |||
| 1395 | Ga0070677_10249176 | |||
| 1396 | Ga0068869_100591799 | |||
| 1397 | Ga0068869_101174875 | |||
| 1398 | Ga0070666_10255579 | |||
| 1399 | Ga0070666_10556109 | |||
| 1400 | Ga0070682_100257297 | |||
| 1401 | Ga0068868_100261488 | |||
| 1402 | Ga0068868_102055195 | |||
| 1403 | Ga0070660_101374600 | |||
| 1404 | Ga0070689_100011365 | |||
| 1405 | Ga0070689_100083460 | |||
| 1406 | Ga0070689_100264441 | |||
| 1407 | Ga0070687_100037609 | |||
| 1408 | Ga0070687_100053260 | |||
| 1409 | Ga0070687_101411732 | |||
| 1410 | Ga0070661_100516182 | |||
| 1411 | Ga0070661_100516592 | |||
| 1412 | Ga0070661_100645552 | |||
| 1413 | Ga0070668_100187942 | |||
| 1414 | Ga0070668_100328393 | |||
| 1415 | Ga0070668_100389669 | |||
| 1416 | Ga0070668_101390894 | |||
| 1417 | Ga0070669_100079992 | |||
| 1418 | Ga0070669_100482785 | |||
| 1419 | Ga0070669_100514859 | |||
| 1420 | Ga0070669_101757113 | |||
| 1421 | Ga0070675_100879531 | |||
| 1422 | Ga0070675_100978501 | |||
| 1423 | Ga0070675_101199172 | |||
| 1424 | Ga0070671_100051030 | |||
| 1425 | Ga0070671_100663275 | |||
| 1426 | Ga0070674_100049075 | |||
| 1427 | Ga0070674_100052380 | |||
| 1428 | Ga0070674_100053108 | |||
| 1429 | Ga0070673_100250143 | |||
| 1430 | Ga0070673_100379664 | |||
| 1431 | Ga0070673_100978995 | |||
| 1432 | Ga0070673_102083664 | |||
| 1433 | Ga0070688_100072863 | |||
| 1434 | Ga0070688_100250587 | |||
| 1435 | Ga0070688_100631611 | |||
| 1436 | Ga0070659_100443214 | |||
| 1437 | Ga0070659_100966432 | |||
| 1438 | Ga0070709_10033715 | |||
| 1439 | Ga0070709_10034132 | |||
| 1440 | Ga0070709_10469603 | |||
| 1441 | Ga0070709_10710111 | |||
| 1442 | Ga0070714_100089521 | |||
| 1443 | Ga0070714_100430685 | |||
| 1444 | Ga0070714_100664872 | |||
| 1445 | Ga0070713_100155707 | |||
| 1446 | Ga0070713_100160496 | |||
| 1447 | Ga0070713_102291936 | |||
| 1448 | Ga0070710_10010559 | |||
| 1449 | Ga0070710_10104521 | |||
| 1450 | Ga0070710_11137971 | |||
| 1451 | Ga0070701_10384208 | |||
| 1452 | Ga0070711_100016594 | |||
| 1453 | Ga0070711_100406876 | |||
| 1454 | Ga0070711_100421601 | |||
| 1455 | Ga0070711_100664720 | |||
| 1456 | Ga0070711_100987821 | |||
| 1457 | Ga0070700_100410564 | |||
| 1458 | Ga0070700_100990340 | |||
| 1459 | Ga0070663_100265137 | |||
| 1460 | Ga0070663_100504600 | |||
| 1461 | Ga0070678_100085821 | |||
| 1462 | Ga0070678_100631505 | |||
| 1463 | Ga0070662_100234813 | |||
| 1464 | Ga0070662_100379096 | |||
| 1465 | Ga0070681_11091239 | |||
| 1466 | Ga0068867_101092874 | |||
| 1467 | Ga0070685_10300257 | |||
| 1468 | Ga0070685_10884137 | |||
| 1469 | Ga0070706_100100870 | |||
| 1470 | Ga0070706_100664098 | |||
| 1471 | Ga0070707_100593921 | |||
| 1472 | Ga0070707_101447140 | |||
| 1473 | Ga0070679_100153277 | |||
| 1474 | Ga0070679_100949472 | |||
| 1475 | Ga0070684_101348708 | |||
| 1476 | Ga0070684_101914088 | |||
| 1477 | Ga0068853_100744429 | |||
| 1478 | Ga0068853_101716085 | |||
| 1479 | Ga0070672_100057945 | |||
| 1480 | Ga0070672_100157323 | |||
| 1481 | Ga0070672_100201470 | |||
| 1482 | Ga0070672_100568605 | |||
| 1483 | Ga0070686_100178843 | |||
| 1484 | Ga0070686_100637421 | |||
| 1485 | Ga0070686_101622692 | |||
| 1486 | Ga0070696_100190361 | |||
| 1487 | Ga0070693_100340709 | |||
| 1488 | Ga0070665_100038049 | |||
| 1489 | Ga0070665_101649369 | |||
| 1490 | Ga0070665_101759330 | |||
| 1491 | Ga0070665_101873722 | |||
| 1492 | Ga0068855_100797846 | |||
| 1493 | Ga0068855_100929282 | |||
| 1494 | Ga0070664_101454186 | |||
| 1495 | Ga0068856_101441545 | |||
| 1496 | Ga0070702_100032604 | |||
| 1497 | Ga0070702_101013622 | |||
| 1498 | Ga0068852_100292799 | |||
| 1499 | Ga0068852_101473584 | |||
| 1500 | Ga0068859_100247315 | |||
| 1501 | Ga0068859_100667255 | |||
| 1502 | Ga0068859_100708856 | |||
| 1503 | Ga0068859_102402636 | |||
| 1504 | Ga0068864_100020725 | |||
| 1505 | Ga0068864_100169431 | |||
| 1506 | Ga0068864_100191178 | |||
| 1507 | Ga0068866_10063718 | |||
| 1508 | Ga0068861_101284597 | |||
| 1509 | Ga0068870_10253508 | |||
| 1510 | Ga0068870_10279786 | |||
| 1511 | Ga0068870_11160387 | |||
| 1512 | Ga0068863_100193114 | |||
| 1513 | Ga0068863_100536184 | |||
| 1514 | Ga0068863_102307007 | |||
| 1515 | Ga0068858_100107762 | |||
| 1516 | Ga0068858_100214665 | |||
| 1517 | Ga0068858_100397031 | |||
| 1518 | Ga0068858_100752517 | |||
| 1519 | Ga0068858_102586847 | |||
| 1520 | Ga0068860_100131677 | |||
| 1521 | Ga0068860_100139914 | |||
| 1522 | Ga0068860_100262185 | |||
| 1523 | Ga0068860_100411374 | |||
| 1524 | Ga0068860_100973313 | |||
| 1525 | Ga0068862_100157171 | |||
| 1526 | Ga0068862_100298871 | |||
| 1527 | Ga0068862_100760387 | |||
| 1528 | Ga0068862_101215412 | |||
| 1529 | Ga0068862_101982150 | |||
| 1530 | Ga0081455_10016563 | |||
| 1531 | Ga0081455_10033402 | |||
| 1532 | Ga0081455_10034075 | |||
| 1533 | Ga0081455_10128955 | |||
| 1534 | Ga0081455_10138410 | |||
| 1535 | Ga0081540_1002643 | |||
| 1536 | Ga0081540_1003668 | |||
| 1537 | Ga0081540_1004247 | |||
| 1538 | Ga0081540_1018838 | |||
| 1539 | Ga0081540_1031583 | |||
| 1540 | Ga0081540_1046731 | |||
| 1541 | Ga0081540_1311851 | |||
| 1542 | Ga0081539_10394090 | |||
| 1543 | Ga0070717_10217896 | |||
| 1544 | Ga0070717_10346302 | |||
| 1545 | Ga0070717_10887499 | |||
| 1546 | Ga0070717_10890872 | |||
| 1547 | Ga0075368_10198096 | |||
| 1548 | Ga0075363_100128500 | |||
| 1549 | Ga0075364_10044125 | |||
| 1550 | Ga0075364_10585543 | |||
| 1551 | Ga0075364_10943362 | |||
| 1552 | Ga0075432_10235375 | |||
| 1553 | Ga0075432_10368483 | |||
| 1554 | Ga0070715_10015272 | |||
| 1555 | Ga0070715_10127212 | |||
| 1556 | Ga0070715_10249100 | |||
| 1557 | Ga0070715_10982275 | |||
| 1558 | Ga0070716_100030610 | |||
| 1559 | Ga0070716_100095755 | |||
| 1560 | Ga0070716_100292627 | |||
| 1561 | Ga0070716_100515859 | |||
