F492631
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1290 | 561 | 1290 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_1414920|Ga0501036_1414920_206_541 |
| Length | 111 |
| Sequence | VLDDIPALAADRWVFSNRKENPMSITAERKQALIKEYANGANDTGSPEVQVAILSERIANLTEHFKTHKKDNHSRRGLLKLVSQRRSLLDYLKGKEEARYKTLIERLGIRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 122 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 123 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 241 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 245 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 246 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 256 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 257 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 264 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 279 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 291 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 292 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 293 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 294 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 295 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 296 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 297 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 298 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 301 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 302 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 306 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 310 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 314 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 315 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 316 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 317 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 318 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 319 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 320 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 321 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 322 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 323 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 324 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 325 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 326 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 327 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 328 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 329 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 330 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 331 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 332 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 333 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 334 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 335 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 336 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 337 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 338 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 339 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 340 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 394 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 395 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 396 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 397 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 398 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 399 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 401 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 402 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 403 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 404 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 405 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 418 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 419 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 459 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 460 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 465 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 466 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 471 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 472 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 484 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 488 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 489 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 491 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 492 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 493 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 494 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 497 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 498 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 499 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 500 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 501 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 502 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 504 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 505 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 506 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 508 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 509 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 510 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 511 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 514 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 515 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 516 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 517 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 518 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 520 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 521 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 523 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.84 |
| Metatranscriptomes | 11.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.78 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 77.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10096869 | 3300003215 | Bacteria | 701 |
| 2 | rootL2_10142746 | 3300003322 | Bacteria | 1396 |
| 3 | Ga0006558J51389_1030434 | 3300003558 | Bacteria | 611 |
| 4 | Ga0055537_1004646 | 3300003773 | Bacteria | 3878 |
| 5 | Ga0055524_1068676 | 3300003775 | Bacteria | 693 |
| 6 | Ga0055536_1004742 | 3300003781 | Bacteria | 6834 |
| 7 | Ga0055536_1053798 | 3300003781 | Bacteria | 868 |
| 8 | Ga0055528_1004920 | 3300003790 | Bacteria | 6310 |
| 9 | Ga0055530_10009589 | 3300003791 | Bacteria | 3699 |
| 10 | Ga0055540_1024508 | 3300003792 | Bacteria | 1495 |
| 11 | Ga0055531_10000968 | 3300003794 | Bacteria | 22999 |
| 12 | Ga0055531_10006710 | 3300003794 | Bacteria | 6442 |
| 13 | Ga0055531_10007558 | 3300003794 | Bacteria | 5898 |
| 14 | Ga0055531_10035065 | 3300003794 | Bacteria | 1578 |
| 15 | Ga0055543_1017106 | 3300004625 | Bacteria | 1368 |
| 16 | Ga0058863_11934056 | 3300004799 | Bacteria | 697 |
| 17 | Ga0058861_11969232 | 3300004800 | Bacteria | 992 |
| 18 | Ga0058861_12043731 | 3300004800 | Bacteria | 946 |
| 19 | Ga0058860_12201779 | 3300004801 | Bacteria | 781 |
| 20 | Ga0058862_10101958 | 3300004803 | Bacteria | 690 |
| 21 | Ga0058862_12762670 | 3300004803 | Bacteria | 519 |
| 22 | Ga0058862_12763025 | 3300004803 | Bacteria | 937 |
| 23 | Ga0058862_12821347 | 3300004803 | Bacteria | 593 |
| 24 | Ga0065165_1000345 | 3300005262 | Bacteria | 76072 |
| 25 | Ga0065165_1001044 | 3300005262 | Bacteria | 33434 |
| 26 | Ga0065704_10053697 | 3300005289 | Bacteria | 708 |
| 27 | Ga0065704_10113070 | 3300005289 | Bacteria | 1920 |
| 28 | Ga0065704_10657186 | 3300005289 | Bacteria | 580 |
| 29 | Ga0065704_10778563 | 3300005289 | Bacteria | 532 |
| 30 | Ga0065715_10005462 | 3300005293 | Bacteria | 3382 |
| 31 | Ga0070658_10625286 | 3300005327 | Bacteria | 934 |
| 32 | Ga0070658_10669684 | 3300005327 | Bacteria | 900 |
| 33 | Ga0070676_10380717 | 3300005328 | Bacteria | 977 |
| 34 | Ga0070676_11592608 | 3300005328 | Bacteria | 504 |
| 35 | Ga0070690_100184757 | 3300005330 | Bacteria | 1442 |
| 36 | Ga0070670_100111080 | 3300005331 | Bacteria | 2362 |
| 37 | Ga0070670_101255424 | 3300005331 | Bacteria | 678 |
| 38 | Ga0068869_100049925 | 3300005334 | Bacteria | 3031 |
| 39 | Ga0068869_100118268 | 3300005334 | Bacteria | 2024 |
| 40 | Ga0068869_101092181 | 3300005334 | Bacteria | 698 |
| 41 | Ga0068869_101529218 | 3300005334 | Bacteria | 593 |
| 42 | Ga0070666_10707515 | 3300005335 | Bacteria | 739 |
| 43 | Ga0070680_100016416 | 3300005336 | Bacteria | 5828 |
| 44 | Ga0070682_101263394 | 3300005337 | Bacteria | 626 |
| 45 | Ga0068868_101159455 | 3300005338 | Unclassified | 713 |
| 46 | Ga0068868_101761723 | 3300005338 | Bacteria | 585 |
| 47 | Ga0070660_100460371 | 3300005339 | Bacteria | 1056 |
| 48 | Ga0070660_101449038 | 3300005339 | Bacteria | 584 |
| 49 | Ga0070660_101813807 | 3300005339 | Bacteria | 520 |
| 50 | Ga0070689_101260739 | 3300005340 | Bacteria | 665 |
| 51 | Ga0070691_10227010 | 3300005341 | Bacteria | 992 |
| 52 | Ga0070661_100670954 | 3300005344 | Bacteria | 843 |
| 53 | Ga0070661_100988451 | 3300005344 | Bacteria | 698 |
| 54 | Ga0070692_10439872 | 3300005345 | Bacteria | 832 |
| 55 | Ga0070692_11249688 | 3300005345 | Bacteria | 531 |
| 56 | Ga0070668_100113463 | 3300005347 | Bacteria | 2159 |
| 57 | Ga0070668_100463259 | 3300005347 | Bacteria | 1092 |
| 58 | Ga0070668_100755407 | 3300005347 | Bacteria | 861 |
| 59 | Ga0070669_100091793 | 3300005353 | Bacteria | 2278 |
| 60 | Ga0070669_100939978 | 3300005353 | Bacteria | 740 |
| 61 | Ga0070669_101431469 | 3300005353 | Bacteria | 600 |
| 62 | Ga0070675_100713125 | 3300005354 | Bacteria | 914 |
| 63 | Ga0070675_100951533 | 3300005354 | Bacteria | 788 |
| 64 | Ga0070674_100462839 | 3300005356 | Bacteria | 1049 |
| 65 | Ga0070674_101737076 | 3300005356 | Bacteria | 565 |
| 66 | Ga0070659_100015080 | 3300005366 | Bacteria | 5781 |
| 67 | Ga0070659_100508916 | 3300005366 | Unclassified | 1027 |
| 68 | Ga0070667_100464157 | 3300005367 | Bacteria | 1158 |
| 69 | Ga0070667_100823887 | 3300005367 | Bacteria | 862 |
| 70 | Ga0070667_101366872 | 3300005367 | Bacteria | 664 |
| 71 | Ga0070667_101497008 | 3300005367 | Bacteria | 634 |
| 72 | Ga0070667_101923418 | 3300005367 | Bacteria | 557 |
| 73 | Ga0070703_10042681 | 3300005406 | Bacteria | 1419 |
| 74 | Ga0070714_100503652 | 3300005435 | Bacteria | 1155 |
| 75 | Ga0070713_101636727 | 3300005436 | Bacteria | 625 |
| 76 | Ga0070701_10046848 | 3300005438 | Bacteria | 2224 |
| 77 | Ga0070711_100479064 | 3300005439 | Bacteria | 1023 |
| 78 | Ga0070705_100000422 | 3300005440 | Bacteria | 24408 |
| 79 | Ga0070705_100612625 | 3300005440 | Bacteria | 844 |
| 80 | Ga0070700_100000646 | 3300005441 | Bacteria | 17236 |
| 81 | Ga0070700_100255677 | 3300005441 | Bacteria | 1259 |
| 82 | Ga0070700_101357823 | 3300005441 | Bacteria | 599 |
| 83 | Ga0070694_100001076 | 3300005444 | Bacteria | 15626 |
| 84 | Ga0070694_100314683 | 3300005444 | Bacteria | 1203 |
| 85 | Ga0070694_100760996 | 3300005444 | Bacteria | 792 |
| 86 | Ga0070694_101406741 | 3300005444 | Bacteria | 589 |
| 87 | Ga0070708_100086386 | 3300005445 | Bacteria | 2849 |
| 88 | Ga0070708_101039194 | 3300005445 | Bacteria | 768 |
| 89 | Ga0070663_100016933 | 3300005455 | Bacteria | 4744 |
| 90 | Ga0070663_100206840 | 3300005455 | Bacteria | 1535 |
| 91 | Ga0070663_101578351 | 3300005455 | Bacteria | 585 |
| 92 | Ga0070678_100467269 | 3300005456 | Bacteria | 1108 |
| 93 | Ga0070678_100912178 | 3300005456 | Bacteria | 804 |
| 94 | Ga0070678_101029372 | 3300005456 | Bacteria | 758 |
| 95 | Ga0070678_101315047 | 3300005456 | Bacteria | 673 |
| 96 | Ga0070662_100035296 | 3300005457 | Bacteria | 3531 |
| 97 | Ga0070685_11615019 | 3300005466 | Bacteria | 502 |
| 98 | Ga0070706_100313262 | 3300005467 | Bacteria | 1464 |
| 99 | Ga0070706_101078426 | 3300005467 | Bacteria | 740 |
| 100 | Ga0070707_100684776 | 3300005468 | Bacteria | 988 |
| 101 | Ga0070698_100102986 | 3300005471 | Bacteria | 2825 |
| 102 | Ga0070698_100229707 | 3300005471 | Bacteria | 1789 |
| 103 | Ga0070698_100657213 | 3300005471 | Bacteria | 989 |
| 104 | Ga0070698_100917818 | 3300005471 | Unclassified | 821 |
| 105 | Ga0070698_101291247 | 3300005471 | Bacteria | 680 |
| 106 | Ga0070698_101807300 | 3300005471 | Bacteria | 564 |
| 107 | Ga0070699_100011141 | 3300005518 | Bacteria | 7771 |
| 108 | Ga0070699_100084090 | 3300005518 | Bacteria | 2776 |
| 109 | Ga0070699_100088848 | 3300005518 | Bacteria | 2700 |
| 110 | Ga0070699_100148536 | 3300005518 | Bacteria | 2072 |
| 111 | Ga0070679_100098880 | 3300005530 | Bacteria | 2905 |
| 112 | Ga0070679_100663362 | 3300005530 | Bacteria | 986 |
| 113 | Ga0070684_101108936 | 3300005535 | Bacteria | 744 |
| 114 | Ga0070684_101993843 | 3300005535 | Unclassified | 548 |
| 115 | Ga0070697_100020913 | 3300005536 | Bacteria | 5180 |
| 116 | Ga0070697_100021215 | 3300005536 | Bacteria | 5146 |
| 117 | Ga0070697_101163812 | 3300005536 | Bacteria | 687 |
| 118 | Ga0068853_100135251 | 3300005539 | Bacteria | 2209 |
| 119 | Ga0068853_100229928 | 3300005539 | Bacteria | 1696 |
| 120 | Ga0068853_100853413 | 3300005539 | Bacteria | 873 |
| 121 | Ga0070695_100010589 | 3300005545 | Bacteria | 5511 |
| 122 | Ga0070695_100834306 | 3300005545 | Bacteria | 741 |
| 123 | Ga0070695_100913471 | 3300005545 | Bacteria | 710 |
| 124 | Ga0070695_101394124 | 3300005545 | Bacteria | 581 |
| 125 | Ga0070695_101418543 | 3300005545 | Bacteria | 576 |
| 126 | Ga0070696_100003141 | 3300005546 | Bacteria | 10998 |
| 127 | Ga0070696_100061214 | 3300005546 | Unclassified | 2633 |
| 128 | Ga0070696_100311747 | 3300005546 | Bacteria | 1208 |
| 129 | Ga0070693_100047576 | 3300005547 | Bacteria | 2441 |
| 130 | Ga0070693_100524656 | 3300005547 | Bacteria | 844 |
| 131 | Ga0070693_100755821 | 3300005547 | Bacteria | 717 |
| 132 | Ga0070693_101186723 | 3300005547 | Bacteria | 586 |
| 133 | Ga0070693_101478322 | 3300005547 | Bacteria | 530 |
| 134 | Ga0070665_100000187 | 3300005548 | Bacteria | 110095 |
| 135 | Ga0070665_100111454 | 3300005548 | Bacteria | 2738 |
| 136 | Ga0070665_100366247 | 3300005548 | Bacteria | 1448 |
| 137 | Ga0070665_101047263 | 3300005548 | Bacteria | 828 |
| 138 | Ga0070665_102279128 | 3300005548 | Bacteria | 545 |
| 139 | Ga0070665_102400754 | 3300005548 | Bacteria | 530 |
| 140 | Ga0070704_100069383 | 3300005549 | Unclassified | 2553 |
| 141 | Ga0070704_100561558 | 3300005549 | Bacteria | 998 |
| 142 | Ga0068855_100477917 | 3300005563 | Bacteria | 1357 |
| 143 | Ga0068855_100722158 | 3300005563 | Bacteria | 1064 |
| 144 | Ga0068855_100859354 | 3300005563 | Bacteria | 961 |
| 145 | Ga0068855_101458103 | 3300005563 | Bacteria | 704 |
| 146 | Ga0068855_101480494 | 3300005563 | Bacteria | 698 |
| 147 | Ga0068855_102349453 | 3300005563 | Bacteria | 533 |
| 148 | Ga0070664_101373789 | 3300005564 | Bacteria | 668 |
| 149 | Ga0068857_100051141 | 3300005577 | Bacteria | 3664 |
| 150 | Ga0068857_100867067 | 3300005577 | Bacteria | 865 |
| 151 | Ga0068857_100930406 | 3300005577 | Bacteria | 834 |
| 152 | Ga0068857_101597264 | 3300005577 | Bacteria | 637 |
| 153 | Ga0068856_100125919 | 3300005614 | Bacteria | 2565 |
| 154 | Ga0068856_100189873 | 3300005614 | Bacteria | 2068 |
| 155 | Ga0070702_100548035 | 3300005615 | Unclassified | 858 |
| 156 | Ga0068852_100725546 | 3300005616 | Bacteria | 1005 |
| 157 | Ga0068852_100949953 | 3300005616 | Bacteria | 878 |
| 158 | Ga0068852_101048322 | 3300005616 | Bacteria | 835 |
| 159 | Ga0068859_100001348 | 3300005617 | Bacteria | 25055 |
| 160 | Ga0068859_100308317 | 3300005617 | Bacteria | 1676 |
| 161 | Ga0068859_100859924 | 3300005617 | Bacteria | 993 |
| 162 | Ga0068859_101253628 | 3300005617 | Bacteria | 817 |
| 163 | Ga0068864_100078352 | 3300005618 | Bacteria | 2892 |
| 164 | Ga0068864_100179969 | 3300005618 | Bacteria | 1932 |
| 165 | Ga0068864_100388174 | 3300005618 | Bacteria | 1325 |
| 166 | Ga0068864_101764359 | 3300005618 | Bacteria | 624 |
| 167 | Ga0068866_10180745 | 3300005718 | Bacteria | 1246 |
| 168 | Ga0068866_10957200 | 3300005718 | Bacteria | 606 |
| 169 | Ga0068866_11472197 | 3300005718 | Bacteria | 500 |
| 170 | Ga0068861_100006874 | 3300005719 | Bacteria | 7770 |
| 171 | Ga0068861_100424264 | 3300005719 | Bacteria | 1186 |
| 172 | Ga0068861_100572277 | 3300005719 | Bacteria | 1033 |
| 173 | Ga0068861_101285715 | 3300005719 | Bacteria | 711 |
| 174 | Ga0068861_101465516 | 3300005719 | Bacteria | 669 |
| 175 | Ga0068870_10555349 | 3300005840 | Bacteria | 774 |
| 176 | Ga0068870_11194866 | 3300005840 | Bacteria | 550 |
| 177 | Ga0068863_100335627 | 3300005841 | Bacteria | 1470 |
| 178 | Ga0068863_100820669 | 3300005841 | Bacteria | 928 |
| 179 | Ga0068863_100942717 | 3300005841 | Bacteria | 864 |
| 180 | Ga0068863_101536035 | 3300005841 | Bacteria | 674 |
| 181 | Ga0068863_102557560 | 3300005841 | Bacteria | 520 |
| 182 | Ga0068858_100948399 | 3300005842 | Bacteria | 842 |
| 183 | Ga0068860_100014816 | 3300005843 | Bacteria | 7626 |
| 184 | Ga0068860_100226978 | 3300005843 | Bacteria | 1814 |
| 185 | Ga0068860_100459488 | 3300005843 | Bacteria | 1267 |
| 186 | Ga0068860_100490209 | 3300005843 | Bacteria | 1226 |
| 187 | Ga0068862_100001566 | 3300005844 | Bacteria | 20878 |
| 188 | Ga0068862_100016985 | 3300005844 | Bacteria | 6056 |
| 189 | Ga0068862_100027838 | 3300005844 | Bacteria | 4760 |
| 190 | Ga0068862_100813013 | 3300005844 | Bacteria | 913 |
| 191 | Ga0068862_101560373 | 3300005844 | Bacteria | 667 |
| 192 | Ga0068862_101954523 | 3300005844 | Bacteria | 597 |
| 193 | Ga0081455_10070527 | 3300005937 | Bacteria | 2901 |
| 194 | Ga0081455_10380279 | 3300005937 | Bacteria | 986 |
| 195 | Ga0081540_1119940 | 3300005983 | Bacteria | 1093 |
| 196 | Ga0081539_10132353 | 3300005985 | Bacteria | 1223 |
| 197 | Ga0075365_10686934 | 3300006038 | Bacteria | 723 |
| 198 | Ga0075365_11117540 | 3300006038 | Bacteria | 555 |
| 199 | Ga0075363_100124223 | 3300006048 | Bacteria | 1443 |
| 200 | Ga0075363_100576261 | 3300006048 | Unclassified | 673 |
| 201 | Ga0075363_100592633 | 3300006048 | Bacteria | 664 |
| 202 | Ga0075364_10076847 | 3300006051 | Bacteria | 2204 |
| 203 | Ga0075364_10275765 | 3300006051 | Bacteria | 1144 |
| 204 | Ga0075364_10317377 | 3300006051 | Bacteria | 1061 |
| 205 | Ga0075364_10484407 | 3300006051 | Bacteria | 845 |
| 206 | Ga0075364_10564703 | 3300006051 | Bacteria | 778 |
