F492631

General Info

Members Datasets Scaffolds Average Seq Length
1290 561 1290 89

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_1414920|Ga0501036_1414920_206_541
Length 111
Sequence VLDDIPALAADRWVFSNRKENPMSITAERKQALIKEYANGANDTGSPEVQVAILSERIANLTEHFKTHKKDNHSRRGLLKLVSQRRSLLDYLKGKEEARYKTLIERLGIRR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
122 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
123 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
221 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
225 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
236 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
241 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
242 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
243 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
256 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
257 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
263 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
264 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
265 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
278 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
279 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
293 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
294 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
295 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
296 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
297 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
298 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
299 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
300 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
301 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
302 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
303 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
304 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
305 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
306 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
307 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
308 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
309 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
310 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
311 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
312 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
313 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
314 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
315 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
316 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
317 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
318 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
319 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
320 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
321 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
322 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
323 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
324 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
325 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
326 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
327 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
328 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
329 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
330 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
331 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
332 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
333 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
334 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
335 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
336 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
337 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
338 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
341 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
350 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
351 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
355 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
356 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
357 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
361 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
368 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
369 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
376 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
377 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
378 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
379 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
380 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
381 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
382 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
383 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
384 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
385 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
386 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
387 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
388 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
389 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
390 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
391 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
392 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
393 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
394 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
395 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
396 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
397 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
398 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
399 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
400 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
418 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
419 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
448 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
449 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
450 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
451 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
452 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
453 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
454 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
455 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
456 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
457 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
458 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
459 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
460 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
465 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
466 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
469 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
470 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
471 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
472 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
476 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
477 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
480 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
481 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
484 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
488 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
489 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
490 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
491 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
492 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
493 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
494 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
495 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
496 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
497 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
498 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
499 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
500 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
501 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
502 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
503 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
504 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
505 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
506 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
507 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
508 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
509 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
510 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
511 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
512 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
513 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
514 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
515 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
516 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
517 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
518 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
519 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
520 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
521 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
522 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
523 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
524 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
561 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.84
Metatranscriptomes 11.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.78
Nodule 0
Rhizoplane 5.74
Rhizosphere 77.52
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10096869 3300003215 Bacteria 701
2 rootL2_10142746 3300003322 Bacteria 1396
3 Ga0006558J51389_1030434 3300003558 Bacteria 611
4 Ga0055537_1004646 3300003773 Bacteria 3878
5 Ga0055524_1068676 3300003775 Bacteria 693
6 Ga0055536_1004742 3300003781 Bacteria 6834
7 Ga0055536_1053798 3300003781 Bacteria 868
8 Ga0055528_1004920 3300003790 Bacteria 6310
9 Ga0055530_10009589 3300003791 Bacteria 3699
10 Ga0055540_1024508 3300003792 Bacteria 1495
11 Ga0055531_10000968 3300003794 Bacteria 22999
12 Ga0055531_10006710 3300003794 Bacteria 6442
13 Ga0055531_10007558 3300003794 Bacteria 5898
14 Ga0055531_10035065 3300003794 Bacteria 1578
15 Ga0055543_1017106 3300004625 Bacteria 1368
16 Ga0058863_11934056 3300004799 Bacteria 697
17 Ga0058861_11969232 3300004800 Bacteria 992
18 Ga0058861_12043731 3300004800 Bacteria 946
19 Ga0058860_12201779 3300004801 Bacteria 781
20 Ga0058862_10101958 3300004803 Bacteria 690
21 Ga0058862_12762670 3300004803 Bacteria 519
22 Ga0058862_12763025 3300004803 Bacteria 937
23 Ga0058862_12821347 3300004803 Bacteria 593
24 Ga0065165_1000345 3300005262 Bacteria 76072
25 Ga0065165_1001044 3300005262 Bacteria 33434
26 Ga0065704_10053697 3300005289 Bacteria 708
27 Ga0065704_10113070 3300005289 Bacteria 1920
28 Ga0065704_10657186 3300005289 Bacteria 580
29 Ga0065704_10778563 3300005289 Bacteria 532
30 Ga0065715_10005462 3300005293 Bacteria 3382
31 Ga0070658_10625286 3300005327 Bacteria 934
32 Ga0070658_10669684 3300005327 Bacteria 900
33 Ga0070676_10380717 3300005328 Bacteria 977
34 Ga0070676_11592608 3300005328 Bacteria 504
35 Ga0070690_100184757 3300005330 Bacteria 1442
36 Ga0070670_100111080 3300005331 Bacteria 2362
37 Ga0070670_101255424 3300005331 Bacteria 678
38 Ga0068869_100049925 3300005334 Bacteria 3031
39 Ga0068869_100118268 3300005334 Bacteria 2024
40 Ga0068869_101092181 3300005334 Bacteria 698
41 Ga0068869_101529218 3300005334 Bacteria 593
42 Ga0070666_10707515 3300005335 Bacteria 739
43 Ga0070680_100016416 3300005336 Bacteria 5828
44 Ga0070682_101263394 3300005337 Bacteria 626
45 Ga0068868_101159455 3300005338 Unclassified 713
46 Ga0068868_101761723 3300005338 Bacteria 585
47 Ga0070660_100460371 3300005339 Bacteria 1056
48 Ga0070660_101449038 3300005339 Bacteria 584
49 Ga0070660_101813807 3300005339 Bacteria 520
50 Ga0070689_101260739 3300005340 Bacteria 665
51 Ga0070691_10227010 3300005341 Bacteria 992
52 Ga0070661_100670954 3300005344 Bacteria 843
53 Ga0070661_100988451 3300005344 Bacteria 698
54 Ga0070692_10439872 3300005345 Bacteria 832
55 Ga0070692_11249688 3300005345 Bacteria 531
56 Ga0070668_100113463 3300005347 Bacteria 2159
57 Ga0070668_100463259 3300005347 Bacteria 1092
58 Ga0070668_100755407 3300005347 Bacteria 861
59 Ga0070669_100091793 3300005353 Bacteria 2278
60 Ga0070669_100939978 3300005353 Bacteria 740
61 Ga0070669_101431469 3300005353 Bacteria 600
62 Ga0070675_100713125 3300005354 Bacteria 914
63 Ga0070675_100951533 3300005354 Bacteria 788
64 Ga0070674_100462839 3300005356 Bacteria 1049
65 Ga0070674_101737076 3300005356 Bacteria 565
66 Ga0070659_100015080 3300005366 Bacteria 5781
67 Ga0070659_100508916 3300005366 Unclassified 1027
68 Ga0070667_100464157 3300005367 Bacteria 1158
69 Ga0070667_100823887 3300005367 Bacteria 862
70 Ga0070667_101366872 3300005367 Bacteria 664
71 Ga0070667_101497008 3300005367 Bacteria 634
72 Ga0070667_101923418 3300005367 Bacteria 557
73 Ga0070703_10042681 3300005406 Bacteria 1419
74 Ga0070714_100503652 3300005435 Bacteria 1155
75 Ga0070713_101636727 3300005436 Bacteria 625
76 Ga0070701_10046848 3300005438 Bacteria 2224
77 Ga0070711_100479064 3300005439 Bacteria 1023
78 Ga0070705_100000422 3300005440 Bacteria 24408
79 Ga0070705_100612625 3300005440 Bacteria 844
80 Ga0070700_100000646 3300005441 Bacteria 17236
81 Ga0070700_100255677 3300005441 Bacteria 1259
82 Ga0070700_101357823 3300005441 Bacteria 599
83 Ga0070694_100001076 3300005444 Bacteria 15626
84 Ga0070694_100314683 3300005444 Bacteria 1203
85 Ga0070694_100760996 3300005444 Bacteria 792
86 Ga0070694_101406741 3300005444 Bacteria 589
87 Ga0070708_100086386 3300005445 Bacteria 2849
88 Ga0070708_101039194 3300005445 Bacteria 768
89 Ga0070663_100016933 3300005455 Bacteria 4744
90 Ga0070663_100206840 3300005455 Bacteria 1535
91 Ga0070663_101578351 3300005455 Bacteria 585
92 Ga0070678_100467269 3300005456 Bacteria 1108
93 Ga0070678_100912178 3300005456 Bacteria 804
94 Ga0070678_101029372 3300005456 Bacteria 758
95 Ga0070678_101315047 3300005456 Bacteria 673
96 Ga0070662_100035296 3300005457 Bacteria 3531
97 Ga0070685_11615019 3300005466 Bacteria 502
98 Ga0070706_100313262 3300005467 Bacteria 1464
99 Ga0070706_101078426 3300005467 Bacteria 740
100 Ga0070707_100684776 3300005468 Bacteria 988
101 Ga0070698_100102986 3300005471 Bacteria 2825
102 Ga0070698_100229707 3300005471 Bacteria 1789
103 Ga0070698_100657213 3300005471 Bacteria 989
104 Ga0070698_100917818 3300005471 Unclassified 821
105 Ga0070698_101291247 3300005471 Bacteria 680
106 Ga0070698_101807300 3300005471 Bacteria 564
107 Ga0070699_100011141 3300005518 Bacteria 7771
108 Ga0070699_100084090 3300005518 Bacteria 2776
109 Ga0070699_100088848 3300005518 Bacteria 2700
110 Ga0070699_100148536 3300005518 Bacteria 2072
111 Ga0070679_100098880 3300005530 Bacteria 2905
112 Ga0070679_100663362 3300005530 Bacteria 986
113 Ga0070684_101108936 3300005535 Bacteria 744
114 Ga0070684_101993843 3300005535 Unclassified 548
115 Ga0070697_100020913 3300005536 Bacteria 5180
116 Ga0070697_100021215 3300005536 Bacteria 5146
117 Ga0070697_101163812 3300005536 Bacteria 687
118 Ga0068853_100135251 3300005539 Bacteria 2209
119 Ga0068853_100229928 3300005539 Bacteria 1696
120 Ga0068853_100853413 3300005539 Bacteria 873
121 Ga0070695_100010589 3300005545 Bacteria 5511
122 Ga0070695_100834306 3300005545 Bacteria 741
123 Ga0070695_100913471 3300005545 Bacteria 710
124 Ga0070695_101394124 3300005545 Bacteria 581
125 Ga0070695_101418543 3300005545 Bacteria 576
126 Ga0070696_100003141 3300005546 Bacteria 10998
127 Ga0070696_100061214 3300005546 Unclassified 2633
128 Ga0070696_100311747 3300005546 Bacteria 1208
129 Ga0070693_100047576 3300005547 Bacteria 2441
130 Ga0070693_100524656 3300005547 Bacteria 844
131 Ga0070693_100755821 3300005547 Bacteria 717
132 Ga0070693_101186723 3300005547 Bacteria 586
133 Ga0070693_101478322 3300005547 Bacteria 530
134 Ga0070665_100000187 3300005548 Bacteria 110095
135 Ga0070665_100111454 3300005548 Bacteria 2738
136 Ga0070665_100366247 3300005548 Bacteria 1448
137 Ga0070665_101047263 3300005548 Bacteria 828
138 Ga0070665_102279128 3300005548 Bacteria 545
139 Ga0070665_102400754 3300005548 Bacteria 530
140 Ga0070704_100069383 3300005549 Unclassified 2553
141 Ga0070704_100561558 3300005549 Bacteria 998
142 Ga0068855_100477917 3300005563 Bacteria 1357
143 Ga0068855_100722158 3300005563 Bacteria 1064
144 Ga0068855_100859354 3300005563 Bacteria 961
145 Ga0068855_101458103 3300005563 Bacteria 704
146 Ga0068855_101480494 3300005563 Bacteria 698
147 Ga0068855_102349453 3300005563 Bacteria 533
148 Ga0070664_101373789 3300005564 Bacteria 668
149 Ga0068857_100051141 3300005577 Bacteria 3664
150 Ga0068857_100867067 3300005577 Bacteria 865
151 Ga0068857_100930406 3300005577 Bacteria 834
152 Ga0068857_101597264 3300005577 Bacteria 637
153 Ga0068856_100125919 3300005614 Bacteria 2565
154 Ga0068856_100189873 3300005614 Bacteria 2068
155 Ga0070702_100548035 3300005615 Unclassified 858
156 Ga0068852_100725546 3300005616 Bacteria 1005
157 Ga0068852_100949953 3300005616 Bacteria 878
158 Ga0068852_101048322 3300005616 Bacteria 835
159 Ga0068859_100001348 3300005617 Bacteria 25055
160 Ga0068859_100308317 3300005617 Bacteria 1676
161 Ga0068859_100859924 3300005617 Bacteria 993
162 Ga0068859_101253628 3300005617 Bacteria 817
163 Ga0068864_100078352 3300005618 Bacteria 2892
164 Ga0068864_100179969 3300005618 Bacteria 1932
165 Ga0068864_100388174 3300005618 Bacteria 1325
166 Ga0068864_101764359 3300005618 Bacteria 624
167 Ga0068866_10180745 3300005718 Bacteria 1246
168 Ga0068866_10957200 3300005718 Bacteria 606
169 Ga0068866_11472197 3300005718 Bacteria 500
170 Ga0068861_100006874 3300005719 Bacteria 7770
171 Ga0068861_100424264 3300005719 Bacteria 1186
172 Ga0068861_100572277 3300005719 Bacteria 1033
173 Ga0068861_101285715 3300005719 Bacteria 711
174 Ga0068861_101465516 3300005719 Bacteria 669
175 Ga0068870_10555349 3300005840 Bacteria 774
176 Ga0068870_11194866 3300005840 Bacteria 550
177 Ga0068863_100335627 3300005841 Bacteria 1470
178 Ga0068863_100820669 3300005841 Bacteria 928
179 Ga0068863_100942717 3300005841 Bacteria 864
180 Ga0068863_101536035 3300005841 Bacteria 674
181 Ga0068863_102557560 3300005841 Bacteria 520
182 Ga0068858_100948399 3300005842 Bacteria 842
183 Ga0068860_100014816 3300005843 Bacteria 7626
184 Ga0068860_100226978 3300005843 Bacteria 1814
185 Ga0068860_100459488 3300005843 Bacteria 1267
186 Ga0068860_100490209 3300005843 Bacteria 1226
187 Ga0068862_100001566 3300005844 Bacteria 20878
188 Ga0068862_100016985 3300005844 Bacteria 6056
189 Ga0068862_100027838 3300005844 Bacteria 4760