| 1562 | Ga0070716_100655020 | |||
| 1563 | Ga0070712_100030217 | |||
| 1564 | Ga0070712_100212042 | |||
| 1565 | Ga0070712_101487919 | |||
| 1566 | Ga0075362_10002782 | |||
| 1567 | Ga0075362_10157715 | |||
| 1568 | Ga0075362_10489714 | |||
| 1569 | Ga0075367_10108434 | |||
| 1570 | Ga0075367_10116266 | |||
| 1571 | Ga0075367_10365758 | |||
| 1572 | Ga0075367_10433306 | |||
| 1573 | Ga0075369_10095943 | |||
| 1574 | Ga0075369_10169370 | |||
| 1575 | Ga0075369_10233015 | |||
| 1576 | Ga0075366_10001525 | |||
| 1577 | Ga0075366_10004076 | |||
| 1578 | Ga0075366_10038714 | |||
| 1579 | Ga0075366_10857394 | |||
| 1580 | Ga0097621_100195892 | |||
| 1581 | Ga0097621_100679345 | |||
| 1582 | Ga0097621_101036947 | |||
| 1583 | Ga0097621_101991136 | |||
| 1584 | Ga0075370_10154131 | |||
| 1585 | Ga0075370_10534298 | |||
| 1586 | Ga0075370_10706601 | |||
| 1587 | Ga0068871_100106807 | |||
| 1588 | Ga0068871_100524455 | |||
| 1589 | Ga0068871_101062978 | |||
| 1590 | Ga0068871_102384835 | |||
| 1591 | Ga0075434_100061863 | |||
| 1592 | Ga0075434_100068500 | |||
| 1593 | Ga0075434_102166881 | |||
| 1594 | Ga0075429_100063803 | |||
| 1595 | Ga0075429_101517559 | |||
| 1596 | Ga0068865_100077349 | |||
| 1597 | Ga0068865_100394881 | |||
| 1598 | Ga0068865_100674376 | |||
| 1599 | Ga0068865_100907474 | |||
| 1600 | Ga0068865_100993456 | |||
| 1601 | Ga0075436_100984401 | |||
| 1602 | Ga0075436_101550072 | |||
| 1603 | Ga0097620_100247314 | |||
| 1604 | Ga0097620_100667226 | |||
| 1605 | Ga0097620_100708887 | |||
| 1606 | Ga0097620_102403042 | |||
| 1607 | Ga0075435_100356738 | |||
| 1608 | Ga0075435_101694169 | |||
| 1609 | Ga0099794_10064167 | |||
| 1610 | Ga0099795_10168008 | |||
| 1611 | Ga0105251_10370334 | |||
| 1612 | Ga0105250_10126450 | |||
| 1613 | Ga0105240_11943134 | |||
| 1614 | Ga0105240_12013630 | |||
| 1615 | Ga0111539_11052666 | |||
| 1616 | Ga0105245_10868807 | |||
| 1617 | Ga0105245_12359647 | |||
| 1618 | Ga0105247_10676972 | |||
| 1619 | Ga0105247_11048369 | |||
| 1620 | Ga0105247_11699887 | |||
| 1621 | Ga0114129_10964522 | |||
| 1622 | Ga0114129_11223890 | |||
| 1623 | Ga0105243_11044250 | |||
| 1624 | Ga0105241_11138202 | |||
| 1625 | Ga0105248_10356682 | |||
| 1626 | Ga0105248_10452532 | |||
| 1627 | Ga0105248_10968511 | |||
| 1628 | Ga0105237_11343131 | |||
| 1629 | Ga0105237_12057461 | |||
| 1630 | Ga0105237_12749559 | |||
| 1631 | Ga0105238_11692532 | |||
| 1632 | Ga0105249_10092872 | |||
| 1633 | Ga0105249_10254004 | |||
| 1634 | Ga0105249_12117931 | |||
| 1635 | Ga0099796_10467188 | |||
| 1636 | Ga0105239_10063157 | |||
| 1637 | Ga0105239_10128151 | |||
| 1638 | Ga0105246_10120796 | |||
| 1639 | Ga0105246_11347508 | |||
| 1640 | Ga0105246_12015610 | |||
| 1641 | Ga0105246_12522602 | |||
| 1642 | Ga0157335_1048709 | |||
| 1643 | Ga0157373_10525021 | |||
| 1644 | Ga0157370_10099255 | |||
| 1645 | Ga0157370_10099681 | |||
| 1646 | Ga0157369_10856514 | |||
| 1647 | Ga0157378_10528327 | |||
| 1648 | Ga0157378_10983944 | |||
| 1649 | Ga0163162_10425135 | |||
| 1650 | Ga0163162_10628412 | |||
| 1651 | Ga0163162_11071737 | |||
| 1652 | Ga0163162_12867969 | |||
| 1653 | Ga0157375_10618797 | |||
| 1654 | Ga0163163_10663280 | |||
| 1655 | Ga0163163_11015510 | |||
| 1656 | Ga0163163_11956756 | |||
| 1657 | Ga0157380_10055433 | |||
| 1658 | Ga0157380_11334648 | |||
| 1659 | Ga0157380_12549546 | |||
| 1660 | Ga0157377_10739326 | |||
| 1661 | Ga0157377_10749698 | |||
| 1662 | Ga0157377_11159841 | |||
| 1663 | Ga0163161_10120658 | |||
| 1664 | Ga0163161_10258850 | |||
| 1665 | Ga0163161_10886438 | |||
| 1666 | Ga0163161_12048601 | |||
| 1667 | Ga0184601_131220 | |||
| 1668 | Ga0184603_138419 | |||
| 1669 | Ga0206354_10020402 | |||
| 1670 | Ga0206353_10880577 | |||
| 1671 | Ga0213872_10111441 | |||
| 1672 | Ga0213874_10053869 | |||
| 1673 | Ga0213876_10289419 | |||
| 1674 | Ga0213871_10019928 | |||
| 1675 | Ga0213871_10111906 | |||
| 1676 | Ga0213871_10250519 | |||
| 1677 | Ga0224712_10609470 | |||
| 1678 | Ga0209148_1000321 | |||
| 1679 | Ga0209148_1023478 | |||
| 1680 | Ga0209233_1040885 | |||
| 1681 | Ga0209455_1013823 | |||
| 1682 | Ga0209758_1000125 | |||
| 1683 | Ga0209257_1019362 | |||
| 1684 | Ga0209257_1061004 | |||
| 1685 | Ga0207697_10009193 | |||
| 1686 | Ga0207697_10080726 | |||
| 1687 | Ga0207697_10139319 | |||
| 1688 | Ga0207697_10303717 | |||
| 1689 | Ga0207696_1154997 | |||
| 1690 | Ga0207682_10129393 | |||
| 1691 | Ga0207692_10300699 | |||
| 1692 | Ga0207692_10514247 | |||
| 1693 | Ga0207642_10073056 | |||
| 1694 | Ga0207642_10315562 | |||
| 1695 | Ga0207710_10035362 | |||
| 1696 | Ga0207710_10148135 | |||
| 1697 | Ga0207710_10285129 | |||
| 1698 | Ga0207710_10426037 | |||
| 1699 | Ga0207688_10023915 | |||
| 1700 | Ga0207688_10080700 | |||
| 1701 | Ga0207688_10468030 | |||
| 1702 | Ga0207680_10087821 | |||
| 1703 | Ga0207680_10842590 | |||
| 1704 | Ga0207647_10005715 | |||
| 1705 | Ga0207647_10284961 | |||
| 1706 | Ga0207685_10119165 | |||
| 1707 | Ga0207685_10216717 | |||
| 1708 | Ga0207685_10312379 | |||
| 1709 | Ga0207685_10497118 | |||
| 1710 | Ga0207685_10664504 | |||
| 1711 | Ga0207699_10031047 | |||
| 1712 | Ga0207699_10051570 | |||
| 1713 | Ga0207699_10161118 | |||
| 1714 | Ga0207699_10340964 | |||
| 1715 | Ga0207699_11239545 | |||
| 1716 | Ga0207645_10107331 | |||
| 1717 | Ga0207645_10111597 | |||
| 1718 | Ga0207645_10328763 | |||
| 1719 | Ga0207643_10200467 | |||
| 1720 | Ga0207643_10474128 | |||
| 1721 | Ga0207643_10856882 | |||
| 1722 | Ga0207705_10006176 | |||
| 1723 | Ga0207705_10391858 | |||
| 1724 | Ga0207705_11331398 | |||
| 1725 | Ga0207654_10083868 | |||
| 1726 | Ga0207654_10617362 | |||
| 1727 | Ga0207654_10809271 | |||
| 1728 | Ga0207707_10062398 | |||
| 1729 | Ga0207707_10446309 | |||
| 1730 | Ga0207707_10558665 | |||