| 207 | Ga0075364_10727560 | 3300006051 | Bacteria | 677 |
| 208 | Ga0075364_11012878 | 3300006051 | Bacteria | 565 |
| 209 | Ga0070715_10000031 | 3300006163 | Bacteria | 86230 |
| 210 | Ga0070716_100472419 | 3300006173 | Bacteria | 919 |
| 211 | Ga0070712_100491086 | 3300006175 | Bacteria | 1028 |
| 212 | Ga0075362_10193590 | 3300006177 | Bacteria | 988 |
| 213 | Ga0075367_10182503 | 3300006178 | Bacteria | 1309 |
| 214 | Ga0075367_10327488 | 3300006178 | Bacteria | 966 |
| 215 | Ga0075367_10798426 | 3300006178 | Unclassified | 601 |
| 216 | Ga0075369_10043828 | 3300006186 | Bacteria | 1921 |
| 217 | Ga0075366_10114577 | 3300006195 | Bacteria | 1623 |
| 218 | Ga0075366_10394632 | 3300006195 | Bacteria | 851 |
| 219 | Ga0075366_10547553 | 3300006195 | Bacteria | 716 |
| 220 | Ga0075366_10576897 | 3300006195 | Bacteria | 697 |
| 221 | Ga0097621_100316806 | 3300006237 | Bacteria | 1381 |
| 222 | Ga0075370_10109639 | 3300006353 | Bacteria | 1602 |
| 223 | Ga0075370_10292586 | 3300006353 | Bacteria | 968 |
| 224 | Ga0075370_10353252 | 3300006353 | Bacteria | 878 |
| 225 | Ga0068871_100764926 | 3300006358 | Bacteria | 889 |
| 226 | Ga0075428_100095612 | 3300006844 | Bacteria | 3239 |
| 227 | Ga0075428_101142595 | 3300006844 | Bacteria | 822 |
| 228 | Ga0075428_101210736 | 3300006844 | Bacteria | 796 |
| 229 | Ga0075430_100016885 | 3300006846 | Bacteria | 6217 |
| 230 | Ga0075430_100068032 | 3300006846 | Bacteria | 2989 |
| 231 | Ga0075431_100006929 | 3300006847 | Bacteria | 11270 |
| 232 | Ga0075431_100007900 | 3300006847 | Bacteria | 10602 |
| 233 | Ga0075431_100119471 | 3300006847 | Bacteria | 2720 |
| 234 | Ga0075431_100932465 | 3300006847 | Bacteria | 837 |
| 235 | Ga0075433_10149593 | 3300006852 | Bacteria | 2077 |
| 236 | Ga0075433_10918707 | 3300006852 | Bacteria | 763 |
| 237 | Ga0075434_100418729 | 3300006871 | Bacteria | 1361 |
| 238 | Ga0075429_100163276 | 3300006880 | Bacteria | 1951 |
| 239 | Ga0068865_100025593 | 3300006881 | Bacteria | 3883 |
| 240 | Ga0068865_100272278 | 3300006881 | Bacteria | 1345 |
| 241 | Ga0068865_100360862 | 3300006881 | Bacteria | 1180 |
| 242 | Ga0068865_100567893 | 3300006881 | Unclassified | 955 |
| 243 | Ga0068865_100837874 | 3300006881 | Bacteria | 796 |
| 244 | Ga0068865_101126665 | 3300006881 | Bacteria | 692 |
| 245 | Ga0097620_100001348 | 3300006931 | Bacteria | 25055 |
| 246 | Ga0097620_100308337 | 3300006931 | Bacteria | 1676 |
| 247 | Ga0097620_100859866 | 3300006931 | Bacteria | 993 |
| 248 | Ga0097620_101253638 | 3300006931 | Bacteria | 817 |
| 249 | Ga0075435_100301837 | 3300007076 | Bacteria | 1370 |
| 250 | Ga0075435_100502749 | 3300007076 | Bacteria | 1048 |
| 251 | Ga0075435_100641183 | 3300007076 | Bacteria | 922 |
| 252 | Ga0105244_10532145 | 3300009036 | Bacteria | 541 |
| 253 | Ga0105250_10006712 | 3300009092 | Bacteria | 5001 |
| 254 | Ga0105240_10011290 | 3300009093 | Bacteria | 12448 |
| 255 | Ga0105240_10236334 | 3300009093 | Bacteria | 2121 |
| 256 | Ga0105240_10596293 | 3300009093 | Bacteria | 1217 |
| 257 | Ga0105240_10618521 | 3300009093 | Bacteria | 1191 |
| 258 | Ga0105240_10668291 | 3300009093 | Bacteria | 1137 |
| 259 | Ga0105240_10898609 | 3300009093 | Bacteria | 953 |
| 260 | Ga0111539_10079678 | 3300009094 | Bacteria | 3853 |
| 261 | Ga0111539_10545879 | 3300009094 | Bacteria | 1350 |
| 262 | Ga0111539_13497400 | 3300009094 | Bacteria | 504 |
| 263 | Ga0105245_10224845 | 3300009098 | Bacteria | 1813 |
| 264 | Ga0105245_10683292 | 3300009098 | Bacteria | 1059 |
| 265 | Ga0105245_12367960 | 3300009098 | Bacteria | 585 |
| 266 | Ga0105245_12592299 | 3300009098 | Bacteria | 560 |
| 267 | Ga0105247_10291118 | 3300009101 | Bacteria | 1130 |
| 268 | Ga0114129_10045488 | 3300009147 | Bacteria | 6171 |
| 269 | Ga0114129_10332574 | 3300009147 | Bacteria | 2017 |
| 270 | Ga0114129_10740823 | 3300009147 | Bacteria | 1259 |
| 271 | Ga0114129_10805309 | 3300009147 | Bacteria | 1198 |
| 272 | Ga0114129_11810165 | 3300009147 | Bacteria | 742 |
| 273 | Ga0114129_12063250 | 3300009147 | Bacteria | 688 |
| 274 | Ga0105243_10137333 | 3300009148 | Bacteria | 2082 |
| 275 | Ga0105243_10181582 | 3300009148 | Bacteria | 1830 |
| 276 | Ga0105243_11238242 | 3300009148 | Bacteria | 761 |
| 277 | Ga0105243_11325068 | 3300009148 | Bacteria | 738 |
| 278 | Ga0105243_11410710 | 3300009148 | Bacteria | 717 |
| 279 | Ga0105241_10303952 | 3300009174 | Bacteria | 1370 |
| 280 | Ga0105241_10371163 | 3300009174 | Bacteria | 1248 |
| 281 | Ga0105241_10371798 | 3300009174 | Bacteria | 1246 |
| 282 | Ga0105241_10905885 | 3300009174 | Bacteria | 819 |
| 283 | Ga0105241_10987422 | 3300009174 | Bacteria | 787 |
| 284 | Ga0105242_10232711 | 3300009176 | Bacteria | 1652 |
| 285 | Ga0105242_10394715 | 3300009176 | Bacteria | 1289 |
| 286 | Ga0105242_10515666 | 3300009176 | Bacteria | 1140 |
| 287 | Ga0105242_11241810 | 3300009176 | Bacteria | 766 |
| 288 | Ga0105242_11443437 | 3300009176 | Bacteria | 717 |
| 289 | Ga0105242_11870363 | 3300009176 | Bacteria | 640 |
| 290 | Ga0105248_10631821 | 3300009177 | Bacteria | 1208 |
| 291 | Ga0105237_10648427 | 3300009545 | Bacteria | 1063 |
| 292 | Ga0105237_11332160 | 3300009545 | Bacteria | 724 |
| 293 | Ga0105237_11918943 | 3300009545 | Bacteria | 600 |
| 294 | Ga0105238_10061875 | 3300009551 | Bacteria | 3745 |
| 295 | Ga0105238_10077822 | 3300009551 | Bacteria | 3308 |
| 296 | Ga0105238_10192854 | 3300009551 | Bacteria | 2013 |
| 297 | Ga0105238_10211229 | 3300009551 | Bacteria | 1917 |
| 298 | Ga0105238_10229711 | 3300009551 | Bacteria | 1832 |
| 299 | Ga0105238_10396633 | 3300009551 | Bacteria | 1372 |
| 300 | Ga0105238_10603881 | 3300009551 | Bacteria | 1105 |
| 301 | Ga0105238_11518864 | 3300009551 | Bacteria | 699 |
| 302 | Ga0105238_12317508 | 3300009551 | Bacteria | 572 |
| 303 | Ga0105249_10000689 | 3300009553 | Bacteria | 30748 |
| 304 | Ga0105249_10511220 | 3300009553 | Bacteria | 1247 |
| 305 | Ga0105249_11035945 | 3300009553 | Bacteria | 890 |
| 306 | Ga0105249_12892584 | 3300009553 | Bacteria | 551 |
| 307 | Ga0105239_10123802 | 3300010375 | Bacteria | 2873 |
| 308 | Ga0105239_10916730 | 3300010375 | Bacteria | 1006 |
| 309 | Ga0105239_12398926 | 3300010375 | Bacteria | 614 |
| 310 | Ga0105246_10099127 | 3300011119 | Bacteria | 2118 |
| 311 | Ga0105246_10395020 | 3300011119 | Bacteria | 1147 |
| 312 | Ga0105246_11246818 | 3300011119 | Bacteria | 686 |
| 313 | Ga0105246_11320725 | 3300011119 | Bacteria | 669 |
| 314 | Ga0105246_11742197 | 3300011119 | Bacteria | 593 |
| 315 | Ga0157323_1033709 | 3300012495 | Bacteria | 556 |
| 316 | Ga0157319_1008110 | 3300012497 | Bacteria | 796 |
| 317 | Ga0157326_1037903 | 3300012513 | Bacteria | 665 |
| 318 | Ga0157373_10009155 | 3300013100 | Bacteria | 7322 |
| 319 | Ga0157371_11017213 | 3300013102 | Bacteria | 633 |
| 320 | Ga0157370_10080372 | 3300013104 | Bacteria | 3069 |
| 321 | Ga0157370_10231753 | 3300013104 | Bacteria | 1709 |
| 322 | Ga0157370_10336172 | 3300013104 | Bacteria | 1392 |
| 323 | Ga0157369_10019954 | 3300013105 | Bacteria | 7495 |
| 324 | Ga0157369_10706873 | 3300013105 | Bacteria | 1038 |
| 325 | Ga0157369_12285570 | 3300013105 | Bacteria | 548 |
| 326 | Ga0157374_10117372 | 3300013296 | Bacteria | 2565 |
| 327 | Ga0157374_10778898 | 3300013296 | Bacteria | 972 |
| 328 | Ga0157374_10956765 | 3300013296 | Bacteria | 875 |
| 329 | Ga0157374_11663755 | 3300013296 | Bacteria | 663 |
| 330 | Ga0157378_10324328 | 3300013297 | Bacteria | 1497 |
| 331 | Ga0157378_10507617 | 3300013297 | Bacteria | 1205 |
| 332 | Ga0157378_11009840 | 3300013297 | Bacteria | 866 |
| 333 | Ga0157378_11544702 | 3300013297 | Bacteria | 709 |
| 334 | Ga0163162_10414409 | 3300013306 | Bacteria | 1479 |
| 335 | Ga0163162_10735398 | 3300013306 | Bacteria | 1107 |
| 336 | Ga0163162_11464116 | 3300013306 | Bacteria | 777 |
| 337 | Ga0163162_11837195 | 3300013306 | Bacteria | 693 |
| 338 | Ga0157372_10435701 | 3300013307 | Bacteria | 1528 |
| 339 | Ga0157375_12956772 | 3300013308 | Bacteria | 568 |
| 340 | Ga0157375_13702778 | 3300013308 | Bacteria | 508 |
| 341 | Ga0163163_10010481 | 3300014325 | Bacteria | 8340 |
| 342 | Ga0163163_10507652 | 3300014325 | Bacteria | 1268 |
| 343 | Ga0163163_10698019 | 3300014325 | Bacteria | 1078 |
| 344 | Ga0163163_10733495 | 3300014325 | Bacteria | 1051 |
| 345 | Ga0163163_11396914 | 3300014325 | Bacteria | 762 |
| 346 | Ga0163163_11466515 | 3300014325 | Bacteria | 744 |
| 347 | Ga0157380_10119958 | 3300014326 | Bacteria | 2226 |
| 348 | Ga0157380_10452391 | 3300014326 | Bacteria | 1234 |
| 349 | Ga0157380_10577100 | 3300014326 | Bacteria | 1108 |
| 350 | Ga0157380_10649004 | 3300014326 | Bacteria | 1052 |
| 351 | Ga0157380_10697032 | 3300014326 | Bacteria | 1020 |
| 352 | Ga0157380_12497143 | 3300014326 | Bacteria | 582 |
| 353 | Ga0182008_10138293 | 3300014497 | Bacteria | 1217 |
| 354 | Ga0157377_10088990 | 3300014745 | Bacteria | 1819 |
| 355 | Ga0157379_10366652 | 3300014968 | Bacteria | 1320 |
| 356 | Ga0157379_10523958 | 3300014968 | Bacteria | 1100 |
| 357 | Ga0157379_10559794 | 3300014968 | Bacteria | 1064 |
| 358 | Ga0157379_11086645 | 3300014968 | Bacteria | 766 |
| 359 | Ga0157376_10684177 | 3300014969 | Bacteria | 1029 |
| 360 | Ga0157376_11090967 | 3300014969 | Bacteria | 824 |
| 361 | Ga0157376_12705866 | 3300014969 | Bacteria | 536 |
| 362 | Ga0182007_10156376 | 3300015262 | Bacteria | 778 |
| 363 | Ga0182007_10190265 | 3300015262 | Bacteria | 713 |
| 364 | Ga0163161_10097742 | 3300017792 | Bacteria | 2181 |
| 365 | Ga0163161_10318403 | 3300017792 | Bacteria | 1229 |
| 366 | Ga0163161_10386598 | 3300017792 | Bacteria | 1119 |
| 367 | Ga0163161_10559011 | 3300017792 | Bacteria | 939 |
| 368 | Ga0206356_10591617 | 3300020070 | Bacteria | 620 |
| 369 | Ga0206356_11363650 | 3300020070 | Unclassified | 626 |
| 370 | Ga0206352_10433278 | 3300020078 | Bacteria | 754 |
| 371 | Ga0206352_11190364 | 3300020078 | Bacteria | 603 |
| 372 | Ga0206354_10869696 | 3300020081 | Unclassified | 517 |
| 373 | Ga0206354_11690617 | 3300020081 | Bacteria | 647 |
| 374 | Ga0206353_10388764 | 3300020082 | Bacteria | 607 |
| 375 | Ga0213872_10087989 | 3300021361 | Bacteria | 1391 |
| 376 | Ga0213876_10035419 | 3300021384 | Bacteria | 2633 |
| 377 | Ga0224712_10341888 | 3300022467 | Bacteria | 706 |
| 378 | Ga0207425_1068486 | 3300025245 | Bacteria | 612 |
| 379 | Ga0209026_1001443 | 3300025250 | Bacteria | 10504 |
| 380 | Ga0209233_1009619 | 3300025261 | Bacteria | 2936 |
| 381 | Ga0209233_1058476 | 3300025261 | Bacteria | 753 |
| 382 | Ga0209565_1001056 | 3300025263 | Bacteria | 13845 |
| 383 | Ga0209673_1000796 | 3300025273 | Bacteria | 42005 |
| 384 | Ga0209675_1027043 | 3300025291 | Bacteria | 1417 |
| 385 | Ga0209676_1000115 | 3300025292 | Bacteria | 205183 |
| 386 | Ga0209676_1005229 | 3300025292 | Bacteria | 6874 |
| 387 | Ga0209564_1007404 | 3300025295 | Bacteria | 5678 |
| 388 | Ga0209564_1025111 | 3300025295 | Bacteria | 2016 |
| 389 | Ga0209758_1000852 | 3300025297 | Bacteria | 42442 |
| 390 | Ga0209758_1000917 | 3300025297 | Bacteria | 39944 |
| 391 | Ga0209758_1042409 | 3300025297 | Bacteria | 1688 |
| 392 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 393 | Ga0209050_1006111 | 3300025298 | Bacteria | 7265 |
| 394 | Ga0209050_1023604 | 3300025298 | Bacteria | 2157 |
| 395 | Ga0209050_1037824 | 3300025298 | Bacteria | 1385 |
| 396 | Ga0209256_1005104 | 3300025299 | Bacteria | 7788 |
| 397 | Ga0209256_1008353 | 3300025299 | Bacteria | 4823 |
| 398 | Ga0209256_1041065 | 3300025299 | Bacteria | 1177 |
| 399 | Ga0209051_1004762 | 3300025303 | Bacteria | 8201 |
| 400 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 401 | Ga0209257_1000192 | 3300025304 | Bacteria | 151851 |
| 402 | Ga0209257_1000289 | 3300025304 | Bacteria | 110882 |
| 403 | Ga0209257_1008306 | 3300025304 | Bacteria | 5950 |
| 404 | Ga0209257_1056241 | 3300025304 | Bacteria | 1087 |
| 405 | Ga0207697_10347190 | 3300025315 | Bacteria | 659 |
| 406 | Ga0207653_10004893 | 3300025885 | Bacteria | 4187 |
| 407 | Ga0207642_10256363 | 3300025899 | Bacteria | 995 |
| 408 | Ga0207688_10442074 | 3300025901 | Bacteria | 810 |
| 409 | Ga0207680_10254725 | 3300025903 | Bacteria | 1213 |
| 410 | Ga0207680_10720958 | 3300025903 | Unclassified | 715 |
| 411 | Ga0207680_10799975 | 3300025903 | Bacteria | 676 |
| 412 | Ga0207680_11277711 | 3300025903 | Bacteria | 522 |
| 413 | Ga0207647_10067199 | 3300025904 | Bacteria | 2173 |
| 414 | Ga0207685_10000007 | 3300025905 | Bacteria | 278341 |
| 415 | Ga0207645_10110413 | 3300025907 | Bacteria | 1780 |
| 416 | Ga0207645_10451294 | 3300025907 | Bacteria | 868 |
| 417 | Ga0207643_10273629 | 3300025908 | Bacteria | 1046 |
| 418 | Ga0207643_10727418 | 3300025908 | Bacteria | 642 |
| 419 | Ga0207705_10121475 | 3300025909 | Bacteria | 1939 |
| 420 | Ga0207705_10179685 | 3300025909 | Bacteria | 1596 |
| 421 | Ga0207705_10410344 | 3300025909 | Bacteria | 1048 |
| 422 | Ga0207654_10292661 | 3300025911 | Bacteria | 1105 |
| 423 | Ga0207654_11201060 | 3300025911 | Bacteria | 553 |
| 424 | Ga0207695_10012980 | 3300025913 | Bacteria | 9955 |
| 425 | Ga0207695_10512280 | 3300025913 | Bacteria | 1082 |
| 426 | Ga0207695_10625698 | 3300025913 | Bacteria | 958 |
| 427 | Ga0207695_11694229 | 3300025913 | Bacteria | 513 |
| 428 | Ga0207671_10665651 | 3300025914 | Bacteria | 829 |
| 429 | Ga0207671_11087822 | 3300025914 | Bacteria | 628 |
| 430 | Ga0207671_11480527 | 3300025914 | Bacteria | 524 |
| 431 | Ga0207660_10001868 | 3300025917 | Bacteria | 14029 |
| 432 | Ga0207660_10885148 | 3300025917 | Bacteria | 729 |
| 433 | Ga0207657_10229918 | 3300025919 | Bacteria | 1483 |
| 434 | Ga0207657_10420043 | 3300025919 | Bacteria | 1051 |
| 435 | Ga0207657_10586210 | 3300025919 | Bacteria | 871 |
| 436 | Ga0207649_10860443 | 3300025920 | Bacteria | 710 |
| 437 | Ga0207652_10018573 | 3300025921 | Bacteria | 5705 |
| 438 | Ga0207652_10581991 | 3300025921 | Bacteria | 1005 |
| 439 | Ga0207646_10018114 | 3300025922 | Bacteria | 6573 |
| 440 | Ga0207646_10053819 | 3300025922 | Bacteria | 3600 |
| 441 | Ga0207646_10889578 | 3300025922 | Unclassified | 790 |
| 442 | Ga0207681_10178896 | 3300025923 | Bacteria | 1614 |
| 443 | Ga0207681_10363105 | 3300025923 | Bacteria | 1162 |
| 444 | Ga0207681_10750363 | 3300025923 | Bacteria | 813 |
| 445 | Ga0207681_11102893 | 3300025923 | Bacteria | 666 |
| 446 | Ga0207694_10070351 | 3300025924 | Bacteria | 2734 |
| 447 | Ga0207694_10121581 | 3300025924 | Bacteria | 2085 |
| 448 | Ga0207694_10132540 | 3300025924 | Bacteria | 1998 |
| 449 | Ga0207694_10334990 | 3300025924 | Bacteria | 1251 |
| 450 | Ga0207694_10435777 | 3300025924 | Bacteria | 1093 |
| 451 | Ga0207694_10465168 | 3300025924 | Bacteria | 1057 |
| 452 | Ga0207694_11537780 | 3300025924 | Bacteria | 561 |
| 453 | Ga0207659_11061279 | 3300025926 | Bacteria | 697 |
| 454 | Ga0207659_11904657 | 3300025926 | Bacteria | 504 |
| 455 | Ga0207687_10266575 | 3300025927 | Bacteria | 1367 |
| 456 | Ga0207687_11239911 | 3300025927 | Bacteria | 641 |
| 457 | Ga0207664_10637238 | 3300025929 | Bacteria | 958 |
| 458 | Ga0207690_10008653 | 3300025932 | Bacteria | 6036 |
| 459 | Ga0207690_10437058 | 3300025932 | Bacteria | 1049 |
| 460 | Ga0207690_10604156 | 3300025932 | Unclassified | 896 |
| 461 | Ga0207706_10399141 | 3300025933 | Bacteria | 1192 |
| 462 | Ga0207706_10597686 | 3300025933 | Bacteria | 948 |
| 463 | Ga0207706_10655792 | 3300025933 | Bacteria | 898 |
| 464 | Ga0207706_10891251 | 3300025933 | Bacteria | 752 |
| 465 | Ga0207686_10141220 | 3300025934 | Bacteria | 1665 |
| 466 | Ga0207686_10306742 | 3300025934 | Bacteria | 1181 |
| 467 | Ga0207709_10098021 | 3300025935 | Bacteria | 1932 |
| 468 | Ga0207709_10239000 | 3300025935 | Bacteria | 1320 |
| 469 | Ga0207709_11741474 | 3300025935 | Bacteria | 518 |
| 470 | Ga0207670_10286478 | 3300025936 | Bacteria | 1285 |
| 471 | Ga0207669_10283465 | 3300025937 | Bacteria | 1251 |
| 472 | Ga0207669_10910644 | 3300025937 | Bacteria | 735 |
| 473 | Ga0207704_10000526 | 3300025938 | Bacteria | 17029 |
| 474 | Ga0207704_10532964 | 3300025938 | Bacteria | 952 |
| 475 | Ga0207665_10800427 | 3300025939 | Bacteria | 745 |
| 476 | Ga0207691_10475940 | 3300025940 | Bacteria | 1062 |
| 477 | Ga0207691_10570589 | 3300025940 | Bacteria | 959 |
| 478 | Ga0207691_11245807 | 3300025940 | Bacteria | 616 |
| 479 | Ga0207711_10894150 | 3300025941 | Bacteria | 826 |
| 480 | Ga0207711_11093589 | 3300025941 | Bacteria | 738 |
| 481 | Ga0207711_11242393 | 3300025941 | Bacteria | 687 |
| 482 | Ga0207711_11252161 | 3300025941 | Bacteria | 684 |
| 483 | Ga0207711_11938465 | 3300025941 | Bacteria | 532 |
| 484 | Ga0207689_10031246 | 3300025942 | Bacteria | 4435 |
| 485 | Ga0207689_10034906 | 3300025942 | Bacteria | 4177 |
| 486 | Ga0207689_10203962 | 3300025942 | Bacteria | 1633 |
| 487 | Ga0207689_10275634 | 3300025942 | Bacteria | 1393 |
| 488 | Ga0207689_10293373 | 3300025942 | Bacteria | 1347 |
| 489 | Ga0207689_11207673 | 3300025942 | Bacteria | 636 |
| 490 | Ga0207661_10639726 | 3300025944 | Bacteria | 977 |
| 491 | Ga0207679_11146309 | 3300025945 | Bacteria | 713 |
| 492 | Ga0207679_11281073 | 3300025945 | Bacteria | 673 |
| 493 | Ga0207679_12152243 | 3300025945 | Bacteria | 506 |
| 494 | Ga0207667_10111601 | 3300025949 | Bacteria | 2820 |
| 495 | Ga0207651_10717091 | 3300025960 | Bacteria | 882 |
| 496 | Ga0207712_10014689 | 3300025961 | Bacteria | 5043 |
| 497 | Ga0207712_11096766 | 3300025961 | Bacteria | 708 |
| 498 | Ga0207712_11275969 | 3300025961 | Bacteria | 656 |
| 499 | Ga0207712_11309245 | 3300025961 | Bacteria | 648 |
| 500 | Ga0207712_11882620 | 3300025961 | Bacteria | 536 |
| 501 | Ga0207668_10004082 | 3300025972 | Bacteria | 8581 |
| 502 | Ga0207668_10206733 | 3300025972 | Bacteria | 1567 |
| 503 | Ga0207668_10391180 | 3300025972 | Bacteria | 1173 |
| 504 | Ga0207668_10432829 | 3300025972 | Bacteria | 1119 |
| 505 | Ga0207668_10455330 | 3300025972 | Bacteria | 1093 |
| 506 | Ga0207668_10462186 | 3300025972 | Bacteria | 1085 |
| 507 | Ga0207668_11198233 | 3300025972 | Bacteria | 682 |
| 508 | Ga0207668_11481863 | 3300025972 | Bacteria | 612 |
| 509 | Ga0207640_10434293 | 3300025981 | Bacteria | 1078 |
| 510 | Ga0207640_10590775 | 3300025981 | Bacteria | 939 |
| 511 | Ga0207658_10020434 | 3300025986 | Bacteria | 4585 |
| 512 | Ga0207658_10184327 | 3300025986 | Bacteria | 1730 |
| 513 | Ga0207658_10734851 | 3300025986 | Bacteria | 893 |