190 Ga0068862_100813013 3300005844 Bacteria 913
191 Ga0068862_101560373 3300005844 Bacteria 667
192 Ga0068862_101954523 3300005844 Bacteria 597
193 Ga0081455_10070527 3300005937 Bacteria 2901
194 Ga0081455_10380279 3300005937 Bacteria 986
195 Ga0081540_1119940 3300005983 Bacteria 1093
196 Ga0081539_10132353 3300005985 Bacteria 1223
197 Ga0075365_10686934 3300006038 Bacteria 723
198 Ga0075365_11117540 3300006038 Bacteria 555
199 Ga0075363_100124223 3300006048 Bacteria 1443
200 Ga0075363_100576261 3300006048 Unclassified 673
201 Ga0075363_100592633 3300006048 Bacteria 664
202 Ga0075364_10076847 3300006051 Bacteria 2204
203 Ga0075364_10275765 3300006051 Bacteria 1144
204 Ga0075364_10317377 3300006051 Bacteria 1061
205 Ga0075364_10484407 3300006051 Bacteria 845
206 Ga0075364_10564703 3300006051 Bacteria 778
207 Ga0075364_10727560 3300006051 Bacteria 677
208 Ga0075364_11012878 3300006051 Bacteria 565
209 Ga0070715_10000031 3300006163 Bacteria 86230
210 Ga0070716_100472419 3300006173 Bacteria 919
211 Ga0070712_100491086 3300006175 Bacteria 1028
212 Ga0075362_10193590 3300006177 Bacteria 988
213 Ga0075367_10182503 3300006178 Bacteria 1309
214 Ga0075367_10327488 3300006178 Bacteria 966
215 Ga0075367_10798426 3300006178 Unclassified 601
216 Ga0075369_10043828 3300006186 Bacteria 1921
217 Ga0075366_10114577 3300006195 Bacteria 1623
218 Ga0075366_10394632 3300006195 Bacteria 851
219 Ga0075366_10547553 3300006195 Bacteria 716
220 Ga0075366_10576897 3300006195 Bacteria 697
221 Ga0097621_100316806 3300006237 Bacteria 1381
222 Ga0075370_10109639 3300006353 Bacteria 1602
223 Ga0075370_10292586 3300006353 Bacteria 968
224 Ga0075370_10353252 3300006353 Bacteria 878
225 Ga0068871_100764926 3300006358 Bacteria 889
226 Ga0075428_100095612 3300006844 Bacteria 3239
227 Ga0075428_101142595 3300006844 Bacteria 822
228 Ga0075428_101210736 3300006844 Bacteria 796
229 Ga0075430_100016885 3300006846 Bacteria 6217
230 Ga0075430_100068032 3300006846 Bacteria 2989
231 Ga0075431_100006929 3300006847 Bacteria 11270
232 Ga0075431_100007900 3300006847 Bacteria 10602
233 Ga0075431_100119471 3300006847 Bacteria 2720
234 Ga0075431_100932465 3300006847 Bacteria 837
235 Ga0075433_10149593 3300006852 Bacteria 2077
236 Ga0075433_10918707 3300006852 Bacteria 763
237 Ga0075434_100418729 3300006871 Bacteria 1361
238 Ga0075429_100163276 3300006880 Bacteria 1951
239 Ga0068865_100025593 3300006881 Bacteria 3883
240 Ga0068865_100272278 3300006881 Bacteria 1345
241 Ga0068865_100360862 3300006881 Bacteria 1180
242 Ga0068865_100567893 3300006881 Unclassified 955
243 Ga0068865_100837874 3300006881 Bacteria 796
244 Ga0068865_101126665 3300006881 Bacteria 692
245 Ga0097620_100001348 3300006931 Bacteria 25055
246 Ga0097620_100308337 3300006931 Bacteria 1676
247 Ga0097620_100859866 3300006931 Bacteria 993
248 Ga0097620_101253638 3300006931 Bacteria 817
249 Ga0075435_100301837 3300007076 Bacteria 1370
250 Ga0075435_100502749 3300007076 Bacteria 1048
251 Ga0075435_100641183 3300007076 Bacteria 922
252 Ga0105244_10532145 3300009036 Bacteria 541
253 Ga0105250_10006712 3300009092 Bacteria 5001
254 Ga0105240_10011290 3300009093 Bacteria 12448
255 Ga0105240_10236334 3300009093 Bacteria 2121
256 Ga0105240_10596293 3300009093 Bacteria 1217
257 Ga0105240_10618521 3300009093 Bacteria 1191
258 Ga0105240_10668291 3300009093 Bacteria 1137
259 Ga0105240_10898609 3300009093 Bacteria 953
260 Ga0111539_10079678 3300009094 Bacteria 3853
261 Ga0111539_10545879 3300009094 Bacteria 1350
262 Ga0111539_13497400 3300009094 Bacteria 504
263 Ga0105245_10224845 3300009098 Bacteria 1813
264 Ga0105245_10683292 3300009098 Bacteria 1059
265 Ga0105245_12367960 3300009098 Bacteria 585
266 Ga0105245_12592299 3300009098 Bacteria 560
267 Ga0105247_10291118 3300009101 Bacteria 1130
268 Ga0114129_10045488 3300009147 Bacteria 6171
269 Ga0114129_10332574 3300009147 Bacteria 2017
270 Ga0114129_10740823 3300009147 Bacteria 1259
271 Ga0114129_10805309 3300009147 Bacteria 1198
272 Ga0114129_11810165 3300009147 Bacteria 742
273 Ga0114129_12063250 3300009147 Bacteria 688
274 Ga0105243_10137333 3300009148 Bacteria 2082
275 Ga0105243_10181582 3300009148 Bacteria 1830
276 Ga0105243_11238242 3300009148 Bacteria 761
277 Ga0105243_11325068 3300009148 Bacteria 738
278 Ga0105243_11410710 3300009148 Bacteria 717
279 Ga0105241_10303952 3300009174 Bacteria 1370
280 Ga0105241_10371163 3300009174 Bacteria 1248
281 Ga0105241_10371798 3300009174 Bacteria 1246
282 Ga0105241_10905885 3300009174 Bacteria 819
283 Ga0105241_10987422 3300009174 Bacteria 787
284 Ga0105242_10232711 3300009176 Bacteria 1652
285 Ga0105242_10394715 3300009176 Bacteria 1289
286 Ga0105242_10515666 3300009176 Bacteria 1140
287 Ga0105242_11241810 3300009176 Bacteria 766
288 Ga0105242_11443437 3300009176 Bacteria 717
289 Ga0105242_11870363 3300009176 Bacteria 640
290 Ga0105248_10631821 3300009177 Bacteria 1208
291 Ga0105237_10648427 3300009545 Bacteria 1063
292 Ga0105237_11332160 3300009545 Bacteria 724
293 Ga0105237_11918943 3300009545 Bacteria 600
294 Ga0105238_10061875 3300009551 Bacteria 3745
295 Ga0105238_10077822 3300009551 Bacteria 3308
296 Ga0105238_10192854 3300009551 Bacteria 2013
297 Ga0105238_10211229 3300009551 Bacteria 1917
298 Ga0105238_10229711 3300009551 Bacteria 1832
299 Ga0105238_10396633 3300009551 Bacteria 1372
300 Ga0105238_10603881 3300009551 Bacteria 1105
301 Ga0105238_11518864 3300009551 Bacteria 699
302 Ga0105238_12317508 3300009551 Bacteria 572
303 Ga0105249_10000689 3300009553 Bacteria 30748
304 Ga0105249_10511220 3300009553 Bacteria 1247
305 Ga0105249_11035945 3300009553 Bacteria 890
306 Ga0105249_12892584 3300009553 Bacteria 551
307 Ga0105239_10123802 3300010375 Bacteria 2873
308 Ga0105239_10916730 3300010375 Bacteria 1006
309 Ga0105239_12398926 3300010375 Bacteria 614
310 Ga0105246_10099127 3300011119 Bacteria 2118
311 Ga0105246_10395020 3300011119 Bacteria 1147
312 Ga0105246_11246818 3300011119 Bacteria 686
313 Ga0105246_11320725 3300011119 Bacteria 669
314 Ga0105246_11742197 3300011119 Bacteria 593
315 Ga0157323_1033709 3300012495 Bacteria 556
316 Ga0157319_1008110 3300012497 Bacteria 796
317 Ga0157326_1037903 3300012513 Bacteria 665
318 Ga0157373_10009155 3300013100 Bacteria 7322
319 Ga0157371_11017213 3300013102 Bacteria 633
320 Ga0157370_10080372 3300013104 Bacteria 3069
321 Ga0157370_10231753 3300013104 Bacteria 1709
322 Ga0157370_10336172 3300013104 Bacteria 1392
323 Ga0157369_10019954 3300013105 Bacteria 7495
324 Ga0157369_10706873 3300013105 Bacteria 1038
325 Ga0157369_12285570 3300013105 Bacteria 548
326 Ga0157374_10117372 3300013296 Bacteria 2565
327 Ga0157374_10778898 3300013296 Bacteria 972
328 Ga0157374_10956765 3300013296 Bacteria 875
329 Ga0157374_11663755 3300013296 Bacteria 663
330 Ga0157378_10324328 3300013297 Bacteria 1497
331 Ga0157378_10507617 3300013297 Bacteria 1205
332 Ga0157378_11009840 3300013297 Bacteria 866
333 Ga0157378_11544702 3300013297 Bacteria 709
334 Ga0163162_10414409 3300013306 Bacteria 1479
335 Ga0163162_10735398 3300013306 Bacteria 1107
336 Ga0163162_11464116 3300013306 Bacteria 777
337 Ga0163162_11837195 3300013306 Bacteria 693
338 Ga0157372_10435701 3300013307 Bacteria 1528
339 Ga0157375_12956772 3300013308 Bacteria 568
340 Ga0157375_13702778 3300013308 Bacteria 508
341 Ga0163163_10010481 3300014325 Bacteria 8340
342 Ga0163163_10507652 3300014325 Bacteria 1268
343 Ga0163163_10698019 3300014325 Bacteria 1078
344 Ga0163163_10733495 3300014325 Bacteria 1051
345 Ga0163163_11396914 3300014325 Bacteria 762
346 Ga0163163_11466515 3300014325 Bacteria 744
347 Ga0157380_10119958 3300014326 Bacteria 2226
348 Ga0157380_10452391 3300014326 Bacteria 1234
349 Ga0157380_10577100 3300014326 Bacteria 1108
350 Ga0157380_10649004 3300014326 Bacteria 1052
351 Ga0157380_10697032 3300014326 Bacteria 1020
352 Ga0157380_12497143 3300014326 Bacteria 582
353 Ga0182008_10138293 3300014497 Bacteria 1217
354 Ga0157377_10088990 3300014745 Bacteria 1819
355 Ga0157379_10366652 3300014968 Bacteria 1320
356 Ga0157379_10523958 3300014968 Bacteria 1100
357 Ga0157379_10559794 3300014968 Bacteria 1064
358 Ga0157379_11086645 3300014968 Bacteria 766
359 Ga0157376_10684177 3300014969 Bacteria 1029
360 Ga0157376_11090967 3300014969 Bacteria 824
361 Ga0157376_12705866 3300014969 Bacteria 536
362 Ga0182007_10156376 3300015262 Bacteria 778
363 Ga0182007_10190265 3300015262 Bacteria 713
364 Ga0163161_10097742 3300017792 Bacteria 2181
365 Ga0163161_10318403 3300017792 Bacteria 1229
366 Ga0163161_10386598 3300017792 Bacteria 1119
367 Ga0163161_10559011 3300017792 Bacteria 939
368 Ga0206356_10591617 3300020070 Bacteria 620
369 Ga0206356_11363650 3300020070 Unclassified 626
370 Ga0206352_10433278 3300020078 Bacteria 754
371 Ga0206352_11190364 3300020078 Bacteria 603
372 Ga0206354_10869696 3300020081 Unclassified 517
373 Ga0206354_11690617 3300020081 Bacteria 647
374 Ga0206353_10388764 3300020082 Bacteria 607
375 Ga0213872_10087989 3300021361 Bacteria 1391
376 Ga0213876_10035419 3300021384 Bacteria 2633
377 Ga0224712_10341888 3300022467 Bacteria 706
378 Ga0207425_1068486 3300025245 Bacteria 612
379 Ga0209026_1001443 3300025250 Bacteria 10504
380 Ga0209233_1009619 3300025261 Bacteria 2936
381 Ga0209233_1058476 3300025261 Bacteria 753
382 Ga0209565_1001056 3300025263 Bacteria 13845
383 Ga0209673_1000796 3300025273 Bacteria 42005
384 Ga0209675_1027043 3300025291 Bacteria 1417
385 Ga0209676_1000115 3300025292 Bacteria 205183
386 Ga0209676_1005229 3300025292 Bacteria 6874
387 Ga0209564_1007404 3300025295 Bacteria 5678
388 Ga0209564_1025111 3300025295 Bacteria 2016
389 Ga0209758_1000852 3300025297 Bacteria 42442
390 Ga0209758_1000917 3300025297 Bacteria 39944
391 Ga0209758_1042409 3300025297 Bacteria 1688
392 Ga0209050_1000053 3300025298 Bacteria 349521
393 Ga0209050_1006111 3300025298 Bacteria 7265
394 Ga0209050_1023604 3300025298 Bacteria 2157
395 Ga0209050_1037824 3300025298 Bacteria 1385
396 Ga0209256_1005104 3300025299 Bacteria 7788
397 Ga0209256_1008353 3300025299 Bacteria 4823
398 Ga0209256_1041065 3300025299 Bacteria 1177
399 Ga0209051_1004762 3300025303 Bacteria 8201
400 Ga0209257_1000090 3300025304 Bacteria 274746
401 Ga0209257_1000192 3300025304 Bacteria 151851
402 Ga0209257_1000289 3300025304 Bacteria 110882
403 Ga0209257_1008306 3300025304 Bacteria 5950
404 Ga0209257_1056241 3300025304 Bacteria 1087
405 Ga0207697_10347190 3300025315 Bacteria 659
406 Ga0207653_10004893 3300025885 Bacteria 4187
407 Ga0207642_10256363 3300025899 Bacteria 995
408 Ga0207688_10442074 3300025901 Bacteria 810
409 Ga0207680_10254725 3300025903 Bacteria 1213
410 Ga0207680_10720958 3300025903 Unclassified 715
411 Ga0207680_10799975 3300025903 Bacteria 676
412 Ga0207680_11277711 3300025903 Bacteria 522
413 Ga0207647_10067199 3300025904 Bacteria 2173
414 Ga0207685_10000007 3300025905 Bacteria 278341
415 Ga0207645_10110413 3300025907 Bacteria 1780
416 Ga0207645_10451294 3300025907 Bacteria 868
417 Ga0207643_10273629 3300025908 Bacteria 1046
418 Ga0207643_10727418 3300025908 Bacteria 642
419 Ga0207705_10121475 3300025909 Bacteria 1939
420 Ga0207705_10179685 3300025909 Bacteria 1596
421 Ga0207705_10410344 3300025909 Bacteria 1048
422 Ga0207654_10292661 3300025911 Bacteria 1105
423 Ga0207654_11201060 3300025911 Bacteria 553
424 Ga0207695_10012980 3300025913 Bacteria 9955
425 Ga0207695_10512280 3300025913 Bacteria 1082
426 Ga0207695_10625698 3300025913 Bacteria 958
427 Ga0207695_11694229 3300025913 Bacteria 513
428 Ga0207671_10665651 3300025914 Bacteria 829
429 Ga0207671_11087822 3300025914 Bacteria 628
430 Ga0207671_11480527 3300025914 Bacteria 524
431 Ga0207660_10001868 3300025917 Bacteria 14029
432 Ga0207660_10885148 3300025917 Bacteria 729
433 Ga0207657_10229918 3300025919 Bacteria 1483
434 Ga0207657_10420043 3300025919 Bacteria 1051
435 Ga0207657_10586210 3300025919 Bacteria 871
436 Ga0207649_10860443 3300025920 Bacteria 710
437 Ga0207652_10018573 3300025921 Bacteria 5705
438 Ga0207652_10581991 3300025921 Bacteria 1005
439 Ga0207646_10018114 3300025922 Bacteria 6573
440 Ga0207646_10053819 3300025922 Bacteria 3600
441 Ga0207646_10889578 3300025922 Unclassified 790
442 Ga0207681_10178896 3300025923 Bacteria 1614
443 Ga0207681_10363105 3300025923 Bacteria 1162
444 Ga0207681_10750363 3300025923 Bacteria 813
445 Ga0207681_11102893 3300025923 Bacteria 666
446 Ga0207694_10070351 3300025924 Bacteria 2734
447 Ga0207694_10121581 3300025924 Bacteria 2085
448 Ga0207694_10132540 3300025924 Bacteria 1998
449 Ga0207694_10334990 3300025924 Bacteria 1251
450 Ga0207694_10435777 3300025924 Bacteria 1093
451 Ga0207694_10465168 3300025924 Bacteria 1057
452 Ga0207694_11537780 3300025924 Bacteria 561
453 Ga0207659_11061279 3300025926 Bacteria 697
454 Ga0207659_11904657 3300025926 Bacteria 504
455 Ga0207687_10266575 3300025927 Bacteria 1367
456 Ga0207687_11239911 3300025927 Bacteria 641
457 Ga0207664_10637238 3300025929 Bacteria 958
458 Ga0207690_10008653 3300025932 Bacteria 6036
459 Ga0207690_10437058 3300025932 Bacteria 1049
460 Ga0207690_10604156 3300025932 Unclassified 896
461 Ga0207706_10399141 3300025933 Bacteria 1192
462 Ga0207706_10597686 3300025933 Bacteria 948
463 Ga0207706_10655792 3300025933 Bacteria 898
464 Ga0207706_10891251 3300025933 Bacteria 752
465 Ga0207686_10141220 3300025934 Bacteria 1665
466 Ga0207686_10306742 3300025934 Bacteria 1181
467 Ga0207709_10098021 3300025935 Bacteria 1932
468 Ga0207709_10239000 3300025935 Bacteria 1320
469 Ga0207709_11741474 3300025935 Bacteria 518
470 Ga0207670_10286478 3300025936 Bacteria 1285
471 Ga0207669_10283465 3300025937 Bacteria 1251
472 Ga0207669_10910644 3300025937 Bacteria 735
473 Ga0207704_10000526 3300025938 Bacteria 17029
474 Ga0207704_10532964 3300025938 Bacteria 952
475 Ga0207665_10800427 3300025939 Bacteria 745
476 Ga0207691_10475940 3300025940 Bacteria 1062
477 Ga0207691_10570589 3300025940 Bacteria 959
478 Ga0207691_11245807 3300025940 Bacteria 616
479 Ga0207711_10894150 3300025941 Bacteria 826
480 Ga0207711_11093589 3300025941 Bacteria 738
481 Ga0207711_11242393 3300025941 Bacteria 687
482 Ga0207711_11252161 3300025941 Bacteria 684
483 Ga0207711_11938465 3300025941 Bacteria 532
484 Ga0207689_10031246 3300025942 Bacteria 4435
485 Ga0207689_10034906 3300025942 Bacteria 4177
486 Ga0207689_10203962 3300025942 Bacteria 1633
487 Ga0207689_10275634 3300025942 Bacteria 1393
488 Ga0207689_10293373 3300025942 Bacteria 1347
489 Ga0207689_11207673 3300025942 Bacteria 636
490 Ga0207661_10639726 3300025944 Bacteria 977
491 Ga0207679_11146309 3300025945 Bacteria 713
492 Ga0207679_11281073 3300025945 Bacteria 673
493 Ga0207679_12152243 3300025945 Bacteria 506
494 Ga0207667_10111601 3300025949 Bacteria 2820
495 Ga0207651_10717091 3300025960 Bacteria 882
496 Ga0207712_10014689 3300025961 Bacteria 5043
497 Ga0207712_11096766 3300025961 Bacteria 708
498 Ga0207712_11275969 3300025961 Bacteria 656
499 Ga0207712_11309245 3300025961 Bacteria 648
500 Ga0207712_11882620 3300025961 Bacteria 536
501 Ga0207668_10004082 3300025972 Bacteria 8581
502 Ga0207668_10206733 3300025972 Bacteria 1567
503 Ga0207668_10391180 3300025972 Bacteria 1173
504 Ga0207668_10432829 3300025972 Bacteria 1119
505 Ga0207668_10455330 3300025972 Bacteria 1093
506 Ga0207668_10462186 3300025972 Bacteria 1085
507 Ga0207668_11198233 3300025972 Bacteria 682
508 Ga0207668_11481863 3300025972 Bacteria 612
509 Ga0207640_10434293 3300025981 Bacteria 1078
510 Ga0207640_10590775 3300025981 Bacteria 939
511 Ga0207658_10020434 3300025986 Bacteria 4585
512 Ga0207658_10184327 3300025986 Bacteria 1730
513 Ga0207658_10734851 3300025986 Bacteria 893
514 Ga0207658_11294232 3300025986 Bacteria 667
515 Ga0207658_11764600 3300025986 Bacteria 565
516 Ga0207658_11925637 3300025986 Bacteria 538
517 Ga0207703_10221324 3300026035 Bacteria 1692
518 Ga0207703_10981909 3300026035 Bacteria 810
519 Ga0207639_10179798 3300026041 Bacteria 1798
520 Ga0207639_10885254 3300026041 Bacteria 834
521 Ga0207639_10924747 3300026041 Bacteria 816
522 Ga0207678_10025606 3300026067 Bacteria 5149
523 Ga0207678_10116681 3300026067 Bacteria 2278
524 Ga0207678_10292740 3300026067 Bacteria 1398
525 Ga0207678_10302026 3300026067 Bacteria 1376
526 Ga0207678_10744892 3300026067 Bacteria 864
527 Ga0207708_10005606 3300026075 Bacteria 9264
528 Ga0207708_10837410 3300026075 Unclassified 794
529 Ga0207702_10111519 3300026078 Bacteria 2433
530 Ga0207641_10510555 3300026088 Bacteria 1168
531 Ga0207641_10716011 3300026088 Bacteria 986
532 Ga0207648_10633370 3300026089 Bacteria 987
533 Ga0207648_11020786 3300026089 Bacteria 775
534 Ga0207676_10012959 3300026095 Bacteria 5988
535 Ga0207676_12595028 3300026095 Bacteria 503
536 Ga0207674_10008214 3300026116 Bacteria 12097
537 Ga0207674_10519528 3300026116 Bacteria 1150
538 Ga0207674_10806180 3300026116 Bacteria 906
539 Ga0207674_12121831 3300026116 Bacteria 526
540 Ga0207675_100021206 3300026118 Bacteria 6053
541 Ga0207675_100104034 3300026118 Bacteria 2676
542 Ga0207675_100172608 3300026118 Bacteria 2067
543 Ga0207675_100731699 3300026118 Bacteria 1000
544 Ga0207675_100922042 3300026118 Bacteria 890
545 Ga0207675_101139868 3300026118 Bacteria 800
546 Ga0207683_10406363 3300026121 Bacteria 1253
547 Ga0207683_10737911 3300026121 Bacteria 913
548 Ga0207683_11404006 3300026121 Bacteria 645
549 Ga0209974_10054151 3300027876 Bacteria 1352
550 Ga0209974_10205215 3300027876 Bacteria 729
551 Ga0207428_10787379 3300027907 Bacteria 676
552 Ga0207428_10949238 3300027907 Bacteria 606
553 Ga0268266_10000003 3300028379 Bacteria 1701703
554 Ga0268266_10438449 3300028379 Bacteria 1240
555 Ga0268266_10523183 3300028379 Bacteria 1134
556 Ga0268265_10001206 3300028380 Bacteria 22480
557 Ga0268265_10030635 3300028380 Bacteria 3877
558 Ga0268265_10181305 3300028380 Bacteria 1809
559 Ga0268265_10465008 3300028380 Bacteria 1184
560 Ga0268265_11007503 3300028380 Bacteria 823
561 Ga0268265_11013431 3300028380 Bacteria 821
562 Ga0268265_11195748 3300028380 Bacteria 758
563 Ga0268265_12016065 3300028380 Bacteria 584
564 Ga0268264_10010528 3300028381 Bacteria 7647
565 Ga0268264_10516616 3300028381 Bacteria 1167
566 Ga0268264_10831144 3300028381 Bacteria 924
567 Ga0268264_10906226 3300028381 Bacteria 885
568 Ga0265337_1230260 3300028556 Bacteria 504
569 Ga0265319_1153311 3300028563 Bacteria 713
570 Ga0265334_10117888 3300028573 Bacteria 950
571 Ga0265334_10264357 3300028573 Bacteria 591
572 Ga0307517_10003957 3300028786 Bacteria 22943
573 Ga0307515_10080475 3300028794 Bacteria 4248
574 Ga0307515_10185861 3300028794 Bacteria 2008
575 Ga0265338_10040090 3300028800 Bacteria 4404
576 Ga0265338_10075300 3300028800 Bacteria 2865
577 Ga0265338_10082066 3300028800 Bacteria 2700
578 Ga0265338_10115692 3300028800 Bacteria 2149
579 Ga0265338_10152366 3300028800 Bacteria 1795
580 Ga0265338_10166659 3300028800 Bacteria 1695
581 Ga0265338_10411884 3300028800 Bacteria 962
582 Ga0316182_1185581 3300030745 Bacteria 1075