| 1731 | Ga0207707_11070227 | |||
| 1732 | Ga0207695_10064554 | |||
| 1733 | Ga0207671_10381398 | |||
| 1734 | Ga0207671_10502612 | |||
| 1735 | Ga0207693_10025189 | |||
| 1736 | Ga0207693_10122936 | |||
| 1737 | Ga0207693_10545068 | |||
| 1738 | Ga0207693_10679029 | |||
| 1739 | Ga0207663_10037777 | |||
| 1740 | Ga0207663_10063664 | |||
| 1741 | Ga0207663_10165842 | |||
| 1742 | Ga0207663_10507754 | |||
| 1743 | Ga0207660_10477251 | |||
| 1744 | Ga0207660_10909211 | |||
| 1745 | Ga0207662_10037298 | |||
| 1746 | Ga0207662_10047231 | |||
| 1747 | Ga0207657_10085109 | |||
| 1748 | Ga0207649_10298290 | |||
| 1749 | Ga0207649_11420749 | |||
| 1750 | Ga0207652_10083761 | |||
| 1751 | Ga0207652_10216561 | |||
| 1752 | Ga0207652_10818039 | |||
| 1753 | Ga0207646_10840462 | |||
| 1754 | Ga0207646_11079106 | |||
| 1755 | Ga0207681_10240383 | |||
| 1756 | Ga0207681_10331355 | |||
| 1757 | Ga0207681_10382988 | |||
| 1758 | Ga0207681_11712390 | |||
| 1759 | Ga0207694_10266182 | |||
| 1760 | Ga0207694_10770924 | |||
| 1761 | Ga0207694_11129973 | |||
| 1762 | Ga0207694_11263972 | |||
| 1763 | Ga0207694_11881292 | |||
| 1764 | Ga0207650_10100767 | |||
| 1765 | Ga0207650_10424851 | |||
| 1766 | Ga0207687_10369567 | |||
| 1767 | Ga0207687_10651144 | |||
| 1768 | Ga0207687_11003745 | |||
| 1769 | Ga0207687_11835544 | |||
| 1770 | Ga0207700_10335534 | |||
| 1771 | Ga0207700_10382401 | |||
| 1772 | Ga0207700_10487522 | |||
| 1773 | Ga0207700_11328170 | |||
| 1774 | Ga0207664_10304558 | |||
| 1775 | Ga0207664_10644234 | |||
| 1776 | Ga0207664_10678835 | |||
| 1777 | Ga0207664_10996599 | |||
| 1778 | Ga0207644_10028196 | |||
| 1779 | Ga0207644_10033032 | |||
| 1780 | Ga0207644_10574517 | |||
| 1781 | Ga0207690_10117745 | |||
| 1782 | Ga0207690_10212144 | |||
| 1783 | Ga0207690_10625745 | |||
| 1784 | Ga0207690_11047547 | |||
| 1785 | Ga0207706_10023343 | |||
| 1786 | Ga0207706_10484330 | |||
| 1787 | Ga0207706_11677108 | |||
| 1788 | Ga0207686_10548650 | |||
| 1789 | Ga0207686_10586208 | |||
| 1790 | Ga0207709_10023999 | |||
| 1791 | Ga0207709_10076702 | |||
| 1792 | Ga0207709_11212929 | |||
| 1793 | Ga0207670_10005994 | |||
| 1794 | Ga0207670_10145887 | |||
| 1795 | Ga0207670_11734092 | |||
| 1796 | Ga0207669_10030512 | |||
| 1797 | Ga0207669_10053059 | |||
| 1798 | Ga0207669_10192846 | |||
| 1799 | Ga0207704_10025389 | |||
| 1800 | Ga0207704_10710298 | |||
| 1801 | Ga0207704_10783637 | |||
| 1802 | Ga0207665_10047516 | |||
| 1803 | Ga0207665_10047757 | |||
| 1804 | Ga0207665_10066144 | |||
| 1805 | Ga0207665_10265159 | |||
| 1806 | Ga0207665_11668762 | |||
| 1807 | Ga0207691_10035922 | |||
| 1808 | Ga0207691_10401236 | |||
| 1809 | Ga0207711_10016693 | |||
| 1810 | Ga0207711_10143470 | |||
| 1811 | Ga0207711_10239269 | |||
| 1812 | Ga0207711_10866919 | |||
| 1813 | Ga0207711_11041230 | |||
| 1814 | Ga0207711_11352534 | |||
| 1815 | Ga0207689_10171637 | |||
| 1816 | Ga0207661_11117637 | |||
| 1817 | Ga0207661_11460317 | |||
| 1818 | Ga0207679_10452684 | |||
| 1819 | Ga0207679_10803813 | |||
| 1820 | Ga0207667_10014848 | |||
| 1821 | Ga0207667_10071501 | |||
| 1822 | Ga0207667_11391231 | |||
| 1823 | Ga0207651_10163981 | |||
| 1824 | Ga0207651_10366380 | |||
| 1825 | Ga0207651_11659424 | |||
| 1826 | Ga0207712_10238461 | |||
| 1827 | Ga0207712_10386705 | |||
| 1828 | Ga0207712_12054090 | |||
| 1829 | Ga0207668_10153748 | |||
| 1830 | Ga0207668_10174207 | |||
| 1831 | Ga0207668_10363426 | |||
| 1832 | Ga0207668_10455826 | |||
| 1833 | Ga0207668_11208169 | |||
| 1834 | Ga0207668_11221144 | |||
| 1835 | Ga0207640_10656639 | |||
| 1836 | Ga0207640_11151240 | |||
| 1837 | Ga0207658_10244476 | |||
| 1838 | Ga0207658_10355121 | |||
| 1839 | Ga0207658_10390143 | |||
| 1840 | Ga0207658_11140289 | |||
| 1841 | Ga0207677_11237551 | |||
| 1842 | Ga0207703_10072639 | |||
| 1843 | Ga0207703_10075818 | |||
| 1844 | Ga0207703_10155570 | |||
| 1845 | Ga0207703_10167619 | |||
| 1846 | Ga0207703_10184041 | |||
| 1847 | Ga0207703_10389005 | |||
| 1848 | Ga0207703_10608713 | |||
| 1849 | Ga0207639_10262761 | |||
| 1850 | Ga0207639_10358711 | |||
| 1851 | Ga0207639_10573109 | |||
| 1852 | Ga0207639_11639258 | |||
| 1853 | Ga0207639_12068842 | |||
| 1854 | Ga0207678_10047576 | |||
| 1855 | Ga0207678_10225478 | |||
| 1856 | Ga0207678_10471182 | |||
| 1857 | Ga0207678_10959460 | |||
| 1858 | Ga0207678_11159352 | |||
| 1859 | Ga0207708_10461568 | |||
| 1860 | Ga0207708_11384615 | |||
| 1861 | Ga0207708_11796022 | |||
| 1862 | Ga0207702_10886797 | |||
| 1863 | Ga0207641_10035550 | |||
| 1864 | Ga0207641_10588416 | |||
| 1865 | Ga0207641_10749434 | |||
| 1866 | Ga0207648_10083791 | |||
| 1867 | Ga0207648_10418801 | |||
| 1868 | Ga0207648_11445595 | |||
| 1869 | Ga0207676_10068801 | |||
| 1870 | Ga0207676_10127756 | |||
| 1871 | Ga0207676_10566587 | |||
| 1872 | Ga0207676_11068980 | |||
| 1873 | Ga0207674_10070190 | |||
| 1874 | Ga0207674_10184205 | |||
| 1875 | Ga0207674_10926646 | |||
| 1876 | Ga0207674_11021541 | |||
| 1877 | Ga0207675_100218465 | |||
| 1878 | Ga0207675_100231001 | |||
| 1879 | Ga0207675_101346384 | |||
| 1880 | Ga0207675_102686508 | |||
| 1881 | Ga0207683_10028565 | |||
| 1882 | Ga0207683_10039006 | |||
| 1883 | Ga0207683_10119501 | |||
| 1884 | Ga0207683_10350591 | |||
| 1885 | Ga0207683_10822902 | |||
| 1886 | Ga0207698_10789617 | |||
| 1887 | Ga0207698_12045752 | |||
| 1888 | Ga0209389_1000034 | |||
| 1889 | Ga0209589_1000038 | |||
| 1890 | Ga0209489_100023 | |||
| 1891 | Ga0209179_1105220 | |||
| 1892 | Ga0209813_10036432 | |||
| 1893 | Ga0268266_10006418 | |||
| 1894 | Ga0268266_10475495 | |||
| 1895 | Ga0268266_11163683 | |||
| 1896 | Ga0268266_11165076 | |||
| 1897 | Ga0268266_11516329 | |||
| 1898 | Ga0268266_12081840 | |||
| 1899 | Ga0268265_10080420 | |||
| 1900 | Ga0268265_10219493 | |||
| 1901 | Ga0268265_10343317 | |||