| 514 | Ga0207658_11294232 | 3300025986 | Bacteria | 667 |
| 515 | Ga0207658_11764600 | 3300025986 | Bacteria | 565 |
| 516 | Ga0207658_11925637 | 3300025986 | Bacteria | 538 |
| 517 | Ga0207703_10221324 | 3300026035 | Bacteria | 1692 |
| 518 | Ga0207703_10981909 | 3300026035 | Bacteria | 810 |
| 519 | Ga0207639_10179798 | 3300026041 | Bacteria | 1798 |
| 520 | Ga0207639_10885254 | 3300026041 | Bacteria | 834 |
| 521 | Ga0207639_10924747 | 3300026041 | Bacteria | 816 |
| 522 | Ga0207678_10025606 | 3300026067 | Bacteria | 5149 |
| 523 | Ga0207678_10116681 | 3300026067 | Bacteria | 2278 |
| 524 | Ga0207678_10292740 | 3300026067 | Bacteria | 1398 |
| 525 | Ga0207678_10302026 | 3300026067 | Bacteria | 1376 |
| 526 | Ga0207678_10744892 | 3300026067 | Bacteria | 864 |
| 527 | Ga0207708_10005606 | 3300026075 | Bacteria | 9264 |
| 528 | Ga0207708_10837410 | 3300026075 | Unclassified | 794 |
| 529 | Ga0207702_10111519 | 3300026078 | Bacteria | 2433 |
| 530 | Ga0207641_10510555 | 3300026088 | Bacteria | 1168 |
| 531 | Ga0207641_10716011 | 3300026088 | Bacteria | 986 |
| 532 | Ga0207648_10633370 | 3300026089 | Bacteria | 987 |
| 533 | Ga0207648_11020786 | 3300026089 | Bacteria | 775 |
| 534 | Ga0207676_10012959 | 3300026095 | Bacteria | 5988 |
| 535 | Ga0207676_12595028 | 3300026095 | Bacteria | 503 |
| 536 | Ga0207674_10008214 | 3300026116 | Bacteria | 12097 |
| 537 | Ga0207674_10519528 | 3300026116 | Bacteria | 1150 |
| 538 | Ga0207674_10806180 | 3300026116 | Bacteria | 906 |
| 539 | Ga0207674_12121831 | 3300026116 | Bacteria | 526 |
| 540 | Ga0207675_100021206 | 3300026118 | Bacteria | 6053 |
| 541 | Ga0207675_100104034 | 3300026118 | Bacteria | 2676 |
| 542 | Ga0207675_100172608 | 3300026118 | Bacteria | 2067 |
| 543 | Ga0207675_100731699 | 3300026118 | Bacteria | 1000 |
| 544 | Ga0207675_100922042 | 3300026118 | Bacteria | 890 |
| 545 | Ga0207675_101139868 | 3300026118 | Bacteria | 800 |
| 546 | Ga0207683_10406363 | 3300026121 | Bacteria | 1253 |
| 547 | Ga0207683_10737911 | 3300026121 | Bacteria | 913 |
| 548 | Ga0207683_11404006 | 3300026121 | Bacteria | 645 |
| 549 | Ga0209974_10054151 | 3300027876 | Bacteria | 1352 |
| 550 | Ga0209974_10205215 | 3300027876 | Bacteria | 729 |
| 551 | Ga0207428_10787379 | 3300027907 | Bacteria | 676 |
| 552 | Ga0207428_10949238 | 3300027907 | Bacteria | 606 |
| 553 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 554 | Ga0268266_10438449 | 3300028379 | Bacteria | 1240 |
| 555 | Ga0268266_10523183 | 3300028379 | Bacteria | 1134 |
| 556 | Ga0268265_10001206 | 3300028380 | Bacteria | 22480 |
| 557 | Ga0268265_10030635 | 3300028380 | Bacteria | 3877 |
| 558 | Ga0268265_10181305 | 3300028380 | Bacteria | 1809 |
| 559 | Ga0268265_10465008 | 3300028380 | Bacteria | 1184 |
| 560 | Ga0268265_11007503 | 3300028380 | Bacteria | 823 |
| 561 | Ga0268265_11013431 | 3300028380 | Bacteria | 821 |
| 562 | Ga0268265_11195748 | 3300028380 | Bacteria | 758 |
| 563 | Ga0268265_12016065 | 3300028380 | Bacteria | 584 |
| 564 | Ga0268264_10010528 | 3300028381 | Bacteria | 7647 |
| 565 | Ga0268264_10516616 | 3300028381 | Bacteria | 1167 |
| 566 | Ga0268264_10831144 | 3300028381 | Bacteria | 924 |
| 567 | Ga0268264_10906226 | 3300028381 | Bacteria | 885 |
| 568 | Ga0265337_1230260 | 3300028556 | Bacteria | 504 |
| 569 | Ga0265319_1153311 | 3300028563 | Bacteria | 713 |
| 570 | Ga0265334_10117888 | 3300028573 | Bacteria | 950 |
| 571 | Ga0265334_10264357 | 3300028573 | Bacteria | 591 |
| 572 | Ga0307517_10003957 | 3300028786 | Bacteria | 22943 |
| 573 | Ga0307515_10080475 | 3300028794 | Bacteria | 4248 |
| 574 | Ga0307515_10185861 | 3300028794 | Bacteria | 2008 |
| 575 | Ga0265338_10040090 | 3300028800 | Bacteria | 4404 |
| 576 | Ga0265338_10075300 | 3300028800 | Bacteria | 2865 |
| 577 | Ga0265338_10082066 | 3300028800 | Bacteria | 2700 |
| 578 | Ga0265338_10115692 | 3300028800 | Bacteria | 2149 |
| 579 | Ga0265338_10152366 | 3300028800 | Bacteria | 1795 |
| 580 | Ga0265338_10166659 | 3300028800 | Bacteria | 1695 |
| 581 | Ga0265338_10411884 | 3300028800 | Bacteria | 962 |
| 582 | Ga0316182_1185581 | 3300030745 | Bacteria | 1075 |
| 583 | Ga0265330_10134721 | 3300031235 | Bacteria | 1051 |
| 584 | Ga0265320_10475614 | 3300031240 | Bacteria | 552 |
| 585 | Ga0265340_10490190 | 3300031247 | Bacteria | 541 |
| 586 | Ga0265331_10231556 | 3300031250 | Bacteria | 830 |
| 587 | Ga0265327_10000280 | 3300031251 | Bacteria | 100757 |
| 588 | Ga0265327_10015047 | 3300031251 | Bacteria | 5025 |
| 589 | Ga0265327_10037859 | 3300031251 | Bacteria | 2636 |
| 590 | Ga0265327_10116595 | 3300031251 | Bacteria | 1270 |
| 591 | Ga0265327_10210003 | 3300031251 | Bacteria | 879 |
| 592 | Ga0265316_10371290 | 3300031344 | Bacteria | 1033 |
| 593 | Ga0307513_10000100 | 3300031456 | Bacteria | 125183 |
| 594 | Ga0307513_10003278 | 3300031456 | Bacteria | 22053 |
| 595 | Ga0307513_10021100 | 3300031456 | Bacteria | 7696 |
| 596 | Ga0307513_10147629 | 3300031456 | Bacteria | 2267 |
| 597 | Ga0307509_10924051 | 3300031507 | Bacteria | 538 |
| 598 | Ga0307408_100241565 | 3300031548 | Bacteria | 1485 |
| 599 | Ga0307408_100296711 | 3300031548 | Bacteria | 1352 |
| 600 | Ga0307408_100317322 | 3300031548 | Bacteria | 1311 |
| 601 | Ga0307408_100523961 | 3300031548 | Bacteria | 1041 |
| 602 | Ga0307408_100898456 | 3300031548 | Bacteria | 811 |
| 603 | Ga0307408_100964071 | 3300031548 | Bacteria | 784 |
| 604 | Ga0307408_101207276 | 3300031548 | Bacteria | 706 |
| 605 | Ga0307514_10221183 | 3300031649 | Bacteria | 1161 |
| 606 | Ga0316575_10086787 | 3300031665 | Bacteria | 1265 |
| 607 | Ga0316579_10408310 | 3300031691 | Bacteria | 657 |
| 608 | Ga0265314_10048088 | 3300031711 | Bacteria | 2996 |
| 609 | Ga0265342_10086819 | 3300031712 | Bacteria | 1799 |
| 610 | Ga0265342_10662092 | 3300031712 | Bacteria | 524 |
| 611 | Ga0316576_10036145 | 3300031727 | Bacteria | 3530 |
| 612 | Ga0316578_10029717 | 3300031728 | Bacteria | 3103 |
| 613 | Ga0307516_10149056 | 3300031730 | Bacteria | 2102 |
| 614 | Ga0307516_10331378 | 3300031730 | Bacteria | 1191 |
| 615 | Ga0307405_10190625 | 3300031731 | Bacteria | 1480 |
| 616 | Ga0307405_10224645 | 3300031731 | Bacteria | 1380 |
| 617 | Ga0307405_10690058 | 3300031731 | Bacteria | 844 |
| 618 | Ga0307405_10700499 | 3300031731 | Unclassified | 839 |
| 619 | Ga0307405_10768282 | 3300031731 | Bacteria | 804 |
| 620 | Ga0307405_10942159 | 3300031731 | Bacteria | 733 |
| 621 | Ga0307405_11976640 | 3300031731 | Bacteria | 521 |
| 622 | Ga0307413_10068704 | 3300031824 | Bacteria | 2220 |
| 623 | Ga0307413_10142539 | 3300031824 | Bacteria | 1658 |
| 624 | Ga0307413_10170593 | 3300031824 | Bacteria | 1539 |
| 625 | Ga0307413_10212255 | 3300031824 | Bacteria | 1407 |
| 626 | Ga0307413_10863716 | 3300031824 | Bacteria | 765 |
| 627 | Ga0307413_11493969 | 3300031824 | Bacteria | 597 |
| 628 | Ga0307413_11757938 | 3300031824 | Bacteria | 554 |
| 629 | Ga0307410_10002951 | 3300031852 | Bacteria | 8386 |
| 630 | Ga0307410_11267018 | 3300031852 | Bacteria | 644 |
| 631 | Ga0307410_11475164 | 3300031852 | Bacteria | 599 |
| 632 | Ga0326468_10030048 | 3300031889 | Bacteria | 714 |
| 633 | Ga0307406_10038036 | 3300031901 | Bacteria | 2976 |
| 634 | Ga0307406_10095517 | 3300031901 | Bacteria | 2011 |
| 635 | Ga0307406_10178862 | 3300031901 | Bacteria | 1542 |
| 636 | Ga0307406_10340933 | 3300031901 | Bacteria | 1167 |
| 637 | Ga0307406_11391413 | 3300031901 | Bacteria | 615 |
| 638 | Ga0307407_10454387 | 3300031903 | Bacteria | 930 |
| 639 | Ga0307412_10004367 | 3300031911 | Bacteria | 7883 |
| 640 | Ga0307412_10374182 | 3300031911 | Bacteria | 1151 |
| 641 | Ga0307412_10380014 | 3300031911 | Bacteria | 1143 |
| 642 | Ga0307412_10422691 | 3300031911 | Bacteria | 1090 |
| 643 | Ga0307412_10666930 | 3300031911 | Bacteria | 889 |
| 644 | Ga0307412_10819596 | 3300031911 | Bacteria | 809 |
| 645 | Ga0307412_10939395 | 3300031911 | Bacteria | 760 |
| 646 | Ga0307412_11123106 | 3300031911 | Bacteria | 700 |
| 647 | Ga0307409_100179882 | 3300031995 | Bacteria | 1871 |
| 648 | Ga0307409_100561138 | 3300031995 | Bacteria | 1122 |
| 649 | Ga0307409_100725050 | 3300031995 | Bacteria | 996 |
| 650 | Ga0307409_100864877 | 3300031995 | Bacteria | 916 |
| 651 | Ga0307409_100964293 | 3300031995 | Bacteria | 869 |
| 652 | Ga0307416_100037708 | 3300032002 | Bacteria | 3722 |
| 653 | Ga0307416_100129547 | 3300032002 | Bacteria | 2268 |
| 654 | Ga0307416_100189199 | 3300032002 | Bacteria | 1939 |
| 655 | Ga0307416_100389734 | 3300032002 | Bacteria | 1427 |
| 656 | Ga0307416_100433873 | 3300032002 | Bacteria | 1362 |
| 657 | Ga0307416_101105521 | 3300032002 | Bacteria | 897 |
| 658 | Ga0307416_101145819 | 3300032002 | Bacteria | 883 |
| 659 | Ga0307416_101417688 | 3300032002 | Bacteria | 800 |
| 660 | Ga0307416_102097694 | 3300032002 | Unclassified | 667 |
| 661 | Ga0307416_102174932 | 3300032002 | Bacteria | 656 |
| 662 | Ga0307416_102233796 | 3300032002 | Bacteria | 648 |
| 663 | Ga0307416_103820283 | 3300032002 | Bacteria | 504 |
| 664 | Ga0307414_10031506 | 3300032004 | Bacteria | 3479 |
| 665 | Ga0307414_10057750 | 3300032004 | Bacteria | 2730 |
| 666 | Ga0307414_10238317 | 3300032004 | Bacteria | 1504 |
| 667 | Ga0307414_10342927 | 3300032004 | Bacteria | 1279 |
| 668 | Ga0307414_10350081 | 3300032004 | Bacteria | 1267 |
| 669 | Ga0307414_11547615 | 3300032004 | Bacteria | 617 |
| 670 | Ga0307414_11575460 | 3300032004 | Bacteria | 612 |
| 671 | Ga0307411_10023874 | 3300032005 | Bacteria | 3633 |
| 672 | Ga0307411_10044388 | 3300032005 | Bacteria | 2851 |
| 673 | Ga0307411_10138312 | 3300032005 | Bacteria | 1792 |
| 674 | Ga0307411_10660188 | 3300032005 | Bacteria | 906 |
| 675 | Ga0307411_10778024 | 3300032005 | Bacteria | 841 |
| 676 | Ga0307415_100006354 | 3300032126 | Bacteria | 6362 |
| 677 | Ga0307415_100718061 | 3300032126 | Bacteria | 904 |
| 678 | Ga0307415_100854144 | 3300032126 | Bacteria | 835 |
| 679 | Ga0307415_101117103 | 3300032126 | Bacteria | 739 |
| 680 | Ga0307415_101178221 | 3300032126 | Bacteria | 721 |
| 681 | Ga0307415_101354163 | 3300032126 | Bacteria | 676 |
| 682 | Ga0307415_101442577 | 3300032126 | Bacteria | 657 |
| 683 | Ga0316583_10303319 | 3300032133 | Bacteria | 552 |
| 684 | Ga0316580_10010145 | 3300032139 | Bacteria | 2838 |
| 685 | Ga0316593_10313765 | 3300032168 | Bacteria | 595 |
| 686 | Ga0307510_10106393 | 3300033180 | Bacteria | 2569 |
| 687 | Ga0307510_10337820 | 3300033180 | Bacteria | 959 |
| 688 | Ga0307510_10427982 | 3300033180 | Bacteria | 765 |
| 689 | Ga0307510_10574483 | 3300033180 | Bacteria | 576 |
| 690 | Ga0316592_1092784 | 3300033524 | Bacteria | 691 |
| 691 | Ga0316588_1084877 | 3300033528 | Bacteria | 786 |
| 692 | Ga0316596_1171711 | 3300033541 | Bacteria | 599 |
| 693 | Ga0316596_1227815 | 3300033541 | Bacteria | 522 |
| 694 | Ga0373950_0177590 | 3300034818 | Bacteria | 500 |
| 695 | Ga0373938_0108372 | 3300034957 | Bacteria | 705 |
| 696 | Ga0373934_0431957 | 3300035086 | Bacteria | 551 |
| 697 | Ga0373923_0100456 | 3300035111 | Bacteria | 1275 |
| 698 | Ga0373936_0002108 | 3300035113 | Bacteria | 7393 |
| 699 | Ga0373936_0135076 | 3300035113 | Bacteria | 1062 |
| 700 | Ga0373936_0192601 | 3300035113 | Bacteria | 898 |
| 701 | Ga0373941_0120813 | 3300035115 | Bacteria | 934 |
| 702 | Ga0373945_0391798 | 3300035116 | Bacteria | 608 |
| 703 | Ga0373953_0123771 | 3300035117 | Bacteria | 1099 |
| 704 | Ga0373954_0166710 | 3300035118 | Bacteria | 1078 |
| 705 | Ga0373956_0469499 | 3300035119 | Bacteria | 600 |
| 706 | Ga0373960_0087008 | 3300035121 | Bacteria | 993 |
| 707 | Ga0373943_0576866 | 3300035170 | Bacteria | 661 |
| 708 | Ga0373946_0026220 | 3300035171 | Bacteria | 2297 |
| 709 | Ga0373955_0031767 | 3300035172 | Bacteria | 2767 |
| 710 | Ga0373942_0074927 | 3300035207 | Bacteria | 995 |
| 711 | Ga0373962_0319761 | 3300035242 | Bacteria | 554 |
| 712 | Ga0316574_0916766 | 3300035398 | Bacteria | 530 |
| 713 | Ga0373924_0251430 | 3300035410 | Bacteria | 782 |
| 714 | Ga0373935_0099848 | 3300035692 | Bacteria | 1911 |
| 715 | Ga0373935_0251127 | 3300035692 | Bacteria | 1238 |
| 716 | Ga0373933_0343972 | 3300035724 | Bacteria | 968 |
| 717 | Ga0373933_0360557 | 3300035724 | Bacteria | 945 |
| 718 | Ga0373947_0156168 | 3300035725 | Bacteria | 1472 |
| 719 | Ga0373937_0134663 | 3300036401 | Bacteria | 2309 |
| 720 | Ga0373937_0548289 | 3300036401 | Bacteria | 1098 |
| 721 | Ga0373937_0917668 | 3300036401 | Bacteria | 824 |
| 722 | Ga0373925_0454625 | 3300037068 | Bacteria | 1049 |
| 723 | Ga0395899_0172596 | 3300037312 | Bacteria | 1522 |
| 724 | Ga0395899_0858290 | 3300037312 | Bacteria | 557 |
| 725 | Ga0395900_0026092 | 3300037418 | Bacteria | 5982 |
| 726 | Ga0395900_0132952 | 3300037418 | Bacteria | 2549 |
| 727 | Ga0395900_0373927 | 3300037418 | Bacteria | 1394 |
| 728 | Ga0395900_1083319 | 3300037418 | Bacteria | 719 |
| 729 | Ga0395898_0020586 | 3300037466 | Bacteria | 6700 |
| 730 | Ga0395905_0058657 | 3300037471 | Bacteria | 3599 |
| 731 | Ga0395905_0287381 | 3300037471 | Bacteria | 1531 |
| 732 | Ga0395905_0308378 | 3300037471 | Bacteria | 1471 |
| 733 | Ga0395905_0598646 | 3300037471 | Bacteria | 1004 |
| 734 | Ga0395905_1008775 | 3300037471 | Bacteria | 735 |
| 735 | Ga0395905_1668341 | 3300037471 | Bacteria | 542 |
| 736 | Ga0395901_0024541 | 3300038443 | Bacteria | 6191 |
| 737 | Ga0395901_0094369 | 3300038443 | Bacteria | 3134 |
| 738 | Ga0395901_1411864 | 3300038443 | Bacteria | 654 |
| 739 | Ga0395901_2079600 | 3300038443 | Bacteria | 513 |
| 740 | Ga0400483_129175 | 3300039062 | Bacteria | 1229 |
| 741 | Ga0436365_0165150 | 3300039437 | Bacteria | 3050 |
| 742 | Ga0436365_0412280 | 3300039437 | Bacteria | 4862 |
| 743 | Ga0436365_0792369 | 3300039437 | Bacteria | 967 |
| 744 | Ga0436365_1349511 | 3300039437 | Bacteria | 988 |
| 745 | Ga0436365_1353601 | 3300039437 | Bacteria | 1340 |
| 746 | Ga0436365_1519503 | 3300039437 | Bacteria | 972 |
| 747 | Ga0436360_0031527 | 3300039438 | Bacteria | 998 |
| 748 | Ga0436360_0193881 | 3300039438 | Bacteria | 519 |
| 749 | Ga0436360_0802865 | 3300039438 | Bacteria | 554 |
| 750 | Ga0436360_1129668 | 3300039438 | Bacteria | 522 |
| 751 | Ga0436361_0553807 | 3300039447 | Bacteria | 20297 |
| 752 | Ga0436363_0034667 | 3300039450 | Bacteria | 639 |
| 753 | Ga0436363_0167927 | 3300039450 | Bacteria | 2109 |
| 754 | Ga0436363_0876492 | 3300039450 | Bacteria | 1198 |
| 755 | Ga0436363_1250061 | 3300039450 | Bacteria | 1015 |
| 756 | Ga0439453_0012409 | 3300041408 | Bacteria | 1435 |
| 757 | Ga0439461_0123404 | 3300041410 | Bacteria | 649 |
| 758 | Ga0439465_0167723 | 3300041413 | Bacteria | 790 |
| 759 | Ga0451787_014158 | 3300041441 | Bacteria | 809 |
| 760 | Ga0451789_0130043 | 3300041443 | Bacteria | 521 |
| 761 | Ga0451790_33734 | 3300041444 | Bacteria | 552 |
| 762 | Ga0451794_09956 | 3300041446 | Bacteria | 684 |
| 763 | Ga0451791_0986555 | 3300041451 | Bacteria | 746 |
| 764 | Ga0451791_1141798 | 3300041451 | Bacteria | 1138 |
| 765 | Ga0451793_0143183 | 3300041452 | Bacteria | 515 |
| 766 | Ga0451793_1580084 | 3300041452 | Bacteria | 533 |
| 767 | Ga0451797_1241774 | 3300041453 | Bacteria | 621 |
| 768 | Ga0451797_1562136 | 3300041453 | Bacteria | 746 |
| 769 | Ga0451801_31341 | 3300041455 | Bacteria | 524 |
| 770 | Ga0451795_0372914 | 3300041456 | Bacteria | 892 |
| 771 | Ga0451800_1087923 | 3300041459 | Bacteria | 552 |
| 772 | Ga0451802_0313528 | 3300041460 | Bacteria | 568 |
| 773 | Ga0451802_0427992 | 3300041460 | Bacteria | 987 |
| 774 | Ga0451802_0835340 | 3300041460 | Bacteria | 609 |
| 775 | Ga0451805_017743 | 3300041461 | Bacteria | 832 |
| 776 | Ga0451805_019020 | 3300041461 | Bacteria | 702 |
| 777 | Ga0451805_062075 | 3300041461 | Bacteria | 649 |
| 778 | Ga0451806_199844 | 3300041462 | Bacteria | 1017 |
| 779 | Ga0451804_0300224 | 3300041463 | Bacteria | 863 |
| 780 | Ga0451807_1151417 | 3300041486 | Bacteria | 1124 |
| 781 | Ga0451807_2363815 | 3300041486 | Bacteria | 524 |
| 782 | Ga0451833_0300335 | 3300041491 | Bacteria | 740 |
| 783 | Ga0451835_1223003 | 3300041492 | Bacteria | 723 |
| 784 | Ga0451837_1428663 | 3300041494 | Bacteria | 879 |
| 785 | Ga0451839_0946880 | 3300041496 | Bacteria | 942 |
| 786 | Ga0451839_1072371 | 3300041496 | Bacteria | 602 |
| 787 | Ga0451845_0522626 | 3300041501 | Bacteria | 640 |
| 788 | Ga0451846_32729 | 3300041502 | Bacteria | 663 |
| 789 | Ga0451847_0632259 | 3300041503 | Bacteria | 687 |
| 790 | Ga0451849_0010923 | 3300041505 | Bacteria | 621 |
| 791 | Ga0451850_00416 | 3300041506 | Bacteria | 512 |
| 792 | Ga0451843_1189529 | 3300041509 | Bacteria | 525 |
| 793 | Ga0451855_1262419 | 3300041511 | Bacteria | 1047 |
| 794 | Ga0451855_1910206 | 3300041511 | Bacteria | 958 |
| 795 | Ga0451853_0633361 | 3300041512 | Bacteria | 728 |
| 796 | Ga0451853_1923124 | 3300041512 | Bacteria | 1141 |
| 797 | Ga0451853_2561966 | 3300041512 | Bacteria | 1936 |
| 798 | Ga0452268_42262 | 3300041907 | Bacteria | 533 |
| 799 | Ga0439433_0111771 | 3300041999 | Bacteria | 684 |
| 800 | Ga0439433_0178550 | 3300041999 | Bacteria | 555 |
| 801 | Ga0439441_091096 | 3300042001 | Bacteria | 674 |
| 802 | Ga0439445_0086061 | 3300042004 | Bacteria | 882 |
| 803 | Ga0439455_0195698 | 3300042012 | Bacteria | 584 |
| 804 | Ga0439462_0154359 | 3300042015 | Bacteria | 646 |
| 805 | Ga0450923_156787 | 3300042125 | Bacteria | 553 |
| 806 | Ga0450890_037290 | 3300042127 | Bacteria | 710 |
| 807 | Ga0439446_0029309 | 3300042156 | Bacteria | 1588 |
| 808 | Ga0439458_0054448 | 3300042157 | Bacteria | 991 |
| 809 | Ga0439459_0003734 | 3300042438 | Bacteria | 2429 |
| 810 | Ga0439459_0052395 | 3300042438 | Bacteria | 900 |
| 811 | Ga0451577_0000543 | 3300042876 | Bacteria | 61740 |
| 812 | Ga0466965_0205372 | 3300044683 | Bacteria | 1046 |
| 813 | Ga0453684_0000533 | 3300044712 | Bacteria | 144782 |
| 814 | Ga0453684_0095700 | 3300044712 | Bacteria | 3649 |
| 815 | Ga0466960_0214925 | 3300044901 | Bacteria | 1056 |
| 816 | Ga0495627_001096 | 3300046453 | Bacteria | 17686 |
| 817 | Ga0495590_0001565 | 3300046457 | Bacteria | 9804 |
| 818 | Ga0495638_0011692 | 3300046460 | Bacteria | 6045 |
| 819 | Ga0495638_0097961 | 3300046460 | Bacteria | 1757 |
| 820 | Ga0495638_0232966 | 3300046460 | Bacteria | 1023 |
| 821 | Ga0495638_0308158 | 3300046460 | Bacteria | 850 |
| 822 | Ga0495651_0125469 | 3300046462 | Bacteria | 1881 |
| 823 | Ga0495651_0425878 | 3300046462 | Bacteria | 862 |