583 Ga0265330_10134721 3300031235 Bacteria 1051
584 Ga0265320_10475614 3300031240 Bacteria 552
585 Ga0265340_10490190 3300031247 Bacteria 541
586 Ga0265331_10231556 3300031250 Bacteria 830
587 Ga0265327_10000280 3300031251 Bacteria 100757
588 Ga0265327_10015047 3300031251 Bacteria 5025
589 Ga0265327_10037859 3300031251 Bacteria 2636
590 Ga0265327_10116595 3300031251 Bacteria 1270
591 Ga0265327_10210003 3300031251 Bacteria 879
592 Ga0265316_10371290 3300031344 Bacteria 1033
593 Ga0307513_10000100 3300031456 Bacteria 125183
594 Ga0307513_10003278 3300031456 Bacteria 22053
595 Ga0307513_10021100 3300031456 Bacteria 7696
596 Ga0307513_10147629 3300031456 Bacteria 2267
597 Ga0307509_10924051 3300031507 Bacteria 538
598 Ga0307408_100241565 3300031548 Bacteria 1485
599 Ga0307408_100296711 3300031548 Bacteria 1352
600 Ga0307408_100317322 3300031548 Bacteria 1311
601 Ga0307408_100523961 3300031548 Bacteria 1041
602 Ga0307408_100898456 3300031548 Bacteria 811
603 Ga0307408_100964071 3300031548 Bacteria 784
604 Ga0307408_101207276 3300031548 Bacteria 706
605 Ga0307514_10221183 3300031649 Bacteria 1161
606 Ga0316575_10086787 3300031665 Bacteria 1265
607 Ga0316579_10408310 3300031691 Bacteria 657
608 Ga0265314_10048088 3300031711 Bacteria 2996
609 Ga0265342_10086819 3300031712 Bacteria 1799
610 Ga0265342_10662092 3300031712 Bacteria 524
611 Ga0316576_10036145 3300031727 Bacteria 3530
612 Ga0316578_10029717 3300031728 Bacteria 3103
613 Ga0307516_10149056 3300031730 Bacteria 2102
614 Ga0307516_10331378 3300031730 Bacteria 1191
615 Ga0307405_10190625 3300031731 Bacteria 1480
616 Ga0307405_10224645 3300031731 Bacteria 1380
617 Ga0307405_10690058 3300031731 Bacteria 844
618 Ga0307405_10700499 3300031731 Unclassified 839
619 Ga0307405_10768282 3300031731 Bacteria 804
620 Ga0307405_10942159 3300031731 Bacteria 733
621 Ga0307405_11976640 3300031731 Bacteria 521
622 Ga0307413_10068704 3300031824 Bacteria 2220
623 Ga0307413_10142539 3300031824 Bacteria 1658
624 Ga0307413_10170593 3300031824 Bacteria 1539
625 Ga0307413_10212255 3300031824 Bacteria 1407
626 Ga0307413_10863716 3300031824 Bacteria 765
627 Ga0307413_11493969 3300031824 Bacteria 597
628 Ga0307413_11757938 3300031824 Bacteria 554
629 Ga0307410_10002951 3300031852 Bacteria 8386
630 Ga0307410_11267018 3300031852 Bacteria 644
631 Ga0307410_11475164 3300031852 Bacteria 599
632 Ga0326468_10030048 3300031889 Bacteria 714
633 Ga0307406_10038036 3300031901 Bacteria 2976
634 Ga0307406_10095517 3300031901 Bacteria 2011
635 Ga0307406_10178862 3300031901 Bacteria 1542
636 Ga0307406_10340933 3300031901 Bacteria 1167
637 Ga0307406_11391413 3300031901 Bacteria 615
638 Ga0307407_10454387 3300031903 Bacteria 930
639 Ga0307412_10004367 3300031911 Bacteria 7883
640 Ga0307412_10374182 3300031911 Bacteria 1151
641 Ga0307412_10380014 3300031911 Bacteria 1143
642 Ga0307412_10422691 3300031911 Bacteria 1090
643 Ga0307412_10666930 3300031911 Bacteria 889
644 Ga0307412_10819596 3300031911 Bacteria 809
645 Ga0307412_10939395 3300031911 Bacteria 760
646 Ga0307412_11123106 3300031911 Bacteria 700
647 Ga0307409_100179882 3300031995 Bacteria 1871
648 Ga0307409_100561138 3300031995 Bacteria 1122
649 Ga0307409_100725050 3300031995 Bacteria 996
650 Ga0307409_100864877 3300031995 Bacteria 916
651 Ga0307409_100964293 3300031995 Bacteria 869
652 Ga0307416_100037708 3300032002 Bacteria 3722
653 Ga0307416_100129547 3300032002 Bacteria 2268
654 Ga0307416_100189199 3300032002 Bacteria 1939
655 Ga0307416_100389734 3300032002 Bacteria 1427
656 Ga0307416_100433873 3300032002 Bacteria 1362
657 Ga0307416_101105521 3300032002 Bacteria 897
658 Ga0307416_101145819 3300032002 Bacteria 883
659 Ga0307416_101417688 3300032002 Bacteria 800
660 Ga0307416_102097694 3300032002 Unclassified 667
661 Ga0307416_102174932 3300032002 Bacteria 656
662 Ga0307416_102233796 3300032002 Bacteria 648
663 Ga0307416_103820283 3300032002 Bacteria 504
664 Ga0307414_10031506 3300032004 Bacteria 3479
665 Ga0307414_10057750 3300032004 Bacteria 2730
666 Ga0307414_10238317 3300032004 Bacteria 1504
667 Ga0307414_10342927 3300032004 Bacteria 1279
668 Ga0307414_10350081 3300032004 Bacteria 1267
669 Ga0307414_11547615 3300032004 Bacteria 617
670 Ga0307414_11575460 3300032004 Bacteria 612
671 Ga0307411_10023874 3300032005 Bacteria 3633
672 Ga0307411_10044388 3300032005 Bacteria 2851
673 Ga0307411_10138312 3300032005 Bacteria 1792
674 Ga0307411_10660188 3300032005 Bacteria 906
675 Ga0307411_10778024 3300032005 Bacteria 841
676 Ga0307415_100006354 3300032126 Bacteria 6362
677 Ga0307415_100718061 3300032126 Bacteria 904
678 Ga0307415_100854144 3300032126 Bacteria 835
679 Ga0307415_101117103 3300032126 Bacteria 739
680 Ga0307415_101178221 3300032126 Bacteria 721
681 Ga0307415_101354163 3300032126 Bacteria 676
682 Ga0307415_101442577 3300032126 Bacteria 657
683 Ga0316583_10303319 3300032133 Bacteria 552
684 Ga0316580_10010145 3300032139 Bacteria 2838
685 Ga0316593_10313765 3300032168 Bacteria 595
686 Ga0307510_10106393 3300033180 Bacteria 2569
687 Ga0307510_10337820 3300033180 Bacteria 959
688 Ga0307510_10427982 3300033180 Bacteria 765
689 Ga0307510_10574483 3300033180 Bacteria 576
690 Ga0316592_1092784 3300033524 Bacteria 691
691 Ga0316588_1084877 3300033528 Bacteria 786
692 Ga0316596_1171711 3300033541 Bacteria 599
693 Ga0316596_1227815 3300033541 Bacteria 522
694 Ga0373950_0177590 3300034818 Bacteria 500
695 Ga0373938_0108372 3300034957 Bacteria 705
696 Ga0373934_0431957 3300035086 Bacteria 551
697 Ga0373923_0100456 3300035111 Bacteria 1275
698 Ga0373936_0002108 3300035113 Bacteria 7393
699 Ga0373936_0135076 3300035113 Bacteria 1062
700 Ga0373936_0192601 3300035113 Bacteria 898
701 Ga0373941_0120813 3300035115 Bacteria 934
702 Ga0373945_0391798 3300035116 Bacteria 608
703 Ga0373953_0123771 3300035117 Bacteria 1099
704 Ga0373954_0166710 3300035118 Bacteria 1078
705 Ga0373956_0469499 3300035119 Bacteria 600
706 Ga0373960_0087008 3300035121 Bacteria 993
707 Ga0373943_0576866 3300035170 Bacteria 661
708 Ga0373946_0026220 3300035171 Bacteria 2297
709 Ga0373955_0031767 3300035172 Bacteria 2767
710 Ga0373942_0074927 3300035207 Bacteria 995
711 Ga0373962_0319761 3300035242 Bacteria 554
712 Ga0316574_0916766 3300035398 Bacteria 530
713 Ga0373924_0251430 3300035410 Bacteria 782
714 Ga0373935_0099848 3300035692 Bacteria 1911
715 Ga0373935_0251127 3300035692 Bacteria 1238
716 Ga0373933_0343972 3300035724 Bacteria 968
717 Ga0373933_0360557 3300035724 Bacteria 945
718 Ga0373947_0156168 3300035725 Bacteria 1472
719 Ga0373937_0134663 3300036401 Bacteria 2309
720 Ga0373937_0548289 3300036401 Bacteria 1098
721 Ga0373937_0917668 3300036401 Bacteria 824
722 Ga0373925_0454625 3300037068 Bacteria 1049
723 Ga0395899_0172596 3300037312 Bacteria 1522
724 Ga0395899_0858290 3300037312 Bacteria 557
725 Ga0395900_0026092 3300037418 Bacteria 5982
726 Ga0395900_0132952 3300037418 Bacteria 2549
727 Ga0395900_0373927 3300037418 Bacteria 1394
728 Ga0395900_1083319 3300037418 Bacteria 719
729 Ga0395898_0020586 3300037466 Bacteria 6700
730 Ga0395905_0058657 3300037471 Bacteria 3599
731 Ga0395905_0287381 3300037471 Bacteria 1531
732 Ga0395905_0308378 3300037471 Bacteria 1471
733 Ga0395905_0598646 3300037471 Bacteria 1004
734 Ga0395905_1008775 3300037471 Bacteria 735
735 Ga0395905_1668341 3300037471 Bacteria 542
736 Ga0395901_0024541 3300038443 Bacteria 6191
737 Ga0395901_0094369 3300038443 Bacteria 3134
738 Ga0395901_1411864 3300038443 Bacteria 654
739 Ga0395901_2079600 3300038443 Bacteria 513
740 Ga0400483_129175 3300039062 Bacteria 1229
741 Ga0436365_0165150 3300039437 Bacteria 3050
742 Ga0436365_0412280 3300039437 Bacteria 4862
743 Ga0436365_0792369 3300039437 Bacteria 967
744 Ga0436365_1349511 3300039437 Bacteria 988
745 Ga0436365_1353601 3300039437 Bacteria 1340
746 Ga0436365_1519503 3300039437 Bacteria 972
747 Ga0436360_0031527 3300039438 Bacteria 998
748 Ga0436360_0193881 3300039438 Bacteria 519
749 Ga0436360_0802865 3300039438 Bacteria 554
750 Ga0436360_1129668 3300039438 Bacteria 522
751 Ga0436361_0553807 3300039447 Bacteria 20297
752 Ga0436363_0034667 3300039450 Bacteria 639
753 Ga0436363_0167927 3300039450 Bacteria 2109
754 Ga0436363_0876492 3300039450 Bacteria 1198
755 Ga0436363_1250061 3300039450 Bacteria 1015
756 Ga0439453_0012409 3300041408 Bacteria 1435
757 Ga0439461_0123404 3300041410 Bacteria 649
758 Ga0439465_0167723 3300041413 Bacteria 790
759 Ga0451787_014158 3300041441 Bacteria 809
760 Ga0451789_0130043 3300041443 Bacteria 521
761 Ga0451790_33734 3300041444 Bacteria 552
762 Ga0451794_09956 3300041446 Bacteria 684
763 Ga0451791_0986555 3300041451 Bacteria 746
764 Ga0451791_1141798 3300041451 Bacteria 1138
765 Ga0451793_0143183 3300041452 Bacteria 515
766 Ga0451793_1580084 3300041452 Bacteria 533
767 Ga0451797_1241774 3300041453 Bacteria 621
768 Ga0451797_1562136 3300041453 Bacteria 746
769 Ga0451801_31341 3300041455 Bacteria 524
770 Ga0451795_0372914 3300041456 Bacteria 892
771 Ga0451800_1087923 3300041459 Bacteria 552
772 Ga0451802_0313528 3300041460 Bacteria 568
773 Ga0451802_0427992 3300041460 Bacteria 987
774 Ga0451802_0835340 3300041460 Bacteria 609
775 Ga0451805_017743 3300041461 Bacteria 832
776 Ga0451805_019020 3300041461 Bacteria 702
777 Ga0451805_062075 3300041461 Bacteria 649
778 Ga0451806_199844 3300041462 Bacteria 1017
779 Ga0451804_0300224 3300041463 Bacteria 863
780 Ga0451807_1151417 3300041486 Bacteria 1124
781 Ga0451807_2363815 3300041486 Bacteria 524
782 Ga0451833_0300335 3300041491 Bacteria 740
783 Ga0451835_1223003 3300041492 Bacteria 723
784 Ga0451837_1428663 3300041494 Bacteria 879
785 Ga0451839_0946880 3300041496 Bacteria 942
786 Ga0451839_1072371 3300041496 Bacteria 602
787 Ga0451845_0522626 3300041501 Bacteria 640
788 Ga0451846_32729 3300041502 Bacteria 663
789 Ga0451847_0632259 3300041503 Bacteria 687
790 Ga0451849_0010923 3300041505 Bacteria 621
791 Ga0451850_00416 3300041506 Bacteria 512
792 Ga0451843_1189529 3300041509 Bacteria 525
793 Ga0451855_1262419 3300041511 Bacteria 1047
794 Ga0451855_1910206 3300041511 Bacteria 958
795 Ga0451853_0633361 3300041512 Bacteria 728
796 Ga0451853_1923124 3300041512 Bacteria 1141
797 Ga0451853_2561966 3300041512 Bacteria 1936
798 Ga0452268_42262 3300041907 Bacteria 533
799 Ga0439433_0111771 3300041999 Bacteria 684
800 Ga0439433_0178550 3300041999 Bacteria 555
801 Ga0439441_091096 3300042001 Bacteria 674
802 Ga0439445_0086061 3300042004 Bacteria 882
803 Ga0439455_0195698 3300042012 Bacteria 584
804 Ga0439462_0154359 3300042015 Bacteria 646
805 Ga0450923_156787 3300042125 Bacteria 553
806 Ga0450890_037290 3300042127 Bacteria 710
807 Ga0439446_0029309 3300042156 Bacteria 1588
808 Ga0439458_0054448 3300042157 Bacteria 991
809 Ga0439459_0003734 3300042438 Bacteria 2429
810 Ga0439459_0052395 3300042438 Bacteria 900
811 Ga0451577_0000543 3300042876 Bacteria 61740
812 Ga0466965_0205372 3300044683 Bacteria 1046
813 Ga0453684_0000533 3300044712 Bacteria 144782
814 Ga0453684_0095700 3300044712 Bacteria 3649
815 Ga0466960_0214925 3300044901 Bacteria 1056
816 Ga0495627_001096 3300046453 Bacteria 17686
817 Ga0495590_0001565 3300046457 Bacteria 9804
818 Ga0495638_0011692 3300046460 Bacteria 6045
819 Ga0495638_0097961 3300046460 Bacteria 1757
820 Ga0495638_0232966 3300046460 Bacteria 1023
821 Ga0495638_0308158 3300046460 Bacteria 850
822 Ga0495651_0125469 3300046462 Bacteria 1881
823 Ga0495651_0425878 3300046462 Bacteria 862
824 Ga0495650_0000468 3300046471 Bacteria 62149
825 Ga0495650_0134607 3300046471 Bacteria 899
826 Ga0495650_0284709 3300046471 Bacteria 556
827 Ga0495580_0627629 3300046472 Bacteria 708
828 Ga0495584_0306137 3300046491 Bacteria 807
829 Ga0495583_0000003 3300046506 Bacteria 709273
830 Ga0495583_0023513 3300046506 Bacteria 3115
831 Ga0495606_0016672 3300046507 Bacteria 5588
832 Ga0495606_0038274 3300046507 Bacteria 3247
833 Ga0495608_0195054 3300046511 Bacteria 1278
834 Ga0495610_0048755 3300046512 Bacteria 2077
835 Ga0495616_0006961 3300046513 Bacteria 6809
836 Ga0495620_0141352 3300046515 Bacteria 941
837 Ga0495620_0149407 3300046515 Bacteria 911
838 Ga0495632_0009729 3300046519 Bacteria 5764
839 Ga0495637_0026076 3300046520 Bacteria 2629
840 Ga0495637_0036307 3300046520 Bacteria 2147
841 Ga0495643_0030755 3300046522 Bacteria 2995
842 Ga0495643_0149626 3300046522 Bacteria 1157
843 Ga0495648_0010816 3300046524 Bacteria 6929
844 Ga0495648_0377078 3300046524 Bacteria 640
845 Ga0495663_0028986 3300046525 Bacteria 1632
846 Ga0495663_0390686 3300046525 Bacteria 511
847 Ga0495652_0263381 3300046529 Bacteria 1271
848 Ga0495654_0000199 3300046530 Bacteria 58450
849 Ga0495640_0302089 3300046533 Bacteria 994
850 Ga0495587_0217497 3300046536 Bacteria 1078
851 Ga0495587_0489303 3300046536 Bacteria 680
852 Ga0495609_0212133 3300046538 Bacteria 806
853 Ga0495609_0260227 3300046538 Bacteria 713
854 Ga0495597_0057218 3300046542 Bacteria 1706
855 Ga0495597_0394148 3300046542 Bacteria 527
856 Ga0495645_0313309 3300046543 Bacteria 1021
857 Ga0495633_0003428 3300046558 Bacteria 10552
858 Ga0495633_0051134 3300046558 Bacteria 1947
859 Ga0495667_0118985 3300046559 Bacteria 1706
860 Ga0495656_0191352 3300046615 Bacteria 1011
861 Ga0495656_0496274 3300046615 Bacteria 647
862 Ga0495668_0131932 3300046616 Bacteria 1367
863 Ga0495668_0151790 3300046616 Bacteria 1269
864 Ga0495668_0383898 3300046616 Bacteria 771
865 Ga0495625_0000152 3300046660 Bacteria 105589
866 Ga0495625_0189527 3300046660 Bacteria 1363
867 Ga0495625_0285071 3300046660 Bacteria 1061
868 Ga0495635_0263648 3300046663 Bacteria 1160
869 Ga0495659_0097393 3300046664 Bacteria 1136
870 Ga0495657_0160607 3300046675 Bacteria 1391
871 Ga0495657_0409541 3300046675 Bacteria 797
872 Ga0495613_0000049 3300046689 Bacteria 122792
873 Ga0495670_0154356 3300046691 Bacteria 1204
874 Ga0495670_0279535 3300046691 Unclassified 893
875 Ga0495671_0363605 3300046692 Bacteria 694
876 Ga0495671_0628238 3300046692 Bacteria 510
877 Ga0495649_0000048 3300046694 Bacteria 118180
878 Ga0495589_0013748 3300046794 Bacteria 4174
879 Ga0495600_0452554 3300046809 Bacteria 794
880 Ga0495660_0008301 3300046810 Bacteria 6080
881 Ga0495660_0126268 3300046810 Bacteria 1288
882 Ga0495604_0542713 3300047317 Bacteria 750
883 Ga0495636_0303475 3300047318 Bacteria 747
884 Ga0495674_0825467 3300047319 Bacteria 720
885 Ga0495674_1328424 3300047319 Bacteria 538
886 Ga0495672_0002318 3300047320 Bacteria 17654
887 Ga0495672_0014969 3300047320 Bacteria 5285
888 Ga0495672_0028725 3300047320 Bacteria 3513
889 Ga0495675_0482412 3300047444 Bacteria 714
890 Ga0495675_0490702 3300047444 Bacteria 706
891 Ga0495677_0315135 3300047445 Bacteria 616
892 Ga0495679_004598 3300047446 Bacteria 6300
893 Ga0495673_0009616 3300047469 Bacteria 5332
894 Ga0495673_0037613 3300047469 Bacteria 2208
895 Ga0495673_0248201 3300047469 Bacteria 650
896 Ga0495681_0058372 3300047470 Bacteria 1788
897 Ga0495686_0009578 3300047472 Bacteria 6962
898 Ga0495686_0045341 3300047472 Bacteria 2782
899 Ga0495686_0056387 3300047472 Bacteria 2455
900 Ga0495686_0118768 3300047472 Bacteria 1578
901 Ga0495602_0258751 3300048088 Bacteria 1292
902 Ga0496100_0319614 3300048903 Bacteria 1166
903 Ga0496100_0406379 3300048903 Bacteria 1038
904 Ga0496100_0881621 3300048903 Unclassified 702
905 Ga0496100_1385334 3300048903 Bacteria 555
906 Ga0496100_1424489 3300048903 Bacteria 547
907 Ga0496101_0220741 3300048904 Bacteria 1471
908 Ga0496101_0508344 3300048904 Bacteria 952
909 Ga0496101_1517506 3300048904 Bacteria 521
910 Ga0496102_0003769 3300048905 Bacteria 12817
911 Ga0496102_0047197 3300048905 Bacteria 3913
912 Ga0496102_0091024 3300048905 Bacteria 2823
913 Ga0496102_0162361 3300048905 Bacteria 2102
914 Ga0496102_0519863 3300048905 Bacteria 1113
915 Ga0496102_0606835 3300048905 Bacteria 1017
916 Ga0496103_0015027 3300048906 Bacteria 4602
917 Ga0496103_0289702 3300048906 Bacteria 1053
918 Ga0496104_0332646 3300048907 Bacteria 1432
919 Ga0496104_0549034 3300048907 Unclassified 1066
920 Ga0496105_0074257 3300048908 Bacteria 2809
921 Ga0496106_0002791 3300048909 Bacteria 12946
922 Ga0496106_0004326 3300048909 Bacteria 10547
923 Ga0496106_0147677 3300048909 Bacteria 1853
924 Ga0496106_0153849 3300048909 Bacteria 1815
925 Ga0496106_0240050 3300048909 Bacteria 1448
926 Ga0496107_0002891 3300048910 Bacteria 11349
927 Ga0496107_0006827 3300048910 Bacteria 7863
928 Ga0496107_0240226 3300048910 Bacteria 1348
929 Ga0496107_0352618 3300048910 Bacteria 1095
930 Ga0496107_0624295 3300048910 Bacteria 795
931 Ga0496109_0130840 3300048912 Bacteria 2342
932 Ga0496109_0165656 3300048912 Bacteria 2072
933 Ga0496109_0512819 3300048912 Bacteria 1132
934 Ga0496109_0859087 3300048912 Bacteria 845
935 Ga0496110_0220479 3300048913 Bacteria 1725
936 Ga0496110_0972722 3300048913 Bacteria 756
937 Ga0496110_1323451 3300048913 Bacteria 630
938 Ga0496112_0042175 3300048915 Bacteria 4464
939 Ga0496112_0300801 3300048915 Bacteria 1550
940 Ga0496112_1451187 3300048915 Bacteria 600
941 Ga0496113_0257229 3300048916 Bacteria 1395
942 Ga0496113_1373480 3300048916 Bacteria 548
943 Ga0496114_0267935 3300048917 Bacteria 1505
944 Ga0496114_0406893 3300048917 Bacteria 1205
945 Ga0496114_0799512 3300048917 Bacteria 822
946 Ga0496114_1320444 3300048917 Bacteria 608
947 Ga0496115_0001882 3300048918 Bacteria 15034
948 Ga0496115_0012290 3300048918 Bacteria 6438
949 Ga0496115_0018363 3300048918 Bacteria 5367
950 Ga0496115_0091520 3300048918 Bacteria 2486
951 Ga0496115_0125028 3300048918 Bacteria 2118
952 Ga0496115_0142589 3300048918 Bacteria 1977
953 Ga0496116_0034074 3300048919 Bacteria 3601
954 Ga0496121_0006932 3300048924 Bacteria 13810
955 Ga0496121_0025079 3300048924 Bacteria 5675
956 Ga0496121_0218763 3300048924 Bacteria 1343
957 Ga0496121_0312755 3300048924 Bacteria 1061
958 Ga0496122_0019200 3300048925 Bacteria 6259
959 Ga0496123_0003231 3300048926 Bacteria 18540
960 Ga0496124_0235773 3300048927 Bacteria 1364
961 Ga0496124_0377040 3300048927 Bacteria 993
962 Ga0496124_0388020 3300048927 Bacteria 974
963 Ga0496124_0605547 3300048927 Bacteria 712
964 Ga0496125_0005019 3300048928 Bacteria 14945
965 Ga0496125_0238456 3300048928 Bacteria 1157
966 Ga0496126_0020747 3300048929 Bacteria 6432
967 Ga0496126_0281280 3300048929 Bacteria 1378
968 Ga0496126_0695042 3300048929 Bacteria 791
969 Ga0496126_1333487 3300048929 Bacteria 521
970 Ga0501306_038842 3300049127 Bacteria 732
971 Ga0501306_055739 3300049127 Bacteria 643
972 Ga0501306_071972 3300049127 Bacteria 585
973 Ga0501308_002052 3300049128 Bacteria 1719
974 Ga0501308_067183 3300049128 Bacteria 551
975 Ga0501309_055897 3300049129 Bacteria 627
976 Ga0501304_016396 3300049160 Bacteria 701
977 Ga0501307_036794 3300049162 Bacteria 699
978 Ga0501291_110920 3300049514 Bacteria 584
979 Ga0501298_043813 3300049521 Bacteria 913
980 Ga0501311_026657 3300049527 Bacteria 816
981 Ga0501311_071973 3300049527 Bacteria 575
982 Ga0501312_101100 3300049528 Bacteria 541