| 1902 | Ga0268265_10593419 | |||
| 1903 | Ga0268265_11426959 | |||
| 1904 | Ga0268264_10000194 | |||
| 1905 | Ga0268264_10172181 | |||
| 1906 | Ga0268264_10391927 | |||
| 1907 | Ga0268264_10421011 | |||
| 1908 | Ga0268264_10724720 | |||
| 1909 | Ga0268264_12165850 | |||
| 1910 | Ga0265319_1080633 | |||
| 1911 | Ga0265334_10278992 | |||
| 1912 | Ga0265318_10044086 | |||
| 1913 | Ga0265323_10000720 | |||
| 1914 | Ga0265336_10000640 | |||
| 1915 | Ga0307517_10468816 | |||
| 1916 | Ga0307517_10509457 | |||
| 1917 | Ga0307515_10711495 | |||
| 1918 | Ga0265338_10001434 | |||
| 1919 | Ga0265338_10561380 | |||
| 1920 | Ga0265324_10001605 | |||
| 1921 | Ga0265762_1043916 | |||
| 1922 | Ga0265762_1093671 | |||
| 1923 | Ga0265762_1131184 | |||
| 1924 | Ga0265775_102827 | |||
| 1925 | Ga0265767_106021 | |||
| 1926 | Ga0265777_114020 | |||
| 1927 | Ga0265769_121512 | |||
| 1928 | Ga0265771_1032895 | |||
| 1929 | Ga0265760_10129268 | |||
| 1930 | Ga0265325_10000126 | |||
| 1931 | Ga0265325_10000470 | |||
| 1932 | Ga0265325_10093811 | |||
| 1933 | Ga0265340_10095479 | |||
| 1934 | Ga0265339_10172626 | |||
| 1935 | Ga0265339_10322841 | |||
| 1936 | Ga0265327_10120506 | |||
| 1937 | Ga0265327_10509724 | |||
| 1938 | Ga0265316_10196971 | |||
| 1939 | Ga0307513_10276584 | |||
| 1940 | Ga0307509_10947770 | |||
| 1941 | Ga0310117_121285 | |||
| 1942 | Ga0307508_10278611 | |||
| 1943 | Ga0307508_10316059 | |||
| 1944 | Ga0265314_10017036 | |||
| 1945 | Ga0265342_10089626 | |||
| 1946 | Ga0265342_10491021 | |||
| 1947 | Ga0307406_10942930 | |||
| 1948 | Ga0307407_10357590 | |||
| 1949 | Ga0307409_101208794 | |||
| 1950 | Ga0307409_101541459 | |||
| 1951 | Ga0307416_101374241 | |||
| 1952 | Ga0307416_101598931 | |||
| 1953 | Ga0307416_102314245 | |||
| 1954 | Ga0307414_10405696 | |||
| 1955 | Ga0307414_11592044 | |||
| 1956 | Ga0307411_10057196 | |||
| 1957 | Ga0307415_100385194 | |||
| 1958 | Ga0307507_10325907 | |||
| 1959 | Ga0373948_0205085 | |||
| 1960 | Ga0373938_0044796 | |||
| 1961 | Ga0373926_0028112 | |||
| 1962 | Ga0373926_0423326 | |||
| 1963 | Ga0373926_0454273 | |||
| 1964 | Ga0373929_0033882 | |||
| 1965 | Ga0373934_0020498 | |||
| 1966 | Ga0373944_0049719 | |||
| 1967 | Ga0373949_0017442 | |||
| 1968 | Ga0373949_0129113 | |||
| 1969 | Ga0373952_0012840 | |||
| 1970 | Ga0373952_0051555 | |||
| 1971 | Ga0373952_0170343 | |||
| 1972 | Ga0373923_0004214 | |||
| 1973 | Ga0373932_0015356 | |||
| 1974 | Ga0373932_0038954 | |||
| 1975 | Ga0373932_0156678 | |||
| 1976 | Ga0373936_0018243 | |||
| 1977 | Ga0373936_0042601 | |||
| 1978 | Ga0373936_0457532 | |||
| 1979 | Ga0373939_0082617 | |||
| 1980 | Ga0373939_0400481 | |||
| 1981 | Ga0373945_0015924 | |||
| 1982 | Ga0373945_0053511 | |||
| 1983 | Ga0373953_0029700 | |||
| 1984 | Ga0373954_0040683 | |||
| 1985 | Ga0373956_0129241 | |||
| 1986 | Ga0373957_0063649 | |||
| 1987 | Ga0373943_0094530 | |||
| 1988 | Ga0373943_0295351 | |||
| 1989 | Ga0373946_0041154 | |||
| 1990 | Ga0373946_0104020 | |||
| 1991 | Ga0373946_0190840 | |||
| 1992 | Ga0373955_0173360 | |||
| 1993 | Ga0373942_0116036 | |||
| 1994 | Ga0373961_0243167 | |||
| 1995 | Ga0373962_0076787 | |||
| 1996 | Ga0373924_0075521 | |||
| 1997 | Ga0373924_0221097 | |||
| 1998 | Ga0373931_0012673 | |||
| 1999 | Ga0373931_0262031 | |||
| 2000 | Ga0373931_0402488 | |||
| 2001 | Ga0373931_1056126 | |||
| 2002 | Ga0373935_0008303 | |||
| 2003 | Ga0373935_0212024 | |||
| 2004 | Ga0373935_0548796 | |||
| 2005 | Ga0373935_0695297 | |||
| 2006 | Ga0373927_0042629 | |||
| 2007 | Ga0373927_0048081 | |||
| 2008 | Ga0373927_0431383 | |||
| 2009 | Ga0373927_0631216 | |||
| 2010 | Ga0373927_1163135 | |||
| 2011 | Ga0373933_0257013 | |||
| 2012 | Ga0373947_0016229 | |||
| 2013 | Ga0373947_0996504 | |||
| 2014 | Ga0373947_1111872 | |||
| 2015 | Ga0373937_0029238 | |||
| 2016 | Ga0373937_0065822 | |||
| 2017 | Ga0373937_0066365 | |||
| 2018 | Ga0265778_067364 | |||
| 2019 | Ga0373925_0065401 | |||
| 2020 | Ga0373925_0132097 | |||
| 2021 | Ga0373925_0323039 | |||
| 2022 | Ga0373925_0328877 | |||
| 2023 | Ga0373925_0486669 | |||
| 2024 | Ga0373925_1336576 | |||
| 2025 | Ga0395899_0435588 | |||
| 2026 | Ga0395900_0304918 | |||
| 2027 | Ga0395900_1046107 | |||
| 2028 | Ga0395898_0012221 | |||
| 2029 | Ga0395898_0050374 | |||
| 2030 | Ga0395898_0494678 | |||
| 2031 | Ga0395898_0508197 | |||
| 2032 | Ga0395905_1367532 | |||
| 2033 | Ga0395905_1379564 | |||
| 2034 | Ga0395905_1859113 | |||
| 2035 | Ga0436364_0036886 | |||
| 2036 | Ga0436364_0315770 | |||
| 2037 | Ga0436364_1186832 | |||
| 2038 | Ga0436364_1233691 | |||
| 2039 | Ga0436364_1286138 | |||
| 2040 | Ga0436364_1474561 | |||
| 2041 | Ga0436364_1516960 | |||
| 2042 | Ga0436364_1531434 | |||
| 2043 | Ga0395901_0041272 | |||
| 2044 | Ga0395901_0383425 | |||
| 2045 | Ga0395901_0722658 | |||
| 2046 | Ga0400483_289328 | |||
| 2047 | Ga0436365_0160999 | |||
| 2048 | Ga0436365_0703944 | |||
| 2049 | Ga0436365_0900444 | |||
| 2050 | Ga0436365_1141253 | |||
| 2051 | Ga0436365_1491242 | |||
| 2052 | Ga0436360_0097049 | |||
| 2053 | Ga0436360_0547363 | |||
| 2054 | Ga0436360_0855640 | |||
| 2055 | Ga0436360_0918467 | |||
| 2056 | Ga0436360_1151401 | |||
| 2057 | Ga0436361_0021799 | |||
| 2058 | Ga0436361_0044782 | |||
| 2059 | Ga0436361_0250690 | |||
| 2060 | Ga0436361_0690845 | |||
| 2061 | Ga0436361_0720097 | |||
| 2062 | Ga0436363_0154853 | |||
| 2063 | Ga0436363_0211976 | |||
| 2064 | Ga0436363_0965241 | |||
| 2065 | Ga0436363_1109504 | |||
| 2066 | Ga0436363_1262652 | |||
| 2067 | Ga0436363_1322015 | |||
| 2068 | Ga0436363_1502120 | |||
| 2069 | Ga0436362_0421234 | |||
| 2070 | Ga0436362_0869632 | |||
| 2071 | Ga0451789_0350328 | |||
| 2072 | Ga0451794_41682 | |||
| 2073 | Ga0451793_0188671 | |||
| 2074 | Ga0451797_0893948 | |||
| 2075 | Ga0451795_0161699 | |||