| 824 | Ga0495650_0000468 | 3300046471 | Bacteria | 62149 |
| 825 | Ga0495650_0134607 | 3300046471 | Bacteria | 899 |
| 826 | Ga0495650_0284709 | 3300046471 | Bacteria | 556 |
| 827 | Ga0495580_0627629 | 3300046472 | Bacteria | 708 |
| 828 | Ga0495584_0306137 | 3300046491 | Bacteria | 807 |
| 829 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 830 | Ga0495583_0023513 | 3300046506 | Bacteria | 3115 |
| 831 | Ga0495606_0016672 | 3300046507 | Bacteria | 5588 |
| 832 | Ga0495606_0038274 | 3300046507 | Bacteria | 3247 |
| 833 | Ga0495608_0195054 | 3300046511 | Bacteria | 1278 |
| 834 | Ga0495610_0048755 | 3300046512 | Bacteria | 2077 |
| 835 | Ga0495616_0006961 | 3300046513 | Bacteria | 6809 |
| 836 | Ga0495620_0141352 | 3300046515 | Bacteria | 941 |
| 837 | Ga0495620_0149407 | 3300046515 | Bacteria | 911 |
| 838 | Ga0495632_0009729 | 3300046519 | Bacteria | 5764 |
| 839 | Ga0495637_0026076 | 3300046520 | Bacteria | 2629 |
| 840 | Ga0495637_0036307 | 3300046520 | Bacteria | 2147 |
| 841 | Ga0495643_0030755 | 3300046522 | Bacteria | 2995 |
| 842 | Ga0495643_0149626 | 3300046522 | Bacteria | 1157 |
| 843 | Ga0495648_0010816 | 3300046524 | Bacteria | 6929 |
| 844 | Ga0495648_0377078 | 3300046524 | Bacteria | 640 |
| 845 | Ga0495663_0028986 | 3300046525 | Bacteria | 1632 |
| 846 | Ga0495663_0390686 | 3300046525 | Bacteria | 511 |
| 847 | Ga0495652_0263381 | 3300046529 | Bacteria | 1271 |
| 848 | Ga0495654_0000199 | 3300046530 | Bacteria | 58450 |
| 849 | Ga0495640_0302089 | 3300046533 | Bacteria | 994 |
| 850 | Ga0495587_0217497 | 3300046536 | Bacteria | 1078 |
| 851 | Ga0495587_0489303 | 3300046536 | Bacteria | 680 |
| 852 | Ga0495609_0212133 | 3300046538 | Bacteria | 806 |
| 853 | Ga0495609_0260227 | 3300046538 | Bacteria | 713 |
| 854 | Ga0495597_0057218 | 3300046542 | Bacteria | 1706 |
| 855 | Ga0495597_0394148 | 3300046542 | Bacteria | 527 |
| 856 | Ga0495645_0313309 | 3300046543 | Bacteria | 1021 |
| 857 | Ga0495633_0003428 | 3300046558 | Bacteria | 10552 |
| 858 | Ga0495633_0051134 | 3300046558 | Bacteria | 1947 |
| 859 | Ga0495667_0118985 | 3300046559 | Bacteria | 1706 |
| 860 | Ga0495656_0191352 | 3300046615 | Bacteria | 1011 |
| 861 | Ga0495656_0496274 | 3300046615 | Bacteria | 647 |
| 862 | Ga0495668_0131932 | 3300046616 | Bacteria | 1367 |
| 863 | Ga0495668_0151790 | 3300046616 | Bacteria | 1269 |
| 864 | Ga0495668_0383898 | 3300046616 | Bacteria | 771 |
| 865 | Ga0495625_0000152 | 3300046660 | Bacteria | 105589 |
| 866 | Ga0495625_0189527 | 3300046660 | Bacteria | 1363 |
| 867 | Ga0495625_0285071 | 3300046660 | Bacteria | 1061 |
| 868 | Ga0495635_0263648 | 3300046663 | Bacteria | 1160 |
| 869 | Ga0495659_0097393 | 3300046664 | Bacteria | 1136 |
| 870 | Ga0495657_0160607 | 3300046675 | Bacteria | 1391 |
| 871 | Ga0495657_0409541 | 3300046675 | Bacteria | 797 |
| 872 | Ga0495613_0000049 | 3300046689 | Bacteria | 122792 |
| 873 | Ga0495670_0154356 | 3300046691 | Bacteria | 1204 |
| 874 | Ga0495670_0279535 | 3300046691 | Unclassified | 893 |
| 875 | Ga0495671_0363605 | 3300046692 | Bacteria | 694 |
| 876 | Ga0495671_0628238 | 3300046692 | Bacteria | 510 |
| 877 | Ga0495649_0000048 | 3300046694 | Bacteria | 118180 |
| 878 | Ga0495589_0013748 | 3300046794 | Bacteria | 4174 |
| 879 | Ga0495600_0452554 | 3300046809 | Bacteria | 794 |
| 880 | Ga0495660_0008301 | 3300046810 | Bacteria | 6080 |
| 881 | Ga0495660_0126268 | 3300046810 | Bacteria | 1288 |
| 882 | Ga0495604_0542713 | 3300047317 | Bacteria | 750 |
| 883 | Ga0495636_0303475 | 3300047318 | Bacteria | 747 |
| 884 | Ga0495674_0825467 | 3300047319 | Bacteria | 720 |
| 885 | Ga0495674_1328424 | 3300047319 | Bacteria | 538 |
| 886 | Ga0495672_0002318 | 3300047320 | Bacteria | 17654 |
| 887 | Ga0495672_0014969 | 3300047320 | Bacteria | 5285 |
| 888 | Ga0495672_0028725 | 3300047320 | Bacteria | 3513 |
| 889 | Ga0495675_0482412 | 3300047444 | Bacteria | 714 |
| 890 | Ga0495675_0490702 | 3300047444 | Bacteria | 706 |
| 891 | Ga0495677_0315135 | 3300047445 | Bacteria | 616 |
| 892 | Ga0495679_004598 | 3300047446 | Bacteria | 6300 |
| 893 | Ga0495673_0009616 | 3300047469 | Bacteria | 5332 |
| 894 | Ga0495673_0037613 | 3300047469 | Bacteria | 2208 |
| 895 | Ga0495673_0248201 | 3300047469 | Bacteria | 650 |
| 896 | Ga0495681_0058372 | 3300047470 | Bacteria | 1788 |
| 897 | Ga0495686_0009578 | 3300047472 | Bacteria | 6962 |
| 898 | Ga0495686_0045341 | 3300047472 | Bacteria | 2782 |
| 899 | Ga0495686_0056387 | 3300047472 | Bacteria | 2455 |
| 900 | Ga0495686_0118768 | 3300047472 | Bacteria | 1578 |
| 901 | Ga0495602_0258751 | 3300048088 | Bacteria | 1292 |
| 902 | Ga0496100_0319614 | 3300048903 | Bacteria | 1166 |
| 903 | Ga0496100_0406379 | 3300048903 | Bacteria | 1038 |
| 904 | Ga0496100_0881621 | 3300048903 | Unclassified | 702 |
| 905 | Ga0496100_1385334 | 3300048903 | Bacteria | 555 |
| 906 | Ga0496100_1424489 | 3300048903 | Bacteria | 547 |
| 907 | Ga0496101_0220741 | 3300048904 | Bacteria | 1471 |
| 908 | Ga0496101_0508344 | 3300048904 | Bacteria | 952 |
| 909 | Ga0496101_1517506 | 3300048904 | Bacteria | 521 |
| 910 | Ga0496102_0003769 | 3300048905 | Bacteria | 12817 |
| 911 | Ga0496102_0047197 | 3300048905 | Bacteria | 3913 |
| 912 | Ga0496102_0091024 | 3300048905 | Bacteria | 2823 |
| 913 | Ga0496102_0162361 | 3300048905 | Bacteria | 2102 |
| 914 | Ga0496102_0519863 | 3300048905 | Bacteria | 1113 |
| 915 | Ga0496102_0606835 | 3300048905 | Bacteria | 1017 |
| 916 | Ga0496103_0015027 | 3300048906 | Bacteria | 4602 |
| 917 | Ga0496103_0289702 | 3300048906 | Bacteria | 1053 |
| 918 | Ga0496104_0332646 | 3300048907 | Bacteria | 1432 |
| 919 | Ga0496104_0549034 | 3300048907 | Unclassified | 1066 |
| 920 | Ga0496105_0074257 | 3300048908 | Bacteria | 2809 |
| 921 | Ga0496106_0002791 | 3300048909 | Bacteria | 12946 |
| 922 | Ga0496106_0004326 | 3300048909 | Bacteria | 10547 |
| 923 | Ga0496106_0147677 | 3300048909 | Bacteria | 1853 |
| 924 | Ga0496106_0153849 | 3300048909 | Bacteria | 1815 |
| 925 | Ga0496106_0240050 | 3300048909 | Bacteria | 1448 |
| 926 | Ga0496107_0002891 | 3300048910 | Bacteria | 11349 |
| 927 | Ga0496107_0006827 | 3300048910 | Bacteria | 7863 |
| 928 | Ga0496107_0240226 | 3300048910 | Bacteria | 1348 |
| 929 | Ga0496107_0352618 | 3300048910 | Bacteria | 1095 |
| 930 | Ga0496107_0624295 | 3300048910 | Bacteria | 795 |
| 931 | Ga0496109_0130840 | 3300048912 | Bacteria | 2342 |
| 932 | Ga0496109_0165656 | 3300048912 | Bacteria | 2072 |
| 933 | Ga0496109_0512819 | 3300048912 | Bacteria | 1132 |
| 934 | Ga0496109_0859087 | 3300048912 | Bacteria | 845 |
| 935 | Ga0496110_0220479 | 3300048913 | Bacteria | 1725 |
| 936 | Ga0496110_0972722 | 3300048913 | Bacteria | 756 |
| 937 | Ga0496110_1323451 | 3300048913 | Bacteria | 630 |
| 938 | Ga0496112_0042175 | 3300048915 | Bacteria | 4464 |
| 939 | Ga0496112_0300801 | 3300048915 | Bacteria | 1550 |
| 940 | Ga0496112_1451187 | 3300048915 | Bacteria | 600 |
| 941 | Ga0496113_0257229 | 3300048916 | Bacteria | 1395 |
| 942 | Ga0496113_1373480 | 3300048916 | Bacteria | 548 |
| 943 | Ga0496114_0267935 | 3300048917 | Bacteria | 1505 |
| 944 | Ga0496114_0406893 | 3300048917 | Bacteria | 1205 |
| 945 | Ga0496114_0799512 | 3300048917 | Bacteria | 822 |
| 946 | Ga0496114_1320444 | 3300048917 | Bacteria | 608 |
| 947 | Ga0496115_0001882 | 3300048918 | Bacteria | 15034 |
| 948 | Ga0496115_0012290 | 3300048918 | Bacteria | 6438 |
| 949 | Ga0496115_0018363 | 3300048918 | Bacteria | 5367 |
| 950 | Ga0496115_0091520 | 3300048918 | Bacteria | 2486 |
| 951 | Ga0496115_0125028 | 3300048918 | Bacteria | 2118 |
| 952 | Ga0496115_0142589 | 3300048918 | Bacteria | 1977 |
| 953 | Ga0496116_0034074 | 3300048919 | Bacteria | 3601 |
| 954 | Ga0496121_0006932 | 3300048924 | Bacteria | 13810 |
| 955 | Ga0496121_0025079 | 3300048924 | Bacteria | 5675 |
| 956 | Ga0496121_0218763 | 3300048924 | Bacteria | 1343 |
| 957 | Ga0496121_0312755 | 3300048924 | Bacteria | 1061 |
| 958 | Ga0496122_0019200 | 3300048925 | Bacteria | 6259 |
| 959 | Ga0496123_0003231 | 3300048926 | Bacteria | 18540 |
| 960 | Ga0496124_0235773 | 3300048927 | Bacteria | 1364 |
| 961 | Ga0496124_0377040 | 3300048927 | Bacteria | 993 |
| 962 | Ga0496124_0388020 | 3300048927 | Bacteria | 974 |
| 963 | Ga0496124_0605547 | 3300048927 | Bacteria | 712 |
| 964 | Ga0496125_0005019 | 3300048928 | Bacteria | 14945 |
| 965 | Ga0496125_0238456 | 3300048928 | Bacteria | 1157 |
| 966 | Ga0496126_0020747 | 3300048929 | Bacteria | 6432 |
| 967 | Ga0496126_0281280 | 3300048929 | Bacteria | 1378 |
| 968 | Ga0496126_0695042 | 3300048929 | Bacteria | 791 |
| 969 | Ga0496126_1333487 | 3300048929 | Bacteria | 521 |
| 970 | Ga0501306_038842 | 3300049127 | Bacteria | 732 |
| 971 | Ga0501306_055739 | 3300049127 | Bacteria | 643 |
| 972 | Ga0501306_071972 | 3300049127 | Bacteria | 585 |
| 973 | Ga0501308_002052 | 3300049128 | Bacteria | 1719 |
| 974 | Ga0501308_067183 | 3300049128 | Bacteria | 551 |
| 975 | Ga0501309_055897 | 3300049129 | Bacteria | 627 |
| 976 | Ga0501304_016396 | 3300049160 | Bacteria | 701 |
| 977 | Ga0501307_036794 | 3300049162 | Bacteria | 699 |
| 978 | Ga0501291_110920 | 3300049514 | Bacteria | 584 |
| 979 | Ga0501298_043813 | 3300049521 | Bacteria | 913 |
| 980 | Ga0501311_026657 | 3300049527 | Bacteria | 816 |
| 981 | Ga0501311_071973 | 3300049527 | Bacteria | 575 |
| 982 | Ga0501312_101100 | 3300049528 | Bacteria | 541 |
| 983 | Ga0501313_044659 | 3300049529 | Bacteria | 602 |
| 984 | Ga0501313_060026 | 3300049529 | Bacteria | 538 |
| 985 | Ga0501314_034091 | 3300049530 | Bacteria | 575 |
| 986 | Ga0501315_038122 | 3300049531 | Bacteria | 718 |
| 987 | Ga0501317_069869 | 3300049533 | Bacteria | 591 |
| 988 | Ga0501319_009655 | 3300049535 | Bacteria | 758 |
| 989 | Ga0501319_019549 | 3300049535 | Bacteria | 600 |
| 990 | Ga0501320_010289 | 3300049536 | Bacteria | 951 |
| 991 | Ga0501320_054744 | 3300049536 | Bacteria | 550 |
| 992 | Ga0501321_030466 | 3300049537 | Bacteria | 719 |
| 993 | Ga0501323_020971 | 3300049539 | Bacteria | 861 |
| 994 | Ga0501324_023178 | 3300049540 | Bacteria | 645 |
| 995 | Ga0501325_031814 | 3300049541 | Bacteria | 608 |
| 996 | Ga0501326_10819 | 3300049542 | Bacteria | 550 |
| 997 | Ga0501332_13471 | 3300049548 | Bacteria | 569 |
| 998 | Ga0501335_035084 | 3300049551 | Bacteria | 578 |
| 999 | Ga0501031_0943306 | 3300049568 | Bacteria | 552 |
| 1000 | Ga0501032_0357693 | 3300049569 | Bacteria | 940 |
| 1001 | Ga0501032_0629437 | 3300049569 | Bacteria | 682 |
| 1002 | Ga0501032_0841737 | 3300049569 | Bacteria | 579 |
| 1003 | Ga0501033_0161773 | 3300049570 | Bacteria | 1611 |
| 1004 | Ga0501034_0000369 | 3300049571 | Bacteria | 76727 |
| 1005 | Ga0501034_0276891 | 3300049571 | Bacteria | 1618 |
| 1006 | Ga0501036_0073757 | 3300049572 | Bacteria | 2885 |
| 1007 | Ga0501036_1154324 | 3300049572 | Bacteria | 632 |
| 1008 | Ga0501036_1253622 | 3300049572 | Bacteria | 603 |
| 1009 | Ga0501036_1414920 | 3300049572 | Bacteria | 564 |
| 1010 | Ga0501036_1689706 | 3300049572 | Bacteria | 510 |
| 1011 | Ga0501038_0668622 | 3300049574 | Bacteria | 780 |
| 1012 | Ga0501039_0083327 | 3300049575 | Bacteria | 2490 |
| 1013 | Ga0501041_0036376 | 3300049577 | Bacteria | 2983 |
| 1014 | Ga0501042_0421174 | 3300049578 | Bacteria | 968 |
| 1015 | Ga0501042_1045035 | 3300049578 | Bacteria | 595 |
| 1016 | Ga0501043_0958466 | 3300049579 | Bacteria | 611 |
| 1017 | Ga0501046_0011384 | 3300049580 | Bacteria | 7611 |
| 1018 | Ga0501046_0241656 | 3300049580 | Bacteria | 1332 |
| 1019 | Ga0501046_0393858 | 3300049580 | Bacteria | 1001 |
| 1020 | Ga0501047_0265028 | 3300049581 | Bacteria | 1565 |
| 1021 | Ga0501047_0313133 | 3300049581 | Bacteria | 1410 |
| 1022 | Ga0501047_0577604 | 3300049581 | Bacteria | 947 |
| 1023 | Ga0501047_0713866 | 3300049581 | Bacteria | 820 |
| 1024 | Ga0501047_0881233 | 3300049581 | Bacteria | 709 |
| 1025 | Ga0501047_0908151 | 3300049581 | Bacteria | 694 |
| 1026 | Ga0501047_0939092 | 3300049581 | Bacteria | 678 |
| 1027 | Ga0501047_1267342 | 3300049581 | Bacteria | 551 |
| 1028 | Ga0501048_0053847 | 3300049582 | Bacteria | 2859 |
| 1029 | Ga0501048_0868282 | 3300049582 | Bacteria | 649 |
| 1030 | Ga0501067_0010065 | 3300049583 | Bacteria | 5232 |
| 1031 | Ga0501067_0072493 | 3300049583 | Bacteria | 1908 |
| 1032 | Ga0501067_0232490 | 3300049583 | Bacteria | 1026 |
| 1033 | Ga0501067_0825746 | 3300049583 | Bacteria | 522 |
| 1034 | Ga0501068_0527927 | 3300049584 | Bacteria | 767 |
| 1035 | Ga0501068_0857022 | 3300049584 | Bacteria | 597 |
| 1036 | Ga0501069_0168755 | 3300049585 | Bacteria | 1262 |
| 1037 | Ga0501070_0711096 | 3300049586 | Bacteria | 794 |
| 1038 | Ga0501071_0103754 | 3300049587 | Bacteria | 2098 |
| 1039 | Ga0501072_0130901 | 3300049588 | Bacteria | 2000 |
| 1040 | Ga0501072_0593658 | 3300049588 | Bacteria | 873 |
| 1041 | Ga0501073_0037252 | 3300049589 | Bacteria | 3454 |
| 1042 | Ga0501073_0469775 | 3300049589 | Bacteria | 870 |
| 1043 | Ga0501073_0718394 | 3300049589 | Bacteria | 689 |
| 1044 | Ga0501074_0063730 | 3300049590 | Bacteria | 2655 |
| 1045 | Ga0501074_0084489 | 3300049590 | Bacteria | 2275 |
| 1046 | Ga0501074_0601244 | 3300049590 | Bacteria | 778 |
| 1047 | Ga0501075_0063296 | 3300049591 | Bacteria | 2788 |
| 1048 | Ga0501076_0012239 | 3300049592 | Bacteria | 6414 |
| 1049 | Ga0501076_0186261 | 3300049592 | Bacteria | 1693 |
| 1050 | Ga0501076_1131097 | 3300049592 | Bacteria | 645 |
| 1051 | Ga0501076_1270391 | 3300049592 | Bacteria | 606 |
| 1052 | Ga0501076_1780405 | 3300049592 | Bacteria | 505 |
| 1053 | Ga0501077_0046071 | 3300049593 | Bacteria | 2771 |
| 1054 | Ga0501077_0060416 | 3300049593 | Bacteria | 2405 |
| 1055 | Ga0501077_1110582 | 3300049593 | Bacteria | 509 |
| 1056 | Ga0501238_000783 | 3300049671 | Bacteria | 3595 |
| 1057 | Ga0501253_044110 | 3300049683 | Bacteria | 911 |
| 1058 | Ga0501079_0015930 | 3300049741 | Bacteria | 5745 |
| 1059 | Ga0501079_0060588 | 3300049741 | Bacteria | 2919 |
| 1060 | Ga0501079_0658667 | 3300049741 | Bacteria | 824 |
| 1061 | Ga0501080_0029716 | 3300049742 | Bacteria | 5087 |
| 1062 | Ga0501080_0053127 | 3300049742 | Bacteria | 3772 |
| 1063 | Ga0501080_0149278 | 3300049742 | Bacteria | 2161 |
| 1064 | Ga0501081_0059167 | 3300049743 | Bacteria | 2652 |
| 1065 | Ga0501081_0060850 | 3300049743 | Bacteria | 2617 |
| 1066 | Ga0501081_0115554 | 3300049743 | Bacteria | 1907 |
| 1067 | Ga0501081_0309641 | 3300049743 | Bacteria | 1159 |
| 1068 | Ga0501083_0047578 | 3300049744 | Bacteria | 2897 |
| 1069 | Ga0501083_0274941 | 3300049744 | Bacteria | 1096 |
| 1070 | Ga0501083_0557753 | 3300049744 | Bacteria | 745 |
| 1071 | Ga0501083_0685066 | 3300049744 | Bacteria | 667 |
| 1072 | Ga0501268_078994 | 3300049765 | Bacteria | 677 |
| 1073 | Ga0501280_075783 | 3300049776 | Bacteria | 610 |
| 1074 | Ga0501035_0212703 | 3300049822 | Bacteria | 1654 |
| 1075 | Ga0501035_0923031 | 3300049822 | Bacteria | 690 |
| 1076 | Ga0501044_0003898 | 3300049823 | Bacteria | 16717 |
| 1077 | Ga0501044_0330910 | 3300049823 | Bacteria | 1446 |
| 1078 | Ga0501044_0365272 | 3300049823 | Bacteria | 1361 |
| 1079 | Ga0501044_1204031 | 3300049823 | Bacteria | 625 |
| 1080 | Ga0501044_1471192 | 3300049823 | Bacteria | 546 |
| 1081 | Ga0501045_0068163 | 3300049824 | Bacteria | 2613 |
| 1082 | Ga0501045_0754348 | 3300049824 | Bacteria | 717 |
| 1083 | nmdc:mga03683_241070_c1 | 3300050489 | Bacteria | 838 |
| 1084 | nmdc:mga03683_406440_c1 | 3300050489 | Bacteria | 651 |
| 1085 | nmdc:mga03n38_417799_c1 | 3300050490 | Unclassified | 741 |
| 1086 | nmdc:mga03n38_943733_c1 | 3300050490 | Bacteria | 509 |
| 1087 | nmdc:mga00v17_1034173_c1 | 3300050491 | Bacteria | 516 |
| 1088 | nmdc:mga00v17_266670_c1 | 3300050491 | Bacteria | 1111 |
| 1089 | nmdc:mga00v17_505960_c1 | 3300050491 | Bacteria | 783 |
| 1090 | nmdc:mga00v17_542613_c1 | 3300050491 | Bacteria | 752 |
| 1091 | nmdc:mga00v17_966720_c1 | 3300050491 | Bacteria | 537 |
| 1092 | nmdc:mga0k408_192269_c1 | 3300050493 | Bacteria | 1218 |
| 1093 | nmdc:mga0k408_324476_c1 | 3300050493 | Bacteria | 919 |
| 1094 | nmdc:mga0k408_407633_c1 | 3300050493 | Bacteria | 809 |
| 1095 | nmdc:mga0k408_48942_c1 | 3300050493 | Bacteria | 2447 |
| 1096 | nmdc:mga0k408_742890_c1 | 3300050493 | Bacteria | 573 |
| 1097 | nmdc:mga07m45_21235_c1 | 3300050496 | Bacteria | 2152 |
| 1098 | nmdc:mga07m45_343552_c1 | 3300050496 | Bacteria | 867 |
| 1099 | nmdc:mga07m45_357764_c1 | 3300050496 | Bacteria | 848 |
| 1100 | nmdc:mga05p37_122797_c1 | 3300050507 | Bacteria | 3190 |
| 1101 | nmdc:mga05p37_1467144_c1 | 3300050507 | Bacteria | 682 |
| 1102 | nmdc:mga05p37_1848956_c1 | 3300050507 | Bacteria | 580 |
| 1103 | nmdc:mga05p37_588696_c1 | 3300050507 | Bacteria | 1258 |
| 1104 | nmdc:mga05p37_71314_c1 | 3300050507 | Bacteria | 4273 |
| 1105 | nmdc:mga05p37_72758_c1 | 3300050507 | Bacteria | 4230 |
| 1106 | nmdc:mga09592_158152_c1 | 3300050508 | Bacteria | 1956 |
| 1107 | nmdc:mga0qj67_12510_c2 | 3300050509 | Bacteria | 5937 |
| 1108 | nmdc:mga0qj67_65221_c1 | 3300050509 | Bacteria | 2899 |
| 1109 | nmdc:mga06r32_40836_c1 | 3300050510 | Bacteria | 4406 |
| 1110 | nmdc:mga06r32_48597_c1 | 3300050510 | Bacteria | 4056 |
| 1111 | nmdc:mga06r32_790726_c1 | 3300050510 | Bacteria | 910 |
| 1112 | nmdc:mga08y16_1051708_c1 | 3300050511 | Bacteria | 791 |
| 1113 | nmdc:mga08y16_46873_c1 | 3300050511 | Bacteria | 4524 |
| 1114 | nmdc:mga0n895_147281_c1 | 3300050512 | Bacteria | 2384 |
| 1115 | nmdc:mga0rr50_431955_c1 | 3300050513 | Bacteria | 1115 |
| 1116 | nmdc:mga08x19_1344177_c1 | 3300050514 | Bacteria | 506 |
| 1117 | nmdc:mga0a205_90841_c1 | 3300050515 | Bacteria | 2950 |
| 1118 | nmdc:mga0sz30_55512_c1 | 3300050516 | Bacteria | 1686 |
| 1119 | Ga0495601_0318698 | 3300053077 | Bacteria | 1012 |
| 1120 | Ga0495595_0041871 | 3300053084 | Bacteria | 2098 |
| 1121 | Ga0495619_0789782 | 3300053085 | Bacteria | 642 |
| 1122 | Ga0500578_0000015 | 3300053086 | Bacteria | 179217 |
| 1123 | Ga0500643_000968 | 3300053087 | Bacteria | 17812 |
| 1124 | Ga0500643_001537 | 3300053087 | Bacteria | 13092 |
| 1125 | Ga0500643_004694 | 3300053087 | Bacteria | 6081 |
| 1126 | Ga0500643_027817 | 3300053087 | Bacteria | 1753 |
| 1127 | Ga0500644_0000058 | 3300053088 | Bacteria | 64557 |
| 1128 | Ga0500644_0001545 | 3300053088 | Bacteria | 6048 |
| 1129 | Ga0500647_0006857 | 3300053091 | Bacteria | 4852 |
| 1130 | Ga0500651_0004155 | 3300053093 | Bacteria | 8072 |
| 1131 | Ga0500651_0107595 | 3300053093 | Bacteria | 1704 |