983 Ga0501313_044659 3300049529 Bacteria 602
984 Ga0501313_060026 3300049529 Bacteria 538
985 Ga0501314_034091 3300049530 Bacteria 575
986 Ga0501315_038122 3300049531 Bacteria 718
987 Ga0501317_069869 3300049533 Bacteria 591
988 Ga0501319_009655 3300049535 Bacteria 758
989 Ga0501319_019549 3300049535 Bacteria 600
990 Ga0501320_010289 3300049536 Bacteria 951
991 Ga0501320_054744 3300049536 Bacteria 550
992 Ga0501321_030466 3300049537 Bacteria 719
993 Ga0501323_020971 3300049539 Bacteria 861
994 Ga0501324_023178 3300049540 Bacteria 645
995 Ga0501325_031814 3300049541 Bacteria 608
996 Ga0501326_10819 3300049542 Bacteria 550
997 Ga0501332_13471 3300049548 Bacteria 569
998 Ga0501335_035084 3300049551 Bacteria 578
999 Ga0501031_0943306 3300049568 Bacteria 552
1000 Ga0501032_0357693 3300049569 Bacteria 940
1001 Ga0501032_0629437 3300049569 Bacteria 682
1002 Ga0501032_0841737 3300049569 Bacteria 579
1003 Ga0501033_0161773 3300049570 Bacteria 1611
1004 Ga0501034_0000369 3300049571 Bacteria 76727
1005 Ga0501034_0276891 3300049571 Bacteria 1618
1006 Ga0501036_0073757 3300049572 Bacteria 2885
1007 Ga0501036_1154324 3300049572 Bacteria 632
1008 Ga0501036_1253622 3300049572 Bacteria 603
1009 Ga0501036_1414920 3300049572 Bacteria 564
1010 Ga0501036_1689706 3300049572 Bacteria 510
1011 Ga0501038_0668622 3300049574 Bacteria 780
1012 Ga0501039_0083327 3300049575 Bacteria 2490
1013 Ga0501041_0036376 3300049577 Bacteria 2983
1014 Ga0501042_0421174 3300049578 Bacteria 968
1015 Ga0501042_1045035 3300049578 Bacteria 595
1016 Ga0501043_0958466 3300049579 Bacteria 611
1017 Ga0501046_0011384 3300049580 Bacteria 7611
1018 Ga0501046_0241656 3300049580 Bacteria 1332
1019 Ga0501046_0393858 3300049580 Bacteria 1001
1020 Ga0501047_0265028 3300049581 Bacteria 1565
1021 Ga0501047_0313133 3300049581 Bacteria 1410
1022 Ga0501047_0577604 3300049581 Bacteria 947
1023 Ga0501047_0713866 3300049581 Bacteria 820
1024 Ga0501047_0881233 3300049581 Bacteria 709
1025 Ga0501047_0908151 3300049581 Bacteria 694
1026 Ga0501047_0939092 3300049581 Bacteria 678
1027 Ga0501047_1267342 3300049581 Bacteria 551
1028 Ga0501048_0053847 3300049582 Bacteria 2859
1029 Ga0501048_0868282 3300049582 Bacteria 649
1030 Ga0501067_0010065 3300049583 Bacteria 5232
1031 Ga0501067_0072493 3300049583 Bacteria 1908
1032 Ga0501067_0232490 3300049583 Bacteria 1026
1033 Ga0501067_0825746 3300049583 Bacteria 522
1034 Ga0501068_0527927 3300049584 Bacteria 767
1035 Ga0501068_0857022 3300049584 Bacteria 597
1036 Ga0501069_0168755 3300049585 Bacteria 1262
1037 Ga0501070_0711096 3300049586 Bacteria 794
1038 Ga0501071_0103754 3300049587 Bacteria 2098
1039 Ga0501072_0130901 3300049588 Bacteria 2000
1040 Ga0501072_0593658 3300049588 Bacteria 873
1041 Ga0501073_0037252 3300049589 Bacteria 3454
1042 Ga0501073_0469775 3300049589 Bacteria 870
1043 Ga0501073_0718394 3300049589 Bacteria 689
1044 Ga0501074_0063730 3300049590 Bacteria 2655
1045 Ga0501074_0084489 3300049590 Bacteria 2275
1046 Ga0501074_0601244 3300049590 Bacteria 778
1047 Ga0501075_0063296 3300049591 Bacteria 2788
1048 Ga0501076_0012239 3300049592 Bacteria 6414
1049 Ga0501076_0186261 3300049592 Bacteria 1693
1050 Ga0501076_1131097 3300049592 Bacteria 645
1051 Ga0501076_1270391 3300049592 Bacteria 606
1052 Ga0501076_1780405 3300049592 Bacteria 505
1053 Ga0501077_0046071 3300049593 Bacteria 2771
1054 Ga0501077_0060416 3300049593 Bacteria 2405
1055 Ga0501077_1110582 3300049593 Bacteria 509
1056 Ga0501238_000783 3300049671 Bacteria 3595
1057 Ga0501253_044110 3300049683 Bacteria 911
1058 Ga0501079_0015930 3300049741 Bacteria 5745
1059 Ga0501079_0060588 3300049741 Bacteria 2919
1060 Ga0501079_0658667 3300049741 Bacteria 824
1061 Ga0501080_0029716 3300049742 Bacteria 5087
1062 Ga0501080_0053127 3300049742 Bacteria 3772
1063 Ga0501080_0149278 3300049742 Bacteria 2161
1064 Ga0501081_0059167 3300049743 Bacteria 2652
1065 Ga0501081_0060850 3300049743 Bacteria 2617
1066 Ga0501081_0115554 3300049743 Bacteria 1907
1067 Ga0501081_0309641 3300049743 Bacteria 1159
1068 Ga0501083_0047578 3300049744 Bacteria 2897
1069 Ga0501083_0274941 3300049744 Bacteria 1096
1070 Ga0501083_0557753 3300049744 Bacteria 745
1071 Ga0501083_0685066 3300049744 Bacteria 667
1072 Ga0501268_078994 3300049765 Bacteria 677
1073 Ga0501280_075783 3300049776 Bacteria 610
1074 Ga0501035_0212703 3300049822 Bacteria 1654
1075 Ga0501035_0923031 3300049822 Bacteria 690
1076 Ga0501044_0003898 3300049823 Bacteria 16717
1077 Ga0501044_0330910 3300049823 Bacteria 1446
1078 Ga0501044_0365272 3300049823 Bacteria 1361
1079 Ga0501044_1204031 3300049823 Bacteria 625
1080 Ga0501044_1471192 3300049823 Bacteria 546
1081 Ga0501045_0068163 3300049824 Bacteria 2613
1082 Ga0501045_0754348 3300049824 Bacteria 717
1083 nmdc:mga03683_241070_c1 3300050489 Bacteria 838
1084 nmdc:mga03683_406440_c1 3300050489 Bacteria 651
1085 nmdc:mga03n38_417799_c1 3300050490 Unclassified 741
1086 nmdc:mga03n38_943733_c1 3300050490 Bacteria 509
1087 nmdc:mga00v17_1034173_c1 3300050491 Bacteria 516
1088 nmdc:mga00v17_266670_c1 3300050491 Bacteria 1111
1089 nmdc:mga00v17_505960_c1 3300050491 Bacteria 783
1090 nmdc:mga00v17_542613_c1 3300050491 Bacteria 752
1091 nmdc:mga00v17_966720_c1 3300050491 Bacteria 537
1092 nmdc:mga0k408_192269_c1 3300050493 Bacteria 1218
1093 nmdc:mga0k408_324476_c1 3300050493 Bacteria 919
1094 nmdc:mga0k408_407633_c1 3300050493 Bacteria 809
1095 nmdc:mga0k408_48942_c1 3300050493 Bacteria 2447
1096 nmdc:mga0k408_742890_c1 3300050493 Bacteria 573
1097 nmdc:mga07m45_21235_c1 3300050496 Bacteria 2152
1098 nmdc:mga07m45_343552_c1 3300050496 Bacteria 867
1099 nmdc:mga07m45_357764_c1 3300050496 Bacteria 848
1100 nmdc:mga05p37_122797_c1 3300050507 Bacteria 3190
1101 nmdc:mga05p37_1467144_c1 3300050507 Bacteria 682
1102 nmdc:mga05p37_1848956_c1 3300050507 Bacteria 580
1103 nmdc:mga05p37_588696_c1 3300050507 Bacteria 1258
1104 nmdc:mga05p37_71314_c1 3300050507 Bacteria 4273
1105 nmdc:mga05p37_72758_c1 3300050507 Bacteria 4230
1106 nmdc:mga09592_158152_c1 3300050508 Bacteria 1956
1107 nmdc:mga0qj67_12510_c2 3300050509 Bacteria 5937
1108 nmdc:mga0qj67_65221_c1 3300050509 Bacteria 2899
1109 nmdc:mga06r32_40836_c1 3300050510 Bacteria 4406
1110 nmdc:mga06r32_48597_c1 3300050510 Bacteria 4056
1111 nmdc:mga06r32_790726_c1 3300050510 Bacteria 910
1112 nmdc:mga08y16_1051708_c1 3300050511 Bacteria 791
1113 nmdc:mga08y16_46873_c1 3300050511 Bacteria 4524
1114 nmdc:mga0n895_147281_c1 3300050512 Bacteria 2384
1115 nmdc:mga0rr50_431955_c1 3300050513 Bacteria 1115
1116 nmdc:mga08x19_1344177_c1 3300050514 Bacteria 506
1117 nmdc:mga0a205_90841_c1 3300050515 Bacteria 2950
1118 nmdc:mga0sz30_55512_c1 3300050516 Bacteria 1686
1119 Ga0495601_0318698 3300053077 Bacteria 1012
1120 Ga0495595_0041871 3300053084 Bacteria 2098
1121 Ga0495619_0789782 3300053085 Bacteria 642
1122 Ga0500578_0000015 3300053086 Bacteria 179217
1123 Ga0500643_000968 3300053087 Bacteria 17812
1124 Ga0500643_001537 3300053087 Bacteria 13092
1125 Ga0500643_004694 3300053087 Bacteria 6081
1126 Ga0500643_027817 3300053087 Bacteria 1753
1127 Ga0500644_0000058 3300053088 Bacteria 64557
1128 Ga0500644_0001545 3300053088 Bacteria 6048
1129 Ga0500647_0006857 3300053091 Bacteria 4852
1130 Ga0500651_0004155 3300053093 Bacteria 8072
1131 Ga0500651_0107595 3300053093 Bacteria 1704
1132 Ga0500641_0000654 3300053096 Bacteria 12478
1133 Ga0500641_0002664 3300053096 Bacteria 6303
1134 Ga0500641_0031491 3300053096 Bacteria 2092
1135 Ga0500641_0076092 3300053096 Bacteria 1419
1136 Ga0500650_0170722 3300053098 Bacteria 1000
1137 Ga0500650_0203529 3300053098 Bacteria 901
1138 Ga0500650_0504894 3300053098 Bacteria 514
1139 Ga0500555_005991 3300053103 Bacteria 3450
1140 Ga0500555_051950 3300053103 Bacteria 1120
1141 Ga0500556_0003063 3300053104 Bacteria 5008
1142 Ga0500557_184260 3300053105 Bacteria 677
1143 Ga0500562_029255 3300053108 Bacteria 1449
1144 Ga0500562_055144 3300053108 Bacteria 1065
1145 Ga0500594_0008044 3300053118 Bacteria 2396
1146 Ga0500594_0028014 3300053118 Bacteria 1463
1147 Ga0500595_024261 3300053119 Bacteria 2119
1148 Ga0500595_052936 3300053119 Bacteria 1251
1149 Ga0500595_083273 3300053119 Bacteria 934
1150 Ga0500597_060952 3300053120 Bacteria 1621
1151 Ga0500608_000471 3300053122 Bacteria 15044
1152 Ga0500608_057135 3300053122 Bacteria 1870
1153 Ga0500618_002668 3300053125 Bacteria 6543
1154 Ga0500642_0489896 3300053130 Bacteria 521
1155 Ga0500652_042727 3300053131 Bacteria 1830
1156 Ga0500655_034856 3300053133 Bacteria 977
1157 Ga0500655_052680 3300053133 Bacteria 812
1158 Ga0500658_0015841 3300053134 Bacteria 2804
1159 Ga0500559_0000004 3300053136 Bacteria 241551
1160 Ga0500559_0007940 3300053136 Bacteria 4678
1161 Ga0500559_0046749 3300053136 Bacteria 1898
1162 Ga0500559_0346057 3300053136 Bacteria 695
1163 Ga0500568_0105288 3300053139 Bacteria 1057
1164 Ga0500568_0354179 3300053139 Bacteria 532
1165 Ga0500573_0224389 3300053140 Bacteria 983
1166 Ga0500588_0410545 3300053146 Bacteria 516
1167 Ga0500604_0093064 3300053151 Bacteria 987
1168 Ga0500604_0198816 3300053151 Bacteria 689
1169 Ga0500616_0013830 3300053153 Bacteria 4660
1170 Ga0500616_0031769 3300053153 Bacteria 2890
1171 Ga0500616_0034483 3300053153 Bacteria 2756
1172 Ga0500616_0102293 3300053153 Bacteria 1398
1173 Ga0500616_0404285 3300053153 Bacteria 545
1174 Ga0500622_0003216 3300053156 Bacteria 11108
1175 Ga0500622_0008772 3300053156 Bacteria 5630
1176 Ga0500622_0019728 3300053156 Bacteria 3579
1177 Ga0500622_0057699 3300053156 Bacteria 1985
1178 Ga0500622_0086816 3300053156 Bacteria 1558
1179 Ga0500624_000193 3300053157 Bacteria 24175
1180 Ga0500627_0001642 3300053158 Bacteria 6327
1181 Ga0500627_0155284 3300053158 Bacteria 1033
1182 Ga0500633_0167837 3300053160 Bacteria 824
1183 Ga0500634_0147912 3300053161 Bacteria 1102
1184 Ga0500636_0520626 3300053177 Bacteria 521
1185 Ga0500637_0001689 3300053178 Bacteria 9504
1186 Ga0500611_007667 3300053727 Bacteria 1634
1187 Ga0500645_000730 3300053730 Bacteria 20251
1188 Ga0500645_003413 3300053730 Bacteria 6458
1189 Ga0500645_004984 3300053730 Bacteria 4978
1190 Ga0500552_005395 3300053733 Bacteria 1391
1191 Ga0501084_0029290 3300054114 Bacteria 4605
1192 Ga0501084_0059405 3300054114 Bacteria 3200
1193 Ga0501084_0453374 3300054114 Bacteria 1084
1194 Ga0501084_0925832 3300054114 Bacteria 733
1195 Ga0501084_1432218 3300054114 Bacteria 579
1196 Ga0587084_045345 3300059477 Bacteria 761
1197 Ga0587084_129107 3300059477 Bacteria 539
1198 Ga0587093_108132 3300059478 Bacteria 509
1199 Ga0587066_171539 3300059490 Bacteria 552
1200 Ga0587070_009166 3300059491 Bacteria 1423
1201 Ga0587070_196204 3300059491 Bacteria 534
1202 Ga0587073_0198660 3300059492 Bacteria 600
1203 Ga0587077_078882 3300059493 Bacteria 751
1204 Ga0587077_084621 3300059493 Bacteria 735
1205 Ga0587077_196856 3300059493 Bacteria 555
1206 Ga0587077_268092 3300059493 Bacteria 500
1207 Ga0587080_048073 3300059503 Bacteria 798
1208 Ga0587080_056927 3300059503 Bacteria 752
1209 Ga0587082_062142 3300059504 Bacteria 739
1210 Ga0587082_077604 3300059504 Bacteria 686
1211 Ga0587082_126145 3300059504 Bacteria 583
1212 Ga0587083_0002069 3300059505 Bacteria 2422
1213 Ga0587083_0069149 3300059505 Bacteria 815
1214 Ga0587083_0130208 3300059505 Bacteria 659
1215 Ga0587083_0193085 3300059505 Bacteria 577
1216 Ga0587083_0207277 3300059505 Bacteria 563
1217 Ga0587085_029109 3300059506 Bacteria 897
1218 Ga0587085_032522 3300059506 Bacteria 866
1219 Ga0587085_040279 3300059506 Bacteria 811
1220 Ga0587085_101280 3300059506 Bacteria 608
1221 Ga0587085_131533 3300059506 Bacteria 560
1222 Ga0587086_019882 3300059507 Bacteria 908
1223 Ga0587088_123448 3300059508 Bacteria 602
1224 Ga0587090_045301 3300059510 Bacteria 788
1225 Ga0587090_097141 3300059510 Bacteria 612
1226 Ga0587090_140730 3300059510 Bacteria 539
1227 Ga0587091_122771 3300059511 Bacteria 633
1228 Ga0587091_198655 3300059511 Bacteria 537
1229 Ga0587092_054154 3300059512 Bacteria 734
1230 Ga0587092_107895 3300059512 Bacteria 581
1231 Ga0587094_010142 3300059513 Bacteria 1216
1232 Ga0587094_089105 3300059513 Bacteria 581
1233 Ga0587098_039252 3300059604 Bacteria 683
1234 Ga0587098_052495 3300059604 Bacteria 622
1235 Ga0587125_022605 3300059607 Bacteria 753
1236 Ga0587101_006195 3300059623 Bacteria 1361
1237 Ga0587101_061627 3300059623 Bacteria 671
1238 Ga0587101_082685 3300059623 Bacteria 611
1239 Ga0587101_085971 3300059623 Bacteria 604
1240 Ga0587101_093544 3300059623 Bacteria 588
1241 Ga0587109_168549 3300059624 Bacteria 552
1242 Ga0587109_184727 3300059624 Bacteria 535
1243 Ga0587115_076061 3300059626 Bacteria 587
1244 Ga0587115_102520 3300059626 Bacteria 532
1245 Ga0587128_042925 3300059630 Bacteria 798
1246 Ga0587128_094714 3300059630 Bacteria 618
1247 Ga0587128_096287 3300059630 Bacteria 614
1248 Ga0587062_066382 3300059639 Bacteria 644
1249 Ga0587062_071306 3300059639 Bacteria 629
1250 Ga0587062_087157 3300059639 Bacteria 589
1251 Ga0587068_079951 3300059641 Bacteria 658
1252 Ga0587068_110464 3300059641 Bacteria 587
1253 Ga0587068_161699 3300059641 Bacteria 513
1254 Ga0587068_161715 3300059641 Bacteria 513
1255 Ga0587069_102712 3300059642 Bacteria 586
1256 Ga0587072_066045 3300059643 Bacteria 755
1257 Ga0587072_141462 3300059643 Bacteria 574
1258 Ga0587072_203244 3300059643 Bacteria 505
1259 Ga0587076_005924 3300059645 Bacteria 1606
1260 Ga0587076_177405 3300059645 Bacteria 534
1261 Ga0587078_032556 3300059646 Bacteria 709
1262 Ga0587079_038790 3300059647 Bacteria 952
1263 Ga0587079_072064 3300059647 Bacteria 773
1264 Ga0587079_090939 3300059647 Bacteria 714
1265 Ga0587105_013126 3300059651 Bacteria 657
1266 Ga0587107_012142 3300059652 Bacteria 1068
1267 Ga0587107_051188 3300059652 Bacteria 701
1268 Ga0587108_038871 3300059653 Bacteria 506
1269 Ga0587110_018106 3300059654 Bacteria 777
1270 Ga0587124_033986 3300059660 Bacteria 574
1271 Ga0587071_058758 3300060344 Bacteria 812
1272 Ga0587071_118874 3300060344 Bacteria 629
1273 Ga0587071_150537 3300060344 Bacteria 578
1274 Ga0587111_0003255 3300060346 Bacteria 2287
1275 Ga0587111_0009437 3300060346 Bacteria 1646
1276 Ga0587111_0026302 3300060346 Bacteria 1159
1277 Ga0587111_0050087 3300060346 Bacteria 919
1278 Ga0587111_0079645 3300060346 Bacteria 781
1279 Ga0587111_0120838 3300060346 Bacteria 674
1280 Ga0587111_0193254 3300060346 Bacteria 573
1281 Ga0587111_0230872 3300060346 Bacteria 538
1282 Ga0501082_0007661 3300060353 Bacteria 9318
1283 Ga0501082_0020564 3300060353 Bacteria 5689
1284 Ga0501082_0038268 3300060353 Bacteria 4138
1285 Ga0501082_0041062 3300060353 Bacteria 3988
1286 Ga0501082_0332342 3300060353 Bacteria 1324
1287 Ga0530510_0012139 3300061734 Bacteria 6047
1288 Ga0530510_0164147 3300061734 Bacteria 1643
1289 Ga0530510_1138423 3300061734 Bacteria 598
1290 Ga0530510_1501704 3300061734 Bacteria 517

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_13497400 Ga0111539_134974002 88
2 3300003215 JGI25153J46596_10096869 JGI25153J46596_100968691 89
3 3300003322 rootL2_10142746 rootL2_101427461 89
4 3300003558 Ga0006558J51389_1030434 Ga0006558J51389_10304342 89
5 3300003773 Ga0055537_1004646 Ga0055537_10046461 89
6 3300003775 Ga0055524_1068676 Ga0055524_10686761 89
7 3300003781 Ga0055536_1004742 Ga0055536_10047427 89
8 3300003781 Ga0055536_1053798 Ga0055536_10537981 89
9 3300003790 Ga0055528_1004920 Ga0055528_10049206 89
10 3300003791 Ga0055530_10009589 Ga0055530_100095894 89
11 3300003792 Ga0055540_1024508 Ga0055540_10245082 89
12 3300003794 Ga0055531_10000968 Ga0055531_1000096812 89
13 3300003794 Ga0055531_10006710 Ga0055531_100067102 89
14 3300003794 Ga0055531_10007558 Ga0055531_100075581 89
15 3300003794 Ga0055531_10035065 Ga0055531_100350652 89
16 3300004625 Ga0055543_1017106 Ga0055543_10171062 89
17 3300004799 Ga0058863_11934056 Ga0058863_119340562 89
18 3300004800 Ga0058861_11969232 Ga0058861_119692322 89
19 3300004800 Ga0058861_12043731 Ga0058861_120437312 89
20 3300004801 Ga0058860_12201779 Ga0058860_122017791 89
21 3300004803 Ga0058862_10101958 Ga0058862_101019582 89
22 3300004803 Ga0058862_12762670 Ga0058862_127626701 89
23 3300004803 Ga0058862_12763025 Ga0058862_127630251 89
24 3300004803 Ga0058862_12821347 Ga0058862_128213471 89
25 3300005262 Ga0065165_1000345 Ga0065165_100034534 89
26 3300005262 Ga0065165_1001044 Ga0065165_10010448 89
27 3300005289 Ga0065704_10053697 Ga0065704_100536972 89
28 3300005289 Ga0065704_10113070 Ga0065704_101130702 89
29 3300005289 Ga0065704_10657186 Ga0065704_106571862 89
30 3300005289 Ga0065704_10778563 Ga0065704_107785631 89
31 3300005293 Ga0065715_10005462 Ga0065715_100054622 89
32 3300005327 Ga0070658_10625286 Ga0070658_106252861 89
33 3300005327 Ga0070658_10669684 Ga0070658_106696841 89
34 3300005328 Ga0070676_10380717 Ga0070676_103807172 89
35 3300005328 Ga0070676_11592608 Ga0070676_115926081 89
36 3300005330 Ga0070690_100184757 Ga0070690_1001847572 89
37 3300005331 Ga0070670_100111080 Ga0070670_1001110802 89
38 3300005331 Ga0070670_101255424 Ga0070670_1012554241 89
39 3300005334 Ga0068869_100049925 Ga0068869_1000499252 89
40 3300005334 Ga0068869_100118268 Ga0068869_1001182682 89
41 3300005334 Ga0068869_101092181 Ga0068869_1010921811 89
42 3300005334 Ga0068869_101529218 Ga0068869_1015292181 89
43 3300005335 Ga0070666_10707515 Ga0070666_107075151 89
44 3300005336 Ga0070680_100016416 Ga0070680_1000164162 89
45 3300005337 Ga0070682_101263394 Ga0070682_1012633941 89
46 3300005338 Ga0068868_101159455 Ga0068868_1011594551 89
47 3300005338 Ga0068868_101761723 Ga0068868_1017617231 89
48 3300005339 Ga0070660_100460371 Ga0070660_1004603711 89
49 3300005339 Ga0070660_101449038 Ga0070660_1014490381 89
50 3300005339 Ga0070660_101813807 Ga0070660_1018138071 89
51 3300005340 Ga0070689_101260739 Ga0070689_1012607391 89
52 3300005341 Ga0070691_10227010 Ga0070691_102270102 89
53 3300005344 Ga0070661_100670954 Ga0070661_1006709542 89
54 3300005344 Ga0070661_100988451 Ga0070661_1009884511 89
55 3300005345 Ga0070692_10439872 Ga0070692_104398723 89
56 3300005345 Ga0070692_11249688 Ga0070692_112496882 89
57 3300005347 Ga0070668_100113463 Ga0070668_1001134632 89
58 3300005347 Ga0070668_100463259 Ga0070668_1004632592 89
59 3300005347 Ga0070668_100755407 Ga0070668_1007554071 89
60 3300005353 Ga0070669_100091793 Ga0070669_1000917932 89
61 3300005353 Ga0070669_100939978 Ga0070669_1009399782 89
62 3300005353 Ga0070669_101431469 Ga0070669_1014314691 89
63 3300005354 Ga0070675_100713125 Ga0070675_1007131251 89
64 3300005354 Ga0070675_100951533 Ga0070675_1009515331 89
65 3300005356 Ga0070674_100462839 Ga0070674_1004628392 89
66 3300005356 Ga0070674_101737076 Ga0070674_1017370761 89
67 3300005366 Ga0070659_100015080 Ga0070659_1000150802 89
68 3300005366 Ga0070659_100508916 Ga0070659_1005089161 89
69 3300005367 Ga0070667_100464157 Ga0070667_1004641571 89
70 3300005367 Ga0070667_100823887 Ga0070667_1008238872 89
71 3300005367 Ga0070667_101366872 Ga0070667_1013668722 89