| 2076 | Ga0451795_0986905 | |||
| 2077 | Ga0451798_0884644 | |||
| 2078 | Ga0451800_0165008 | |||
| 2079 | Ga0451800_1521909 | |||
| 2080 | Ga0451802_0364258 | |||
| 2081 | Ga0451805_034073 | |||
| 2082 | Ga0451804_0197570 | |||
| 2083 | Ga0451837_1526070 | |||
| 2084 | Ga0451839_0615464 | |||
| 2085 | Ga0451839_1009338 | |||
| 2086 | Ga0451841_0002499 | |||
| 2087 | Ga0451841_0696736 | |||
| 2088 | Ga0439459_0021955 | |||
| 2089 | Ga0451577_0073171 | |||
| 2090 | Ga0466969_0309758 | |||
| 2091 | Ga0466969_0608483 | |||
| 2092 | Ga0466972_0000053 | |||
| 2093 | Ga0466972_0014315 | |||
| 2094 | Ga0453683_0163048 | |||
| 2095 | Ga0453683_0917818 | |||
| 2096 | Ga0453683_1126951 | |||
| 2097 | Ga0466966_0000322 | |||
| 2098 | Ga0466966_0353867 | |||
| 2099 | Ga0466961_0002390 | |||
| 2100 | Ga0466961_0449315 | |||
| 2101 | Ga0466961_0672400 | |||
| 2102 | Ga0466963_0005897 | |||
| 2103 | Ga0466963_0012246 | |||
| 2104 | Ga0466963_0431621 | |||
| 2105 | Ga0466964_0029953 | |||
| 2106 | Ga0466964_0241002 | |||
| 2107 | Ga0466964_0402475 | |||
| 2108 | Ga0466964_0737687 | |||
| 2109 | Ga0453684_0409847 | |||
| 2110 | Ga0453684_0781325 | |||
| 2111 | Ga0466971_0112315 | |||
| 2112 | Ga0466968_0021394 | |||
| 2113 | Ga0466968_0082883 | |||
| 2114 | Ga0466968_0401330 | |||
| 2115 | Ga0466968_0574764 | |||
| 2116 | Ga0466970_0015654 | |||
| 2117 | Ga0466970_0182060 | |||
| 2118 | Ga0466970_0219397 | |||
| 2119 | Ga0466957_0163208 | |||
| 2120 | Ga0466957_0392950 | |||
| 2121 | Ga0466957_1408171 | |||
| 2122 | Ga0466960_0000619 | |||
| 2123 | Ga0466960_0558741 | |||
| 2124 | Ga0466959_0045817 | |||
| 2125 | Ga0466959_0053003 | |||
| 2126 | Ga0466959_0098485 | |||
| 2127 | Ga0466959_0171755 | |||
| 2128 | Ga0466959_0419679 | |||
| 2129 | Ga0451576_0000094 | |||
| 2130 | Ga0466958_0558197 | |||
| 2131 | Ga0466958_0953609 | |||
| 2132 | Ga0466967_0065989 | |||
| 2133 | Ga0466967_0091722 | |||
| 2134 | Ga0466967_0263682 | |||
| 2135 | Ga0466967_0337186 | |||
| 2136 | Ga0466967_0347323 | |||
| 2137 | Ga0466967_1118636 | |||
| 2138 | Ga0466967_2385499 | |||
| 2139 | Ga0495627_116590 | |||
| 2140 | Ga0495592_0437132 | |||
| 2141 | Ga0495603_0000617 | |||
| 2142 | Ga0495603_0019971 | |||
| 2143 | Ga0495590_0066232 | |||
| 2144 | Ga0495590_0076182 | |||
| 2145 | Ga0495590_0279095 | |||
| 2146 | Ga0495590_0351195 | |||
| 2147 | Ga0495629_0034001 | |||
| 2148 | Ga0495638_0013781 | |||
| 2149 | Ga0495638_0026784 | |||
| 2150 | Ga0495638_0069617 | |||
| 2151 | Ga0495638_0109890 | |||
| 2152 | Ga0495638_0481729 | |||
| 2153 | Ga0495638_0510988 | |||
| 2154 | Ga0495641_0264045 | |||
| 2155 | Ga0495651_0039889 | |||
| 2156 | Ga0495651_0208178 | |||
| 2157 | Ga0495651_0252604 | |||
| 2158 | Ga0495653_0144636 | |||
| 2159 | Ga0495653_0522517 | |||
| 2160 | Ga0495653_0789965 | |||
| 2161 | Ga0495650_0001155 | |||
| 2162 | Ga0495580_0005741 | |||
| 2163 | Ga0495580_0854374 | |||
| 2164 | Ga0495582_0006702 | |||
| 2165 | Ga0495582_0422337 | |||
| 2166 | Ga0495582_0876641 | |||
| 2167 | Ga0495605_0032176 | |||
| 2168 | Ga0495605_0034972 | |||
| 2169 | Ga0495605_0044915 | |||
| 2170 | Ga0495639_0011908 | |||
| 2171 | Ga0495639_0067301 | |||
| 2172 | Ga0495639_0103625 | |||
| 2173 | Ga0495639_0311761 | |||
| 2174 | Ga0495639_0568903 | |||
| 2175 | Ga0495662_0020580 | |||
| 2176 | Ga0495662_0058065 | |||
| 2177 | Ga0495664_0005513 | |||
| 2178 | Ga0495664_0049584 | |||
| 2179 | Ga0495664_0116722 | |||
| 2180 | Ga0495584_0017189 | |||
| 2181 | Ga0495584_0028785 | |||
| 2182 | Ga0495585_0064045 | |||
| 2183 | Ga0495585_0069895 | |||
| 2184 | Ga0495585_0276396 | |||
| 2185 | Ga0495585_0287695 | |||
| 2186 | Ga0495585_0428849 | |||
| 2187 | Ga0495585_0514745 | |||
| 2188 | Ga0495594_0233679 | |||
| 2189 | Ga0495594_0242601 | |||
| 2190 | Ga0495594_0262121 | |||
| 2191 | Ga0495594_0550869 | |||
| 2192 | Ga0495596_0228189 | |||
| 2193 | Ga0495607_0008857 | |||
| 2194 | Ga0495607_0090305 | |||
| 2195 | Ga0495607_0251067 | |||
| 2196 | Ga0495607_0253965 | |||
| 2197 | Ga0495607_0394482 | |||
| 2198 | Ga0495583_0070481 | |||
| 2199 | Ga0495583_0078227 | |||
| 2200 | Ga0495583_0368032 | |||
| 2201 | Ga0495606_0001566 | |||
| 2202 | Ga0495606_0012761 | |||
| 2203 | Ga0495606_0034333 | |||
| 2204 | Ga0495606_0039871 | |||
| 2205 | Ga0495606_0075267 | |||
| 2206 | Ga0495606_0154197 | |||
| 2207 | Ga0495606_0510765 | |||
| 2208 | Ga0495606_0622683 | |||
| 2209 | Ga0495608_0082922 | |||
| 2210 | Ga0495608_0096243 | |||
| 2211 | Ga0495608_0271644 | |||
| 2212 | Ga0495610_0078453 | |||
| 2213 | Ga0495616_0045289 | |||
| 2214 | Ga0495616_0153229 | |||
| 2215 | Ga0495618_0292532 | |||
| 2216 | Ga0495618_0626160 | |||
| 2217 | Ga0495620_0353824 | |||
| 2218 | Ga0495620_0389075 | |||
| 2219 | Ga0495628_0208129 | |||
| 2220 | Ga0495630_0064559 | |||
| 2221 | Ga0495630_0241928 | |||
| 2222 | Ga0495631_0016371 | |||
| 2223 | Ga0495631_0093831 | |||
| 2224 | Ga0495631_0120100 | |||
| 2225 | Ga0495631_0205675 | |||
| 2226 | Ga0495631_0265885 | |||
| 2227 | Ga0495631_0320169 | |||
| 2228 | Ga0495632_0017675 | |||
| 2229 | Ga0495632_0118175 | |||
| 2230 | Ga0495632_0342218 | |||
| 2231 | Ga0495637_0036160 | |||
| 2232 | Ga0495643_0011150 | |||
| 2233 | Ga0495643_0326024 | |||
| 2234 | Ga0495643_0389680 | |||
| 2235 | Ga0495644_0091621 | |||
| 2236 | Ga0495644_0271393 | |||
| 2237 | Ga0495644_0277466 | |||
| 2238 | Ga0495644_0367660 | |||
| 2239 | Ga0495648_0029624 | |||
| 2240 | Ga0495648_0173823 | |||
| 2241 | Ga0495648_0420033 | |||
| 2242 | Ga0495663_0313484 | |||
| 2243 | Ga0495663_0323900 | |||
| 2244 | Ga0495666_0034619 | |||
| 2245 | Ga0495666_0158746 | |||
| 2246 | Ga0495666_0319879 | |||
| 2247 | Ga0495666_0489021 | |||
| 2248 | Ga0495642_0508511 | |||
| 2249 | Ga0495652_0017151 | |||
| 2250 | Ga0495652_0057203 | |||