| 1132 | Ga0500641_0000654 | 3300053096 | Bacteria | 12478 |
| 1133 | Ga0500641_0002664 | 3300053096 | Bacteria | 6303 |
| 1134 | Ga0500641_0031491 | 3300053096 | Bacteria | 2092 |
| 1135 | Ga0500641_0076092 | 3300053096 | Bacteria | 1419 |
| 1136 | Ga0500650_0170722 | 3300053098 | Bacteria | 1000 |
| 1137 | Ga0500650_0203529 | 3300053098 | Bacteria | 901 |
| 1138 | Ga0500650_0504894 | 3300053098 | Bacteria | 514 |
| 1139 | Ga0500555_005991 | 3300053103 | Bacteria | 3450 |
| 1140 | Ga0500555_051950 | 3300053103 | Bacteria | 1120 |
| 1141 | Ga0500556_0003063 | 3300053104 | Bacteria | 5008 |
| 1142 | Ga0500557_184260 | 3300053105 | Bacteria | 677 |
| 1143 | Ga0500562_029255 | 3300053108 | Bacteria | 1449 |
| 1144 | Ga0500562_055144 | 3300053108 | Bacteria | 1065 |
| 1145 | Ga0500594_0008044 | 3300053118 | Bacteria | 2396 |
| 1146 | Ga0500594_0028014 | 3300053118 | Bacteria | 1463 |
| 1147 | Ga0500595_024261 | 3300053119 | Bacteria | 2119 |
| 1148 | Ga0500595_052936 | 3300053119 | Bacteria | 1251 |
| 1149 | Ga0500595_083273 | 3300053119 | Bacteria | 934 |
| 1150 | Ga0500597_060952 | 3300053120 | Bacteria | 1621 |
| 1151 | Ga0500608_000471 | 3300053122 | Bacteria | 15044 |
| 1152 | Ga0500608_057135 | 3300053122 | Bacteria | 1870 |
| 1153 | Ga0500618_002668 | 3300053125 | Bacteria | 6543 |
| 1154 | Ga0500642_0489896 | 3300053130 | Bacteria | 521 |
| 1155 | Ga0500652_042727 | 3300053131 | Bacteria | 1830 |
| 1156 | Ga0500655_034856 | 3300053133 | Bacteria | 977 |
| 1157 | Ga0500655_052680 | 3300053133 | Bacteria | 812 |
| 1158 | Ga0500658_0015841 | 3300053134 | Bacteria | 2804 |
| 1159 | Ga0500559_0000004 | 3300053136 | Bacteria | 241551 |
| 1160 | Ga0500559_0007940 | 3300053136 | Bacteria | 4678 |
| 1161 | Ga0500559_0046749 | 3300053136 | Bacteria | 1898 |
| 1162 | Ga0500559_0346057 | 3300053136 | Bacteria | 695 |
| 1163 | Ga0500568_0105288 | 3300053139 | Bacteria | 1057 |
| 1164 | Ga0500568_0354179 | 3300053139 | Bacteria | 532 |
| 1165 | Ga0500573_0224389 | 3300053140 | Bacteria | 983 |
| 1166 | Ga0500588_0410545 | 3300053146 | Bacteria | 516 |
| 1167 | Ga0500604_0093064 | 3300053151 | Bacteria | 987 |
| 1168 | Ga0500604_0198816 | 3300053151 | Bacteria | 689 |
| 1169 | Ga0500616_0013830 | 3300053153 | Bacteria | 4660 |
| 1170 | Ga0500616_0031769 | 3300053153 | Bacteria | 2890 |
| 1171 | Ga0500616_0034483 | 3300053153 | Bacteria | 2756 |
| 1172 | Ga0500616_0102293 | 3300053153 | Bacteria | 1398 |
| 1173 | Ga0500616_0404285 | 3300053153 | Bacteria | 545 |
| 1174 | Ga0500622_0003216 | 3300053156 | Bacteria | 11108 |
| 1175 | Ga0500622_0008772 | 3300053156 | Bacteria | 5630 |
| 1176 | Ga0500622_0019728 | 3300053156 | Bacteria | 3579 |
| 1177 | Ga0500622_0057699 | 3300053156 | Bacteria | 1985 |
| 1178 | Ga0500622_0086816 | 3300053156 | Bacteria | 1558 |
| 1179 | Ga0500624_000193 | 3300053157 | Bacteria | 24175 |
| 1180 | Ga0500627_0001642 | 3300053158 | Bacteria | 6327 |
| 1181 | Ga0500627_0155284 | 3300053158 | Bacteria | 1033 |
| 1182 | Ga0500633_0167837 | 3300053160 | Bacteria | 824 |
| 1183 | Ga0500634_0147912 | 3300053161 | Bacteria | 1102 |
| 1184 | Ga0500636_0520626 | 3300053177 | Bacteria | 521 |
| 1185 | Ga0500637_0001689 | 3300053178 | Bacteria | 9504 |
| 1186 | Ga0500611_007667 | 3300053727 | Bacteria | 1634 |
| 1187 | Ga0500645_000730 | 3300053730 | Bacteria | 20251 |
| 1188 | Ga0500645_003413 | 3300053730 | Bacteria | 6458 |
| 1189 | Ga0500645_004984 | 3300053730 | Bacteria | 4978 |
| 1190 | Ga0500552_005395 | 3300053733 | Bacteria | 1391 |
| 1191 | Ga0501084_0029290 | 3300054114 | Bacteria | 4605 |
| 1192 | Ga0501084_0059405 | 3300054114 | Bacteria | 3200 |
| 1193 | Ga0501084_0453374 | 3300054114 | Bacteria | 1084 |
| 1194 | Ga0501084_0925832 | 3300054114 | Bacteria | 733 |
| 1195 | Ga0501084_1432218 | 3300054114 | Bacteria | 579 |
| 1196 | Ga0587084_045345 | 3300059477 | Bacteria | 761 |
| 1197 | Ga0587084_129107 | 3300059477 | Bacteria | 539 |
| 1198 | Ga0587093_108132 | 3300059478 | Bacteria | 509 |
| 1199 | Ga0587066_171539 | 3300059490 | Bacteria | 552 |
| 1200 | Ga0587070_009166 | 3300059491 | Bacteria | 1423 |
| 1201 | Ga0587070_196204 | 3300059491 | Bacteria | 534 |
| 1202 | Ga0587073_0198660 | 3300059492 | Bacteria | 600 |
| 1203 | Ga0587077_078882 | 3300059493 | Bacteria | 751 |
| 1204 | Ga0587077_084621 | 3300059493 | Bacteria | 735 |
| 1205 | Ga0587077_196856 | 3300059493 | Bacteria | 555 |
| 1206 | Ga0587077_268092 | 3300059493 | Bacteria | 500 |
| 1207 | Ga0587080_048073 | 3300059503 | Bacteria | 798 |
| 1208 | Ga0587080_056927 | 3300059503 | Bacteria | 752 |
| 1209 | Ga0587082_062142 | 3300059504 | Bacteria | 739 |
| 1210 | Ga0587082_077604 | 3300059504 | Bacteria | 686 |
| 1211 | Ga0587082_126145 | 3300059504 | Bacteria | 583 |
| 1212 | Ga0587083_0002069 | 3300059505 | Bacteria | 2422 |
| 1213 | Ga0587083_0069149 | 3300059505 | Bacteria | 815 |
| 1214 | Ga0587083_0130208 | 3300059505 | Bacteria | 659 |
| 1215 | Ga0587083_0193085 | 3300059505 | Bacteria | 577 |
| 1216 | Ga0587083_0207277 | 3300059505 | Bacteria | 563 |
| 1217 | Ga0587085_029109 | 3300059506 | Bacteria | 897 |
| 1218 | Ga0587085_032522 | 3300059506 | Bacteria | 866 |
| 1219 | Ga0587085_040279 | 3300059506 | Bacteria | 811 |
| 1220 | Ga0587085_101280 | 3300059506 | Bacteria | 608 |
| 1221 | Ga0587085_131533 | 3300059506 | Bacteria | 560 |
| 1222 | Ga0587086_019882 | 3300059507 | Bacteria | 908 |
| 1223 | Ga0587088_123448 | 3300059508 | Bacteria | 602 |
| 1224 | Ga0587090_045301 | 3300059510 | Bacteria | 788 |
| 1225 | Ga0587090_097141 | 3300059510 | Bacteria | 612 |
| 1226 | Ga0587090_140730 | 3300059510 | Bacteria | 539 |
| 1227 | Ga0587091_122771 | 3300059511 | Bacteria | 633 |
| 1228 | Ga0587091_198655 | 3300059511 | Bacteria | 537 |
| 1229 | Ga0587092_054154 | 3300059512 | Bacteria | 734 |
| 1230 | Ga0587092_107895 | 3300059512 | Bacteria | 581 |
| 1231 | Ga0587094_010142 | 3300059513 | Bacteria | 1216 |
| 1232 | Ga0587094_089105 | 3300059513 | Bacteria | 581 |
| 1233 | Ga0587098_039252 | 3300059604 | Bacteria | 683 |
| 1234 | Ga0587098_052495 | 3300059604 | Bacteria | 622 |
| 1235 | Ga0587125_022605 | 3300059607 | Bacteria | 753 |
| 1236 | Ga0587101_006195 | 3300059623 | Bacteria | 1361 |
| 1237 | Ga0587101_061627 | 3300059623 | Bacteria | 671 |
| 1238 | Ga0587101_082685 | 3300059623 | Bacteria | 611 |
| 1239 | Ga0587101_085971 | 3300059623 | Bacteria | 604 |
| 1240 | Ga0587101_093544 | 3300059623 | Bacteria | 588 |
| 1241 | Ga0587109_168549 | 3300059624 | Bacteria | 552 |
| 1242 | Ga0587109_184727 | 3300059624 | Bacteria | 535 |
| 1243 | Ga0587115_076061 | 3300059626 | Bacteria | 587 |
| 1244 | Ga0587115_102520 | 3300059626 | Bacteria | 532 |
| 1245 | Ga0587128_042925 | 3300059630 | Bacteria | 798 |
| 1246 | Ga0587128_094714 | 3300059630 | Bacteria | 618 |
| 1247 | Ga0587128_096287 | 3300059630 | Bacteria | 614 |
| 1248 | Ga0587062_066382 | 3300059639 | Bacteria | 644 |
| 1249 | Ga0587062_071306 | 3300059639 | Bacteria | 629 |
| 1250 | Ga0587062_087157 | 3300059639 | Bacteria | 589 |
| 1251 | Ga0587068_079951 | 3300059641 | Bacteria | 658 |
| 1252 | Ga0587068_110464 | 3300059641 | Bacteria | 587 |
| 1253 | Ga0587068_161699 | 3300059641 | Bacteria | 513 |
| 1254 | Ga0587068_161715 | 3300059641 | Bacteria | 513 |
| 1255 | Ga0587069_102712 | 3300059642 | Bacteria | 586 |
| 1256 | Ga0587072_066045 | 3300059643 | Bacteria | 755 |
| 1257 | Ga0587072_141462 | 3300059643 | Bacteria | 574 |
| 1258 | Ga0587072_203244 | 3300059643 | Bacteria | 505 |
| 1259 | Ga0587076_005924 | 3300059645 | Bacteria | 1606 |
| 1260 | Ga0587076_177405 | 3300059645 | Bacteria | 534 |
| 1261 | Ga0587078_032556 | 3300059646 | Bacteria | 709 |
| 1262 | Ga0587079_038790 | 3300059647 | Bacteria | 952 |
| 1263 | Ga0587079_072064 | 3300059647 | Bacteria | 773 |
| 1264 | Ga0587079_090939 | 3300059647 | Bacteria | 714 |
| 1265 | Ga0587105_013126 | 3300059651 | Bacteria | 657 |
| 1266 | Ga0587107_012142 | 3300059652 | Bacteria | 1068 |
| 1267 | Ga0587107_051188 | 3300059652 | Bacteria | 701 |
| 1268 | Ga0587108_038871 | 3300059653 | Bacteria | 506 |
| 1269 | Ga0587110_018106 | 3300059654 | Bacteria | 777 |
| 1270 | Ga0587124_033986 | 3300059660 | Bacteria | 574 |
| 1271 | Ga0587071_058758 | 3300060344 | Bacteria | 812 |
| 1272 | Ga0587071_118874 | 3300060344 | Bacteria | 629 |
| 1273 | Ga0587071_150537 | 3300060344 | Bacteria | 578 |
| 1274 | Ga0587111_0003255 | 3300060346 | Bacteria | 2287 |
| 1275 | Ga0587111_0009437 | 3300060346 | Bacteria | 1646 |
| 1276 | Ga0587111_0026302 | 3300060346 | Bacteria | 1159 |
| 1277 | Ga0587111_0050087 | 3300060346 | Bacteria | 919 |
| 1278 | Ga0587111_0079645 | 3300060346 | Bacteria | 781 |
| 1279 | Ga0587111_0120838 | 3300060346 | Bacteria | 674 |
| 1280 | Ga0587111_0193254 | 3300060346 | Bacteria | 573 |
| 1281 | Ga0587111_0230872 | 3300060346 | Bacteria | 538 |
| 1282 | Ga0501082_0007661 | 3300060353 | Bacteria | 9318 |
| 1283 | Ga0501082_0020564 | 3300060353 | Bacteria | 5689 |
| 1284 | Ga0501082_0038268 | 3300060353 | Bacteria | 4138 |
| 1285 | Ga0501082_0041062 | 3300060353 | Bacteria | 3988 |
| 1286 | Ga0501082_0332342 | 3300060353 | Bacteria | 1324 |
| 1287 | Ga0530510_0012139 | 3300061734 | Bacteria | 6047 |
| 1288 | Ga0530510_0164147 | 3300061734 | Bacteria | 1643 |
| 1289 | Ga0530510_1138423 | 3300061734 | Bacteria | 598 |
| 1290 | Ga0530510_1501704 | 3300061734 | Bacteria | 517 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_13497400 | Ga0111539_134974002 | 88 |
| 2 | 3300003215 | JGI25153J46596_10096869 | JGI25153J46596_100968691 | 89 |
| 3 | 3300003322 | rootL2_10142746 | rootL2_101427461 | 89 |
| 4 | 3300003558 | Ga0006558J51389_1030434 | Ga0006558J51389_10304342 | 89 |
| 5 | 3300003773 | Ga0055537_1004646 | Ga0055537_10046461 | 89 |
| 6 | 3300003775 | Ga0055524_1068676 | Ga0055524_10686761 | 89 |
| 7 | 3300003781 | Ga0055536_1004742 | Ga0055536_10047427 | 89 |
| 8 | 3300003781 | Ga0055536_1053798 | Ga0055536_10537981 | 89 |
| 9 | 3300003790 | Ga0055528_1004920 | Ga0055528_10049206 | 89 |
| 10 | 3300003791 | Ga0055530_10009589 | Ga0055530_100095894 | 89 |
| 11 | 3300003792 | Ga0055540_1024508 | Ga0055540_10245082 | 89 |
| 12 | 3300003794 | Ga0055531_10000968 | Ga0055531_1000096812 | 89 |
| 13 | 3300003794 | Ga0055531_10006710 | Ga0055531_100067102 | 89 |
| 14 | 3300003794 | Ga0055531_10007558 | Ga0055531_100075581 | 89 |
| 15 | 3300003794 | Ga0055531_10035065 | Ga0055531_100350652 | 89 |
| 16 | 3300004625 | Ga0055543_1017106 | Ga0055543_10171062 | 89 |
| 17 | 3300004799 | Ga0058863_11934056 | Ga0058863_119340562 | 89 |
| 18 | 3300004800 | Ga0058861_11969232 | Ga0058861_119692322 | 89 |
| 19 | 3300004800 | Ga0058861_12043731 | Ga0058861_120437312 | 89 |
| 20 | 3300004801 | Ga0058860_12201779 | Ga0058860_122017791 | 89 |
| 21 | 3300004803 | Ga0058862_10101958 | Ga0058862_101019582 | 89 |
| 22 | 3300004803 | Ga0058862_12762670 | Ga0058862_127626701 | 89 |
| 23 | 3300004803 | Ga0058862_12763025 | Ga0058862_127630251 | 89 |
| 24 | 3300004803 | Ga0058862_12821347 | Ga0058862_128213471 | 89 |
| 25 | 3300005262 | Ga0065165_1000345 | Ga0065165_100034534 | 89 |
| 26 | 3300005262 | Ga0065165_1001044 | Ga0065165_10010448 | 89 |
| 27 | 3300005289 | Ga0065704_10053697 | Ga0065704_100536972 | 89 |
| 28 | 3300005289 | Ga0065704_10113070 | Ga0065704_101130702 | 89 |
| 29 | 3300005289 | Ga0065704_10657186 | Ga0065704_106571862 | 89 |
| 30 | 3300005289 | Ga0065704_10778563 | Ga0065704_107785631 | 89 |
| 31 | 3300005293 | Ga0065715_10005462 | Ga0065715_100054622 | 89 |
| 32 | 3300005327 | Ga0070658_10625286 | Ga0070658_106252861 | 89 |
| 33 | 3300005327 | Ga0070658_10669684 | Ga0070658_106696841 | 89 |
| 34 | 3300005328 | Ga0070676_10380717 | Ga0070676_103807172 | 89 |
| 35 | 3300005328 | Ga0070676_11592608 | Ga0070676_115926081 | 89 |
| 36 | 3300005330 | Ga0070690_100184757 | Ga0070690_1001847572 | 89 |
| 37 | 3300005331 | Ga0070670_100111080 | Ga0070670_1001110802 | 89 |
| 38 | 3300005331 | Ga0070670_101255424 | Ga0070670_1012554241 | 89 |
| 39 | 3300005334 | Ga0068869_100049925 | Ga0068869_1000499252 | 89 |
| 40 | 3300005334 | Ga0068869_100118268 | Ga0068869_1001182682 | 89 |
| 41 | 3300005334 | Ga0068869_101092181 | Ga0068869_1010921811 | 89 |
| 42 | 3300005334 | Ga0068869_101529218 | Ga0068869_1015292181 | 89 |
| 43 | 3300005335 | Ga0070666_10707515 | Ga0070666_107075151 | 89 |
| 44 | 3300005336 | Ga0070680_100016416 | Ga0070680_1000164162 | 89 |
| 45 | 3300005337 | Ga0070682_101263394 | Ga0070682_1012633941 | 89 |
| 46 | 3300005338 | Ga0068868_101159455 | Ga0068868_1011594551 | 89 |
| 47 | 3300005338 | Ga0068868_101761723 | Ga0068868_1017617231 | 89 |
| 48 | 3300005339 | Ga0070660_100460371 | Ga0070660_1004603711 | 89 |
| 49 | 3300005339 | Ga0070660_101449038 | Ga0070660_1014490381 | 89 |
| 50 | 3300005339 | Ga0070660_101813807 | Ga0070660_1018138071 | 89 |
| 51 | 3300005340 | Ga0070689_101260739 | Ga0070689_1012607391 | 89 |
| 52 | 3300005341 | Ga0070691_10227010 | Ga0070691_102270102 | 89 |
| 53 | 3300005344 | Ga0070661_100670954 | Ga0070661_1006709542 | 89 |
| 54 | 3300005344 | Ga0070661_100988451 | Ga0070661_1009884511 | 89 |
| 55 | 3300005345 | Ga0070692_10439872 | Ga0070692_104398723 | 89 |
| 56 | 3300005345 | Ga0070692_11249688 | Ga0070692_112496882 | 89 |
| 57 | 3300005347 | Ga0070668_100113463 | Ga0070668_1001134632 | 89 |
| 58 | 3300005347 | Ga0070668_100463259 | Ga0070668_1004632592 | 89 |
| 59 | 3300005347 | Ga0070668_100755407 | Ga0070668_1007554071 | 89 |
| 60 | 3300005353 | Ga0070669_100091793 | Ga0070669_1000917932 | 89 |
| 61 | 3300005353 | Ga0070669_100939978 | Ga0070669_1009399782 | 89 |
| 62 | 3300005353 | Ga0070669_101431469 | Ga0070669_1014314691 | 89 |
| 63 | 3300005354 | Ga0070675_100713125 | Ga0070675_1007131251 | 89 |
| 64 | 3300005354 | Ga0070675_100951533 | Ga0070675_1009515331 | 89 |
| 65 | 3300005356 | Ga0070674_100462839 | Ga0070674_1004628392 | 89 |
| 66 | 3300005356 | Ga0070674_101737076 | Ga0070674_1017370761 | 89 |
| 67 | 3300005366 | Ga0070659_100015080 | Ga0070659_1000150802 | 89 |
| 68 | 3300005366 | Ga0070659_100508916 | Ga0070659_1005089161 | 89 |
| 69 | 3300005367 | Ga0070667_100464157 | Ga0070667_1004641571 | 89 |
| 70 | 3300005367 | Ga0070667_100823887 | Ga0070667_1008238872 | 89 |
| 71 | 3300005367 | Ga0070667_101366872 | Ga0070667_1013668722 | 89 |
| 72 | 3300005367 | Ga0070667_101497008 | Ga0070667_1014970081 | 89 |
| 73 | 3300005367 | Ga0070667_101923418 | Ga0070667_1019234181 | 89 |
| 74 | 3300005406 | Ga0070703_10042681 | Ga0070703_100426812 | 89 |
| 75 | 3300005435 | Ga0070714_100503652 | Ga0070714_1005036522 | 89 |
| 76 | 3300005436 | Ga0070713_101636727 | Ga0070713_1016367272 | 89 |
| 77 | 3300005438 | Ga0070701_10046848 | Ga0070701_100468482 | 89 |
| 78 | 3300005439 | Ga0070711_100479064 | Ga0070711_1004790642 | 89 |
| 79 | 3300005440 | Ga0070705_100000422 | Ga0070705_10000042220 | 89 |
| 80 | 3300005440 | Ga0070705_100612625 | Ga0070705_1006126251 | 89 |
| 81 | 3300005441 | Ga0070700_100000646 | Ga0070700_10000064614 | 89 |
| 82 | 3300005441 | Ga0070700_100255677 | Ga0070700_1002556771 | 89 |
| 83 | 3300005441 | Ga0070700_101357823 | Ga0070700_1013578232 | 89 |
| 84 | 3300005444 | Ga0070694_100001076 | Ga0070694_10000107612 | 89 |
| 85 | 3300005444 | Ga0070694_100314683 | Ga0070694_1003146832 | 89 |
| 86 | 3300005444 | Ga0070694_100760996 | Ga0070694_1007609961 | 89 |
| 87 | 3300005444 | Ga0070694_101406741 | Ga0070694_1014067411 | 89 |
| 88 | 3300005445 | Ga0070708_100086386 | Ga0070708_1000863862 | 89 |
| 89 | 3300005445 | Ga0070708_101039194 | Ga0070708_1010391941 | 89 |
| 90 | 3300005455 | Ga0070663_100016933 | Ga0070663_1000169333 | 89 |
| 91 | 3300005455 | Ga0070663_100206840 | Ga0070663_1002068402 | 89 |
| 92 | 3300005455 | Ga0070663_101578351 | Ga0070663_1015783511 | 89 |
| 93 | 3300005456 | Ga0070678_100467269 | Ga0070678_1004672692 | 89 |
| 94 | 3300005456 | Ga0070678_100912178 | Ga0070678_1009121782 | 89 |
| 95 | 3300005456 | Ga0070678_101029372 | Ga0070678_1010293721 | 89 |
| 96 | 3300005456 | Ga0070678_101315047 | Ga0070678_1013150472 | 89 |
| 97 | 3300005457 | Ga0070662_100035296 | Ga0070662_1000352962 | 89 |
| 98 | 3300005466 | Ga0070685_11615019 | Ga0070685_116150191 | 89 |
| 99 | 3300005467 | Ga0070706_100313262 | Ga0070706_1003132622 | 89 |
| 100 | 3300005467 | Ga0070706_101078426 | Ga0070706_1010784261 | 89 |
| 101 | 3300005468 | Ga0070707_100684776 | Ga0070707_1006847762 | 89 |
| 102 | 3300005471 | Ga0070698_100102986 | Ga0070698_1001029862 | 89 |
| 103 | 3300005471 | Ga0070698_100229707 | Ga0070698_1002297072 | 89 |
| 104 | 3300005471 | Ga0070698_100657213 | Ga0070698_1006572131 | 89 |
| 105 | 3300005471 | Ga0070698_100917818 | Ga0070698_1009178182 | 89 |
| 106 | 3300005471 | Ga0070698_101291247 | Ga0070698_1012912471 | 89 |
| 107 | 3300005471 | Ga0070698_101807300 | Ga0070698_1018073001 | 89 |
| 108 | 3300005518 | Ga0070699_100011141 | Ga0070699_1000111413 | 89 |
| 109 | 3300005518 | Ga0070699_100084090 | Ga0070699_1000840902 | 89 |
| 110 | 3300005518 | Ga0070699_100088848 | Ga0070699_1000888482 | 89 |
| 111 | 3300005518 | Ga0070699_100148536 | Ga0070699_1001485362 | 89 |
| 112 | 3300005530 | Ga0070679_100098880 | Ga0070679_1000988802 | 89 |
| 113 | 3300005530 | Ga0070679_100663362 | Ga0070679_1006633622 | 89 |
| 114 | 3300005535 | Ga0070684_101108936 | Ga0070684_1011089361 | 89 |
| 115 | 3300005535 | Ga0070684_101993843 | Ga0070684_1019938431 | 89 |
| 116 | 3300005536 | Ga0070697_100020913 | Ga0070697_1000209132 | 89 |
| 117 | 3300005536 | Ga0070697_100021215 | Ga0070697_1000212154 | 89 |
| 118 | 3300005536 | Ga0070697_101163812 | Ga0070697_1011638121 | 89 |
| 119 | 3300005539 | Ga0068853_100135251 | Ga0068853_1001352513 | 89 |
| 120 | 3300005539 | Ga0068853_100229928 | Ga0068853_1002299282 | 89 |
| 121 | 3300005539 | Ga0068853_100853413 | Ga0068853_1008534132 | 89 |
| 122 | 3300005545 | Ga0070695_100010589 | Ga0070695_1000105892 | 89 |
| 123 | 3300005545 | Ga0070695_100834306 | Ga0070695_1008343061 | 89 |
| 124 | 3300005545 | Ga0070695_100913471 | Ga0070695_1009134712 | 89 |
| 125 | 3300005545 | Ga0070695_101394124 | Ga0070695_1013941241 | 89 |
| 126 | 3300005545 | Ga0070695_101418543 | Ga0070695_1014185431 | 89 |
| 127 | 3300005546 | Ga0070696_100003141 | Ga0070696_1000031413 | 89 |
| 128 | 3300005546 | Ga0070696_100061214 | Ga0070696_1000612142 | 89 |
| 129 | 3300005546 | Ga0070696_100311747 | Ga0070696_1003117471 | 89 |