72 3300005367 Ga0070667_101497008 Ga0070667_1014970081 89
73 3300005367 Ga0070667_101923418 Ga0070667_1019234181 89
74 3300005406 Ga0070703_10042681 Ga0070703_100426812 89
75 3300005435 Ga0070714_100503652 Ga0070714_1005036522 89
76 3300005436 Ga0070713_101636727 Ga0070713_1016367272 89
77 3300005438 Ga0070701_10046848 Ga0070701_100468482 89
78 3300005439 Ga0070711_100479064 Ga0070711_1004790642 89
79 3300005440 Ga0070705_100000422 Ga0070705_10000042220 89
80 3300005440 Ga0070705_100612625 Ga0070705_1006126251 89
81 3300005441 Ga0070700_100000646 Ga0070700_10000064614 89
82 3300005441 Ga0070700_100255677 Ga0070700_1002556771 89
83 3300005441 Ga0070700_101357823 Ga0070700_1013578232 89
84 3300005444 Ga0070694_100001076 Ga0070694_10000107612 89
85 3300005444 Ga0070694_100314683 Ga0070694_1003146832 89
86 3300005444 Ga0070694_100760996 Ga0070694_1007609961 89
87 3300005444 Ga0070694_101406741 Ga0070694_1014067411 89
88 3300005445 Ga0070708_100086386 Ga0070708_1000863862 89
89 3300005445 Ga0070708_101039194 Ga0070708_1010391941 89
90 3300005455 Ga0070663_100016933 Ga0070663_1000169333 89
91 3300005455 Ga0070663_100206840 Ga0070663_1002068402 89
92 3300005455 Ga0070663_101578351 Ga0070663_1015783511 89
93 3300005456 Ga0070678_100467269 Ga0070678_1004672692 89
94 3300005456 Ga0070678_100912178 Ga0070678_1009121782 89
95 3300005456 Ga0070678_101029372 Ga0070678_1010293721 89
96 3300005456 Ga0070678_101315047 Ga0070678_1013150472 89
97 3300005457 Ga0070662_100035296 Ga0070662_1000352962 89
98 3300005466 Ga0070685_11615019 Ga0070685_116150191 89
99 3300005467 Ga0070706_100313262 Ga0070706_1003132622 89
100 3300005467 Ga0070706_101078426 Ga0070706_1010784261 89
101 3300005468 Ga0070707_100684776 Ga0070707_1006847762 89
102 3300005471 Ga0070698_100102986 Ga0070698_1001029862 89
103 3300005471 Ga0070698_100229707 Ga0070698_1002297072 89
104 3300005471 Ga0070698_100657213 Ga0070698_1006572131 89
105 3300005471 Ga0070698_100917818 Ga0070698_1009178182 89
106 3300005471 Ga0070698_101291247 Ga0070698_1012912471 89
107 3300005471 Ga0070698_101807300 Ga0070698_1018073001 89
108 3300005518 Ga0070699_100011141 Ga0070699_1000111413 89
109 3300005518 Ga0070699_100084090 Ga0070699_1000840902 89
110 3300005518 Ga0070699_100088848 Ga0070699_1000888482 89
111 3300005518 Ga0070699_100148536 Ga0070699_1001485362 89
112 3300005530 Ga0070679_100098880 Ga0070679_1000988802 89
113 3300005530 Ga0070679_100663362 Ga0070679_1006633622 89
114 3300005535 Ga0070684_101108936 Ga0070684_1011089361 89
115 3300005535 Ga0070684_101993843 Ga0070684_1019938431 89
116 3300005536 Ga0070697_100020913 Ga0070697_1000209132 89
117 3300005536 Ga0070697_100021215 Ga0070697_1000212154 89
118 3300005536 Ga0070697_101163812 Ga0070697_1011638121 89
119 3300005539 Ga0068853_100135251 Ga0068853_1001352513 89
120 3300005539 Ga0068853_100229928 Ga0068853_1002299282 89
121 3300005539 Ga0068853_100853413 Ga0068853_1008534132 89
122 3300005545 Ga0070695_100010589 Ga0070695_1000105892 89
123 3300005545 Ga0070695_100834306 Ga0070695_1008343061 89
124 3300005545 Ga0070695_100913471 Ga0070695_1009134712 89
125 3300005545 Ga0070695_101394124 Ga0070695_1013941241 89
126 3300005545 Ga0070695_101418543 Ga0070695_1014185431 89
127 3300005546 Ga0070696_100003141 Ga0070696_1000031413 89
128 3300005546 Ga0070696_100061214 Ga0070696_1000612142 89
129 3300005546 Ga0070696_100311747 Ga0070696_1003117471 89
130 3300005547 Ga0070693_100047576 Ga0070693_1000475762 89
131 3300005547 Ga0070693_100524656 Ga0070693_1005246562 89
132 3300005547 Ga0070693_100755821 Ga0070693_1007558211 89
133 3300005547 Ga0070693_101186723 Ga0070693_1011867231 89
134 3300005547 Ga0070693_101478322 Ga0070693_1014783221 89
135 3300005548 Ga0070665_100000187 Ga0070665_10000018711 89
136 3300005548 Ga0070665_100111454 Ga0070665_1001114542 89
137 3300005548 Ga0070665_100366247 Ga0070665_1003662471 89
138 3300005548 Ga0070665_101047263 Ga0070665_1010472632 89
139 3300005548 Ga0070665_102279128 Ga0070665_1022791282 89
140 3300005548 Ga0070665_102400754 Ga0070665_1024007541 89
141 3300005549 Ga0070704_100069383 Ga0070704_1000693832 89
142 3300005549 Ga0070704_100561558 Ga0070704_1005615581 89
143 3300005563 Ga0068855_100477917 Ga0068855_1004779172 89
144 3300005563 Ga0068855_100722158 Ga0068855_1007221582 89
145 3300005563 Ga0068855_100859354 Ga0068855_1008593541 89
146 3300005563 Ga0068855_101458103 Ga0068855_1014581032 89
147 3300005563 Ga0068855_101480494 Ga0068855_1014804941 89
148 3300005563 Ga0068855_102349453 Ga0068855_1023494531 89
149 3300005564 Ga0070664_101373789 Ga0070664_1013737892 89
150 3300005577 Ga0068857_100051141 Ga0068857_1000511412 89
151 3300005577 Ga0068857_100867067 Ga0068857_1008670671 89
152 3300005577 Ga0068857_100930406 Ga0068857_1009304062 89
153 3300005577 Ga0068857_101597264 Ga0068857_1015972642 89
154 3300005614 Ga0068856_100125919 Ga0068856_1001259192 89
155 3300005614 Ga0068856_100189873 Ga0068856_1001898732 89
156 3300005615 Ga0070702_100548035 Ga0070702_1005480352 89
157 3300005616 Ga0068852_100725546 Ga0068852_1007255462 89
158 3300005616 Ga0068852_100949953 Ga0068852_1009499532 89
159 3300005616 Ga0068852_101048322 Ga0068852_1010483222 89
160 3300005617 Ga0068859_100001348 Ga0068859_1000013483 89
161 3300005617 Ga0068859_100308317 Ga0068859_1003083172 89
162 3300005617 Ga0068859_100859924 Ga0068859_1008599241 89
163 3300005617 Ga0068859_101253628 Ga0068859_1012536282 89
164 3300005618 Ga0068864_100078352 Ga0068864_1000783522 89
165 3300005618 Ga0068864_100179969 Ga0068864_1001799692 89
166 3300005618 Ga0068864_100388174 Ga0068864_1003881742 89
167 3300005618 Ga0068864_101764359 Ga0068864_1017643592 89
168 3300005718 Ga0068866_10180745 Ga0068866_101807452 89
169 3300005718 Ga0068866_10957200 Ga0068866_109572001 89
170 3300005718 Ga0068866_11472197 Ga0068866_114721971 89
171 3300005719 Ga0068861_100006874 Ga0068861_1000068747 89
172 3300005719 Ga0068861_100424264 Ga0068861_1004242642 89
173 3300005719 Ga0068861_100572277 Ga0068861_1005722772 89
174 3300005719 Ga0068861_101285715 Ga0068861_1012857152 89
175 3300005719 Ga0068861_101465516 Ga0068861_1014655162 89
176 3300005840 Ga0068870_10555349 Ga0068870_105553492 89
177 3300005840 Ga0068870_11194866 Ga0068870_111948661 89
178 3300005841 Ga0068863_100335627 Ga0068863_1003356272 89
179 3300005841 Ga0068863_100820669 Ga0068863_1008206692 89
180 3300005841 Ga0068863_100942717 Ga0068863_1009427172 89
181 3300005841 Ga0068863_101536035 Ga0068863_1015360351 89
182 3300005841 Ga0068863_102557560 Ga0068863_1025575602 89
183 3300005842 Ga0068858_100948399 Ga0068858_1009483992 89
184 3300005843 Ga0068860_100014816 Ga0068860_1000148163 89
185 3300005843 Ga0068860_100226978 Ga0068860_1002269782 89
186 3300005843 Ga0068860_100459488 Ga0068860_1004594882 89
187 3300005843 Ga0068860_100490209 Ga0068860_1004902092 89
188 3300005844 Ga0068862_100001566 Ga0068862_1000015667 89
189 3300005844 Ga0068862_100016985 Ga0068862_1000169852 89
190 3300005844 Ga0068862_100027838 Ga0068862_1000278382 89
191 3300005844 Ga0068862_100813013 Ga0068862_1008130132 89
192 3300005844 Ga0068862_101560373 Ga0068862_1015603731 89
193 3300005844 Ga0068862_101954523 Ga0068862_1019545231 89
194 3300005937 Ga0081455_10070527 Ga0081455_100705272 89
195 3300005937 Ga0081455_10380279 Ga0081455_103802792 89
196 3300005983 Ga0081540_1119940 Ga0081540_11199402 89
197 3300005985 Ga0081539_10132353 Ga0081539_101323532 89
198 3300006038 Ga0075365_10686934 Ga0075365_106869342 89
199 3300006038 Ga0075365_11117540 Ga0075365_111175401 89
200 3300006048 Ga0075363_100124223 Ga0075363_1001242232 89
201 3300006048 Ga0075363_100576261 Ga0075363_1005762612 89
202 3300006048 Ga0075363_100592633 Ga0075363_1005926332 89
203 3300006051 Ga0075364_10076847 Ga0075364_100768472 89
204 3300006051 Ga0075364_10275765 Ga0075364_102757652 89
205 3300006051 Ga0075364_10317377 Ga0075364_103173772 89
206 3300006051 Ga0075364_10484407 Ga0075364_104844072 89
207 3300006051 Ga0075364_10564703 Ga0075364_105647031 89
208 3300006051 Ga0075364_10727560 Ga0075364_107275601 89
209 3300006051 Ga0075364_11012878 Ga0075364_110128781 89
210 3300006163 Ga0070715_10000031 Ga0070715_1000003175 89
211 3300006173 Ga0070716_100472419 Ga0070716_1004724191 89
212 3300006175 Ga0070712_100491086 Ga0070712_1004910861 89
213 3300006177 Ga0075362_10193590 Ga0075362_101935902 89
214 3300006178 Ga0075367_10182503 Ga0075367_101825032 89
215 3300006178 Ga0075367_10327488 Ga0075367_103274882 89
216 3300006178 Ga0075367_10798426 Ga0075367_107984261 89
217 3300006186 Ga0075369_10043828 Ga0075369_100438282 89
218 3300006195 Ga0075366_10114577 Ga0075366_101145772 89
219 3300006195 Ga0075366_10394632 Ga0075366_103946322 89
220 3300006195 Ga0075366_10547553 Ga0075366_105475533 89
221 3300006195 Ga0075366_10576897 Ga0075366_105768971 89
222 3300006237 Ga0097621_100316806 Ga0097621_1003168062 89
223 3300006353 Ga0075370_10109639 Ga0075370_101096392 89
224 3300006353 Ga0075370_10292586 Ga0075370_102925861 89
225 3300006353 Ga0075370_10353252 Ga0075370_103532522 89
226 3300006358 Ga0068871_100764926 Ga0068871_1007649262 89
227 3300006844 Ga0075428_100095612 Ga0075428_1000956124 89
228 3300006844 Ga0075428_101142595 Ga0075428_1011425952 89
229 3300006844 Ga0075428_101210736 Ga0075428_1012107362 89
230 3300006846 Ga0075430_100016885 Ga0075430_1000168854 89
231 3300006846 Ga0075430_100068032 Ga0075430_1000680322 89
232 3300006847 Ga0075431_100006929 Ga0075431_10000692912 89
233 3300006847 Ga0075431_100007900 Ga0075431_1000079003 89
234 3300006847 Ga0075431_100119471 Ga0075431_1001194712 89
235 3300006847 Ga0075431_100932465 Ga0075431_1009324652 89
236 3300006852 Ga0075433_10149593 Ga0075433_101495932 89
237 3300006852 Ga0075433_10918707 Ga0075433_109187071 89
238 3300006871 Ga0075434_100418729 Ga0075434_1004187292 89
239 3300006880 Ga0075429_100163276 Ga0075429_1001632762 89
240 3300006881 Ga0068865_100025593 Ga0068865_1000255932 89
241 3300006881 Ga0068865_100272278 Ga0068865_1002722781 89
242 3300006881 Ga0068865_100360862 Ga0068865_1003608622 89
243 3300006881 Ga0068865_100567893 Ga0068865_1005678931 89
244 3300006881 Ga0068865_100837874 Ga0068865_1008378742 89
245 3300006881 Ga0068865_101126665 Ga0068865_1011266652 89
246 3300006931 Ga0097620_100001348 Ga0097620_1000013483 89
247 3300006931 Ga0097620_100308337 Ga0097620_1003083372 89
248 3300006931 Ga0097620_100859866 Ga0097620_1008598661 89
249 3300006931 Ga0097620_101253638 Ga0097620_1012536382 89
250 3300007076 Ga0075435_100301837 Ga0075435_1003018372 89
251 3300007076 Ga0075435_100502749 Ga0075435_1005027492 89
252 3300007076 Ga0075435_100641183 Ga0075435_1006411832 89
253 3300009036 Ga0105244_10532145 Ga0105244_105321451 89
254 3300009092 Ga0105250_10006712 Ga0105250_100067125 89
255 3300009093 Ga0105240_10011290 Ga0105240_100112902 89
256 3300009093 Ga0105240_10236334 Ga0105240_102363342 89
257 3300009093 Ga0105240_10596293 Ga0105240_105962932 89
258 3300009093 Ga0105240_10618521 Ga0105240_106185212 89
259 3300009093 Ga0105240_10668291 Ga0105240_106682911 89
260 3300009093 Ga0105240_10898609 Ga0105240_108986092 89
261 3300009094 Ga0111539_10079678 Ga0111539_100796782 89
262 3300009094 Ga0111539_10545879 Ga0111539_105458792 89
263 3300009098 Ga0105245_10224845 Ga0105245_102248452 89
264 3300009098 Ga0105245_10683292 Ga0105245_106832922 89
265 3300009098 Ga0105245_12367960 Ga0105245_123679602 89
266 3300009098 Ga0105245_12592299 Ga0105245_125922991 89
267 3300009101 Ga0105247_10291118 Ga0105247_102911182 89
268 3300009147 Ga0114129_10045488 Ga0114129_100454884 89
269 3300009147 Ga0114129_10332574 Ga0114129_103325741 89
270 3300009147 Ga0114129_10740823 Ga0114129_107408232 89
271 3300009147 Ga0114129_10805309 Ga0114129_108053092 89
272 3300009147 Ga0114129_11810165 Ga0114129_118101652 89
273 3300009147 Ga0114129_12063250 Ga0114129_120632502 89
274 3300009148 Ga0105243_10137333 Ga0105243_101373332 89
275 3300009148 Ga0105243_10181582 Ga0105243_101815822 89
276 3300009148 Ga0105243_11238242 Ga0105243_112382422 89
277 3300009148 Ga0105243_11325068 Ga0105243_113250682 89
278 3300009148 Ga0105243_11410710 Ga0105243_114107102 89
279 3300009174 Ga0105241_10303952 Ga0105241_103039522 89
280 3300009174 Ga0105241_10371163 Ga0105241_103711632 89
281 3300009174 Ga0105241_10371798 Ga0105241_103717981 89
282 3300009174 Ga0105241_10905885 Ga0105241_109058852 89
283 3300009174 Ga0105241_10987422 Ga0105241_109874221 89
284 3300009176 Ga0105242_10232711 Ga0105242_102327113 89
285 3300009176 Ga0105242_10394715 Ga0105242_103947152 89
286 3300009176 Ga0105242_10515666 Ga0105242_105156662 89
287 3300009176 Ga0105242_11241810 Ga0105242_112418102 89
288 3300009176 Ga0105242_11443437 Ga0105242_114434372 89
289 3300009176 Ga0105242_11870363 Ga0105242_118703632 89
290 3300009177 Ga0105248_10631821 Ga0105248_106318211 89
291 3300009545 Ga0105237_10648427 Ga0105237_106484272 89
292 3300009545 Ga0105237_11332160 Ga0105237_113321602 89
293 3300009545 Ga0105237_11918943 Ga0105237_119189431 89
294 3300009551 Ga0105238_10061875 Ga0105238_100618752 89
295 3300009551 Ga0105238_10077822 Ga0105238_100778224 89
296 3300009551 Ga0105238_10192854 Ga0105238_101928542 89
297 3300009551 Ga0105238_10211229 Ga0105238_102112292 89
298 3300009551 Ga0105238_10229711 Ga0105238_102297112 89
299 3300009551 Ga0105238_10396633 Ga0105238_103966332 89
300 3300009551 Ga0105238_10603881 Ga0105238_106038811 89
301 3300009551 Ga0105238_11518864 Ga0105238_115188642 89
302 3300009551 Ga0105238_12317508 Ga0105238_123175081 89
303 3300009553 Ga0105249_10000689 Ga0105249_100006892 89
304 3300009553 Ga0105249_10511220 Ga0105249_105112202 89
305 3300009553 Ga0105249_11035945 Ga0105249_110359452 89
306 3300009553 Ga0105249_12892584 Ga0105249_128925841 89
307 3300010375 Ga0105239_10123802 Ga0105239_101238022 89
308 3300010375 Ga0105239_10916730 Ga0105239_109167302 89
309 3300010375 Ga0105239_12398926 Ga0105239_123989262 89
310 3300011119 Ga0105246_10099127 Ga0105246_100991272 89
311 3300011119 Ga0105246_10395020 Ga0105246_103950202 89
312 3300011119 Ga0105246_11246818 Ga0105246_112468182 89
313 3300011119 Ga0105246_11320725 Ga0105246_113207251 89
314 3300011119 Ga0105246_11742197 Ga0105246_117421972 89
315 3300012495 Ga0157323_1033709 Ga0157323_10337092 89
316 3300012497 Ga0157319_1008110 Ga0157319_10081102 89
317 3300012513 Ga0157326_1037903 Ga0157326_10379032 89
318 3300013100 Ga0157373_10009155 Ga0157373_100091558 89
319 3300013102 Ga0157371_11017213 Ga0157371_110172132 89
320 3300013104 Ga0157370_10080372 Ga0157370_100803722 89
321 3300013104 Ga0157370_10231753 Ga0157370_102317532 89
322 3300013104 Ga0157370_10336172 Ga0157370_103361722 89
323 3300013105 Ga0157369_10019954 Ga0157369_100199542 89
324 3300013105 Ga0157369_10706873 Ga0157369_107068732 89
325 3300013105 Ga0157369_12285570 Ga0157369_122855701 89
326 3300013296 Ga0157374_10117372 Ga0157374_101173722 89
327 3300013296 Ga0157374_10778898 Ga0157374_107788982 89
328 3300013296 Ga0157374_10956765 Ga0157374_109567652 89
329 3300013296 Ga0157374_11663755 Ga0157374_116637552 89
330 3300013297 Ga0157378_10324328 Ga0157378_103243282 89
331 3300013297 Ga0157378_10507617 Ga0157378_105076172 89
332 3300013297 Ga0157378_11009840 Ga0157378_110098401 89
333 3300013297 Ga0157378_11544702 Ga0157378_115447021 89
334 3300013306 Ga0163162_10414409 Ga0163162_104144092 89
335 3300013306 Ga0163162_10735398 Ga0163162_107353982 89
336 3300013306 Ga0163162_11464116 Ga0163162_114641162 89
337 3300013306 Ga0163162_11837195 Ga0163162_118371952 89
338 3300013307 Ga0157372_10435701 Ga0157372_104357012 89
339 3300013308 Ga0157375_12956772 Ga0157375_129567722 89
340 3300013308 Ga0157375_13702778 Ga0157375_137027781 89
341 3300014325 Ga0163163_10010481 Ga0163163_1001048111 89
342 3300014325 Ga0163163_10507652 Ga0163163_105076522 89
343 3300014325 Ga0163163_10698019 Ga0163163_106980191 89
344 3300014325 Ga0163163_10733495 Ga0163163_107334952 89
345 3300014325 Ga0163163_11396914 Ga0163163_113969142 89
346 3300014325 Ga0163163_11466515 Ga0163163_114665151 89
347 3300014326 Ga0157380_10119958 Ga0157380_101199582 89
348 3300014326 Ga0157380_10452391 Ga0157380_104523912 89
349 3300014326 Ga0157380_10577100 Ga0157380_105771001 89
350 3300014326 Ga0157380_10649004 Ga0157380_106490042 89
351 3300014326 Ga0157380_10697032 Ga0157380_106970322 89
352 3300014326 Ga0157380_12497143 Ga0157380_124971432 89
353 3300014497 Ga0182008_10138293 Ga0182008_101382932 89
354 3300014745 Ga0157377_10088990 Ga0157377_100889902 89
355 3300014968 Ga0157379_10366652 Ga0157379_103666522 89
356 3300014968 Ga0157379_10523958 Ga0157379_105239582 89
357 3300014968 Ga0157379_10559794 Ga0157379_105597942 89
358 3300014968 Ga0157379_11086645 Ga0157379_110866451 89
359 3300014969 Ga0157376_10684177 Ga0157376_106841772 89
360 3300014969 Ga0157376_11090967 Ga0157376_110909672 89
361 3300014969 Ga0157376_12705866 Ga0157376_127058662 89
362 3300015262 Ga0182007_10156376 Ga0182007_101563762 89
363 3300015262 Ga0182007_10190265 Ga0182007_101902652 89
364 3300017792 Ga0163161_10097742 Ga0163161_100977422 89
365 3300017792 Ga0163161_10318403 Ga0163161_103184032 89
366 3300017792 Ga0163161_10386598 Ga0163161_103865981 89
367 3300017792 Ga0163161_10559011 Ga0163161_105590112 89
368 3300020070 Ga0206356_10591617 Ga0206356_105916172 89
369 3300020070 Ga0206356_11363650 Ga0206356_113636502 89
370 3300020078 Ga0206352_10433278 Ga0206352_104332782 89
371 3300020078 Ga0206352_11190364 Ga0206352_111903642 89
372 3300020081 Ga0206354_10869696 Ga0206354_108696961 89
373 3300020081 Ga0206354_11690617 Ga0206354_116906172 89
374 3300020082 Ga0206353_10388764 Ga0206353_103887642 89
375 3300021361 Ga0213872_10087989 Ga0213872_100879892 89
376 3300021384 Ga0213876_10035419 Ga0213876_100354192 89
377 3300022467 Ga0224712_10341888 Ga0224712_103418881 89
378 3300025245 Ga0207425_1068486 Ga0207425_10684862 89
379 3300025250 Ga0209026_1001443 Ga0209026_10014439 89
380 3300025261 Ga0209233_1009619 Ga0209233_10096193 89
381 3300025261 Ga0209233_1058476 Ga0209233_10584762 89
382 3300025263 Ga0209565_1001056 Ga0209565_10010565 89
383 3300025273 Ga0209673_1000796 Ga0209673_100079610 89
384 3300025291 Ga0209675_1027043 Ga0209675_10270432 89
385 3300025292 Ga0209676_1000115 Ga0209676_1000115195 89
386 3300025292 Ga0209676_1005229 Ga0209676_10052297 89
387 3300025295 Ga0209564_1007404 Ga0209564_10074049 89
388 3300025295 Ga0209564_1025111 Ga0209564_10251112 89
389 3300025297 Ga0209758_1000852 Ga0209758_100085217 89
390 3300025297 Ga0209758_1000917 Ga0209758_10009172 89
391 3300025297 Ga0209758_1042409 Ga0209758_10424091 89
392 3300025298 Ga0209050_1000053 Ga0209050_1000053224 89
393 3300025298 Ga0209050_1006111 Ga0209050_10061118 89
394 3300025298 Ga0209050_1023604 Ga0209050_10236043 89
395 3300025298 Ga0209050_1037824 Ga0209050_10378242 89
396 3300025299 Ga0209256_1005104 Ga0209256_10051042 89
397 3300025299 Ga0209256_1008353 Ga0209256_10083536 89