| 2251 | Ga0495652_0089438 | |||
| 2252 | Ga0495652_0816282 | |||
| 2253 | Ga0495654_0015853 | |||
| 2254 | Ga0495654_0159228 | |||
| 2255 | Ga0495654_0387415 | |||
| 2256 | Ga0495665_0005603 | |||
| 2257 | Ga0495665_0135346 | |||
| 2258 | Ga0495640_0005237 | |||
| 2259 | Ga0495640_0732680 | |||
| 2260 | Ga0495586_0118068 | |||
| 2261 | Ga0495587_0052305 | |||
| 2262 | Ga0495587_0082496 | |||
| 2263 | Ga0495587_0364677 | |||
| 2264 | Ga0495609_0019411 | |||
| 2265 | Ga0495609_0087339 | |||
| 2266 | Ga0495609_0194033 | |||
| 2267 | Ga0495609_0244400 | |||
| 2268 | Ga0495609_0342483 | |||
| 2269 | Ga0495621_0027947 | |||
| 2270 | Ga0495621_0318831 | |||
| 2271 | Ga0495621_0525150 | |||
| 2272 | Ga0495597_0072862 | |||
| 2273 | Ga0495645_0001939 | |||
| 2274 | Ga0495645_0010968 | |||
| 2275 | Ga0495645_0074893 | |||
| 2276 | Ga0495645_0217539 | |||
| 2277 | Ga0495645_0586280 | |||
| 2278 | Ga0495622_0229507 | |||
| 2279 | Ga0495633_0314727 | |||
| 2280 | Ga0495667_0028020 | |||
| 2281 | Ga0495667_0086796 | |||
| 2282 | Ga0495667_0167633 | |||
| 2283 | Ga0495656_0026864 | |||
| 2284 | Ga0495656_0046559 | |||
| 2285 | Ga0495656_0074179 | |||
| 2286 | Ga0495656_0090614 | |||
| 2287 | Ga0495656_0153921 | |||
| 2288 | Ga0495668_0013946 | |||
| 2289 | Ga0495668_0047101 | |||
| 2290 | Ga0495668_0270412 | |||
| 2291 | Ga0495668_0460986 | |||
| 2292 | Ga0495634_0746574 | |||
| 2293 | Ga0495611_0091070 | |||
| 2294 | Ga0495611_0222139 | |||
| 2295 | Ga0495611_0484364 | |||
| 2296 | Ga0495625_0035568 | |||
| 2297 | Ga0495625_0138370 | |||
| 2298 | Ga0495625_0260799 | |||
| 2299 | Ga0495625_0307221 | |||
| 2300 | Ga0495625_0722439 | |||
| 2301 | Ga0495635_0037964 | |||
| 2302 | Ga0495659_0043372 | |||
| 2303 | Ga0495659_0393263 | |||
| 2304 | Ga0495661_0165205 | |||
| 2305 | Ga0495661_0235255 | |||
| 2306 | Ga0495588_0030445 | |||
| 2307 | Ga0495588_0073237 | |||
| 2308 | Ga0495588_0120965 | |||
| 2309 | Ga0495657_0091606 | |||
| 2310 | Ga0495657_0789688 | |||
| 2311 | Ga0495599_0060792 | |||
| 2312 | Ga0495599_0415426 | |||
| 2313 | Ga0495623_0071142 | |||
| 2314 | Ga0495623_0674509 | |||
| 2315 | Ga0495647_0300216 | |||
| 2316 | Ga0495658_0010407 | |||
| 2317 | Ga0495658_0939970 | |||
| 2318 | Ga0495669_0171418 | |||
| 2319 | Ga0495669_0201378 | |||
| 2320 | Ga0495669_0205324 | |||
| 2321 | Ga0495669_0277193 | |||
| 2322 | Ga0495669_0629960 | |||
| 2323 | Ga0495613_0109070 | |||
| 2324 | Ga0495613_0390683 | |||
| 2325 | Ga0495624_0019628 | |||
| 2326 | Ga0495624_0235282 | |||
| 2327 | Ga0495670_0085054 | |||
| 2328 | Ga0495670_0097664 | |||
| 2329 | Ga0495670_0387931 | |||
| 2330 | Ga0495671_0213271 | |||
| 2331 | Ga0495671_0227131 | |||
| 2332 | Ga0495671_0281844 | |||
| 2333 | Ga0495671_0307717 | |||
| 2334 | Ga0495671_0379050 | |||
| 2335 | Ga0495671_0425340 | |||
| 2336 | Ga0495649_0062122 | |||
| 2337 | Ga0495649_0223410 | |||
| 2338 | Ga0495649_0306035 | |||
| 2339 | Ga0495649_0518042 | |||
| 2340 | Ga0495649_0648524 | |||
| 2341 | Ga0495589_0011378 | |||
| 2342 | Ga0495589_0095519 | |||
| 2343 | Ga0495589_0123180 | |||
| 2344 | Ga0495589_0371791 | |||
| 2345 | Ga0495589_0474871 | |||
| 2346 | Ga0495600_0069308 | |||
| 2347 | Ga0495600_0833438 | |||
| 2348 | Ga0495660_0216541 | |||
| 2349 | Ga0495660_0453147 | |||
| 2350 | Ga0495581_0011373 | |||
| 2351 | Ga0495581_0073400 | |||
| 2352 | Ga0495581_0077939 | |||
| 2353 | Ga0495604_0138184 | |||
| 2354 | Ga0495604_0180476 | |||
| 2355 | Ga0495636_0518154 | |||
| 2356 | Ga0495636_0520336 | |||
| 2357 | Ga0495674_0001989 | |||
| 2358 | Ga0495674_0114150 | |||
| 2359 | Ga0495674_0521353 | |||
| 2360 | Ga0495674_1342913 | |||
| 2361 | Ga0495672_0121391 | |||
| 2362 | Ga0495672_0189891 | |||
| 2363 | Ga0495676_0250239 | |||
| 2364 | Ga0495676_0307204 | |||
| 2365 | Ga0495676_0330065 | |||
| 2366 | Ga0495676_0375024 | |||
| 2367 | Ga0495680_0028837 | |||
| 2368 | Ga0495680_0329372 | |||
| 2369 | Ga0495680_0533299 | |||
| 2370 | Ga0495683_0017557 | |||
| 2371 | Ga0495683_0336560 | |||
| 2372 | Ga0495687_020352 | |||
| 2373 | Ga0495675_0343313 | |||
| 2374 | Ga0495677_0132549 | |||
| 2375 | Ga0495677_0171566 | |||
| 2376 | Ga0495679_082617 | |||
| 2377 | Ga0495679_129092 | |||
| 2378 | Ga0495673_0132158 | |||
| 2379 | Ga0495673_0148558 | |||
| 2380 | Ga0495673_0259376 | |||
| 2381 | Ga0495673_0323495 | |||
| 2382 | Ga0495681_0273396 | |||
| 2383 | Ga0495684_0004921 | |||
| 2384 | Ga0495684_0176305 | |||
| 2385 | Ga0495686_0081319 | |||
| 2386 | Ga0495686_0163246 | |||
| 2387 | Ga0495686_0169662 | |||
| 2388 | Ga0495686_0301112 | |||
| 2389 | Ga0495686_0558241 | |||
| 2390 | Ga0495593_0115467 | |||
| 2391 | Ga0495602_0280084 | |||
| 2392 | Ga0495602_0418278 | |||
| 2393 | Ga0495614_0203513 | |||
| 2394 | Ga0495615_0152132 | |||
| 2395 | Ga0495626_0095969 | |||
| 2396 | Ga0495626_0440159 | |||
| 2397 | Ga0496100_0352046 | |||
| 2398 | Ga0496100_0526155 | |||
| 2399 | Ga0496100_0916657 | |||
| 2400 | Ga0496100_1151080 | |||
| 2401 | Ga0496101_0052463 | |||
| 2402 | Ga0496101_0560693 | |||
| 2403 | Ga0496101_0880246 | |||
| 2404 | Ga0496102_0003175 | |||
| 2405 | Ga0496102_0351511 | |||
| 2406 | Ga0496102_0994313 | |||
| 2407 | Ga0496102_1673601 | |||
| 2408 | Ga0496103_0024988 | |||
| 2409 | Ga0496103_0466512 | |||
| 2410 | Ga0496103_0491165 | |||
| 2411 | Ga0496104_0054701 | |||
| 2412 | Ga0496104_0071290 | |||
| 2413 | Ga0496104_0167266 | |||
| 2414 | Ga0496104_0559707 | |||
| 2415 | Ga0496104_0933093 | |||
| 2416 | Ga0496105_0023165 | |||
| 2417 | Ga0496105_0043187 | |||
| 2418 | Ga0496105_0062157 | |||
| 2419 | Ga0496105_0913986 | |||
| 2420 | Ga0496106_0039537 | |||
| 2421 | Ga0496106_0435815 | |||
| 2422 | Ga0496106_0492430 | |||
| 2423 | Ga0496106_0537320 | |||
| 2424 | Ga0496106_1481734 | |||
| 2425 | Ga0496107_0027047 | |||
| 2426 | Ga0496107_0083697 | |||