| 130 | 3300005547 | Ga0070693_100047576 | Ga0070693_1000475762 | 89 |
| 131 | 3300005547 | Ga0070693_100524656 | Ga0070693_1005246562 | 89 |
| 132 | 3300005547 | Ga0070693_100755821 | Ga0070693_1007558211 | 89 |
| 133 | 3300005547 | Ga0070693_101186723 | Ga0070693_1011867231 | 89 |
| 134 | 3300005547 | Ga0070693_101478322 | Ga0070693_1014783221 | 89 |
| 135 | 3300005548 | Ga0070665_100000187 | Ga0070665_10000018711 | 89 |
| 136 | 3300005548 | Ga0070665_100111454 | Ga0070665_1001114542 | 89 |
| 137 | 3300005548 | Ga0070665_100366247 | Ga0070665_1003662471 | 89 |
| 138 | 3300005548 | Ga0070665_101047263 | Ga0070665_1010472632 | 89 |
| 139 | 3300005548 | Ga0070665_102279128 | Ga0070665_1022791282 | 89 |
| 140 | 3300005548 | Ga0070665_102400754 | Ga0070665_1024007541 | 89 |
| 141 | 3300005549 | Ga0070704_100069383 | Ga0070704_1000693832 | 89 |
| 142 | 3300005549 | Ga0070704_100561558 | Ga0070704_1005615581 | 89 |
| 143 | 3300005563 | Ga0068855_100477917 | Ga0068855_1004779172 | 89 |
| 144 | 3300005563 | Ga0068855_100722158 | Ga0068855_1007221582 | 89 |
| 145 | 3300005563 | Ga0068855_100859354 | Ga0068855_1008593541 | 89 |
| 146 | 3300005563 | Ga0068855_101458103 | Ga0068855_1014581032 | 89 |
| 147 | 3300005563 | Ga0068855_101480494 | Ga0068855_1014804941 | 89 |
| 148 | 3300005563 | Ga0068855_102349453 | Ga0068855_1023494531 | 89 |
| 149 | 3300005564 | Ga0070664_101373789 | Ga0070664_1013737892 | 89 |
| 150 | 3300005577 | Ga0068857_100051141 | Ga0068857_1000511412 | 89 |
| 151 | 3300005577 | Ga0068857_100867067 | Ga0068857_1008670671 | 89 |
| 152 | 3300005577 | Ga0068857_100930406 | Ga0068857_1009304062 | 89 |
| 153 | 3300005577 | Ga0068857_101597264 | Ga0068857_1015972642 | 89 |
| 154 | 3300005614 | Ga0068856_100125919 | Ga0068856_1001259192 | 89 |
| 155 | 3300005614 | Ga0068856_100189873 | Ga0068856_1001898732 | 89 |
| 156 | 3300005615 | Ga0070702_100548035 | Ga0070702_1005480352 | 89 |
| 157 | 3300005616 | Ga0068852_100725546 | Ga0068852_1007255462 | 89 |
| 158 | 3300005616 | Ga0068852_100949953 | Ga0068852_1009499532 | 89 |
| 159 | 3300005616 | Ga0068852_101048322 | Ga0068852_1010483222 | 89 |
| 160 | 3300005617 | Ga0068859_100001348 | Ga0068859_1000013483 | 89 |
| 161 | 3300005617 | Ga0068859_100308317 | Ga0068859_1003083172 | 89 |
| 162 | 3300005617 | Ga0068859_100859924 | Ga0068859_1008599241 | 89 |
| 163 | 3300005617 | Ga0068859_101253628 | Ga0068859_1012536282 | 89 |
| 164 | 3300005618 | Ga0068864_100078352 | Ga0068864_1000783522 | 89 |
| 165 | 3300005618 | Ga0068864_100179969 | Ga0068864_1001799692 | 89 |
| 166 | 3300005618 | Ga0068864_100388174 | Ga0068864_1003881742 | 89 |
| 167 | 3300005618 | Ga0068864_101764359 | Ga0068864_1017643592 | 89 |
| 168 | 3300005718 | Ga0068866_10180745 | Ga0068866_101807452 | 89 |
| 169 | 3300005718 | Ga0068866_10957200 | Ga0068866_109572001 | 89 |
| 170 | 3300005718 | Ga0068866_11472197 | Ga0068866_114721971 | 89 |
| 171 | 3300005719 | Ga0068861_100006874 | Ga0068861_1000068747 | 89 |
| 172 | 3300005719 | Ga0068861_100424264 | Ga0068861_1004242642 | 89 |
| 173 | 3300005719 | Ga0068861_100572277 | Ga0068861_1005722772 | 89 |
| 174 | 3300005719 | Ga0068861_101285715 | Ga0068861_1012857152 | 89 |
| 175 | 3300005719 | Ga0068861_101465516 | Ga0068861_1014655162 | 89 |
| 176 | 3300005840 | Ga0068870_10555349 | Ga0068870_105553492 | 89 |
| 177 | 3300005840 | Ga0068870_11194866 | Ga0068870_111948661 | 89 |
| 178 | 3300005841 | Ga0068863_100335627 | Ga0068863_1003356272 | 89 |
| 179 | 3300005841 | Ga0068863_100820669 | Ga0068863_1008206692 | 89 |
| 180 | 3300005841 | Ga0068863_100942717 | Ga0068863_1009427172 | 89 |
| 181 | 3300005841 | Ga0068863_101536035 | Ga0068863_1015360351 | 89 |
| 182 | 3300005841 | Ga0068863_102557560 | Ga0068863_1025575602 | 89 |
| 183 | 3300005842 | Ga0068858_100948399 | Ga0068858_1009483992 | 89 |
| 184 | 3300005843 | Ga0068860_100014816 | Ga0068860_1000148163 | 89 |
| 185 | 3300005843 | Ga0068860_100226978 | Ga0068860_1002269782 | 89 |
| 186 | 3300005843 | Ga0068860_100459488 | Ga0068860_1004594882 | 89 |
| 187 | 3300005843 | Ga0068860_100490209 | Ga0068860_1004902092 | 89 |
| 188 | 3300005844 | Ga0068862_100001566 | Ga0068862_1000015667 | 89 |
| 189 | 3300005844 | Ga0068862_100016985 | Ga0068862_1000169852 | 89 |
| 190 | 3300005844 | Ga0068862_100027838 | Ga0068862_1000278382 | 89 |
| 191 | 3300005844 | Ga0068862_100813013 | Ga0068862_1008130132 | 89 |
| 192 | 3300005844 | Ga0068862_101560373 | Ga0068862_1015603731 | 89 |
| 193 | 3300005844 | Ga0068862_101954523 | Ga0068862_1019545231 | 89 |
| 194 | 3300005937 | Ga0081455_10070527 | Ga0081455_100705272 | 89 |
| 195 | 3300005937 | Ga0081455_10380279 | Ga0081455_103802792 | 89 |
| 196 | 3300005983 | Ga0081540_1119940 | Ga0081540_11199402 | 89 |
| 197 | 3300005985 | Ga0081539_10132353 | Ga0081539_101323532 | 89 |
| 198 | 3300006038 | Ga0075365_10686934 | Ga0075365_106869342 | 89 |
| 199 | 3300006038 | Ga0075365_11117540 | Ga0075365_111175401 | 89 |
| 200 | 3300006048 | Ga0075363_100124223 | Ga0075363_1001242232 | 89 |
| 201 | 3300006048 | Ga0075363_100576261 | Ga0075363_1005762612 | 89 |
| 202 | 3300006048 | Ga0075363_100592633 | Ga0075363_1005926332 | 89 |
| 203 | 3300006051 | Ga0075364_10076847 | Ga0075364_100768472 | 89 |
| 204 | 3300006051 | Ga0075364_10275765 | Ga0075364_102757652 | 89 |
| 205 | 3300006051 | Ga0075364_10317377 | Ga0075364_103173772 | 89 |
| 206 | 3300006051 | Ga0075364_10484407 | Ga0075364_104844072 | 89 |
| 207 | 3300006051 | Ga0075364_10564703 | Ga0075364_105647031 | 89 |
| 208 | 3300006051 | Ga0075364_10727560 | Ga0075364_107275601 | 89 |
| 209 | 3300006051 | Ga0075364_11012878 | Ga0075364_110128781 | 89 |
| 210 | 3300006163 | Ga0070715_10000031 | Ga0070715_1000003175 | 89 |
| 211 | 3300006173 | Ga0070716_100472419 | Ga0070716_1004724191 | 89 |
| 212 | 3300006175 | Ga0070712_100491086 | Ga0070712_1004910861 | 89 |
| 213 | 3300006177 | Ga0075362_10193590 | Ga0075362_101935902 | 89 |
| 214 | 3300006178 | Ga0075367_10182503 | Ga0075367_101825032 | 89 |
| 215 | 3300006178 | Ga0075367_10327488 | Ga0075367_103274882 | 89 |
| 216 | 3300006178 | Ga0075367_10798426 | Ga0075367_107984261 | 89 |
| 217 | 3300006186 | Ga0075369_10043828 | Ga0075369_100438282 | 89 |
| 218 | 3300006195 | Ga0075366_10114577 | Ga0075366_101145772 | 89 |
| 219 | 3300006195 | Ga0075366_10394632 | Ga0075366_103946322 | 89 |
| 220 | 3300006195 | Ga0075366_10547553 | Ga0075366_105475533 | 89 |
| 221 | 3300006195 | Ga0075366_10576897 | Ga0075366_105768971 | 89 |
| 222 | 3300006237 | Ga0097621_100316806 | Ga0097621_1003168062 | 89 |
| 223 | 3300006353 | Ga0075370_10109639 | Ga0075370_101096392 | 89 |
| 224 | 3300006353 | Ga0075370_10292586 | Ga0075370_102925861 | 89 |
| 225 | 3300006353 | Ga0075370_10353252 | Ga0075370_103532522 | 89 |
| 226 | 3300006358 | Ga0068871_100764926 | Ga0068871_1007649262 | 89 |
| 227 | 3300006844 | Ga0075428_100095612 | Ga0075428_1000956124 | 89 |
| 228 | 3300006844 | Ga0075428_101142595 | Ga0075428_1011425952 | 89 |
| 229 | 3300006844 | Ga0075428_101210736 | Ga0075428_1012107362 | 89 |
| 230 | 3300006846 | Ga0075430_100016885 | Ga0075430_1000168854 | 89 |
| 231 | 3300006846 | Ga0075430_100068032 | Ga0075430_1000680322 | 89 |
| 232 | 3300006847 | Ga0075431_100006929 | Ga0075431_10000692912 | 89 |
| 233 | 3300006847 | Ga0075431_100007900 | Ga0075431_1000079003 | 89 |
| 234 | 3300006847 | Ga0075431_100119471 | Ga0075431_1001194712 | 89 |
| 235 | 3300006847 | Ga0075431_100932465 | Ga0075431_1009324652 | 89 |
| 236 | 3300006852 | Ga0075433_10149593 | Ga0075433_101495932 | 89 |
| 237 | 3300006852 | Ga0075433_10918707 | Ga0075433_109187071 | 89 |
| 238 | 3300006871 | Ga0075434_100418729 | Ga0075434_1004187292 | 89 |
| 239 | 3300006880 | Ga0075429_100163276 | Ga0075429_1001632762 | 89 |
| 240 | 3300006881 | Ga0068865_100025593 | Ga0068865_1000255932 | 89 |
| 241 | 3300006881 | Ga0068865_100272278 | Ga0068865_1002722781 | 89 |
| 242 | 3300006881 | Ga0068865_100360862 | Ga0068865_1003608622 | 89 |
| 243 | 3300006881 | Ga0068865_100567893 | Ga0068865_1005678931 | 89 |
| 244 | 3300006881 | Ga0068865_100837874 | Ga0068865_1008378742 | 89 |
| 245 | 3300006881 | Ga0068865_101126665 | Ga0068865_1011266652 | 89 |
| 246 | 3300006931 | Ga0097620_100001348 | Ga0097620_1000013483 | 89 |
| 247 | 3300006931 | Ga0097620_100308337 | Ga0097620_1003083372 | 89 |
| 248 | 3300006931 | Ga0097620_100859866 | Ga0097620_1008598661 | 89 |
| 249 | 3300006931 | Ga0097620_101253638 | Ga0097620_1012536382 | 89 |
| 250 | 3300007076 | Ga0075435_100301837 | Ga0075435_1003018372 | 89 |
| 251 | 3300007076 | Ga0075435_100502749 | Ga0075435_1005027492 | 89 |
| 252 | 3300007076 | Ga0075435_100641183 | Ga0075435_1006411832 | 89 |
| 253 | 3300009036 | Ga0105244_10532145 | Ga0105244_105321451 | 89 |
| 254 | 3300009092 | Ga0105250_10006712 | Ga0105250_100067125 | 89 |
| 255 | 3300009093 | Ga0105240_10011290 | Ga0105240_100112902 | 89 |
| 256 | 3300009093 | Ga0105240_10236334 | Ga0105240_102363342 | 89 |
| 257 | 3300009093 | Ga0105240_10596293 | Ga0105240_105962932 | 89 |
| 258 | 3300009093 | Ga0105240_10618521 | Ga0105240_106185212 | 89 |
| 259 | 3300009093 | Ga0105240_10668291 | Ga0105240_106682911 | 89 |
| 260 | 3300009093 | Ga0105240_10898609 | Ga0105240_108986092 | 89 |
| 261 | 3300009094 | Ga0111539_10079678 | Ga0111539_100796782 | 89 |
| 262 | 3300009094 | Ga0111539_10545879 | Ga0111539_105458792 | 89 |
| 263 | 3300009098 | Ga0105245_10224845 | Ga0105245_102248452 | 89 |
| 264 | 3300009098 | Ga0105245_10683292 | Ga0105245_106832922 | 89 |
| 265 | 3300009098 | Ga0105245_12367960 | Ga0105245_123679602 | 89 |
| 266 | 3300009098 | Ga0105245_12592299 | Ga0105245_125922991 | 89 |
| 267 | 3300009101 | Ga0105247_10291118 | Ga0105247_102911182 | 89 |
| 268 | 3300009147 | Ga0114129_10045488 | Ga0114129_100454884 | 89 |
| 269 | 3300009147 | Ga0114129_10332574 | Ga0114129_103325741 | 89 |
| 270 | 3300009147 | Ga0114129_10740823 | Ga0114129_107408232 | 89 |
| 271 | 3300009147 | Ga0114129_10805309 | Ga0114129_108053092 | 89 |
| 272 | 3300009147 | Ga0114129_11810165 | Ga0114129_118101652 | 89 |
| 273 | 3300009147 | Ga0114129_12063250 | Ga0114129_120632502 | 89 |
| 274 | 3300009148 | Ga0105243_10137333 | Ga0105243_101373332 | 89 |
| 275 | 3300009148 | Ga0105243_10181582 | Ga0105243_101815822 | 89 |
| 276 | 3300009148 | Ga0105243_11238242 | Ga0105243_112382422 | 89 |
| 277 | 3300009148 | Ga0105243_11325068 | Ga0105243_113250682 | 89 |
| 278 | 3300009148 | Ga0105243_11410710 | Ga0105243_114107102 | 89 |
| 279 | 3300009174 | Ga0105241_10303952 | Ga0105241_103039522 | 89 |
| 280 | 3300009174 | Ga0105241_10371163 | Ga0105241_103711632 | 89 |
| 281 | 3300009174 | Ga0105241_10371798 | Ga0105241_103717981 | 89 |
| 282 | 3300009174 | Ga0105241_10905885 | Ga0105241_109058852 | 89 |
| 283 | 3300009174 | Ga0105241_10987422 | Ga0105241_109874221 | 89 |
| 284 | 3300009176 | Ga0105242_10232711 | Ga0105242_102327113 | 89 |
| 285 | 3300009176 | Ga0105242_10394715 | Ga0105242_103947152 | 89 |
| 286 | 3300009176 | Ga0105242_10515666 | Ga0105242_105156662 | 89 |
| 287 | 3300009176 | Ga0105242_11241810 | Ga0105242_112418102 | 89 |
| 288 | 3300009176 | Ga0105242_11443437 | Ga0105242_114434372 | 89 |
| 289 | 3300009176 | Ga0105242_11870363 | Ga0105242_118703632 | 89 |
| 290 | 3300009177 | Ga0105248_10631821 | Ga0105248_106318211 | 89 |
| 291 | 3300009545 | Ga0105237_10648427 | Ga0105237_106484272 | 89 |
| 292 | 3300009545 | Ga0105237_11332160 | Ga0105237_113321602 | 89 |
| 293 | 3300009545 | Ga0105237_11918943 | Ga0105237_119189431 | 89 |
| 294 | 3300009551 | Ga0105238_10061875 | Ga0105238_100618752 | 89 |
| 295 | 3300009551 | Ga0105238_10077822 | Ga0105238_100778224 | 89 |
| 296 | 3300009551 | Ga0105238_10192854 | Ga0105238_101928542 | 89 |
| 297 | 3300009551 | Ga0105238_10211229 | Ga0105238_102112292 | 89 |
| 298 | 3300009551 | Ga0105238_10229711 | Ga0105238_102297112 | 89 |
| 299 | 3300009551 | Ga0105238_10396633 | Ga0105238_103966332 | 89 |
| 300 | 3300009551 | Ga0105238_10603881 | Ga0105238_106038811 | 89 |
| 301 | 3300009551 | Ga0105238_11518864 | Ga0105238_115188642 | 89 |
| 302 | 3300009551 | Ga0105238_12317508 | Ga0105238_123175081 | 89 |
| 303 | 3300009553 | Ga0105249_10000689 | Ga0105249_100006892 | 89 |
| 304 | 3300009553 | Ga0105249_10511220 | Ga0105249_105112202 | 89 |
| 305 | 3300009553 | Ga0105249_11035945 | Ga0105249_110359452 | 89 |
| 306 | 3300009553 | Ga0105249_12892584 | Ga0105249_128925841 | 89 |
| 307 | 3300010375 | Ga0105239_10123802 | Ga0105239_101238022 | 89 |
| 308 | 3300010375 | Ga0105239_10916730 | Ga0105239_109167302 | 89 |
| 309 | 3300010375 | Ga0105239_12398926 | Ga0105239_123989262 | 89 |
| 310 | 3300011119 | Ga0105246_10099127 | Ga0105246_100991272 | 89 |
| 311 | 3300011119 | Ga0105246_10395020 | Ga0105246_103950202 | 89 |
| 312 | 3300011119 | Ga0105246_11246818 | Ga0105246_112468182 | 89 |
| 313 | 3300011119 | Ga0105246_11320725 | Ga0105246_113207251 | 89 |
| 314 | 3300011119 | Ga0105246_11742197 | Ga0105246_117421972 | 89 |
| 315 | 3300012495 | Ga0157323_1033709 | Ga0157323_10337092 | 89 |
| 316 | 3300012497 | Ga0157319_1008110 | Ga0157319_10081102 | 89 |
| 317 | 3300012513 | Ga0157326_1037903 | Ga0157326_10379032 | 89 |
| 318 | 3300013100 | Ga0157373_10009155 | Ga0157373_100091558 | 89 |
| 319 | 3300013102 | Ga0157371_11017213 | Ga0157371_110172132 | 89 |
| 320 | 3300013104 | Ga0157370_10080372 | Ga0157370_100803722 | 89 |
| 321 | 3300013104 | Ga0157370_10231753 | Ga0157370_102317532 | 89 |
| 322 | 3300013104 | Ga0157370_10336172 | Ga0157370_103361722 | 89 |
| 323 | 3300013105 | Ga0157369_10019954 | Ga0157369_100199542 | 89 |
| 324 | 3300013105 | Ga0157369_10706873 | Ga0157369_107068732 | 89 |
| 325 | 3300013105 | Ga0157369_12285570 | Ga0157369_122855701 | 89 |
| 326 | 3300013296 | Ga0157374_10117372 | Ga0157374_101173722 | 89 |
| 327 | 3300013296 | Ga0157374_10778898 | Ga0157374_107788982 | 89 |
| 328 | 3300013296 | Ga0157374_10956765 | Ga0157374_109567652 | 89 |
| 329 | 3300013296 | Ga0157374_11663755 | Ga0157374_116637552 | 89 |
| 330 | 3300013297 | Ga0157378_10324328 | Ga0157378_103243282 | 89 |
| 331 | 3300013297 | Ga0157378_10507617 | Ga0157378_105076172 | 89 |
| 332 | 3300013297 | Ga0157378_11009840 | Ga0157378_110098401 | 89 |
| 333 | 3300013297 | Ga0157378_11544702 | Ga0157378_115447021 | 89 |
| 334 | 3300013306 | Ga0163162_10414409 | Ga0163162_104144092 | 89 |
| 335 | 3300013306 | Ga0163162_10735398 | Ga0163162_107353982 | 89 |
| 336 | 3300013306 | Ga0163162_11464116 | Ga0163162_114641162 | 89 |
| 337 | 3300013306 | Ga0163162_11837195 | Ga0163162_118371952 | 89 |
| 338 | 3300013307 | Ga0157372_10435701 | Ga0157372_104357012 | 89 |
| 339 | 3300013308 | Ga0157375_12956772 | Ga0157375_129567722 | 89 |
| 340 | 3300013308 | Ga0157375_13702778 | Ga0157375_137027781 | 89 |
| 341 | 3300014325 | Ga0163163_10010481 | Ga0163163_1001048111 | 89 |
| 342 | 3300014325 | Ga0163163_10507652 | Ga0163163_105076522 | 89 |
| 343 | 3300014325 | Ga0163163_10698019 | Ga0163163_106980191 | 89 |
| 344 | 3300014325 | Ga0163163_10733495 | Ga0163163_107334952 | 89 |
| 345 | 3300014325 | Ga0163163_11396914 | Ga0163163_113969142 | 89 |
| 346 | 3300014325 | Ga0163163_11466515 | Ga0163163_114665151 | 89 |
| 347 | 3300014326 | Ga0157380_10119958 | Ga0157380_101199582 | 89 |
| 348 | 3300014326 | Ga0157380_10452391 | Ga0157380_104523912 | 89 |
| 349 | 3300014326 | Ga0157380_10577100 | Ga0157380_105771001 | 89 |
| 350 | 3300014326 | Ga0157380_10649004 | Ga0157380_106490042 | 89 |
| 351 | 3300014326 | Ga0157380_10697032 | Ga0157380_106970322 | 89 |
| 352 | 3300014326 | Ga0157380_12497143 | Ga0157380_124971432 | 89 |
| 353 | 3300014497 | Ga0182008_10138293 | Ga0182008_101382932 | 89 |
| 354 | 3300014745 | Ga0157377_10088990 | Ga0157377_100889902 | 89 |
| 355 | 3300014968 | Ga0157379_10366652 | Ga0157379_103666522 | 89 |
| 356 | 3300014968 | Ga0157379_10523958 | Ga0157379_105239582 | 89 |
| 357 | 3300014968 | Ga0157379_10559794 | Ga0157379_105597942 | 89 |
| 358 | 3300014968 | Ga0157379_11086645 | Ga0157379_110866451 | 89 |
| 359 | 3300014969 | Ga0157376_10684177 | Ga0157376_106841772 | 89 |
| 360 | 3300014969 | Ga0157376_11090967 | Ga0157376_110909672 | 89 |
| 361 | 3300014969 | Ga0157376_12705866 | Ga0157376_127058662 | 89 |
| 362 | 3300015262 | Ga0182007_10156376 | Ga0182007_101563762 | 89 |
| 363 | 3300015262 | Ga0182007_10190265 | Ga0182007_101902652 | 89 |
| 364 | 3300017792 | Ga0163161_10097742 | Ga0163161_100977422 | 89 |
| 365 | 3300017792 | Ga0163161_10318403 | Ga0163161_103184032 | 89 |
| 366 | 3300017792 | Ga0163161_10386598 | Ga0163161_103865981 | 89 |
| 367 | 3300017792 | Ga0163161_10559011 | Ga0163161_105590112 | 89 |
| 368 | 3300020070 | Ga0206356_10591617 | Ga0206356_105916172 | 89 |
| 369 | 3300020070 | Ga0206356_11363650 | Ga0206356_113636502 | 89 |
| 370 | 3300020078 | Ga0206352_10433278 | Ga0206352_104332782 | 89 |
| 371 | 3300020078 | Ga0206352_11190364 | Ga0206352_111903642 | 89 |
| 372 | 3300020081 | Ga0206354_10869696 | Ga0206354_108696961 | 89 |
| 373 | 3300020081 | Ga0206354_11690617 | Ga0206354_116906172 | 89 |
| 374 | 3300020082 | Ga0206353_10388764 | Ga0206353_103887642 | 89 |
| 375 | 3300021361 | Ga0213872_10087989 | Ga0213872_100879892 | 89 |
| 376 | 3300021384 | Ga0213876_10035419 | Ga0213876_100354192 | 89 |
| 377 | 3300022467 | Ga0224712_10341888 | Ga0224712_103418881 | 89 |
| 378 | 3300025245 | Ga0207425_1068486 | Ga0207425_10684862 | 89 |
| 379 | 3300025250 | Ga0209026_1001443 | Ga0209026_10014439 | 89 |
| 380 | 3300025261 | Ga0209233_1009619 | Ga0209233_10096193 | 89 |
| 381 | 3300025261 | Ga0209233_1058476 | Ga0209233_10584762 | 89 |
| 382 | 3300025263 | Ga0209565_1001056 | Ga0209565_10010565 | 89 |
| 383 | 3300025273 | Ga0209673_1000796 | Ga0209673_100079610 | 89 |
| 384 | 3300025291 | Ga0209675_1027043 | Ga0209675_10270432 | 89 |
| 385 | 3300025292 | Ga0209676_1000115 | Ga0209676_1000115195 | 89 |
| 386 | 3300025292 | Ga0209676_1005229 | Ga0209676_10052297 | 89 |
| 387 | 3300025295 | Ga0209564_1007404 | Ga0209564_10074049 | 89 |
| 388 | 3300025295 | Ga0209564_1025111 | Ga0209564_10251112 | 89 |
| 389 | 3300025297 | Ga0209758_1000852 | Ga0209758_100085217 | 89 |
| 390 | 3300025297 | Ga0209758_1000917 | Ga0209758_10009172 | 89 |
| 391 | 3300025297 | Ga0209758_1042409 | Ga0209758_10424091 | 89 |
| 392 | 3300025298 | Ga0209050_1000053 | Ga0209050_1000053224 | 89 |
| 393 | 3300025298 | Ga0209050_1006111 | Ga0209050_10061118 | 89 |