398 3300025299 Ga0209256_1041065 Ga0209256_10410652 89
399 3300025303 Ga0209051_1004762 Ga0209051_10047625 89
400 3300025304 Ga0209257_1000090 Ga0209257_1000090177 89
401 3300025304 Ga0209257_1000192 Ga0209257_1000192158 89
402 3300025304 Ga0209257_1000289 Ga0209257_100028952 89
403 3300025304 Ga0209257_1008306 Ga0209257_10083068 89
404 3300025304 Ga0209257_1056241 Ga0209257_10562412 89
405 3300025315 Ga0207697_10347190 Ga0207697_103471901 89
406 3300025885 Ga0207653_10004893 Ga0207653_100048933 89
407 3300025899 Ga0207642_10256363 Ga0207642_102563631 89
408 3300025901 Ga0207688_10442074 Ga0207688_104420741 89
409 3300025903 Ga0207680_10254725 Ga0207680_102547252 89
410 3300025903 Ga0207680_10720958 Ga0207680_107209582 89
411 3300025903 Ga0207680_10799975 Ga0207680_107999751 89
412 3300025903 Ga0207680_11277711 Ga0207680_112777112 89
413 3300025904 Ga0207647_10067199 Ga0207647_100671992 89
414 3300025905 Ga0207685_10000007 Ga0207685_1000000714 89
415 3300025907 Ga0207645_10110413 Ga0207645_101104132 89
416 3300025907 Ga0207645_10451294 Ga0207645_104512942 89
417 3300025908 Ga0207643_10273629 Ga0207643_102736292 89
418 3300025908 Ga0207643_10727418 Ga0207643_107274182 89
419 3300025909 Ga0207705_10121475 Ga0207705_101214752 89
420 3300025909 Ga0207705_10179685 Ga0207705_101796852 89
421 3300025909 Ga0207705_10410344 Ga0207705_104103441 89
422 3300025911 Ga0207654_10292661 Ga0207654_102926612 89
423 3300025911 Ga0207654_11201060 Ga0207654_112010601 89
424 3300025913 Ga0207695_10012980 Ga0207695_100129802 89
425 3300025913 Ga0207695_10512280 Ga0207695_105122802 89
426 3300025913 Ga0207695_10625698 Ga0207695_106256982 89
427 3300025913 Ga0207695_11694229 Ga0207695_116942291 89
428 3300025914 Ga0207671_10665651 Ga0207671_106656511 89
429 3300025914 Ga0207671_11087822 Ga0207671_110878222 89
430 3300025914 Ga0207671_11480527 Ga0207671_114805272 89
431 3300025917 Ga0207660_10001868 Ga0207660_1000186813 89
432 3300025917 Ga0207660_10885148 Ga0207660_108851481 89
433 3300025919 Ga0207657_10229918 Ga0207657_102299182 89
434 3300025919 Ga0207657_10420043 Ga0207657_104200431 89
435 3300025919 Ga0207657_10586210 Ga0207657_105862101 89
436 3300025920 Ga0207649_10860443 Ga0207649_108604431 89
437 3300025921 Ga0207652_10018573 Ga0207652_100185735 89
438 3300025921 Ga0207652_10581991 Ga0207652_105819912 89
439 3300025922 Ga0207646_10018114 Ga0207646_100181143 89
440 3300025922 Ga0207646_10053819 Ga0207646_100538192 89
441 3300025922 Ga0207646_10889578 Ga0207646_108895782 89
442 3300025923 Ga0207681_10178896 Ga0207681_101788962 89
443 3300025923 Ga0207681_10363105 Ga0207681_103631052 89
444 3300025923 Ga0207681_10750363 Ga0207681_107503632 89
445 3300025923 Ga0207681_11102893 Ga0207681_111028931 89
446 3300025924 Ga0207694_10070351 Ga0207694_100703515 89
447 3300025924 Ga0207694_10121581 Ga0207694_101215812 89
448 3300025924 Ga0207694_10132540 Ga0207694_101325402 89
449 3300025924 Ga0207694_10334990 Ga0207694_103349902 89
450 3300025924 Ga0207694_10435777 Ga0207694_104357771 89
451 3300025924 Ga0207694_10465168 Ga0207694_104651682 89
452 3300025924 Ga0207694_11537780 Ga0207694_115377801 89
453 3300025926 Ga0207659_11061279 Ga0207659_110612792 89
454 3300025926 Ga0207659_11904657 Ga0207659_119046572 89
455 3300025927 Ga0207687_10266575 Ga0207687_102665751 89
456 3300025927 Ga0207687_11239911 Ga0207687_112399111 89
457 3300025929 Ga0207664_10637238 Ga0207664_106372382 89
458 3300025932 Ga0207690_10008653 Ga0207690_100086532 89
459 3300025932 Ga0207690_10437058 Ga0207690_104370582 89
460 3300025932 Ga0207690_10604156 Ga0207690_106041562 89
461 3300025933 Ga0207706_10399141 Ga0207706_103991412 89
462 3300025933 Ga0207706_10597686 Ga0207706_105976862 89
463 3300025933 Ga0207706_10655792 Ga0207706_106557922 89
464 3300025933 Ga0207706_10891251 Ga0207706_108912511 89
465 3300025934 Ga0207686_10141220 Ga0207686_101412202 89
466 3300025934 Ga0207686_10306742 Ga0207686_103067421 89
467 3300025935 Ga0207709_10098021 Ga0207709_100980212 89
468 3300025935 Ga0207709_10239000 Ga0207709_102390002 89
469 3300025935 Ga0207709_11741474 Ga0207709_117414741 89
470 3300025936 Ga0207670_10286478 Ga0207670_102864782 89
471 3300025937 Ga0207669_10283465 Ga0207669_102834652 89
472 3300025937 Ga0207669_10910644 Ga0207669_109106442 89
473 3300025938 Ga0207704_10000526 Ga0207704_1000052613 89
474 3300025938 Ga0207704_10532964 Ga0207704_105329642 89
475 3300025939 Ga0207665_10800427 Ga0207665_108004272 89
476 3300025940 Ga0207691_10475940 Ga0207691_104759401 89
477 3300025940 Ga0207691_10570589 Ga0207691_105705893 89
478 3300025940 Ga0207691_11245807 Ga0207691_112458071 89
479 3300025941 Ga0207711_10894150 Ga0207711_108941502 89
480 3300025941 Ga0207711_11093589 Ga0207711_110935892 89
481 3300025941 Ga0207711_11242393 Ga0207711_112423931 89
482 3300025941 Ga0207711_11252161 Ga0207711_112521611 89
483 3300025941 Ga0207711_11938465 Ga0207711_119384652 89
484 3300025942 Ga0207689_10031246 Ga0207689_100312462 89
485 3300025942 Ga0207689_10034906 Ga0207689_100349061 89
486 3300025942 Ga0207689_10203962 Ga0207689_102039623 89
487 3300025942 Ga0207689_10275634 Ga0207689_102756342 89
488 3300025942 Ga0207689_10293373 Ga0207689_102933731 89
489 3300025942 Ga0207689_11207673 Ga0207689_112076731 89
490 3300025944 Ga0207661_10639726 Ga0207661_106397262 89
491 3300025945 Ga0207679_11146309 Ga0207679_111463091 89
492 3300025945 Ga0207679_11281073 Ga0207679_112810732 89
493 3300025945 Ga0207679_12152243 Ga0207679_121522431 89
494 3300025949 Ga0207667_10111601 Ga0207667_101116012 89
495 3300025960 Ga0207651_10717091 Ga0207651_107170911 89
496 3300025961 Ga0207712_10014689 Ga0207712_100146893 89
497 3300025961 Ga0207712_11096766 Ga0207712_110967662 89
498 3300025961 Ga0207712_11275969 Ga0207712_112759692 89
499 3300025961 Ga0207712_11309245 Ga0207712_113092451 89
500 3300025961 Ga0207712_11882620 Ga0207712_118826201 89
501 3300025972 Ga0207668_10004082 Ga0207668_100040828 89
502 3300025972 Ga0207668_10206733 Ga0207668_102067332 89
503 3300025972 Ga0207668_10391180 Ga0207668_103911802 89
504 3300025972 Ga0207668_10432829 Ga0207668_104328292 89
505 3300025972 Ga0207668_10455330 Ga0207668_104553302 89
506 3300025972 Ga0207668_10462186 Ga0207668_104621862 89
507 3300025972 Ga0207668_11198233 Ga0207668_111982332 89
508 3300025972 Ga0207668_11481863 Ga0207668_114818631 89
509 3300025981 Ga0207640_10434293 Ga0207640_104342932 89
510 3300025981 Ga0207640_10590775 Ga0207640_105907752 89
511 3300025986 Ga0207658_10020434 Ga0207658_100204342 89
512 3300025986 Ga0207658_10184327 Ga0207658_101843272 89
513 3300025986 Ga0207658_10734851 Ga0207658_107348511 89
514 3300025986 Ga0207658_11294232 Ga0207658_112942321 89
515 3300025986 Ga0207658_11764600 Ga0207658_117646001 89
516 3300025986 Ga0207658_11925637 Ga0207658_119256371 89
517 3300026035 Ga0207703_10221324 Ga0207703_102213241 89
518 3300026035 Ga0207703_10981909 Ga0207703_109819092 89
519 3300026041 Ga0207639_10179798 Ga0207639_101797982 89
520 3300026041 Ga0207639_10885254 Ga0207639_108852542 89
521 3300026041 Ga0207639_10924747 Ga0207639_109247472 89
522 3300026067 Ga0207678_10025606 Ga0207678_100256062 89
523 3300026067 Ga0207678_10116681 Ga0207678_101166813 89
524 3300026067 Ga0207678_10292740 Ga0207678_102927402 89
525 3300026067 Ga0207678_10302026 Ga0207678_103020262 89
526 3300026067 Ga0207678_10744892 Ga0207678_107448922 89
527 3300026075 Ga0207708_10005606 Ga0207708_100056062 89
528 3300026075 Ga0207708_10837410 Ga0207708_108374101 89
529 3300026078 Ga0207702_10111519 Ga0207702_101115192 89
530 3300026088 Ga0207641_10510555 Ga0207641_105105552 89
531 3300026088 Ga0207641_10716011 Ga0207641_107160111 89
532 3300026089 Ga0207648_10633370 Ga0207648_106333702 89
533 3300026089 Ga0207648_11020786 Ga0207648_110207861 89
534 3300026095 Ga0207676_10012959 Ga0207676_100129593 89
535 3300026095 Ga0207676_12595028 Ga0207676_125950281 89
536 3300026116 Ga0207674_10008214 Ga0207674_100082142 89
537 3300026116 Ga0207674_10519528 Ga0207674_105195282 89
538 3300026116 Ga0207674_10806180 Ga0207674_108061802 89
539 3300026116 Ga0207674_12121831 Ga0207674_121218311 89
540 3300026118 Ga0207675_100021206 Ga0207675_1000212062 89
541 3300026118 Ga0207675_100104034 Ga0207675_1001040344 89
542 3300026118 Ga0207675_100172608 Ga0207675_1001726083 89
543 3300026118 Ga0207675_100731699 Ga0207675_1007316992 89
544 3300026118 Ga0207675_100922042 Ga0207675_1009220422 89
545 3300026118 Ga0207675_101139868 Ga0207675_1011398682 89
546 3300026121 Ga0207683_10406363 Ga0207683_104063632 89
547 3300026121 Ga0207683_10737911 Ga0207683_107379111 89
548 3300026121 Ga0207683_11404006 Ga0207683_114040061 89
549 3300027876 Ga0209974_10054151 Ga0209974_100541512 89
550 3300027876 Ga0209974_10205215 Ga0209974_102052151 89
551 3300027907 Ga0207428_10787379 Ga0207428_107873791 89
552 3300027907 Ga0207428_10949238 Ga0207428_109492381 89
553 3300028379 Ga0268266_10000003 Ga0268266_100000031300 89
554 3300028379 Ga0268266_10438449 Ga0268266_104384492 89
555 3300028379 Ga0268266_10523183 Ga0268266_105231832 89
556 3300028380 Ga0268265_10001206 Ga0268265_1000120611 89
557 3300028380 Ga0268265_10030635 Ga0268265_100306352 89
558 3300028380 Ga0268265_10181305 Ga0268265_101813052 89
559 3300028380 Ga0268265_10465008 Ga0268265_104650082 89
560 3300028380 Ga0268265_11007503 Ga0268265_110075032 89
561 3300028380 Ga0268265_11013431 Ga0268265_110134311 89
562 3300028380 Ga0268265_11195748 Ga0268265_111957481 89
563 3300028380 Ga0268265_12016065 Ga0268265_120160651 89
564 3300028381 Ga0268264_10010528 Ga0268264_100105283 89
565 3300028381 Ga0268264_10516616 Ga0268264_105166162 89
566 3300028381 Ga0268264_10831144 Ga0268264_108311442 89
567 3300028381 Ga0268264_10906226 Ga0268264_109062262 89
568 3300028556 Ga0265337_1230260 Ga0265337_12302602 89
569 3300028563 Ga0265319_1153311 Ga0265319_11533111 89
570 3300028573 Ga0265334_10117888 Ga0265334_101178882 89
571 3300028573 Ga0265334_10264357 Ga0265334_102643572 89
572 3300028786 Ga0307517_10003957 Ga0307517_100039573 89
573 3300028794 Ga0307515_10080475 Ga0307515_100804754 89
574 3300028794 Ga0307515_10185861 Ga0307515_101858612 89
575 3300028800 Ga0265338_10040090 Ga0265338_100400903 89
576 3300028800 Ga0265338_10075300 Ga0265338_100753002 89
577 3300028800 Ga0265338_10082066 Ga0265338_100820662 89
578 3300028800 Ga0265338_10115692 Ga0265338_101156923 89
579 3300028800 Ga0265338_10152366 Ga0265338_101523662 89
580 3300028800 Ga0265338_10166659 Ga0265338_101666592 89
581 3300028800 Ga0265338_10411884 Ga0265338_104118842 89
582 3300030745 Ga0316182_1185581 Ga0316182_11855812 89
583 3300031235 Ga0265330_10134721 Ga0265330_101347212 89
584 3300031240 Ga0265320_10475614 Ga0265320_104756142 89
585 3300031247 Ga0265340_10490190 Ga0265340_104901902 89
586 3300031250 Ga0265331_10231556 Ga0265331_102315562 89
587 3300031251 Ga0265327_10000280 Ga0265327_1000028084 89
588 3300031251 Ga0265327_10015047 Ga0265327_100150472 89
589 3300031251 Ga0265327_10037859 Ga0265327_100378591 89
590 3300031251 Ga0265327_10116595 Ga0265327_101165952 89
591 3300031251 Ga0265327_10210003 Ga0265327_102100031 89
592 3300031344 Ga0265316_10371290 Ga0265316_103712901 89
593 3300031456 Ga0307513_10000100 Ga0307513_1000010019 89
594 3300031456 Ga0307513_10003278 Ga0307513_100032782 89
595 3300031456 Ga0307513_10021100 Ga0307513_100211006 89
596 3300031456 Ga0307513_10147629 Ga0307513_101476294 89
597 3300031507 Ga0307509_10924051 Ga0307509_109240512 89
598 3300031548 Ga0307408_100241565 Ga0307408_1002415651 89
599 3300031548 Ga0307408_100296711 Ga0307408_1002967112 89
600 3300031548 Ga0307408_100317322 Ga0307408_1003173222 89
601 3300031548 Ga0307408_100523961 Ga0307408_1005239611 89
602 3300031548 Ga0307408_100898456 Ga0307408_1008984562 89
603 3300031548 Ga0307408_100964071 Ga0307408_1009640712 89
604 3300031548 Ga0307408_101207276 Ga0307408_1012072761 89
605 3300031649 Ga0307514_10221183 Ga0307514_102211832 89
606 3300031665 Ga0316575_10086787 Ga0316575_100867872 89
607 3300031691 Ga0316579_10408310 Ga0316579_104083101 89
608 3300031711 Ga0265314_10048088 Ga0265314_100480882 89
609 3300031712 Ga0265342_10086819 Ga0265342_100868191 89
610 3300031712 Ga0265342_10662092 Ga0265342_106620921 89
611 3300031727 Ga0316576_10036145 Ga0316576_100361453 89
612 3300031728 Ga0316578_10029717 Ga0316578_100297172 89
613 3300031730 Ga0307516_10149056 Ga0307516_101490562 89
614 3300031730 Ga0307516_10331378 Ga0307516_103313782 89
615 3300031731 Ga0307405_10190625 Ga0307405_101906252 89
616 3300031731 Ga0307405_10224645 Ga0307405_102246452 89
617 3300031731 Ga0307405_10690058 Ga0307405_106900582 89
618 3300031731 Ga0307405_10700499 Ga0307405_107004992 89
619 3300031731 Ga0307405_10768282 Ga0307405_107682822 89
620 3300031731 Ga0307405_10942159 Ga0307405_109421592 89
621 3300031731 Ga0307405_11976640 Ga0307405_119766401 89
622 3300031824 Ga0307413_10068704 Ga0307413_100687042 89
623 3300031824 Ga0307413_10142539 Ga0307413_101425391 89
624 3300031824 Ga0307413_10170593 Ga0307413_101705932 89
625 3300031824 Ga0307413_10212255 Ga0307413_102122552 89
626 3300031824 Ga0307413_10863716 Ga0307413_108637162 89
627 3300031824 Ga0307413_11493969 Ga0307413_114939692 89
628 3300031824 Ga0307413_11757938 Ga0307413_117579382 89
629 3300031852 Ga0307410_10002951 Ga0307410_100029512 89
630 3300031852 Ga0307410_11267018 Ga0307410_112670181 89
631 3300031852 Ga0307410_11475164 Ga0307410_114751642 89
632 3300031889 Ga0326468_10030048 Ga0326468_100300482 89
633 3300031901 Ga0307406_10038036 Ga0307406_100380364 89
634 3300031901 Ga0307406_10095517 Ga0307406_100955172 89
635 3300031901 Ga0307406_10178862 Ga0307406_101788622 89
636 3300031901 Ga0307406_10340933 Ga0307406_103409331 89
637 3300031901 Ga0307406_11391413 Ga0307406_113914132 89
638 3300031903 Ga0307407_10454387 Ga0307407_104543872 89
639 3300031911 Ga0307412_10004367 Ga0307412_100043677 89
640 3300031911 Ga0307412_10374182 Ga0307412_103741822 89
641 3300031911 Ga0307412_10380014 Ga0307412_103800142 89
642 3300031911 Ga0307412_10422691 Ga0307412_104226912 89
643 3300031911 Ga0307412_10666930 Ga0307412_106669303 89
644 3300031911 Ga0307412_10819596 Ga0307412_108195961 89
645 3300031911 Ga0307412_10939395 Ga0307412_109393952 89
646 3300031911 Ga0307412_11123106 Ga0307412_111231061 89
647 3300031995 Ga0307409_100179882 Ga0307409_1001798823 89
648 3300031995 Ga0307409_100561138 Ga0307409_1005611382 89
649 3300031995 Ga0307409_100725050 Ga0307409_1007250501 89
650 3300031995 Ga0307409_100864877 Ga0307409_1008648772 89
651 3300031995 Ga0307409_100964293 Ga0307409_1009642931 89
652 3300032002 Ga0307416_100037708 Ga0307416_1000377082 89
653 3300032002 Ga0307416_100129547 Ga0307416_1001295473 89
654 3300032002 Ga0307416_100189199 Ga0307416_1001891992 89
655 3300032002 Ga0307416_100389734 Ga0307416_1003897341 89
656 3300032002 Ga0307416_100433873 Ga0307416_1004338732 89
657 3300032002 Ga0307416_101105521 Ga0307416_1011055212 89
658 3300032002 Ga0307416_101145819 Ga0307416_1011458191 89
659 3300032002 Ga0307416_101417688 Ga0307416_1014176881 89
660 3300032002 Ga0307416_102097694 Ga0307416_1020976941 89
661 3300032002 Ga0307416_102174932 Ga0307416_1021749322 89
662 3300032002 Ga0307416_102233796 Ga0307416_1022337962 89
663 3300032002 Ga0307416_103820283 Ga0307416_1038202831 89
664 3300032004 Ga0307414_10031506 Ga0307414_100315062 89
665 3300032004 Ga0307414_10057750 Ga0307414_100577502 89
666 3300032004 Ga0307414_10238317 Ga0307414_102383172 89
667 3300032004 Ga0307414_10342927 Ga0307414_103429272 89
668 3300032004 Ga0307414_10350081 Ga0307414_103500812 89
669 3300032004 Ga0307414_11547615 Ga0307414_115476151 89
670 3300032004 Ga0307414_11575460 Ga0307414_115754602 89
671 3300032005 Ga0307411_10023874 Ga0307411_100238742 89
672 3300032005 Ga0307411_10044388 Ga0307411_100443882 89
673 3300032005 Ga0307411_10138312 Ga0307411_101383122 89
674 3300032005 Ga0307411_10660188 Ga0307411_106601882 89
675 3300032005 Ga0307411_10778024 Ga0307411_107780242 89
676 3300032126 Ga0307415_100006354 Ga0307415_1000063544 89
677 3300032126 Ga0307415_100718061 Ga0307415_1007180612 89
678 3300032126 Ga0307415_100854144 Ga0307415_1008541442 89
679 3300032126 Ga0307415_101117103 Ga0307415_1011171031 89
680 3300032126 Ga0307415_101178221 Ga0307415_1011782211 89
681 3300032126 Ga0307415_101354163 Ga0307415_1013541632 89
682 3300032126 Ga0307415_101442577 Ga0307415_1014425772 89
683 3300032133 Ga0316583_10303319 Ga0316583_103033192 89
684 3300032139 Ga0316580_10010145 Ga0316580_100101452 89
685 3300032168 Ga0316593_10313765 Ga0316593_103137651 89
686 3300033180 Ga0307510_10106393 Ga0307510_101063933 89
687 3300033180 Ga0307510_10337820 Ga0307510_103378202 89
688 3300033180 Ga0307510_10427982 Ga0307510_104279821 89
689 3300033180 Ga0307510_10574483 Ga0307510_105744831 89
690 3300033524 Ga0316592_1092784 Ga0316592_10927841 89
691 3300033528 Ga0316588_1084877 Ga0316588_10848773 89
692 3300033541 Ga0316596_1171711 Ga0316596_11717111 89
693 3300033541 Ga0316596_1227815 Ga0316596_12278151 89
694 3300034818 Ga0373950_0177590 Ga0373950_0177590_94_363 89
695 3300034957 Ga0373938_0108372 Ga0373938_0108372_282_551 89
696 3300035086 Ga0373934_0431957 Ga0373934_0431957_153_422 89
697 3300035111 Ga0373923_0100456 Ga0373923_0100456_666_935 89
698 3300035113 Ga0373936_0002108 Ga0373936_0002108_1208_1477 89
699 3300035113 Ga0373936_0135076 Ga0373936_0135076_280_549 89
700 3300035113 Ga0373936_0192601 Ga0373936_0192601_351_623 89
701 3300035115 Ga0373941_0120813 Ga0373941_0120813_88_357 89
702 3300035116 Ga0373945_0391798 Ga0373945_0391798_305_574 89
703 3300035117 Ga0373953_0123771 Ga0373953_0123771_525_794 89
704 3300035118 Ga0373954_0166710 Ga0373954_0166710_535_804 89
705 3300035119 Ga0373956_0469499 Ga0373956_0469499_29_298 89
706 3300035121 Ga0373960_0087008 Ga0373960_0087008_280_549 89
707 3300035170 Ga0373943_0576866 Ga0373943_0576866_13_282 89
708 3300035171 Ga0373946_0026220 Ga0373946_0026220_250_519 89
709 3300035172 Ga0373955_0031767 Ga0373955_0031767_1174_1443 89
710 3300035207 Ga0373942_0074927 Ga0373942_0074927_452_721 89
711 3300035242 Ga0373962_0319761 Ga0373962_0319761_42_311 89
712 3300035398 Ga0316574_0916766 Ga0316574_0916766_92_361 89
713 3300035410 Ga0373924_0251430 Ga0373924_0251430_367_636 89
714 3300035692 Ga0373935_0099848 Ga0373935_0099848_731_1000 89
715 3300035692 Ga0373935_0251127 Ga0373935_0251127_921_1190 89
716 3300035724 Ga0373933_0343972 Ga0373933_0343972_529_798 89
717 3300035724 Ga0373933_0360557 Ga0373933_0360557_275_544 89
718 3300035725 Ga0373947_0156168 Ga0373947_0156168_683_952 89
719 3300036401 Ga0373937_0134663 Ga0373937_0134663_1433_1702 89
720 3300036401 Ga0373937_0548289 Ga0373937_0548289_228_497 89
721 3300036401 Ga0373937_0917668 Ga0373937_0917668_96_365 89
722 3300037068 Ga0373925_0454625 Ga0373925_0454625_31_300 89