| 2427 | Ga0496107_0631163 | |||
| 2428 | Ga0496107_0998515 | |||
| 2429 | Ga0496108_0049151 | |||
| 2430 | Ga0496108_0106154 | |||
| 2431 | Ga0496108_0286660 | |||
| 2432 | Ga0496108_0301255 | |||
| 2433 | Ga0496108_1163312 | |||
| 2434 | Ga0496109_0025925 | |||
| 2435 | Ga0496109_0060765 | |||
| 2436 | Ga0496109_0432040 | |||
| 2437 | Ga0496109_0634531 | |||
| 2438 | Ga0496109_1047145 | |||
| 2439 | Ga0496109_1086224 | |||
| 2440 | Ga0496110_0038811 | |||
| 2441 | Ga0496110_0069002 | |||
| 2442 | Ga0496110_0523976 | |||
| 2443 | Ga0496110_0747209 | |||
| 2444 | Ga0496111_0041412 | |||
| 2445 | Ga0496111_0043022 | |||
| 2446 | Ga0496111_0089098 | |||
| 2447 | Ga0496111_1070947 | |||
| 2448 | Ga0496112_0000018 | |||
| 2449 | Ga0496112_0001958 | |||
| 2450 | Ga0496112_0173931 | |||
| 2451 | Ga0496112_0357325 | |||
| 2452 | Ga0496112_0455136 | |||
| 2453 | Ga0496112_1666590 | |||
| 2454 | Ga0496113_0780927 | |||
| 2455 | Ga0496113_1180533 | |||
| 2456 | Ga0496113_1204054 | |||
| 2457 | Ga0496114_0034614 | |||
| 2458 | Ga0496114_0039299 | |||
| 2459 | Ga0496114_1335562 | |||
| 2460 | Ga0496115_0070966 | |||
| 2461 | Ga0496115_0358527 | |||
| 2462 | Ga0496115_0450856 | |||
| 2463 | Ga0496115_1280224 | |||
| 2464 | Ga0496115_1449207 | |||
| 2465 | Ga0496116_0076148 | |||
| 2466 | Ga0496116_0352428 | |||
| 2467 | Ga0496117_0022310 | |||
| 2468 | Ga0496117_0067196 | |||
| 2469 | Ga0496117_0378397 | |||
| 2470 | Ga0496118_0018395 | |||
| 2471 | Ga0496118_0068579 | |||
| 2472 | Ga0496118_0141924 | |||
| 2473 | Ga0496119_0012507 | |||
| 2474 | Ga0496119_0037823 | |||
| 2475 | Ga0496119_0158132 | |||
| 2476 | Ga0496119_0504467 | |||
| 2477 | Ga0496120_0143214 | |||
| 2478 | Ga0496120_0222928 | |||
| 2479 | Ga0496121_0001046 | |||
| 2480 | Ga0496121_0047732 | |||
| 2481 | Ga0496121_0051267 | |||
| 2482 | Ga0496121_0059293 | |||
| 2483 | Ga0496121_0071614 | |||
| 2484 | Ga0496121_0071682 | |||
| 2485 | Ga0496121_0249867 | |||
| 2486 | Ga0496121_0323593 | |||
| 2487 | Ga0496121_0400013 | |||
| 2488 | Ga0496121_0573616 | |||
| 2489 | Ga0496122_0081810 | |||
| 2490 | Ga0496122_0131235 | |||
| 2491 | Ga0496122_0144541 | |||
| 2492 | Ga0496123_0481154 | |||
| 2493 | Ga0496124_0013092 | |||
| 2494 | Ga0496124_0022005 | |||
| 2495 | Ga0496124_0281883 | |||
| 2496 | Ga0496124_0318201 | |||
| 2497 | Ga0496124_0827992 | |||
| 2498 | Ga0496125_0032864 | |||
| 2499 | Ga0496125_0043837 | |||
| 2500 | Ga0496125_0162034 | |||
| 2501 | Ga0496125_0247778 | |||
| 2502 | Ga0496126_0011825 | |||
| 2503 | Ga0496126_0015601 | |||
| 2504 | Ga0496126_0020176 | |||
| 2505 | Ga0496126_0031303 | |||
| 2506 | Ga0496126_0060458 | |||
| 2507 | Ga0496126_0061824 | |||
| 2508 | Ga0496126_0063195 | |||
| 2509 | Ga0496126_0122996 | |||
| 2510 | Ga0496126_0182744 | |||
| 2511 | Ga0496126_0231407 | |||
| 2512 | Ga0496126_0430252 | |||
| 2513 | Ga0496126_0518849 | |||
| 2514 | Ga0496126_0944773 | |||
| 2515 | Ga0496126_0950196 | |||
| 2516 | Ga0495678_188501 | |||
| 2517 | Ga0495678_218048 | |||
| 2518 | Ga0495682_0006058 | |||
| 2519 | Ga0501031_1072633 | |||
| 2520 | Ga0501033_0206964 | |||
| 2521 | Ga0501034_0354444 | |||
| 2522 | Ga0501036_0234466 | |||
| 2523 | Ga0501036_0579441 | |||
| 2524 | Ga0501039_1507062 | |||
| 2525 | Ga0501046_0044071 | |||
| 2526 | Ga0501047_0036466 | |||
| 2527 | Ga0501048_0277370 | |||
| 2528 | Ga0501067_0051257 | |||
| 2529 | Ga0501067_0083249 | |||
| 2530 | Ga0501069_0207786 | |||
| 2531 | Ga0501070_0602816 | |||
| 2532 | Ga0501073_0043738 | |||
| 2533 | Ga0501073_0621624 | |||
| 2534 | Ga0501074_0203085 | |||
| 2535 | Ga0501080_0004617 | |||
| 2536 | Ga0501080_0077138 | |||
| 2537 | Ga0501083_0000632 | |||
| 2538 | Ga0501083_1124227 | |||
| 2539 | Ga0501044_0022102 | |||
| 2540 | Ga0501044_0039142 | |||
| 2541 | Ga0501044_0896085 | |||
| 2542 | nmdc:mga03683_187787_c1 | |||
| 2543 | nmdc:mga03683_2734_c1 | |||
| 2544 | nmdc:mga03683_457893_c1 | |||
| 2545 | nmdc:mga03683_63046_c2 | |||
| 2546 | nmdc:mga03683_672932_c1 | |||
| 2547 | nmdc:mga03n38_193888_c1 | |||
| 2548 | nmdc:mga03n38_54633_c1 | |||
| 2549 | nmdc:mga03n38_64485_c1 | |||
| 2550 | nmdc:mga03n38_769283_c1 | |||
| 2551 | nmdc:mga00v17_136770_c1 | |||
| 2552 | nmdc:mga00v17_155235_c1 | |||
| 2553 | nmdc:mga00v17_170831_c1 | |||
| 2554 | nmdc:mga00v17_239999_c1 | |||
| 2555 | nmdc:mga0yw44_147116_c1 | |||
| 2556 | nmdc:mga0yw44_94650_c1 | |||
| 2557 | nmdc:mga0k408_17656_c1 | |||
| 2558 | nmdc:mga0k408_23559_c1 | |||
| 2559 | nmdc:mga0k408_29709_c1 | |||
| 2560 | nmdc:mga0k408_4373_c1 | |||
| 2561 | nmdc:mga0k408_626141_c1 | |||
| 2562 | nmdc:mga0k408_7136_c1 | |||
| 2563 | nmdc:mga06z11_14951_c1 | |||
| 2564 | nmdc:mga06z11_188765_c1 | |||
| 2565 | nmdc:mga06z11_242167_c1 | |||
| 2566 | nmdc:mga06z11_302132_c1 | |||
| 2567 | nmdc:mga06z11_842591_c1 | |||
| 2568 | nmdc:mga06z11_97371_c1 | |||
| 2569 | nmdc:mga04h51_43506_c1 | |||
| 2570 | nmdc:mga07m45_141055_c1 | |||
| 2571 | nmdc:mga07m45_150986_c1 | |||
| 2572 | nmdc:mga07m45_34912_c1 | |||
| 2573 | nmdc:mga07m45_397757_c1 | |||
| 2574 | nmdc:mga07m45_616766_c1 | |||
| 2575 | nmdc:mga07m45_63917_c1 | |||
| 2576 | nmdc:mga05p37_2115491_c1 | |||
| 2577 | nmdc:mga05p37_962769_c1 | |||
| 2578 | nmdc:mga08y16_1792193_c1 | |||
| 2579 | nmdc:mga0n895_361327_c1 | |||
| 2580 | nmdc:mga0n895_63525_c1 | |||
| 2581 | nmdc:mga0n895_66805_c1 | |||
| 2582 | nmdc:mga0rr50_200099_c1 | |||
| 2583 | nmdc:mga0rr50_368928_c1 | |||
| 2584 | nmdc:mga08x19_1118757_c1 | |||
| 2585 | nmdc:mga08x19_89222_c1 | |||
| 2586 | nmdc:mga0a205_503770_c1 | |||
| 2587 | nmdc:mga0sz30_233865_c1 | |||
| 2588 | nmdc:mga0sz30_35554_c1 | |||
| 2589 | nmdc:mga0sz30_45811_c1 | |||
| 2590 | nmdc:mga0sz30_47732_c1 | |||
| 2591 | nmdc:mga0sz30_89167_c1 | |||
| 2592 | Ga0495601_0000314 | |||
| 2593 | Ga0495601_0026148 | |||