| 394 | 3300025298 | Ga0209050_1023604 | Ga0209050_10236043 | 89 |
| 395 | 3300025298 | Ga0209050_1037824 | Ga0209050_10378242 | 89 |
| 396 | 3300025299 | Ga0209256_1005104 | Ga0209256_10051042 | 89 |
| 397 | 3300025299 | Ga0209256_1008353 | Ga0209256_10083536 | 89 |
| 398 | 3300025299 | Ga0209256_1041065 | Ga0209256_10410652 | 89 |
| 399 | 3300025303 | Ga0209051_1004762 | Ga0209051_10047625 | 89 |
| 400 | 3300025304 | Ga0209257_1000090 | Ga0209257_1000090177 | 89 |
| 401 | 3300025304 | Ga0209257_1000192 | Ga0209257_1000192158 | 89 |
| 402 | 3300025304 | Ga0209257_1000289 | Ga0209257_100028952 | 89 |
| 403 | 3300025304 | Ga0209257_1008306 | Ga0209257_10083068 | 89 |
| 404 | 3300025304 | Ga0209257_1056241 | Ga0209257_10562412 | 89 |
| 405 | 3300025315 | Ga0207697_10347190 | Ga0207697_103471901 | 89 |
| 406 | 3300025885 | Ga0207653_10004893 | Ga0207653_100048933 | 89 |
| 407 | 3300025899 | Ga0207642_10256363 | Ga0207642_102563631 | 89 |
| 408 | 3300025901 | Ga0207688_10442074 | Ga0207688_104420741 | 89 |
| 409 | 3300025903 | Ga0207680_10254725 | Ga0207680_102547252 | 89 |
| 410 | 3300025903 | Ga0207680_10720958 | Ga0207680_107209582 | 89 |
| 411 | 3300025903 | Ga0207680_10799975 | Ga0207680_107999751 | 89 |
| 412 | 3300025903 | Ga0207680_11277711 | Ga0207680_112777112 | 89 |
| 413 | 3300025904 | Ga0207647_10067199 | Ga0207647_100671992 | 89 |
| 414 | 3300025905 | Ga0207685_10000007 | Ga0207685_1000000714 | 89 |
| 415 | 3300025907 | Ga0207645_10110413 | Ga0207645_101104132 | 89 |
| 416 | 3300025907 | Ga0207645_10451294 | Ga0207645_104512942 | 89 |
| 417 | 3300025908 | Ga0207643_10273629 | Ga0207643_102736292 | 89 |
| 418 | 3300025908 | Ga0207643_10727418 | Ga0207643_107274182 | 89 |
| 419 | 3300025909 | Ga0207705_10121475 | Ga0207705_101214752 | 89 |
| 420 | 3300025909 | Ga0207705_10179685 | Ga0207705_101796852 | 89 |
| 421 | 3300025909 | Ga0207705_10410344 | Ga0207705_104103441 | 89 |
| 422 | 3300025911 | Ga0207654_10292661 | Ga0207654_102926612 | 89 |
| 423 | 3300025911 | Ga0207654_11201060 | Ga0207654_112010601 | 89 |
| 424 | 3300025913 | Ga0207695_10012980 | Ga0207695_100129802 | 89 |
| 425 | 3300025913 | Ga0207695_10512280 | Ga0207695_105122802 | 89 |
| 426 | 3300025913 | Ga0207695_10625698 | Ga0207695_106256982 | 89 |
| 427 | 3300025913 | Ga0207695_11694229 | Ga0207695_116942291 | 89 |
| 428 | 3300025914 | Ga0207671_10665651 | Ga0207671_106656511 | 89 |
| 429 | 3300025914 | Ga0207671_11087822 | Ga0207671_110878222 | 89 |
| 430 | 3300025914 | Ga0207671_11480527 | Ga0207671_114805272 | 89 |
| 431 | 3300025917 | Ga0207660_10001868 | Ga0207660_1000186813 | 89 |
| 432 | 3300025917 | Ga0207660_10885148 | Ga0207660_108851481 | 89 |
| 433 | 3300025919 | Ga0207657_10229918 | Ga0207657_102299182 | 89 |
| 434 | 3300025919 | Ga0207657_10420043 | Ga0207657_104200431 | 89 |
| 435 | 3300025919 | Ga0207657_10586210 | Ga0207657_105862101 | 89 |
| 436 | 3300025920 | Ga0207649_10860443 | Ga0207649_108604431 | 89 |
| 437 | 3300025921 | Ga0207652_10018573 | Ga0207652_100185735 | 89 |
| 438 | 3300025921 | Ga0207652_10581991 | Ga0207652_105819912 | 89 |
| 439 | 3300025922 | Ga0207646_10018114 | Ga0207646_100181143 | 89 |
| 440 | 3300025922 | Ga0207646_10053819 | Ga0207646_100538192 | 89 |
| 441 | 3300025922 | Ga0207646_10889578 | Ga0207646_108895782 | 89 |
| 442 | 3300025923 | Ga0207681_10178896 | Ga0207681_101788962 | 89 |
| 443 | 3300025923 | Ga0207681_10363105 | Ga0207681_103631052 | 89 |
| 444 | 3300025923 | Ga0207681_10750363 | Ga0207681_107503632 | 89 |
| 445 | 3300025923 | Ga0207681_11102893 | Ga0207681_111028931 | 89 |
| 446 | 3300025924 | Ga0207694_10070351 | Ga0207694_100703515 | 89 |
| 447 | 3300025924 | Ga0207694_10121581 | Ga0207694_101215812 | 89 |
| 448 | 3300025924 | Ga0207694_10132540 | Ga0207694_101325402 | 89 |
| 449 | 3300025924 | Ga0207694_10334990 | Ga0207694_103349902 | 89 |
| 450 | 3300025924 | Ga0207694_10435777 | Ga0207694_104357771 | 89 |
| 451 | 3300025924 | Ga0207694_10465168 | Ga0207694_104651682 | 89 |
| 452 | 3300025924 | Ga0207694_11537780 | Ga0207694_115377801 | 89 |
| 453 | 3300025926 | Ga0207659_11061279 | Ga0207659_110612792 | 89 |
| 454 | 3300025926 | Ga0207659_11904657 | Ga0207659_119046572 | 89 |
| 455 | 3300025927 | Ga0207687_10266575 | Ga0207687_102665751 | 89 |
| 456 | 3300025927 | Ga0207687_11239911 | Ga0207687_112399111 | 89 |
| 457 | 3300025929 | Ga0207664_10637238 | Ga0207664_106372382 | 89 |
| 458 | 3300025932 | Ga0207690_10008653 | Ga0207690_100086532 | 89 |
| 459 | 3300025932 | Ga0207690_10437058 | Ga0207690_104370582 | 89 |
| 460 | 3300025932 | Ga0207690_10604156 | Ga0207690_106041562 | 89 |
| 461 | 3300025933 | Ga0207706_10399141 | Ga0207706_103991412 | 89 |
| 462 | 3300025933 | Ga0207706_10597686 | Ga0207706_105976862 | 89 |
| 463 | 3300025933 | Ga0207706_10655792 | Ga0207706_106557922 | 89 |
| 464 | 3300025933 | Ga0207706_10891251 | Ga0207706_108912511 | 89 |
| 465 | 3300025934 | Ga0207686_10141220 | Ga0207686_101412202 | 89 |
| 466 | 3300025934 | Ga0207686_10306742 | Ga0207686_103067421 | 89 |
| 467 | 3300025935 | Ga0207709_10098021 | Ga0207709_100980212 | 89 |
| 468 | 3300025935 | Ga0207709_10239000 | Ga0207709_102390002 | 89 |
| 469 | 3300025935 | Ga0207709_11741474 | Ga0207709_117414741 | 89 |
| 470 | 3300025936 | Ga0207670_10286478 | Ga0207670_102864782 | 89 |
| 471 | 3300025937 | Ga0207669_10283465 | Ga0207669_102834652 | 89 |
| 472 | 3300025937 | Ga0207669_10910644 | Ga0207669_109106442 | 89 |
| 473 | 3300025938 | Ga0207704_10000526 | Ga0207704_1000052613 | 89 |
| 474 | 3300025938 | Ga0207704_10532964 | Ga0207704_105329642 | 89 |
| 475 | 3300025939 | Ga0207665_10800427 | Ga0207665_108004272 | 89 |
| 476 | 3300025940 | Ga0207691_10475940 | Ga0207691_104759401 | 89 |
| 477 | 3300025940 | Ga0207691_10570589 | Ga0207691_105705893 | 89 |
| 478 | 3300025940 | Ga0207691_11245807 | Ga0207691_112458071 | 89 |
| 479 | 3300025941 | Ga0207711_10894150 | Ga0207711_108941502 | 89 |
| 480 | 3300025941 | Ga0207711_11093589 | Ga0207711_110935892 | 89 |
| 481 | 3300025941 | Ga0207711_11242393 | Ga0207711_112423931 | 89 |
| 482 | 3300025941 | Ga0207711_11252161 | Ga0207711_112521611 | 89 |
| 483 | 3300025941 | Ga0207711_11938465 | Ga0207711_119384652 | 89 |
| 484 | 3300025942 | Ga0207689_10031246 | Ga0207689_100312462 | 89 |
| 485 | 3300025942 | Ga0207689_10034906 | Ga0207689_100349061 | 89 |
| 486 | 3300025942 | Ga0207689_10203962 | Ga0207689_102039623 | 89 |
| 487 | 3300025942 | Ga0207689_10275634 | Ga0207689_102756342 | 89 |
| 488 | 3300025942 | Ga0207689_10293373 | Ga0207689_102933731 | 89 |
| 489 | 3300025942 | Ga0207689_11207673 | Ga0207689_112076731 | 89 |
| 490 | 3300025944 | Ga0207661_10639726 | Ga0207661_106397262 | 89 |
| 491 | 3300025945 | Ga0207679_11146309 | Ga0207679_111463091 | 89 |
| 492 | 3300025945 | Ga0207679_11281073 | Ga0207679_112810732 | 89 |
| 493 | 3300025945 | Ga0207679_12152243 | Ga0207679_121522431 | 89 |
| 494 | 3300025949 | Ga0207667_10111601 | Ga0207667_101116012 | 89 |
| 495 | 3300025960 | Ga0207651_10717091 | Ga0207651_107170911 | 89 |
| 496 | 3300025961 | Ga0207712_10014689 | Ga0207712_100146893 | 89 |
| 497 | 3300025961 | Ga0207712_11096766 | Ga0207712_110967662 | 89 |
| 498 | 3300025961 | Ga0207712_11275969 | Ga0207712_112759692 | 89 |
| 499 | 3300025961 | Ga0207712_11309245 | Ga0207712_113092451 | 89 |
| 500 | 3300025961 | Ga0207712_11882620 | Ga0207712_118826201 | 89 |
| 501 | 3300025972 | Ga0207668_10004082 | Ga0207668_100040828 | 89 |
| 502 | 3300025972 | Ga0207668_10206733 | Ga0207668_102067332 | 89 |
| 503 | 3300025972 | Ga0207668_10391180 | Ga0207668_103911802 | 89 |
| 504 | 3300025972 | Ga0207668_10432829 | Ga0207668_104328292 | 89 |
| 505 | 3300025972 | Ga0207668_10455330 | Ga0207668_104553302 | 89 |
| 506 | 3300025972 | Ga0207668_10462186 | Ga0207668_104621862 | 89 |
| 507 | 3300025972 | Ga0207668_11198233 | Ga0207668_111982332 | 89 |
| 508 | 3300025972 | Ga0207668_11481863 | Ga0207668_114818631 | 89 |
| 509 | 3300025981 | Ga0207640_10434293 | Ga0207640_104342932 | 89 |
| 510 | 3300025981 | Ga0207640_10590775 | Ga0207640_105907752 | 89 |
| 511 | 3300025986 | Ga0207658_10020434 | Ga0207658_100204342 | 89 |
| 512 | 3300025986 | Ga0207658_10184327 | Ga0207658_101843272 | 89 |
| 513 | 3300025986 | Ga0207658_10734851 | Ga0207658_107348511 | 89 |
| 514 | 3300025986 | Ga0207658_11294232 | Ga0207658_112942321 | 89 |
| 515 | 3300025986 | Ga0207658_11764600 | Ga0207658_117646001 | 89 |
| 516 | 3300025986 | Ga0207658_11925637 | Ga0207658_119256371 | 89 |
| 517 | 3300026035 | Ga0207703_10221324 | Ga0207703_102213241 | 89 |
| 518 | 3300026035 | Ga0207703_10981909 | Ga0207703_109819092 | 89 |
| 519 | 3300026041 | Ga0207639_10179798 | Ga0207639_101797982 | 89 |
| 520 | 3300026041 | Ga0207639_10885254 | Ga0207639_108852542 | 89 |
| 521 | 3300026041 | Ga0207639_10924747 | Ga0207639_109247472 | 89 |
| 522 | 3300026067 | Ga0207678_10025606 | Ga0207678_100256062 | 89 |
| 523 | 3300026067 | Ga0207678_10116681 | Ga0207678_101166813 | 89 |
| 524 | 3300026067 | Ga0207678_10292740 | Ga0207678_102927402 | 89 |
| 525 | 3300026067 | Ga0207678_10302026 | Ga0207678_103020262 | 89 |
| 526 | 3300026067 | Ga0207678_10744892 | Ga0207678_107448922 | 89 |
| 527 | 3300026075 | Ga0207708_10005606 | Ga0207708_100056062 | 89 |
| 528 | 3300026075 | Ga0207708_10837410 | Ga0207708_108374101 | 89 |
| 529 | 3300026078 | Ga0207702_10111519 | Ga0207702_101115192 | 89 |
| 530 | 3300026088 | Ga0207641_10510555 | Ga0207641_105105552 | 89 |
| 531 | 3300026088 | Ga0207641_10716011 | Ga0207641_107160111 | 89 |
| 532 | 3300026089 | Ga0207648_10633370 | Ga0207648_106333702 | 89 |
| 533 | 3300026089 | Ga0207648_11020786 | Ga0207648_110207861 | 89 |
| 534 | 3300026095 | Ga0207676_10012959 | Ga0207676_100129593 | 89 |
| 535 | 3300026095 | Ga0207676_12595028 | Ga0207676_125950281 | 89 |
| 536 | 3300026116 | Ga0207674_10008214 | Ga0207674_100082142 | 89 |
| 537 | 3300026116 | Ga0207674_10519528 | Ga0207674_105195282 | 89 |
| 538 | 3300026116 | Ga0207674_10806180 | Ga0207674_108061802 | 89 |
| 539 | 3300026116 | Ga0207674_12121831 | Ga0207674_121218311 | 89 |
| 540 | 3300026118 | Ga0207675_100021206 | Ga0207675_1000212062 | 89 |
| 541 | 3300026118 | Ga0207675_100104034 | Ga0207675_1001040344 | 89 |
| 542 | 3300026118 | Ga0207675_100172608 | Ga0207675_1001726083 | 89 |
| 543 | 3300026118 | Ga0207675_100731699 | Ga0207675_1007316992 | 89 |
| 544 | 3300026118 | Ga0207675_100922042 | Ga0207675_1009220422 | 89 |
| 545 | 3300026118 | Ga0207675_101139868 | Ga0207675_1011398682 | 89 |
| 546 | 3300026121 | Ga0207683_10406363 | Ga0207683_104063632 | 89 |
| 547 | 3300026121 | Ga0207683_10737911 | Ga0207683_107379111 | 89 |
| 548 | 3300026121 | Ga0207683_11404006 | Ga0207683_114040061 | 89 |
| 549 | 3300027876 | Ga0209974_10054151 | Ga0209974_100541512 | 89 |
| 550 | 3300027876 | Ga0209974_10205215 | Ga0209974_102052151 | 89 |
| 551 | 3300027907 | Ga0207428_10787379 | Ga0207428_107873791 | 89 |
| 552 | 3300027907 | Ga0207428_10949238 | Ga0207428_109492381 | 89 |
| 553 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031300 | 89 |
| 554 | 3300028379 | Ga0268266_10438449 | Ga0268266_104384492 | 89 |
| 555 | 3300028379 | Ga0268266_10523183 | Ga0268266_105231832 | 89 |
| 556 | 3300028380 | Ga0268265_10001206 | Ga0268265_1000120611 | 89 |
| 557 | 3300028380 | Ga0268265_10030635 | Ga0268265_100306352 | 89 |
| 558 | 3300028380 | Ga0268265_10181305 | Ga0268265_101813052 | 89 |
| 559 | 3300028380 | Ga0268265_10465008 | Ga0268265_104650082 | 89 |
| 560 | 3300028380 | Ga0268265_11007503 | Ga0268265_110075032 | 89 |
| 561 | 3300028380 | Ga0268265_11013431 | Ga0268265_110134311 | 89 |
| 562 | 3300028380 | Ga0268265_11195748 | Ga0268265_111957481 | 89 |
| 563 | 3300028380 | Ga0268265_12016065 | Ga0268265_120160651 | 89 |
| 564 | 3300028381 | Ga0268264_10010528 | Ga0268264_100105283 | 89 |
| 565 | 3300028381 | Ga0268264_10516616 | Ga0268264_105166162 | 89 |
| 566 | 3300028381 | Ga0268264_10831144 | Ga0268264_108311442 | 89 |
| 567 | 3300028381 | Ga0268264_10906226 | Ga0268264_109062262 | 89 |
| 568 | 3300028556 | Ga0265337_1230260 | Ga0265337_12302602 | 89 |
| 569 | 3300028563 | Ga0265319_1153311 | Ga0265319_11533111 | 89 |
| 570 | 3300028573 | Ga0265334_10117888 | Ga0265334_101178882 | 89 |
| 571 | 3300028573 | Ga0265334_10264357 | Ga0265334_102643572 | 89 |
| 572 | 3300028786 | Ga0307517_10003957 | Ga0307517_100039573 | 89 |
| 573 | 3300028794 | Ga0307515_10080475 | Ga0307515_100804754 | 89 |
| 574 | 3300028794 | Ga0307515_10185861 | Ga0307515_101858612 | 89 |
| 575 | 3300028800 | Ga0265338_10040090 | Ga0265338_100400903 | 89 |
| 576 | 3300028800 | Ga0265338_10075300 | Ga0265338_100753002 | 89 |
| 577 | 3300028800 | Ga0265338_10082066 | Ga0265338_100820662 | 89 |
| 578 | 3300028800 | Ga0265338_10115692 | Ga0265338_101156923 | 89 |
| 579 | 3300028800 | Ga0265338_10152366 | Ga0265338_101523662 | 89 |
| 580 | 3300028800 | Ga0265338_10166659 | Ga0265338_101666592 | 89 |
| 581 | 3300028800 | Ga0265338_10411884 | Ga0265338_104118842 | 89 |
| 582 | 3300030745 | Ga0316182_1185581 | Ga0316182_11855812 | 89 |
| 583 | 3300031235 | Ga0265330_10134721 | Ga0265330_101347212 | 89 |
| 584 | 3300031240 | Ga0265320_10475614 | Ga0265320_104756142 | 89 |
| 585 | 3300031247 | Ga0265340_10490190 | Ga0265340_104901902 | 89 |
| 586 | 3300031250 | Ga0265331_10231556 | Ga0265331_102315562 | 89 |
| 587 | 3300031251 | Ga0265327_10000280 | Ga0265327_1000028084 | 89 |
| 588 | 3300031251 | Ga0265327_10015047 | Ga0265327_100150472 | 89 |
| 589 | 3300031251 | Ga0265327_10037859 | Ga0265327_100378591 | 89 |
| 590 | 3300031251 | Ga0265327_10116595 | Ga0265327_101165952 | 89 |
| 591 | 3300031251 | Ga0265327_10210003 | Ga0265327_102100031 | 89 |
| 592 | 3300031344 | Ga0265316_10371290 | Ga0265316_103712901 | 89 |
| 593 | 3300031456 | Ga0307513_10000100 | Ga0307513_1000010019 | 89 |
| 594 | 3300031456 | Ga0307513_10003278 | Ga0307513_100032782 | 89 |
| 595 | 3300031456 | Ga0307513_10021100 | Ga0307513_100211006 | 89 |
| 596 | 3300031456 | Ga0307513_10147629 | Ga0307513_101476294 | 89 |
| 597 | 3300031507 | Ga0307509_10924051 | Ga0307509_109240512 | 89 |
| 598 | 3300031548 | Ga0307408_100241565 | Ga0307408_1002415651 | 89 |
| 599 | 3300031548 | Ga0307408_100296711 | Ga0307408_1002967112 | 89 |
| 600 | 3300031548 | Ga0307408_100317322 | Ga0307408_1003173222 | 89 |
| 601 | 3300031548 | Ga0307408_100523961 | Ga0307408_1005239611 | 89 |
| 602 | 3300031548 | Ga0307408_100898456 | Ga0307408_1008984562 | 89 |
| 603 | 3300031548 | Ga0307408_100964071 | Ga0307408_1009640712 | 89 |
| 604 | 3300031548 | Ga0307408_101207276 | Ga0307408_1012072761 | 89 |
| 605 | 3300031649 | Ga0307514_10221183 | Ga0307514_102211832 | 89 |
| 606 | 3300031665 | Ga0316575_10086787 | Ga0316575_100867872 | 89 |
| 607 | 3300031691 | Ga0316579_10408310 | Ga0316579_104083101 | 89 |
| 608 | 3300031711 | Ga0265314_10048088 | Ga0265314_100480882 | 89 |
| 609 | 3300031712 | Ga0265342_10086819 | Ga0265342_100868191 | 89 |
| 610 | 3300031712 | Ga0265342_10662092 | Ga0265342_106620921 | 89 |
| 611 | 3300031727 | Ga0316576_10036145 | Ga0316576_100361453 | 89 |
| 612 | 3300031728 | Ga0316578_10029717 | Ga0316578_100297172 | 89 |
| 613 | 3300031730 | Ga0307516_10149056 | Ga0307516_101490562 | 89 |
| 614 | 3300031730 | Ga0307516_10331378 | Ga0307516_103313782 | 89 |
| 615 | 3300031731 | Ga0307405_10190625 | Ga0307405_101906252 | 89 |
| 616 | 3300031731 | Ga0307405_10224645 | Ga0307405_102246452 | 89 |
| 617 | 3300031731 | Ga0307405_10690058 | Ga0307405_106900582 | 89 |
| 618 | 3300031731 | Ga0307405_10700499 | Ga0307405_107004992 | 89 |
| 619 | 3300031731 | Ga0307405_10768282 | Ga0307405_107682822 | 89 |
| 620 | 3300031731 | Ga0307405_10942159 | Ga0307405_109421592 | 89 |
| 621 | 3300031731 | Ga0307405_11976640 | Ga0307405_119766401 | 89 |
| 622 | 3300031824 | Ga0307413_10068704 | Ga0307413_100687042 | 89 |
| 623 | 3300031824 | Ga0307413_10142539 | Ga0307413_101425391 | 89 |
| 624 | 3300031824 | Ga0307413_10170593 | Ga0307413_101705932 | 89 |
| 625 | 3300031824 | Ga0307413_10212255 | Ga0307413_102122552 | 89 |
| 626 | 3300031824 | Ga0307413_10863716 | Ga0307413_108637162 | 89 |
| 627 | 3300031824 | Ga0307413_11493969 | Ga0307413_114939692 | 89 |
| 628 | 3300031824 | Ga0307413_11757938 | Ga0307413_117579382 | 89 |
| 629 | 3300031852 | Ga0307410_10002951 | Ga0307410_100029512 | 89 |
| 630 | 3300031852 | Ga0307410_11267018 | Ga0307410_112670181 | 89 |
| 631 | 3300031852 | Ga0307410_11475164 | Ga0307410_114751642 | 89 |
| 632 | 3300031889 | Ga0326468_10030048 | Ga0326468_100300482 | 89 |
| 633 | 3300031901 | Ga0307406_10038036 | Ga0307406_100380364 | 89 |
| 634 | 3300031901 | Ga0307406_10095517 | Ga0307406_100955172 | 89 |
| 635 | 3300031901 | Ga0307406_10178862 | Ga0307406_101788622 | 89 |
| 636 | 3300031901 | Ga0307406_10340933 | Ga0307406_103409331 | 89 |
| 637 | 3300031901 | Ga0307406_11391413 | Ga0307406_113914132 | 89 |
| 638 | 3300031903 | Ga0307407_10454387 | Ga0307407_104543872 | 89 |
| 639 | 3300031911 | Ga0307412_10004367 | Ga0307412_100043677 | 89 |
| 640 | 3300031911 | Ga0307412_10374182 | Ga0307412_103741822 | 89 |
| 641 | 3300031911 | Ga0307412_10380014 | Ga0307412_103800142 | 89 |
| 642 | 3300031911 | Ga0307412_10422691 | Ga0307412_104226912 | 89 |
| 643 | 3300031911 | Ga0307412_10666930 | Ga0307412_106669303 | 89 |
| 644 | 3300031911 | Ga0307412_10819596 | Ga0307412_108195961 | 89 |
| 645 | 3300031911 | Ga0307412_10939395 | Ga0307412_109393952 | 89 |
| 646 | 3300031911 | Ga0307412_11123106 | Ga0307412_111231061 | 89 |
| 647 | 3300031995 | Ga0307409_100179882 | Ga0307409_1001798823 | 89 |
| 648 | 3300031995 | Ga0307409_100561138 | Ga0307409_1005611382 | 89 |
| 649 | 3300031995 | Ga0307409_100725050 | Ga0307409_1007250501 | 89 |
| 650 | 3300031995 | Ga0307409_100864877 | Ga0307409_1008648772 | 89 |
| 651 | 3300031995 | Ga0307409_100964293 | Ga0307409_1009642931 | 89 |
| 652 | 3300032002 | Ga0307416_100037708 | Ga0307416_1000377082 | 89 |
| 653 | 3300032002 | Ga0307416_100129547 | Ga0307416_1001295473 | 89 |
| 654 | 3300032002 | Ga0307416_100189199 | Ga0307416_1001891992 | 89 |
| 655 | 3300032002 | Ga0307416_100389734 | Ga0307416_1003897341 | 89 |
| 656 | 3300032002 | Ga0307416_100433873 | Ga0307416_1004338732 | 89 |
| 657 | 3300032002 | Ga0307416_101105521 | Ga0307416_1011055212 | 89 |
| 658 | 3300032002 | Ga0307416_101145819 | Ga0307416_1011458191 | 89 |
| 659 | 3300032002 | Ga0307416_101417688 | Ga0307416_1014176881 | 89 |