723 3300037312 Ga0395899_0172596 Ga0395899_0172596_741_1010 89
724 3300037312 Ga0395899_0858290 Ga0395899_0858290_210_479 89
725 3300037418 Ga0395900_0026092 Ga0395900_0026092_3278_3547 89
726 3300037418 Ga0395900_0132952 Ga0395900_0132952_532_801 89
727 3300037418 Ga0395900_0373927 Ga0395900_0373927_1077_1346 89
728 3300037418 Ga0395900_1083319 Ga0395900_1083319_148_417 89
729 3300037466 Ga0395898_0020586 Ga0395898_0020586_2597_2866 89
730 3300037471 Ga0395905_0058657 Ga0395905_0058657_1561_1830 89
731 3300037471 Ga0395905_0287381 Ga0395905_0287381_773_1042 89
732 3300037471 Ga0395905_0308378 Ga0395905_0308378_1053_1322 89
733 3300037471 Ga0395905_0598646 Ga0395905_0598646_113_382 89
734 3300037471 Ga0395905_1008775 Ga0395905_1008775_81_350 89
735 3300037471 Ga0395905_1668341 Ga0395905_1668341_236_505 89
736 3300038443 Ga0395901_0024541 Ga0395901_0024541_4016_4285 89
737 3300038443 Ga0395901_0094369 Ga0395901_0094369_1357_1638 89
738 3300038443 Ga0395901_1411864 Ga0395901_1411864_180_449 89
739 3300038443 Ga0395901_2079600 Ga0395901_2079600_233_502 89
740 3300039062 Ga0400483_129175 Ga0400483_129175_469_738 89
741 3300039437 Ga0436365_0165150 Ga0436365_0165150_2014_2283 89
742 3300039437 Ga0436365_0412280 Ga0436365_0412280_538_807 89
743 3300039437 Ga0436365_0792369 Ga0436365_0792369_645_914 89
744 3300039437 Ga0436365_1349511 Ga0436365_1349511_597_866 89
745 3300039437 Ga0436365_1353601 Ga0436365_1353601_137_406 89
746 3300039437 Ga0436365_1519503 Ga0436365_1519503_507_776 89
747 3300039438 Ga0436360_0031527 Ga0436360_0031527_332_601 89
748 3300039438 Ga0436360_0193881 Ga0436360_0193881_122_391 89
749 3300039438 Ga0436360_0802865 Ga0436360_0802865_16_285 89
750 3300039438 Ga0436360_1129668 Ga0436360_1129668_76_345 89
751 3300039447 Ga0436361_0553807 Ga0436361_0553807_16682_16951 89
752 3300039450 Ga0436363_0034667 Ga0436363_0034667_147_416 89
753 3300039450 Ga0436363_0167927 Ga0436363_0167927_362_631 89
754 3300039450 Ga0436363_0876492 Ga0436363_0876492_64_333 89
755 3300039450 Ga0436363_1250061 Ga0436363_1250061_289_558 89
756 3300041408 Ga0439453_0012409 Ga0439453_0012409_372_641 89
757 3300041410 Ga0439461_0123404 Ga0439461_0123404_72_341 89
758 3300041413 Ga0439465_0167723 Ga0439465_0167723_140_409 89
759 3300041441 Ga0451787_014158 Ga0451787_014158_444_713 89
760 3300041443 Ga0451789_0130043 Ga0451789_0130043_174_443 89
761 3300041444 Ga0451790_33734 Ga0451790_33734_27_296 89
762 3300041446 Ga0451794_09956 Ga0451794_09956_240_509 89
763 3300041451 Ga0451791_0986555 Ga0451791_0986555_248_517 89
764 3300041451 Ga0451791_1141798 Ga0451791_1141798_466_735 89
765 3300041452 Ga0451793_0143183 Ga0451793_0143183_129_398 89
766 3300041452 Ga0451793_1580084 Ga0451793_1580084_175_444 89
767 3300041453 Ga0451797_1241774 Ga0451797_1241774_253_522 89
768 3300041453 Ga0451797_1562136 Ga0451797_1562136_84_353 89
769 3300041455 Ga0451801_31341 Ga0451801_31341_177_446 89
770 3300041456 Ga0451795_0372914 Ga0451795_0372914_517_786 89
771 3300041459 Ga0451800_1087923 Ga0451800_1087923_49_318 89
772 3300041460 Ga0451802_0313528 Ga0451802_0313528_29_298 89
773 3300041460 Ga0451802_0427992 Ga0451802_0427992_292_561 89
774 3300041460 Ga0451802_0835340 Ga0451802_0835340_207_476 89
775 3300041461 Ga0451805_017743 Ga0451805_017743_308_577 89
776 3300041461 Ga0451805_019020 Ga0451805_019020_198_467 89
777 3300041461 Ga0451805_062075 Ga0451805_062075_257_526 89
778 3300041462 Ga0451806_199844 Ga0451806_199844_203_472 89
779 3300041463 Ga0451804_0300224 Ga0451804_0300224_442_711 89
780 3300041486 Ga0451807_1151417 Ga0451807_1151417_431_700 89
781 3300041486 Ga0451807_2363815 Ga0451807_2363815_64_333 89
782 3300041491 Ga0451833_0300335 Ga0451833_0300335_90_359 89
783 3300041492 Ga0451835_1223003 Ga0451835_1223003_264_533 89
784 3300041494 Ga0451837_1428663 Ga0451837_1428663_143_412 89
785 3300041496 Ga0451839_0946880 Ga0451839_0946880_271_540 89
786 3300041496 Ga0451839_1072371 Ga0451839_1072371_121_390 89
787 3300041501 Ga0451845_0522626 Ga0451845_0522626_28_297 89
788 3300041502 Ga0451846_32729 Ga0451846_32729_260_529 89
789 3300041503 Ga0451847_0632259 Ga0451847_0632259_307_576 89
790 3300041505 Ga0451849_0010923 Ga0451849_0010923_197_466 89
791 3300041506 Ga0451850_00416 Ga0451850_00416_16_285 89
792 3300041509 Ga0451843_1189529 Ga0451843_1189529_148_417 89
793 3300041511 Ga0451855_1262419 Ga0451855_1262419_343_612 89
794 3300041511 Ga0451855_1910206 Ga0451855_1910206_571_840 89
795 3300041512 Ga0451853_0633361 Ga0451853_0633361_394_663 89
796 3300041512 Ga0451853_1923124 Ga0451853_1923124_592_861 89
797 3300041512 Ga0451853_2561966 Ga0451853_2561966_468_737 89
798 3300041907 Ga0452268_42262 Ga0452268_42262_179_448 89
799 3300041999 Ga0439433_0111771 Ga0439433_0111771_385_654 89
800 3300041999 Ga0439433_0178550 Ga0439433_0178550_121_390 89
801 3300042001 Ga0439441_091096 Ga0439441_091096_103_372 89
802 3300042004 Ga0439445_0086061 Ga0439445_0086061_487_756 89
803 3300042012 Ga0439455_0195698 Ga0439455_0195698_38_307 89
804 3300042015 Ga0439462_0154359 Ga0439462_0154359_357_626 89
805 3300042125 Ga0450923_156787 Ga0450923_156787_160_429 89
806 3300042127 Ga0450890_037290 Ga0450890_037290_379_648 89
807 3300042156 Ga0439446_0029309 Ga0439446_0029309_605_874 89
808 3300042157 Ga0439458_0054448 Ga0439458_0054448_446_715 89
809 3300042438 Ga0439459_0003734 Ga0439459_0003734_1096_1365 89
810 3300042438 Ga0439459_0052395 Ga0439459_0052395_453_722 89
811 3300042876 Ga0451577_0000543 Ga0451577_0000543_2459_2728 89
812 3300044683 Ga0466965_0205372 Ga0466965_0205372_63_332 89
813 3300044712 Ga0453684_0000533 Ga0453684_0000533_55507_55776 89
814 3300044712 Ga0453684_0095700 Ga0453684_0095700_1368_1637 89
815 3300044901 Ga0466960_0214925 Ga0466960_0214925_467_736 89
816 3300046453 Ga0495627_001096 Ga0495627_001096_4345_4614 89
817 3300046457 Ga0495590_0001565 Ga0495590_0001565_8886_9155 89
818 3300046460 Ga0495638_0011692 Ga0495638_0011692_311_580 89
819 3300046460 Ga0495638_0097961 Ga0495638_0097961_1257_1526 89
820 3300046460 Ga0495638_0232966 Ga0495638_0232966_387_656 89
821 3300046460 Ga0495638_0308158 Ga0495638_0308158_270_539 89
822 3300046462 Ga0495651_0125469 Ga0495651_0125469_1261_1530 89
823 3300046462 Ga0495651_0425878 Ga0495651_0425878_246_515 89
824 3300046471 Ga0495650_0000468 Ga0495650_0000468_22706_22975 89
825 3300046471 Ga0495650_0134607 Ga0495650_0134607_486_755 89
826 3300046471 Ga0495650_0284709 Ga0495650_0284709_46_315 89
827 3300046472 Ga0495580_0627629 Ga0495580_0627629_114_383 89
828 3300046491 Ga0495584_0306137 Ga0495584_0306137_321_590 89
829 3300046506 Ga0495583_0000003 Ga0495583_0000003_432250_432519 89
830 3300046506 Ga0495583_0023513 Ga0495583_0023513_1329_1598 89
831 3300046507 Ga0495606_0016672 Ga0495606_0016672_4616_4885 89
832 3300046507 Ga0495606_0038274 Ga0495606_0038274_2881_3150 89
833 3300046511 Ga0495608_0195054 Ga0495608_0195054_572_841 89
834 3300046512 Ga0495610_0048755 Ga0495610_0048755_1678_1947 89
835 3300046513 Ga0495616_0006961 Ga0495616_0006961_1446_1715 89
836 3300046515 Ga0495620_0141352 Ga0495620_0141352_632_901 89
837 3300046515 Ga0495620_0149407 Ga0495620_0149407_463_732 89
838 3300046519 Ga0495632_0009729 Ga0495632_0009729_385_654 89
839 3300046520 Ga0495637_0026076 Ga0495637_0026076_22_291 89
840 3300046520 Ga0495637_0036307 Ga0495637_0036307_773_1042 89
841 3300046522 Ga0495643_0030755 Ga0495643_0030755_1440_1709 89
842 3300046522 Ga0495643_0149626 Ga0495643_0149626_55_324 89
843 3300046524 Ga0495648_0010816 Ga0495648_0010816_5071_5340 89
844 3300046524 Ga0495648_0377078 Ga0495648_0377078_21_290 89
845 3300046525 Ga0495663_0028986 Ga0495663_0028986_855_1124 89
846 3300046525 Ga0495663_0390686 Ga0495663_0390686_70_339 89
847 3300046529 Ga0495652_0263381 Ga0495652_0263381_698_967 89
848 3300046530 Ga0495654_0000199 Ga0495654_0000199_40592_40861 89
849 3300046533 Ga0495640_0302089 Ga0495640_0302089_443_712 89
850 3300046536 Ga0495587_0217497 Ga0495587_0217497_22_303 89
851 3300046536 Ga0495587_0489303 Ga0495587_0489303_311_580 89
852 3300046538 Ga0495609_0212133 Ga0495609_0212133_442_711 89
853 3300046538 Ga0495609_0260227 Ga0495609_0260227_49_318 89
854 3300046542 Ga0495597_0057218 Ga0495597_0057218_1227_1496 89
855 3300046542 Ga0495597_0394148 Ga0495597_0394148_206_475 89
856 3300046543 Ga0495645_0313309 Ga0495645_0313309_422_691 89
857 3300046558 Ga0495633_0003428 Ga0495633_0003428_4494_4763 89
858 3300046558 Ga0495633_0051134 Ga0495633_0051134_921_1190 89
859 3300046559 Ga0495667_0118985 Ga0495667_0118985_818_1087 89
860 3300046615 Ga0495656_0191352 Ga0495656_0191352_390_659 89
861 3300046615 Ga0495656_0496274 Ga0495656_0496274_99_368 89
862 3300046616 Ga0495668_0131932 Ga0495668_0131932_730_999 89
863 3300046616 Ga0495668_0151790 Ga0495668_0151790_570_839 89
864 3300046616 Ga0495668_0383898 Ga0495668_0383898_244_513 89
865 3300046660 Ga0495625_0000152 Ga0495625_0000152_9850_10119 89
866 3300046660 Ga0495625_0189527 Ga0495625_0189527_305_574 89
867 3300046660 Ga0495625_0285071 Ga0495625_0285071_430_699 89
868 3300046663 Ga0495635_0263648 Ga0495635_0263648_300_569 89
869 3300046664 Ga0495659_0097393 Ga0495659_0097393_239_508 89
870 3300046675 Ga0495657_0160607 Ga0495657_0160607_749_1018 89
871 3300046675 Ga0495657_0409541 Ga0495657_0409541_448_717 89
872 3300046689 Ga0495613_0000049 Ga0495613_0000049_68948_69217 89
873 3300046691 Ga0495670_0154356 Ga0495670_0154356_20_289 89
874 3300046691 Ga0495670_0279535 Ga0495670_0279535_24_293 89
875 3300046692 Ga0495671_0363605 Ga0495671_0363605_400_669 89
876 3300046692 Ga0495671_0628238 Ga0495671_0628238_130_399 89
877 3300046694 Ga0495649_0000048 Ga0495649_0000048_571_840 89
878 3300046794 Ga0495589_0013748 Ga0495589_0013748_3636_3905 89
879 3300046809 Ga0495600_0452554 Ga0495600_0452554_367_636 89
880 3300046810 Ga0495660_0008301 Ga0495660_0008301_1261_1530 89
881 3300046810 Ga0495660_0126268 Ga0495660_0126268_997_1266 89
882 3300047317 Ga0495604_0542713 Ga0495604_0542713_307_576 89
883 3300047318 Ga0495636_0303475 Ga0495636_0303475_54_323 89
884 3300047319 Ga0495674_0825467 Ga0495674_0825467_183_452 89
885 3300047319 Ga0495674_1328424 Ga0495674_1328424_224_493 89
886 3300047320 Ga0495672_0002318 Ga0495672_0002318_9805_10074 89
887 3300047320 Ga0495672_0014969 Ga0495672_0014969_4974_5243 89
888 3300047320 Ga0495672_0028725 Ga0495672_0028725_2437_2706 89
889 3300047444 Ga0495675_0482412 Ga0495675_0482412_410_679 89
890 3300047444 Ga0495675_0490702 Ga0495675_0490702_111_380 89
891 3300047445 Ga0495677_0315135 Ga0495677_0315135_76_345 89
892 3300047446 Ga0495679_004598 Ga0495679_004598_5972_6241 89
893 3300047469 Ga0495673_0009616 Ga0495673_0009616_4672_4941 89
894 3300047469 Ga0495673_0037613 Ga0495673_0037613_1661_1930 89
895 3300047469 Ga0495673_0248201 Ga0495673_0248201_362_631 89
896 3300047470 Ga0495681_0058372 Ga0495681_0058372_993_1262 89
897 3300047472 Ga0495686_0009578 Ga0495686_0009578_2134_2403 89
898 3300047472 Ga0495686_0045341 Ga0495686_0045341_705_974 89
899 3300047472 Ga0495686_0056387 Ga0495686_0056387_1506_1775 89
900 3300047472 Ga0495686_0118768 Ga0495686_0118768_316_585 89
901 3300048088 Ga0495602_0258751 Ga0495602_0258751_684_953 89
902 3300048903 Ga0496100_0319614 Ga0496100_0319614_466_735 89
903 3300048903 Ga0496100_0406379 Ga0496100_0406379_372_641 89
904 3300048903 Ga0496100_0881621 Ga0496100_0881621_326_595 89
905 3300048903 Ga0496100_1385334 Ga0496100_1385334_54_335 89
906 3300048903 Ga0496100_1424489 Ga0496100_1424489_172_441 89
907 3300048904 Ga0496101_0220741 Ga0496101_0220741_690_959 89
908 3300048904 Ga0496101_0508344 Ga0496101_0508344_285_554 89
909 3300048904 Ga0496101_1517506 Ga0496101_1517506_25_294 89
910 3300048905 Ga0496102_0003769 Ga0496102_0003769_7032_7301 89
911 3300048905 Ga0496102_0047197 Ga0496102_0047197_370_639 89
912 3300048905 Ga0496102_0091024 Ga0496102_0091024_2445_2726 89
913 3300048905 Ga0496102_0162361 Ga0496102_0162361_1078_1347 89
914 3300048905 Ga0496102_0519863 Ga0496102_0519863_190_459 89
915 3300048905 Ga0496102_0606835 Ga0496102_0606835_570_839 89
916 3300048906 Ga0496103_0015027 Ga0496103_0015027_4108_4377 89
917 3300048906 Ga0496103_0289702 Ga0496103_0289702_528_797 89
918 3300048907 Ga0496104_0332646 Ga0496104_0332646_415_684 89
919 3300048907 Ga0496104_0549034 Ga0496104_0549034_765_1034 89
920 3300048908 Ga0496105_0074257 Ga0496105_0074257_1331_1600 89
921 3300048909 Ga0496106_0002791 Ga0496106_0002791_3920_4189 89
922 3300048909 Ga0496106_0004326 Ga0496106_0004326_4340_4609 89
923 3300048909 Ga0496106_0147677 Ga0496106_0147677_1301_1570 89
924 3300048909 Ga0496106_0153849 Ga0496106_0153849_228_497 89
925 3300048909 Ga0496106_0240050 Ga0496106_0240050_928_1197 89
926 3300048910 Ga0496107_0002891 Ga0496107_0002891_5101_5370 89
927 3300048910 Ga0496107_0006827 Ga0496107_0006827_2898_3167 89
928 3300048910 Ga0496107_0240226 Ga0496107_0240226_484_765 89
929 3300048910 Ga0496107_0352618 Ga0496107_0352618_729_998 89
930 3300048910 Ga0496107_0624295 Ga0496107_0624295_18_287 89
931 3300048912 Ga0496109_0130840 Ga0496109_0130840_1937_2206 89
932 3300048912 Ga0496109_0165656 Ga0496109_0165656_363_632 89
933 3300048912 Ga0496109_0512819 Ga0496109_0512819_493_762 89
934 3300048912 Ga0496109_0859087 Ga0496109_0859087_261_530 89
935 3300048913 Ga0496110_0220479 Ga0496110_0220479_924_1193 89
936 3300048913 Ga0496110_0972722 Ga0496110_0972722_252_521 89
937 3300048913 Ga0496110_1323451 Ga0496110_1323451_83_352 89
938 3300048915 Ga0496112_0042175 Ga0496112_0042175_2875_3144 89
939 3300048915 Ga0496112_0300801 Ga0496112_0300801_804_1073 89
940 3300048915 Ga0496112_1451187 Ga0496112_1451187_264_533 89
941 3300048916 Ga0496113_0257229 Ga0496113_0257229_910_1179 89
942 3300048916 Ga0496113_1373480 Ga0496113_1373480_53_322 89
943 3300048917 Ga0496114_0267935 Ga0496114_0267935_413_682 89
944 3300048917 Ga0496114_0406893 Ga0496114_0406893_820_1089 89
945 3300048917 Ga0496114_0799512 Ga0496114_0799512_113_382 89
946 3300048917 Ga0496114_1320444 Ga0496114_1320444_303_572 89
947 3300048918 Ga0496115_0001882 Ga0496115_0001882_5389_5658 89
948 3300048918 Ga0496115_0012290 Ga0496115_0012290_1643_1912 89
949 3300048918 Ga0496115_0018363 Ga0496115_0018363_3522_3791 89
950 3300048918 Ga0496115_0091520 Ga0496115_0091520_870_1139 89
951 3300048918 Ga0496115_0125028 Ga0496115_0125028_1041_1310 89
952 3300048918 Ga0496115_0142589 Ga0496115_0142589_101_370 89
953 3300048919 Ga0496116_0034074 Ga0496116_0034074_222_491 89
954 3300048924 Ga0496121_0006932 Ga0496121_0006932_451_720 89
955 3300048924 Ga0496121_0025079 Ga0496121_0025079_4828_5097 89
956 3300048924 Ga0496121_0218763 Ga0496121_0218763_702_971 89
957 3300048924 Ga0496121_0312755 Ga0496121_0312755_555_824 89
958 3300048925 Ga0496122_0019200 Ga0496122_0019200_848_1117 89
959 3300048926 Ga0496123_0003231 Ga0496123_0003231_4747_5016 89
960 3300048927 Ga0496124_0235773 Ga0496124_0235773_402_671 89
961 3300048927 Ga0496124_0377040 Ga0496124_0377040_400_669 89
962 3300048927 Ga0496124_0388020 Ga0496124_0388020_115_384 89
963 3300048927 Ga0496124_0605547 Ga0496124_0605547_187_456 89
964 3300048928 Ga0496125_0005019 Ga0496125_0005019_13347_13616 89
965 3300048928 Ga0496125_0238456 Ga0496125_0238456_101_370 89
966 3300048929 Ga0496126_0020747 Ga0496126_0020747_3119_3388 89
967 3300048929 Ga0496126_0281280 Ga0496126_0281280_490_759 89
968 3300048929 Ga0496126_0695042 Ga0496126_0695042_308_577 89
969 3300048929 Ga0496126_1333487 Ga0496126_1333487_182_451 89
970 3300049127 Ga0501306_038842 Ga0501306_038842_258_527 89
971 3300049127 Ga0501306_055739 Ga0501306_055739_119_388 89
972 3300049127 Ga0501306_071972 Ga0501306_071972_76_345 89
973 3300049128 Ga0501308_002052 Ga0501308_002052_1194_1463 89
974 3300049128 Ga0501308_067183 Ga0501308_067183_255_524 89
975 3300049129 Ga0501309_055897 Ga0501309_055897_77_346 89
976 3300049160 Ga0501304_016396 Ga0501304_016396_175_444 89
977 3300049162 Ga0501307_036794 Ga0501307_036794_180_449 89
978 3300049514 Ga0501291_110920 Ga0501291_110920_298_567 89
979 3300049521 Ga0501298_043813 Ga0501298_043813_580_849 89
980 3300049527 Ga0501311_026657 Ga0501311_026657_289_558 89
981 3300049527 Ga0501311_071973 Ga0501311_071973_253_522 89
982 3300049528 Ga0501312_101100 Ga0501312_101100_253_522 89
983 3300049529 Ga0501313_044659 Ga0501313_044659_42_311 89
984 3300049529 Ga0501313_060026 Ga0501313_060026_15_284 89
985 3300049530 Ga0501314_034091 Ga0501314_034091_67_336 89
986 3300049531 Ga0501315_038122 Ga0501315_038122_254_523 89
987 3300049533 Ga0501317_069869 Ga0501317_069869_259_528 89
988 3300049535 Ga0501319_009655 Ga0501319_009655_198_467 89
989 3300049535 Ga0501319_019549 Ga0501319_019549_73_342 89
990 3300049536 Ga0501320_010289 Ga0501320_010289_607_876 89
991 3300049536 Ga0501320_054744 Ga0501320_054744_193_462 89
992 3300049537 Ga0501321_030466 Ga0501321_030466_220_489 89
993 3300049539 Ga0501323_020971 Ga0501323_020971_264_533 89
994 3300049540 Ga0501324_023178 Ga0501324_023178_253_522 89
995 3300049541 Ga0501325_031814 Ga0501325_031814_191_460 89
996 3300049542 Ga0501326_10819 Ga0501326_10819_32_301 89
997 3300049548 Ga0501332_13471 Ga0501332_13471_246_515 89
998 3300049551 Ga0501335_035084 Ga0501335_035084_62_331 89
999 3300049568 Ga0501031_0943306 Ga0501031_0943306_116_385 89
1000 3300049569 Ga0501032_0357693 Ga0501032_0357693_628_897 89
1001 3300049569 Ga0501032_0629437 Ga0501032_0629437_98_379 89
1002 3300049569 Ga0501032_0841737 Ga0501032_0841737_29_298 89
1003 3300049570 Ga0501033_0161773 Ga0501033_0161773_880_1149 89
1004 3300049571 Ga0501034_0000369 Ga0501034_0000369_36946_37215 89
1005 3300049571 Ga0501034_0276891 Ga0501034_0276891_1036_1305 89
1006 3300049572 Ga0501036_0073757 Ga0501036_0073757_955_1224 89
1007 3300049572 Ga0501036_1154324 Ga0501036_1154324_132_401 89
1008 3300049572 Ga0501036_1253622 Ga0501036_1253622_66_335 89
1009 3300049572 Ga0501036_1414920 Ga0501036_1414920_206_541 89
1010 3300049572 Ga0501036_1689706 Ga0501036_1689706_29_298 89
1011 3300049574 Ga0501038_0668622 Ga0501038_0668622_348_617 89
1012 3300049575 Ga0501039_0083327 Ga0501039_0083327_1554_1823 89
1013 3300049577 Ga0501041_0036376 Ga0501041_0036376_471_740 89
1014 3300049578 Ga0501042_0421174 Ga0501042_0421174_515_784 89
1015 3300049578 Ga0501042_1045035 Ga0501042_1045035_232_501 89
1016 3300049579 Ga0501043_0958466 Ga0501043_0958466_183_452 89
1017 3300049580 Ga0501046_0011384 Ga0501046_0011384_7017_7286 89
1018 3300049580 Ga0501046_0241656 Ga0501046_0241656_244_513 89
1019 3300049580 Ga0501046_0393858 Ga0501046_0393858_339_608 89
1020 3300049581 Ga0501047_0265028 Ga0501047_0265028_705_974 89
1021 3300049581 Ga0501047_0313133 Ga0501047_0313133_56_325 89
1022 3300049581 Ga0501047_0577604 Ga0501047_0577604_207_476 89
1023 3300049581 Ga0501047_0713866 Ga0501047_0713866_11_280 89
1024 3300049581 Ga0501047_0881233 Ga0501047_0881233_424_693 89
1025 3300049581 Ga0501047_0908151 Ga0501047_0908151_263_532 89