| 2594 | Ga0495612_0025187 | |||
| 2595 | Ga0495612_0047401 | |||
| 2596 | Ga0495612_0343866 | |||
| 2597 | Ga0500635_0112271 | |||
| 2598 | Ga0500635_0196002 | |||
| 2599 | Ga0495655_0033945 | |||
| 2600 | Ga0495655_0052353 | |||
| 2601 | Ga0495655_0119009 | |||
| 2602 | Ga0495655_0322488 | |||
| 2603 | Ga0495619_0001337 | |||
| 2604 | Ga0495619_0345653 | |||
| 2605 | Ga0495619_1187970 | |||
| 2606 | Ga0500578_0177698 | |||
| 2607 | Ga0500578_0246355 | |||
| 2608 | Ga0500578_0362677 | |||
| 2609 | Ga0500643_050691 | |||
| 2610 | Ga0500644_0228380 | |||
| 2611 | Ga0500646_0013502 | |||
| 2612 | Ga0500646_0046263 | |||
| 2613 | Ga0500646_0097416 | |||
| 2614 | Ga0500646_0322521 | |||
| 2615 | Ga0500646_0366957 | |||
| 2616 | Ga0500647_0033748 | |||
| 2617 | Ga0500647_0337116 | |||
| 2618 | Ga0500647_0429657 | |||
| 2619 | Ga0500583_0362710 | |||
| 2620 | Ga0500651_0064955 | |||
| 2621 | Ga0500566_0000191 | |||
| 2622 | Ga0500566_0013266 | |||
| 2623 | Ga0500566_0132105 | |||
| 2624 | Ga0500566_0165307 | |||
| 2625 | Ga0500566_0179786 | |||
| 2626 | Ga0500640_000328 | |||
| 2627 | Ga0500641_0022750 | |||
| 2628 | Ga0500641_0150043 | |||
| 2629 | Ga0500641_0203834 | |||
| 2630 | Ga0500648_180438 | |||
| 2631 | Ga0500648_352558 | |||
| 2632 | Ga0500650_0001278 | |||
| 2633 | Ga0500654_122720 | |||
| 2634 | Ga0500554_048990 | |||
| 2635 | Ga0500555_167427 | |||
| 2636 | Ga0500556_0000095 | |||
| 2637 | Ga0500556_0142750 | |||
| 2638 | Ga0500558_277070 | |||
| 2639 | Ga0500562_106402 | |||
| 2640 | Ga0500562_164934 | |||
| 2641 | Ga0500569_040695 | |||
| 2642 | Ga0500569_315674 | |||
| 2643 | Ga0500572_000153 | |||
| 2644 | Ga0500572_000739 | |||
| 2645 | Ga0500591_222088 | |||
| 2646 | Ga0500592_019178 | |||
| 2647 | Ga0500593_084377 | |||
| 2648 | Ga0500594_0020980 | |||
| 2649 | Ga0500594_0077410 | |||
| 2650 | Ga0500595_000863 | |||
| 2651 | Ga0500595_015387 | |||
| 2652 | Ga0500595_016281 | |||
| 2653 | Ga0500595_231862 | |||
| 2654 | Ga0500608_092904 | |||
| 2655 | Ga0500614_007288 | |||
| 2656 | Ga0500628_191896 | |||
| 2657 | Ga0500642_0247733 | |||
| 2658 | Ga0500642_0325251 | |||
| 2659 | Ga0500655_002239 | |||
| 2660 | Ga0500655_113949 | |||
| 2661 | Ga0500658_0234229 | |||
| 2662 | Ga0500658_0289686 | |||
| 2663 | Ga0500559_0000299 | |||
| 2664 | Ga0500559_0000585 | |||
| 2665 | Ga0500559_0010824 | |||
| 2666 | Ga0500559_0017076 | |||
| 2667 | Ga0500559_0117444 | |||
| 2668 | Ga0500561_0158082 | |||
| 2669 | Ga0500568_0026201 | |||
| 2670 | Ga0500568_0073513 | |||
| 2671 | Ga0500568_0078005 | |||
| 2672 | Ga0500573_0308853 | |||
| 2673 | Ga0500577_0318774 | |||
| 2674 | Ga0500577_0327468 | |||
| 2675 | Ga0500588_0230347 | |||
| 2676 | Ga0500589_031633 | |||
| 2677 | Ga0500590_201570 | |||
| 2678 | Ga0500603_001431 | |||
| 2679 | Ga0500603_090077 | |||
| 2680 | Ga0500604_0048410 | |||
| 2681 | Ga0500616_0045212 | |||
| 2682 | Ga0500616_0395270 | |||
| 2683 | Ga0500622_0000791 | |||
| 2684 | Ga0500622_0065143 | |||
| 2685 | Ga0500622_0244066 | |||
| 2686 | Ga0500630_003340 | |||
| 2687 | Ga0500633_0311366 | |||
| 2688 | Ga0500634_0153385 | |||
| 2689 | Ga0500634_0407464 | |||
| 2690 | Ga0500638_090362 | |||
| 2691 | Ga0500638_170194 | |||
| 2692 | Ga0500639_000477 | |||
| 2693 | Ga0500639_004935 | |||
| 2694 | Ga0500639_049860 | |||
| 2695 | Ga0500636_0436409 | |||
| 2696 | Ga0500637_0003263 | |||
| 2697 | Ga0500637_0030501 | |||
| 2698 | Ga0500637_0174840 | |||
| 2699 | Ga0500567_251040 | |||
| 2700 | Ga0500570_225740 | |||
| 2701 | Ga0500576_022052 | |||
| 2702 | Ga0500611_086488 | |||
| 2703 | Ga0500657_164981 | |||
| 2704 | Ga0500645_086458 | |||
| 2705 | Ga0500609_049086 | |||
| 2706 | Ga0500656_040579 | |||
| 2707 | Ga0500552_003598 | |||
| 2708 | Ga0500596_001682 | |||
| 2709 | Ga0500596_002529 | |||
| 2710 | Ga0500596_008742 | |||
| 2711 | Ga0500661_007864 | |||
| 2712 | Ga0587084_083580 | |||
| 2713 | Ga0587066_118947 | |||
| 2714 | Ga0587073_0176763 | |||
| 2715 | Ga0587080_030213 | |||
| 2716 | Ga0587088_207040 | |||
| 2717 | Ga0587099_067117 | |||
| 2718 | Ga0587076_173006 | |||
| 2719 | Ga0587111_0260638 | |||
| 2720 | Ga0466962_0022598 | |||
| 2721 | Ga0466962_0256782 | |||
| 2722 | 2597870970 | |||
| 2723 | 2958174469 | |||
| 2724 | 2977978113 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8h1i-assembly1.cif.gz_B | crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c | 0.9201 | 2 | 64 |
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.9157 | 2 | 66 |
| 1hza-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.9117 | 1 | 67 |
| 2lss-assembly1.cif.gz_A | solution structure of the r. rickettsii cold shock-like protein | 0.903 | 3 | 67 |
| 1c9o-assembly1.cif.gz_B | crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp | 0.9015 | 1 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9296 | 2 | 65 | 2.40.50.140 |
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9192 | 2 | 64 | 2.40.50.140 |
| 2lssA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.903 | 3 | 67 | 2.40.50.140 |
| af_Q9VRN5_36_116_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8961 | 2 | 65 | 2.40.50.140 |
| af_Q4DCA9_18_92_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8911 | 3 | 64 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2F0AKQ6-F1-model_v4 | Cold-shock protein | 1.004 | 1 | 66 |
GO:0003676
GO:0005829 |
| AF-A0A2E7RF98-F1-model_v4 | Cold-shock protein | 1.003 | 1 | 66 |
GO:0003676
GO:0005829 |
| AF-A0A085FQU9-F1-model_v4 | Cold shock protein (Beta-ribbon, CspA family) | 1.001 | 2 | 66 |
GO:0003676
GO:0005829 |
| AF-A0A7Y4H5I2-F1-model_v4 | Cold shock domain-containing protein | 0.9994 | 1 | 66 |
GO:0003676
GO:0005829 |
| AF-A0A1M7M1X0-F1-model_v4 | Cold shock protein (Beta-ribbon, CspA family) | 0.9982 | 2 | 67 |
GO:0003676
GO:0005829 |