1026 3300049581 Ga0501047_0939092 Ga0501047_0939092_364_633 89
1027 3300049581 Ga0501047_1267342 Ga0501047_1267342_141_410 89
1028 3300049582 Ga0501048_0053847 Ga0501048_0053847_1672_1941 89
1029 3300049582 Ga0501048_0868282 Ga0501048_0868282_177_446 89
1030 3300049583 Ga0501067_0010065 Ga0501067_0010065_2857_3126 89
1031 3300049583 Ga0501067_0072493 Ga0501067_0072493_278_547 89
1032 3300049583 Ga0501067_0232490 Ga0501067_0232490_144_413 89
1033 3300049583 Ga0501067_0825746 Ga0501067_0825746_44_313 89
1034 3300049584 Ga0501068_0527927 Ga0501068_0527927_214_483 89
1035 3300049584 Ga0501068_0857022 Ga0501068_0857022_277_546 89
1036 3300049585 Ga0501069_0168755 Ga0501069_0168755_859_1128 89
1037 3300049586 Ga0501070_0711096 Ga0501070_0711096_36_305 89
1038 3300049587 Ga0501071_0103754 Ga0501071_0103754_973_1242 89
1039 3300049588 Ga0501072_0130901 Ga0501072_0130901_354_623 89
1040 3300049588 Ga0501072_0593658 Ga0501072_0593658_95_364 89
1041 3300049589 Ga0501073_0037252 Ga0501073_0037252_549_818 89
1042 3300049589 Ga0501073_0469775 Ga0501073_0469775_317_586 89
1043 3300049589 Ga0501073_0718394 Ga0501073_0718394_364_633 89
1044 3300049590 Ga0501074_0063730 Ga0501074_0063730_447_716 89
1045 3300049590 Ga0501074_0084489 Ga0501074_0084489_1355_1624 89
1046 3300049590 Ga0501074_0601244 Ga0501074_0601244_49_318 89
1047 3300049591 Ga0501075_0063296 Ga0501075_0063296_687_956 89
1048 3300049592 Ga0501076_0012239 Ga0501076_0012239_3313_3582 89
1049 3300049592 Ga0501076_0186261 Ga0501076_0186261_1394_1663 89
1050 3300049592 Ga0501076_1131097 Ga0501076_1131097_310_579 89
1051 3300049592 Ga0501076_1270391 Ga0501076_1270391_26_295 89
1052 3300049592 Ga0501076_1780405 Ga0501076_1780405_19_288 89
1053 3300049593 Ga0501077_0046071 Ga0501077_0046071_68_337 89
1054 3300049593 Ga0501077_0060416 Ga0501077_0060416_107_376 89
1055 3300049593 Ga0501077_1110582 Ga0501077_1110582_137_406 89
1056 3300049671 Ga0501238_000783 Ga0501238_000783_2538_2807 89
1057 3300049683 Ga0501253_044110 Ga0501253_044110_165_434 89
1058 3300049741 Ga0501079_0015930 Ga0501079_0015930_3791_4060 89
1059 3300049741 Ga0501079_0060588 Ga0501079_0060588_801_1070 89
1060 3300049741 Ga0501079_0658667 Ga0501079_0658667_101_370 89
1061 3300049742 Ga0501080_0029716 Ga0501080_0029716_3987_4256 89
1062 3300049742 Ga0501080_0053127 Ga0501080_0053127_2200_2469 89
1063 3300049742 Ga0501080_0149278 Ga0501080_0149278_18_287 89
1064 3300049743 Ga0501081_0059167 Ga0501081_0059167_1476_1745 89
1065 3300049743 Ga0501081_0060850 Ga0501081_0060850_2159_2428 89
1066 3300049743 Ga0501081_0115554 Ga0501081_0115554_1525_1794 89
1067 3300049743 Ga0501081_0309641 Ga0501081_0309641_169_438 89
1068 3300049744 Ga0501083_0047578 Ga0501083_0047578_786_1055 89
1069 3300049744 Ga0501083_0274941 Ga0501083_0274941_501_881 89
1070 3300049744 Ga0501083_0557753 Ga0501083_0557753_447_716 89
1071 3300049744 Ga0501083_0685066 Ga0501083_0685066_304_573 89
1072 3300049765 Ga0501268_078994 Ga0501268_078994_91_360 89
1073 3300049776 Ga0501280_075783 Ga0501280_075783_190_459 89
1074 3300049822 Ga0501035_0212703 Ga0501035_0212703_540_809 89
1075 3300049822 Ga0501035_0923031 Ga0501035_0923031_41_310 89
1076 3300049823 Ga0501044_0003898 Ga0501044_0003898_6132_6401 89
1077 3300049823 Ga0501044_0330910 Ga0501044_0330910_630_899 89
1078 3300049823 Ga0501044_0365272 Ga0501044_0365272_255_536 89
1079 3300049823 Ga0501044_1204031 Ga0501044_1204031_225_494 89
1080 3300049823 Ga0501044_1471192 Ga0501044_1471192_164_433 89
1081 3300049824 Ga0501045_0068163 Ga0501045_0068163_115_384 89
1082 3300049824 Ga0501045_0754348 Ga0501045_0754348_163_432 89
1083 3300050489 nmdc:mga03683_241070_c1 nmdc:mga03683_241070_c1_68_337 89
1084 3300050489 nmdc:mga03683_406440_c1 nmdc:mga03683_406440_c1_209_478 89
1085 3300050490 nmdc:mga03n38_417799_c1 nmdc:mga03n38_417799_c1_194_463 89
1086 3300050490 nmdc:mga03n38_943733_c1 nmdc:mga03n38_943733_c1_224_493 89
1087 3300050491 nmdc:mga00v17_1034173_c1 nmdc:mga00v17_1034173_c1_175_444 89
1088 3300050491 nmdc:mga00v17_266670_c1 nmdc:mga00v17_266670_c1_403_672 89
1089 3300050491 nmdc:mga00v17_505960_c1 nmdc:mga00v17_505960_c1_125_403 89
1090 3300050491 nmdc:mga00v17_542613_c1 nmdc:mga00v17_542613_c1_213_482 89
1091 3300050491 nmdc:mga00v17_966720_c1 nmdc:mga00v17_966720_c1_157_426 89
1092 3300050493 nmdc:mga0k408_192269_c1 nmdc:mga0k408_192269_c1_612_881 89
1093 3300050493 nmdc:mga0k408_324476_c1 nmdc:mga0k408_324476_c1_241_510 89
1094 3300050493 nmdc:mga0k408_407633_c1 nmdc:mga0k408_407633_c1_353_622 89
1095 3300050493 nmdc:mga0k408_48942_c1 nmdc:mga0k408_48942_c1_1395_1664 89
1096 3300050493 nmdc:mga0k408_742890_c1 nmdc:mga0k408_742890_c1_48_317 89
1097 3300050496 nmdc:mga07m45_21235_c1 nmdc:mga07m45_21235_c1_326_595 89
1098 3300050496 nmdc:mga07m45_343552_c1 nmdc:mga07m45_343552_c1_331_600 89
1099 3300050496 nmdc:mga07m45_357764_c1 nmdc:mga07m45_357764_c1_67_336 89
1100 3300050507 nmdc:mga05p37_122797_c1 nmdc:mga05p37_122797_c1_1286_1555 89
1101 3300050507 nmdc:mga05p37_1467144_c1 nmdc:mga05p37_1467144_c1_167_436 89
1102 3300050507 nmdc:mga05p37_1848956_c1 nmdc:mga05p37_1848956_c1_301_570 89
1103 3300050507 nmdc:mga05p37_588696_c1 nmdc:mga05p37_588696_c1_632_901 89
1104 3300050507 nmdc:mga05p37_71314_c1 nmdc:mga05p37_71314_c1_243_512 89
1105 3300050507 nmdc:mga05p37_72758_c1 nmdc:mga05p37_72758_c1_1736_2005 89
1106 3300050508 nmdc:mga09592_158152_c1 nmdc:mga09592_158152_c1_952_1221 89
1107 3300050509 nmdc:mga0qj67_12510_c2 nmdc:mga0qj67_12510_c2_3384_3653 89
1108 3300050509 nmdc:mga0qj67_65221_c1 nmdc:mga0qj67_65221_c1_1295_1564 89
1109 3300050510 nmdc:mga06r32_40836_c1 nmdc:mga06r32_40836_c1_1555_1824 89
1110 3300050510 nmdc:mga06r32_48597_c1 nmdc:mga06r32_48597_c1_783_1052 89
1111 3300050510 nmdc:mga06r32_790726_c1 nmdc:mga06r32_790726_c1_277_546 89
1112 3300050511 nmdc:mga08y16_1051708_c1 nmdc:mga08y16_1051708_c1_181_450 89
1113 3300050511 nmdc:mga08y16_46873_c1 nmdc:mga08y16_46873_c1_1534_1803 89
1114 3300050512 nmdc:mga0n895_147281_c1 nmdc:mga0n895_147281_c1_804_1073 89
1115 3300050513 nmdc:mga0rr50_431955_c1 nmdc:mga0rr50_431955_c1_556_825 89
1116 3300050514 nmdc:mga08x19_1344177_c1 nmdc:mga08x19_1344177_c1_21_290 89
1117 3300050515 nmdc:mga0a205_90841_c1 nmdc:mga0a205_90841_c1_2191_2460 89
1118 3300050516 nmdc:mga0sz30_55512_c1 nmdc:mga0sz30_55512_c1_484_753 89
1119 3300053077 Ga0495601_0318698 Ga0495601_0318698_151_420 89
1120 3300053084 Ga0495595_0041871 Ga0495595_0041871_1135_1404 89
1121 3300053085 Ga0495619_0789782 Ga0495619_0789782_154_423 89
1122 3300053086 Ga0500578_0000015 Ga0500578_0000015_107390_107659 89
1123 3300053087 Ga0500643_000968 Ga0500643_000968_5683_5952 89
1124 3300053087 Ga0500643_001537 Ga0500643_001537_5140_5409 89
1125 3300053087 Ga0500643_004694 Ga0500643_004694_836_1105 89
1126 3300053087 Ga0500643_027817 Ga0500643_027817_698_967 89
1127 3300053088 Ga0500644_0000058 Ga0500644_0000058_64208_64477 89
1128 3300053088 Ga0500644_0001545 Ga0500644_0001545_463_732 89
1129 3300053091 Ga0500647_0006857 Ga0500647_0006857_4154_4423 89
1130 3300053093 Ga0500651_0004155 Ga0500651_0004155_5351_5620 89
1131 3300053093 Ga0500651_0107595 Ga0500651_0107595_166_435 89
1132 3300053096 Ga0500641_0000654 Ga0500641_0000654_8770_9039 89
1133 3300053096 Ga0500641_0002664 Ga0500641_0002664_1871_2140 89
1134 3300053096 Ga0500641_0031491 Ga0500641_0031491_845_1114 89
1135 3300053096 Ga0500641_0076092 Ga0500641_0076092_666_935 89
1136 3300053098 Ga0500650_0170722 Ga0500650_0170722_242_511 89
1137 3300053098 Ga0500650_0203529 Ga0500650_0203529_411_680 89
1138 3300053098 Ga0500650_0504894 Ga0500650_0504894_67_336 89
1139 3300053103 Ga0500555_005991 Ga0500555_005991_1573_1842 89
1140 3300053103 Ga0500555_051950 Ga0500555_051950_594_863 89
1141 3300053104 Ga0500556_0003063 Ga0500556_0003063_2692_2961 89
1142 3300053105 Ga0500557_184260 Ga0500557_184260_312_581 89
1143 3300053108 Ga0500562_029255 Ga0500562_029255_479_748 89
1144 3300053108 Ga0500562_055144 Ga0500562_055144_189_458 89
1145 3300053118 Ga0500594_0008044 Ga0500594_0008044_533_802 89
1146 3300053118 Ga0500594_0028014 Ga0500594_0028014_866_1135 89
1147 3300053119 Ga0500595_024261 Ga0500595_024261_1426_1695 89
1148 3300053119 Ga0500595_052936 Ga0500595_052936_649_918 89
1149 3300053119 Ga0500595_083273 Ga0500595_083273_477_746 89
1150 3300053120 Ga0500597_060952 Ga0500597_060952_1168_1437 89
1151 3300053122 Ga0500608_000471 Ga0500608_000471_7828_8097 89
1152 3300053122 Ga0500608_057135 Ga0500608_057135_1075_1344 89
1153 3300053125 Ga0500618_002668 Ga0500618_002668_18_287 89
1154 3300053130 Ga0500642_0489896 Ga0500642_0489896_105_374 89
1155 3300053131 Ga0500652_042727 Ga0500652_042727_612_881 89
1156 3300053133 Ga0500655_034856 Ga0500655_034856_368_637 89
1157 3300053133 Ga0500655_052680 Ga0500655_052680_488_757 89
1158 3300053134 Ga0500658_0015841 Ga0500658_0015841_1751_2020 89
1159 3300053136 Ga0500559_0000004 Ga0500559_0000004_138248_138517 89
1160 3300053136 Ga0500559_0007940 Ga0500559_0007940_4028_4297 89
1161 3300053136 Ga0500559_0046749 Ga0500559_0046749_1437_1706 89
1162 3300053136 Ga0500559_0346057 Ga0500559_0346057_313_582 89
1163 3300053139 Ga0500568_0105288 Ga0500568_0105288_455_724 89
1164 3300053139 Ga0500568_0354179 Ga0500568_0354179_229_498 89
1165 3300053140 Ga0500573_0224389 Ga0500573_0224389_318_587 89
1166 3300053146 Ga0500588_0410545 Ga0500588_0410545_101_370 89
1167 3300053151 Ga0500604_0093064 Ga0500604_0093064_267_536 89
1168 3300053151 Ga0500604_0198816 Ga0500604_0198816_58_327 89
1169 3300053153 Ga0500616_0013830 Ga0500616_0013830_913_1182 89
1170 3300053153 Ga0500616_0031769 Ga0500616_0031769_228_497 89
1171 3300053153 Ga0500616_0034483 Ga0500616_0034483_1657_1926 89
1172 3300053153 Ga0500616_0102293 Ga0500616_0102293_1056_1325 89
1173 3300053153 Ga0500616_0404285 Ga0500616_0404285_182_451 89
1174 3300053156 Ga0500622_0003216 Ga0500622_0003216_6144_6428 89
1175 3300053156 Ga0500622_0008772 Ga0500622_0008772_4056_4325 89
1176 3300053156 Ga0500622_0019728 Ga0500622_0019728_1465_1734 89
1177 3300053156 Ga0500622_0057699 Ga0500622_0057699_1420_1689 89
1178 3300053156 Ga0500622_0086816 Ga0500622_0086816_397_666 89
1179 3300053157 Ga0500624_000193 Ga0500624_000193_21151_21420 89
1180 3300053158 Ga0500627_0001642 Ga0500627_0001642_2580_2849 89
1181 3300053158 Ga0500627_0155284 Ga0500627_0155284_742_1011 89
1182 3300053160 Ga0500633_0167837 Ga0500633_0167837_223_492 89
1183 3300053161 Ga0500634_0147912 Ga0500634_0147912_11_280 89
1184 3300053177 Ga0500636_0520626 Ga0500636_0520626_33_302 89
1185 3300053178 Ga0500637_0001689 Ga0500637_0001689_6494_6763 89
1186 3300053727 Ga0500611_007667 Ga0500611_007667_32_301 89
1187 3300053730 Ga0500645_000730 Ga0500645_000730_5688_5957 89
1188 3300053730 Ga0500645_003413 Ga0500645_003413_5061_5330 89
1189 3300053730 Ga0500645_004984 Ga0500645_004984_1456_1725 89
1190 3300053733 Ga0500552_005395 Ga0500552_005395_733_1002 89
1191 3300054114 Ga0501084_0029290 Ga0501084_0029290_1070_1339 89
1192 3300054114 Ga0501084_0059405 Ga0501084_0059405_593_862 89
1193 3300054114 Ga0501084_0453374 Ga0501084_0453374_804_1073 89
1194 3300054114 Ga0501084_0925832 Ga0501084_0925832_383_652 89
1195 3300054114 Ga0501084_1432218 Ga0501084_1432218_87_356 89
1196 3300059477 Ga0587084_045345 Ga0587084_045345_257_526 89
1197 3300059477 Ga0587084_129107 Ga0587084_129107_32_301 89
1198 3300059478 Ga0587093_108132 Ga0587093_108132_121_390 89
1199 3300059490 Ga0587066_171539 Ga0587066_171539_30_299 89
1200 3300059491 Ga0587070_009166 Ga0587070_009166_258_527 89
1201 3300059491 Ga0587070_196204 Ga0587070_196204_251_520 89
1202 3300059492 Ga0587073_0198660 Ga0587073_0198660_27_296 89
1203 3300059493 Ga0587077_078882 Ga0587077_078882_216_485 89
1204 3300059493 Ga0587077_084621 Ga0587077_084621_239_508 89
1205 3300059493 Ga0587077_196856 Ga0587077_196856_16_285 89
1206 3300059493 Ga0587077_268092 Ga0587077_268092_109_378 89
1207 3300059503 Ga0587080_048073 Ga0587080_048073_276_545 89
1208 3300059503 Ga0587080_056927 Ga0587080_056927_237_506 89
1209 3300059504 Ga0587082_062142 Ga0587082_062142_261_530 89
1210 3300059504 Ga0587082_077604 Ga0587082_077604_256_525 89
1211 3300059504 Ga0587082_126145 Ga0587082_126145_257_526 89
1212 3300059505 Ga0587083_0002069 Ga0587083_0002069_255_524 89
1213 3300059505 Ga0587083_0069149 Ga0587083_0069149_270_539 89
1214 3300059505 Ga0587083_0130208 Ga0587083_0130208_311_580 89
1215 3300059505 Ga0587083_0193085 Ga0587083_0193085_249_518 89
1216 3300059505 Ga0587083_0207277 Ga0587083_0207277_69_338 89
1217 3300059506 Ga0587085_029109 Ga0587085_029109_374_643 89
1218 3300059506 Ga0587085_032522 Ga0587085_032522_327_596 89
1219 3300059506 Ga0587085_040279 Ga0587085_040279_230_499 89
1220 3300059506 Ga0587085_101280 Ga0587085_101280_273_542 89
1221 3300059506 Ga0587085_131533 Ga0587085_131533_253_522 89
1222 3300059507 Ga0587086_019882 Ga0587086_019882_302_571 89
1223 3300059508 Ga0587088_123448 Ga0587088_123448_270_539 89
1224 3300059510 Ga0587090_045301 Ga0587090_045301_258_527 89
1225 3300059510 Ga0587090_097141 Ga0587090_097141_258_527 89
1226 3300059510 Ga0587090_140730 Ga0587090_140730_16_285 89
1227 3300059511 Ga0587091_122771 Ga0587091_122771_251_520 89
1228 3300059511 Ga0587091_198655 Ga0587091_198655_257_526 89
1229 3300059512 Ga0587092_054154 Ga0587092_054154_137_406 89
1230 3300059512 Ga0587092_107895 Ga0587092_107895_258_527 89
1231 3300059513 Ga0587094_010142 Ga0587094_010142_167_436 89
1232 3300059513 Ga0587094_089105 Ga0587094_089105_268_537 89
1233 3300059604 Ga0587098_039252 Ga0587098_039252_246_515 89
1234 3300059604 Ga0587098_052495 Ga0587098_052495_256_558 89
1235 3300059607 Ga0587125_022605 Ga0587125_022605_350_619 89
1236 3300059623 Ga0587101_006195 Ga0587101_006195_258_527 89
1237 3300059623 Ga0587101_061627 Ga0587101_061627_147_416 89
1238 3300059623 Ga0587101_082685 Ga0587101_082685_246_515 89
1239 3300059623 Ga0587101_085971 Ga0587101_085971_130_399 89
1240 3300059623 Ga0587101_093544 Ga0587101_093544_61_330 89
1241 3300059624 Ga0587109_168549 Ga0587109_168549_257_526 89
1242 3300059624 Ga0587109_184727 Ga0587109_184727_255_524 89
1243 3300059626 Ga0587115_076061 Ga0587115_076061_48_317 89
1244 3300059626 Ga0587115_102520 Ga0587115_102520_15_284 89
1245 3300059630 Ga0587128_042925 Ga0587128_042925_256_525 89
1246 3300059630 Ga0587128_094714 Ga0587128_094714_90_359 89
1247 3300059630 Ga0587128_096287 Ga0587128_096287_55_324 89
1248 3300059639 Ga0587062_066382 Ga0587062_066382_256_525 89
1249 3300059639 Ga0587062_071306 Ga0587062_071306_98_367 89
1250 3300059639 Ga0587062_087157 Ga0587062_087157_256_525 89
1251 3300059641 Ga0587068_079951 Ga0587068_079951_88_357 89
1252 3300059641 Ga0587068_110464 Ga0587068_110464_255_524 89
1253 3300059641 Ga0587068_161699 Ga0587068_161699_163_432 89
1254 3300059641 Ga0587068_161715 Ga0587068_161715_229_498 89
1255 3300059642 Ga0587069_102712 Ga0587069_102712_273_542 89
1256 3300059643 Ga0587072_066045 Ga0587072_066045_260_529 89
1257 3300059643 Ga0587072_141462 Ga0587072_141462_257_526 89
1258 3300059643 Ga0587072_203244 Ga0587072_203244_61_330 89
1259 3300059645 Ga0587076_005924 Ga0587076_005924_1039_1308 89
1260 3300059645 Ga0587076_177405 Ga0587076_177405_251_520 89
1261 3300059646 Ga0587078_032556 Ga0587078_032556_170_439 89
1262 3300059647 Ga0587079_038790 Ga0587079_038790_302_571 89
1263 3300059647 Ga0587079_072064 Ga0587079_072064_232_501 89
1264 3300059647 Ga0587079_090939 Ga0587079_090939_256_525 89
1265 3300059651 Ga0587105_013126 Ga0587105_013126_258_527 89
1266 3300059652 Ga0587107_012142 Ga0587107_012142_666_935 89
1267 3300059652 Ga0587107_051188 Ga0587107_051188_178_447 89
1268 3300059653 Ga0587108_038871 Ga0587108_038871_32_301 89
1269 3300059654 Ga0587110_018106 Ga0587110_018106_258_527 89
1270 3300059660 Ga0587124_033986 Ga0587124_033986_252_521 89
1271 3300060344 Ga0587071_058758 Ga0587071_058758_270_539 89
1272 3300060344 Ga0587071_118874 Ga0587071_118874_75_344 89
1273 3300060344 Ga0587071_150537 Ga0587071_150537_39_308 89
1274 3300060346 Ga0587111_0003255 Ga0587111_0003255_256_525 89
1275 3300060346 Ga0587111_0009437 Ga0587111_0009437_1176_1445 89
1276 3300060346 Ga0587111_0026302 Ga0587111_0026302_361_630 89
1277 3300060346 Ga0587111_0050087 Ga0587111_0050087_333_602 89
1278 3300060346 Ga0587111_0079645 Ga0587111_0079645_254_523 89
1279 3300060346 Ga0587111_0120838 Ga0587111_0120838_311_580 89
1280 3300060346 Ga0587111_0193254 Ga0587111_0193254_253_522 89
1281 3300060346 Ga0587111_0230872 Ga0587111_0230872_233_502 89
1282 3300060353 Ga0501082_0007661 Ga0501082_0007661_1452_1721 89
1283 3300060353 Ga0501082_0020564 Ga0501082_0020564_4991_5260 89
1284 3300060353 Ga0501082_0038268 Ga0501082_0038268_2438_2707 89
1285 3300060353 Ga0501082_0041062 Ga0501082_0041062_3176_3445 89
1286 3300060353 Ga0501082_0332342 Ga0501082_0332342_537_806 89
1287 3300061734 Ga0530510_0012139 Ga0530510_0012139_1586_1855 89
1288 3300061734 Ga0530510_0164147 Ga0530510_0164147_75_344 89
1289 3300061734 Ga0530510_1138423 Ga0530510_1138423_231_500 89
1290 3300061734 Ga0530510_1501704 Ga0530510_1501704_49_318 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00312

Ribosomal_S15

Ribosomal protein S15

30

110

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_p vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9943 3 88
7p7t-assembly1.cif.gz_p poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii 0.9926 4 88
7p7u-assembly1.cif.gz_p e. faecalis 70s ribosome with p-trna, state iv 0.9926 4 88
7p7q-assembly1.cif.gz_p e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume 0.9924 4 88
8cdu-assembly1.cif.gz_O rnase r bound to a 30s degradation intermediate (main state) 0.9914 4 88
ID Description Score Start End Superfamily
4ji4O00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9752 2 88 1.10.287.10
4dr7O00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9723 2 89 1.10.287.10
1hnwO00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.972 2 89 1.10.287.10
1ibkO00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9719 2 89 1.10.287.10
1iblO00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9715 2 89 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A7C6BZ41-F1-model_v4 Small ribosomal subunit protein uS15 0.9981 3 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A0G0N241-F1-model_v4 Small ribosomal subunit protein uS15 0.998 2 88 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A800EY98-F1-model_v4 Small ribosomal subunit protein uS15 0.9979 3 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A645AKY0-F1-model_v4 30S ribosomal protein S15 0.9979 4 89 GO:0003735
GO:0006412
GO:0022627
AF-A0A2H0W062-F1-model_v4 Small ribosomal subunit protein uS15 0.9971 2 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
93.28 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map