| 660 | 3300032002 | Ga0307416_102097694 | Ga0307416_1020976941 | 89 |
| 661 | 3300032002 | Ga0307416_102174932 | Ga0307416_1021749322 | 89 |
| 662 | 3300032002 | Ga0307416_102233796 | Ga0307416_1022337962 | 89 |
| 663 | 3300032002 | Ga0307416_103820283 | Ga0307416_1038202831 | 89 |
| 664 | 3300032004 | Ga0307414_10031506 | Ga0307414_100315062 | 89 |
| 665 | 3300032004 | Ga0307414_10057750 | Ga0307414_100577502 | 89 |
| 666 | 3300032004 | Ga0307414_10238317 | Ga0307414_102383172 | 89 |
| 667 | 3300032004 | Ga0307414_10342927 | Ga0307414_103429272 | 89 |
| 668 | 3300032004 | Ga0307414_10350081 | Ga0307414_103500812 | 89 |
| 669 | 3300032004 | Ga0307414_11547615 | Ga0307414_115476151 | 89 |
| 670 | 3300032004 | Ga0307414_11575460 | Ga0307414_115754602 | 89 |
| 671 | 3300032005 | Ga0307411_10023874 | Ga0307411_100238742 | 89 |
| 672 | 3300032005 | Ga0307411_10044388 | Ga0307411_100443882 | 89 |
| 673 | 3300032005 | Ga0307411_10138312 | Ga0307411_101383122 | 89 |
| 674 | 3300032005 | Ga0307411_10660188 | Ga0307411_106601882 | 89 |
| 675 | 3300032005 | Ga0307411_10778024 | Ga0307411_107780242 | 89 |
| 676 | 3300032126 | Ga0307415_100006354 | Ga0307415_1000063544 | 89 |
| 677 | 3300032126 | Ga0307415_100718061 | Ga0307415_1007180612 | 89 |
| 678 | 3300032126 | Ga0307415_100854144 | Ga0307415_1008541442 | 89 |
| 679 | 3300032126 | Ga0307415_101117103 | Ga0307415_1011171031 | 89 |
| 680 | 3300032126 | Ga0307415_101178221 | Ga0307415_1011782211 | 89 |
| 681 | 3300032126 | Ga0307415_101354163 | Ga0307415_1013541632 | 89 |
| 682 | 3300032126 | Ga0307415_101442577 | Ga0307415_1014425772 | 89 |
| 683 | 3300032133 | Ga0316583_10303319 | Ga0316583_103033192 | 89 |
| 684 | 3300032139 | Ga0316580_10010145 | Ga0316580_100101452 | 89 |
| 685 | 3300032168 | Ga0316593_10313765 | Ga0316593_103137651 | 89 |
| 686 | 3300033180 | Ga0307510_10106393 | Ga0307510_101063933 | 89 |
| 687 | 3300033180 | Ga0307510_10337820 | Ga0307510_103378202 | 89 |
| 688 | 3300033180 | Ga0307510_10427982 | Ga0307510_104279821 | 89 |
| 689 | 3300033180 | Ga0307510_10574483 | Ga0307510_105744831 | 89 |
| 690 | 3300033524 | Ga0316592_1092784 | Ga0316592_10927841 | 89 |
| 691 | 3300033528 | Ga0316588_1084877 | Ga0316588_10848773 | 89 |
| 692 | 3300033541 | Ga0316596_1171711 | Ga0316596_11717111 | 89 |
| 693 | 3300033541 | Ga0316596_1227815 | Ga0316596_12278151 | 89 |
| 694 | 3300034818 | Ga0373950_0177590 | Ga0373950_0177590_94_363 | 89 |
| 695 | 3300034957 | Ga0373938_0108372 | Ga0373938_0108372_282_551 | 89 |
| 696 | 3300035086 | Ga0373934_0431957 | Ga0373934_0431957_153_422 | 89 |
| 697 | 3300035111 | Ga0373923_0100456 | Ga0373923_0100456_666_935 | 89 |
| 698 | 3300035113 | Ga0373936_0002108 | Ga0373936_0002108_1208_1477 | 89 |
| 699 | 3300035113 | Ga0373936_0135076 | Ga0373936_0135076_280_549 | 89 |
| 700 | 3300035113 | Ga0373936_0192601 | Ga0373936_0192601_351_623 | 89 |
| 701 | 3300035115 | Ga0373941_0120813 | Ga0373941_0120813_88_357 | 89 |
| 702 | 3300035116 | Ga0373945_0391798 | Ga0373945_0391798_305_574 | 89 |
| 703 | 3300035117 | Ga0373953_0123771 | Ga0373953_0123771_525_794 | 89 |
| 704 | 3300035118 | Ga0373954_0166710 | Ga0373954_0166710_535_804 | 89 |
| 705 | 3300035119 | Ga0373956_0469499 | Ga0373956_0469499_29_298 | 89 |
| 706 | 3300035121 | Ga0373960_0087008 | Ga0373960_0087008_280_549 | 89 |
| 707 | 3300035170 | Ga0373943_0576866 | Ga0373943_0576866_13_282 | 89 |
| 708 | 3300035171 | Ga0373946_0026220 | Ga0373946_0026220_250_519 | 89 |
| 709 | 3300035172 | Ga0373955_0031767 | Ga0373955_0031767_1174_1443 | 89 |
| 710 | 3300035207 | Ga0373942_0074927 | Ga0373942_0074927_452_721 | 89 |
| 711 | 3300035242 | Ga0373962_0319761 | Ga0373962_0319761_42_311 | 89 |
| 712 | 3300035398 | Ga0316574_0916766 | Ga0316574_0916766_92_361 | 89 |
| 713 | 3300035410 | Ga0373924_0251430 | Ga0373924_0251430_367_636 | 89 |
| 714 | 3300035692 | Ga0373935_0099848 | Ga0373935_0099848_731_1000 | 89 |
| 715 | 3300035692 | Ga0373935_0251127 | Ga0373935_0251127_921_1190 | 89 |
| 716 | 3300035724 | Ga0373933_0343972 | Ga0373933_0343972_529_798 | 89 |
| 717 | 3300035724 | Ga0373933_0360557 | Ga0373933_0360557_275_544 | 89 |
| 718 | 3300035725 | Ga0373947_0156168 | Ga0373947_0156168_683_952 | 89 |
| 719 | 3300036401 | Ga0373937_0134663 | Ga0373937_0134663_1433_1702 | 89 |
| 720 | 3300036401 | Ga0373937_0548289 | Ga0373937_0548289_228_497 | 89 |
| 721 | 3300036401 | Ga0373937_0917668 | Ga0373937_0917668_96_365 | 89 |
| 722 | 3300037068 | Ga0373925_0454625 | Ga0373925_0454625_31_300 | 89 |
| 723 | 3300037312 | Ga0395899_0172596 | Ga0395899_0172596_741_1010 | 89 |
| 724 | 3300037312 | Ga0395899_0858290 | Ga0395899_0858290_210_479 | 89 |
| 725 | 3300037418 | Ga0395900_0026092 | Ga0395900_0026092_3278_3547 | 89 |
| 726 | 3300037418 | Ga0395900_0132952 | Ga0395900_0132952_532_801 | 89 |
| 727 | 3300037418 | Ga0395900_0373927 | Ga0395900_0373927_1077_1346 | 89 |
| 728 | 3300037418 | Ga0395900_1083319 | Ga0395900_1083319_148_417 | 89 |
| 729 | 3300037466 | Ga0395898_0020586 | Ga0395898_0020586_2597_2866 | 89 |
| 730 | 3300037471 | Ga0395905_0058657 | Ga0395905_0058657_1561_1830 | 89 |
| 731 | 3300037471 | Ga0395905_0287381 | Ga0395905_0287381_773_1042 | 89 |
| 732 | 3300037471 | Ga0395905_0308378 | Ga0395905_0308378_1053_1322 | 89 |
| 733 | 3300037471 | Ga0395905_0598646 | Ga0395905_0598646_113_382 | 89 |
| 734 | 3300037471 | Ga0395905_1008775 | Ga0395905_1008775_81_350 | 89 |
| 735 | 3300037471 | Ga0395905_1668341 | Ga0395905_1668341_236_505 | 89 |
| 736 | 3300038443 | Ga0395901_0024541 | Ga0395901_0024541_4016_4285 | 89 |
| 737 | 3300038443 | Ga0395901_0094369 | Ga0395901_0094369_1357_1638 | 89 |
| 738 | 3300038443 | Ga0395901_1411864 | Ga0395901_1411864_180_449 | 89 |
| 739 | 3300038443 | Ga0395901_2079600 | Ga0395901_2079600_233_502 | 89 |
| 740 | 3300039062 | Ga0400483_129175 | Ga0400483_129175_469_738 | 89 |
| 741 | 3300039437 | Ga0436365_0165150 | Ga0436365_0165150_2014_2283 | 89 |
| 742 | 3300039437 | Ga0436365_0412280 | Ga0436365_0412280_538_807 | 89 |
| 743 | 3300039437 | Ga0436365_0792369 | Ga0436365_0792369_645_914 | 89 |
| 744 | 3300039437 | Ga0436365_1349511 | Ga0436365_1349511_597_866 | 89 |
| 745 | 3300039437 | Ga0436365_1353601 | Ga0436365_1353601_137_406 | 89 |
| 746 | 3300039437 | Ga0436365_1519503 | Ga0436365_1519503_507_776 | 89 |
| 747 | 3300039438 | Ga0436360_0031527 | Ga0436360_0031527_332_601 | 89 |
| 748 | 3300039438 | Ga0436360_0193881 | Ga0436360_0193881_122_391 | 89 |
| 749 | 3300039438 | Ga0436360_0802865 | Ga0436360_0802865_16_285 | 89 |
| 750 | 3300039438 | Ga0436360_1129668 | Ga0436360_1129668_76_345 | 89 |
| 751 | 3300039447 | Ga0436361_0553807 | Ga0436361_0553807_16682_16951 | 89 |
| 752 | 3300039450 | Ga0436363_0034667 | Ga0436363_0034667_147_416 | 89 |
| 753 | 3300039450 | Ga0436363_0167927 | Ga0436363_0167927_362_631 | 89 |
| 754 | 3300039450 | Ga0436363_0876492 | Ga0436363_0876492_64_333 | 89 |
| 755 | 3300039450 | Ga0436363_1250061 | Ga0436363_1250061_289_558 | 89 |
| 756 | 3300041408 | Ga0439453_0012409 | Ga0439453_0012409_372_641 | 89 |
| 757 | 3300041410 | Ga0439461_0123404 | Ga0439461_0123404_72_341 | 89 |
| 758 | 3300041413 | Ga0439465_0167723 | Ga0439465_0167723_140_409 | 89 |
| 759 | 3300041441 | Ga0451787_014158 | Ga0451787_014158_444_713 | 89 |
| 760 | 3300041443 | Ga0451789_0130043 | Ga0451789_0130043_174_443 | 89 |
| 761 | 3300041444 | Ga0451790_33734 | Ga0451790_33734_27_296 | 89 |
| 762 | 3300041446 | Ga0451794_09956 | Ga0451794_09956_240_509 | 89 |
| 763 | 3300041451 | Ga0451791_0986555 | Ga0451791_0986555_248_517 | 89 |
| 764 | 3300041451 | Ga0451791_1141798 | Ga0451791_1141798_466_735 | 89 |
| 765 | 3300041452 | Ga0451793_0143183 | Ga0451793_0143183_129_398 | 89 |
| 766 | 3300041452 | Ga0451793_1580084 | Ga0451793_1580084_175_444 | 89 |
| 767 | 3300041453 | Ga0451797_1241774 | Ga0451797_1241774_253_522 | 89 |
| 768 | 3300041453 | Ga0451797_1562136 | Ga0451797_1562136_84_353 | 89 |
| 769 | 3300041455 | Ga0451801_31341 | Ga0451801_31341_177_446 | 89 |
| 770 | 3300041456 | Ga0451795_0372914 | Ga0451795_0372914_517_786 | 89 |
| 771 | 3300041459 | Ga0451800_1087923 | Ga0451800_1087923_49_318 | 89 |
| 772 | 3300041460 | Ga0451802_0313528 | Ga0451802_0313528_29_298 | 89 |
| 773 | 3300041460 | Ga0451802_0427992 | Ga0451802_0427992_292_561 | 89 |
| 774 | 3300041460 | Ga0451802_0835340 | Ga0451802_0835340_207_476 | 89 |
| 775 | 3300041461 | Ga0451805_017743 | Ga0451805_017743_308_577 | 89 |
| 776 | 3300041461 | Ga0451805_019020 | Ga0451805_019020_198_467 | 89 |
| 777 | 3300041461 | Ga0451805_062075 | Ga0451805_062075_257_526 | 89 |
| 778 | 3300041462 | Ga0451806_199844 | Ga0451806_199844_203_472 | 89 |
| 779 | 3300041463 | Ga0451804_0300224 | Ga0451804_0300224_442_711 | 89 |
| 780 | 3300041486 | Ga0451807_1151417 | Ga0451807_1151417_431_700 | 89 |
| 781 | 3300041486 | Ga0451807_2363815 | Ga0451807_2363815_64_333 | 89 |
| 782 | 3300041491 | Ga0451833_0300335 | Ga0451833_0300335_90_359 | 89 |
| 783 | 3300041492 | Ga0451835_1223003 | Ga0451835_1223003_264_533 | 89 |
| 784 | 3300041494 | Ga0451837_1428663 | Ga0451837_1428663_143_412 | 89 |
| 785 | 3300041496 | Ga0451839_0946880 | Ga0451839_0946880_271_540 | 89 |
| 786 | 3300041496 | Ga0451839_1072371 | Ga0451839_1072371_121_390 | 89 |
| 787 | 3300041501 | Ga0451845_0522626 | Ga0451845_0522626_28_297 | 89 |
| 788 | 3300041502 | Ga0451846_32729 | Ga0451846_32729_260_529 | 89 |
| 789 | 3300041503 | Ga0451847_0632259 | Ga0451847_0632259_307_576 | 89 |
| 790 | 3300041505 | Ga0451849_0010923 | Ga0451849_0010923_197_466 | 89 |
| 791 | 3300041506 | Ga0451850_00416 | Ga0451850_00416_16_285 | 89 |
| 792 | 3300041509 | Ga0451843_1189529 | Ga0451843_1189529_148_417 | 89 |
| 793 | 3300041511 | Ga0451855_1262419 | Ga0451855_1262419_343_612 | 89 |
| 794 | 3300041511 | Ga0451855_1910206 | Ga0451855_1910206_571_840 | 89 |
| 795 | 3300041512 | Ga0451853_0633361 | Ga0451853_0633361_394_663 | 89 |
| 796 | 3300041512 | Ga0451853_1923124 | Ga0451853_1923124_592_861 | 89 |
| 797 | 3300041512 | Ga0451853_2561966 | Ga0451853_2561966_468_737 | 89 |
| 798 | 3300041907 | Ga0452268_42262 | Ga0452268_42262_179_448 | 89 |
| 799 | 3300041999 | Ga0439433_0111771 | Ga0439433_0111771_385_654 | 89 |
| 800 | 3300041999 | Ga0439433_0178550 | Ga0439433_0178550_121_390 | 89 |
| 801 | 3300042001 | Ga0439441_091096 | Ga0439441_091096_103_372 | 89 |
| 802 | 3300042004 | Ga0439445_0086061 | Ga0439445_0086061_487_756 | 89 |
| 803 | 3300042012 | Ga0439455_0195698 | Ga0439455_0195698_38_307 | 89 |
| 804 | 3300042015 | Ga0439462_0154359 | Ga0439462_0154359_357_626 | 89 |
| 805 | 3300042125 | Ga0450923_156787 | Ga0450923_156787_160_429 | 89 |
| 806 | 3300042127 | Ga0450890_037290 | Ga0450890_037290_379_648 | 89 |
| 807 | 3300042156 | Ga0439446_0029309 | Ga0439446_0029309_605_874 | 89 |
| 808 | 3300042157 | Ga0439458_0054448 | Ga0439458_0054448_446_715 | 89 |
| 809 | 3300042438 | Ga0439459_0003734 | Ga0439459_0003734_1096_1365 | 89 |
| 810 | 3300042438 | Ga0439459_0052395 | Ga0439459_0052395_453_722 | 89 |
| 811 | 3300042876 | Ga0451577_0000543 | Ga0451577_0000543_2459_2728 | 89 |
| 812 | 3300044683 | Ga0466965_0205372 | Ga0466965_0205372_63_332 | 89 |
| 813 | 3300044712 | Ga0453684_0000533 | Ga0453684_0000533_55507_55776 | 89 |
| 814 | 3300044712 | Ga0453684_0095700 | Ga0453684_0095700_1368_1637 | 89 |
| 815 | 3300044901 | Ga0466960_0214925 | Ga0466960_0214925_467_736 | 89 |
| 816 | 3300046453 | Ga0495627_001096 | Ga0495627_001096_4345_4614 | 89 |
| 817 | 3300046457 | Ga0495590_0001565 | Ga0495590_0001565_8886_9155 | 89 |
| 818 | 3300046460 | Ga0495638_0011692 | Ga0495638_0011692_311_580 | 89 |
| 819 | 3300046460 | Ga0495638_0097961 | Ga0495638_0097961_1257_1526 | 89 |
| 820 | 3300046460 | Ga0495638_0232966 | Ga0495638_0232966_387_656 | 89 |
| 821 | 3300046460 | Ga0495638_0308158 | Ga0495638_0308158_270_539 | 89 |
| 822 | 3300046462 | Ga0495651_0125469 | Ga0495651_0125469_1261_1530 | 89 |
| 823 | 3300046462 | Ga0495651_0425878 | Ga0495651_0425878_246_515 | 89 |
| 824 | 3300046471 | Ga0495650_0000468 | Ga0495650_0000468_22706_22975 | 89 |
| 825 | 3300046471 | Ga0495650_0134607 | Ga0495650_0134607_486_755 | 89 |
| 826 | 3300046471 | Ga0495650_0284709 | Ga0495650_0284709_46_315 | 89 |
| 827 | 3300046472 | Ga0495580_0627629 | Ga0495580_0627629_114_383 | 89 |
| 828 | 3300046491 | Ga0495584_0306137 | Ga0495584_0306137_321_590 | 89 |
| 829 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_432250_432519 | 89 |
| 830 | 3300046506 | Ga0495583_0023513 | Ga0495583_0023513_1329_1598 | 89 |
| 831 | 3300046507 | Ga0495606_0016672 | Ga0495606_0016672_4616_4885 | 89 |
| 832 | 3300046507 | Ga0495606_0038274 | Ga0495606_0038274_2881_3150 | 89 |
| 833 | 3300046511 | Ga0495608_0195054 | Ga0495608_0195054_572_841 | 89 |
| 834 | 3300046512 | Ga0495610_0048755 | Ga0495610_0048755_1678_1947 | 89 |
| 835 | 3300046513 | Ga0495616_0006961 | Ga0495616_0006961_1446_1715 | 89 |
| 836 | 3300046515 | Ga0495620_0141352 | Ga0495620_0141352_632_901 | 89 |
| 837 | 3300046515 | Ga0495620_0149407 | Ga0495620_0149407_463_732 | 89 |
| 838 | 3300046519 | Ga0495632_0009729 | Ga0495632_0009729_385_654 | 89 |
| 839 | 3300046520 | Ga0495637_0026076 | Ga0495637_0026076_22_291 | 89 |
| 840 | 3300046520 | Ga0495637_0036307 | Ga0495637_0036307_773_1042 | 89 |
| 841 | 3300046522 | Ga0495643_0030755 | Ga0495643_0030755_1440_1709 | 89 |
| 842 | 3300046522 | Ga0495643_0149626 | Ga0495643_0149626_55_324 | 89 |
| 843 | 3300046524 | Ga0495648_0010816 | Ga0495648_0010816_5071_5340 | 89 |
| 844 | 3300046524 | Ga0495648_0377078 | Ga0495648_0377078_21_290 | 89 |
| 845 | 3300046525 | Ga0495663_0028986 | Ga0495663_0028986_855_1124 | 89 |
| 846 | 3300046525 | Ga0495663_0390686 | Ga0495663_0390686_70_339 | 89 |
| 847 | 3300046529 | Ga0495652_0263381 | Ga0495652_0263381_698_967 | 89 |
| 848 | 3300046530 | Ga0495654_0000199 | Ga0495654_0000199_40592_40861 | 89 |
| 849 | 3300046533 | Ga0495640_0302089 | Ga0495640_0302089_443_712 | 89 |
| 850 | 3300046536 | Ga0495587_0217497 | Ga0495587_0217497_22_303 | 89 |
| 851 | 3300046536 | Ga0495587_0489303 | Ga0495587_0489303_311_580 | 89 |
| 852 | 3300046538 | Ga0495609_0212133 | Ga0495609_0212133_442_711 | 89 |
| 853 | 3300046538 | Ga0495609_0260227 | Ga0495609_0260227_49_318 | 89 |
| 854 | 3300046542 | Ga0495597_0057218 | Ga0495597_0057218_1227_1496 | 89 |
| 855 | 3300046542 | Ga0495597_0394148 | Ga0495597_0394148_206_475 | 89 |
| 856 | 3300046543 | Ga0495645_0313309 | Ga0495645_0313309_422_691 | 89 |
| 857 | 3300046558 | Ga0495633_0003428 | Ga0495633_0003428_4494_4763 | 89 |
| 858 | 3300046558 | Ga0495633_0051134 | Ga0495633_0051134_921_1190 | 89 |
| 859 | 3300046559 | Ga0495667_0118985 | Ga0495667_0118985_818_1087 | 89 |
| 860 | 3300046615 | Ga0495656_0191352 | Ga0495656_0191352_390_659 | 89 |
| 861 | 3300046615 | Ga0495656_0496274 | Ga0495656_0496274_99_368 | 89 |
| 862 | 3300046616 | Ga0495668_0131932 | Ga0495668_0131932_730_999 | 89 |
| 863 | 3300046616 | Ga0495668_0151790 | Ga0495668_0151790_570_839 | 89 |
| 864 | 3300046616 | Ga0495668_0383898 | Ga0495668_0383898_244_513 | 89 |
| 865 | 3300046660 | Ga0495625_0000152 | Ga0495625_0000152_9850_10119 | 89 |
| 866 | 3300046660 | Ga0495625_0189527 | Ga0495625_0189527_305_574 | 89 |
| 867 | 3300046660 | Ga0495625_0285071 | Ga0495625_0285071_430_699 | 89 |
| 868 | 3300046663 | Ga0495635_0263648 | Ga0495635_0263648_300_569 | 89 |
| 869 | 3300046664 | Ga0495659_0097393 | Ga0495659_0097393_239_508 | 89 |
| 870 | 3300046675 | Ga0495657_0160607 | Ga0495657_0160607_749_1018 | 89 |
| 871 | 3300046675 | Ga0495657_0409541 | Ga0495657_0409541_448_717 | 89 |
| 872 | 3300046689 | Ga0495613_0000049 | Ga0495613_0000049_68948_69217 | 89 |
| 873 | 3300046691 | Ga0495670_0154356 | Ga0495670_0154356_20_289 | 89 |
| 874 | 3300046691 | Ga0495670_0279535 | Ga0495670_0279535_24_293 | 89 |
| 875 | 3300046692 | Ga0495671_0363605 | Ga0495671_0363605_400_669 | 89 |
| 876 | 3300046692 | Ga0495671_0628238 | Ga0495671_0628238_130_399 | 89 |
| 877 | 3300046694 | Ga0495649_0000048 | Ga0495649_0000048_571_840 | 89 |
| 878 | 3300046794 | Ga0495589_0013748 | Ga0495589_0013748_3636_3905 | 89 |
| 879 | 3300046809 | Ga0495600_0452554 | Ga0495600_0452554_367_636 | 89 |
| 880 | 3300046810 | Ga0495660_0008301 | Ga0495660_0008301_1261_1530 | 89 |
| 881 | 3300046810 | Ga0495660_0126268 | Ga0495660_0126268_997_1266 | 89 |
| 882 | 3300047317 | Ga0495604_0542713 | Ga0495604_0542713_307_576 | 89 |
| 883 | 3300047318 | Ga0495636_0303475 | Ga0495636_0303475_54_323 | 89 |
| 884 | 3300047319 | Ga0495674_0825467 | Ga0495674_0825467_183_452 | 89 |
| 885 | 3300047319 | Ga0495674_1328424 | Ga0495674_1328424_224_493 | 89 |
| 886 | 3300047320 | Ga0495672_0002318 | Ga0495672_0002318_9805_10074 | 89 |
| 887 | 3300047320 | Ga0495672_0014969 | Ga0495672_0014969_4974_5243 | 89 |
| 888 | 3300047320 | Ga0495672_0028725 | Ga0495672_0028725_2437_2706 | 89 |
| 889 | 3300047444 | Ga0495675_0482412 | Ga0495675_0482412_410_679 | 89 |
| 890 | 3300047444 | Ga0495675_0490702 | Ga0495675_0490702_111_380 | 89 |
| 891 | 3300047445 | Ga0495677_0315135 | Ga0495677_0315135_76_345 | 89 |
| 892 | 3300047446 | Ga0495679_004598 | Ga0495679_004598_5972_6241 | 89 |
| 893 | 3300047469 | Ga0495673_0009616 | Ga0495673_0009616_4672_4941 | 89 |
| 894 | 3300047469 | Ga0495673_0037613 | Ga0495673_0037613_1661_1930 | 89 |
| 895 | 3300047469 | Ga0495673_0248201 | Ga0495673_0248201_362_631 | 89 |
| 896 | 3300047470 | Ga0495681_0058372 | Ga0495681_0058372_993_1262 | 89 |
| 897 | 3300047472 | Ga0495686_0009578 | Ga0495686_0009578_2134_2403 | 89 |
| 898 | 3300047472 | Ga0495686_0045341 | Ga0495686_0045341_705_974 | 89 |
| 899 | 3300047472 | Ga0495686_0056387 | Ga0495686_0056387_1506_1775 | 89 |
| 900 | 3300047472 | Ga0495686_0118768 | Ga0495686_0118768_316_585 | 89 |
| 901 | 3300048088 | Ga0495602_0258751 | Ga0495602_0258751_684_953 | 89 |
| 902 | 3300048903 | Ga0496100_0319614 | Ga0496100_0319614_466_735 | 89 |
| 903 | 3300048903 | Ga0496100_0406379 | Ga0496100_0406379_372_641 | 89 |
| 904 | 3300048903 | Ga0496100_0881621 | Ga0496100_0881621_326_595 | 89 |
| 905 | 3300048903 | Ga0496100_1385334 | Ga0496100_1385334_54_335 | 89 |
| 906 | 3300048903 | Ga0496100_1424489 | Ga0496100_1424489_172_441 | 89 |
| 907 | 3300048904 | Ga0496101_0220741 | Ga0496101_0220741_690_959 | 89 |
| 908 | 3300048904 | Ga0496101_0508344 | Ga0496101_0508344_285_554 | 89 |
| 909 | 3300048904 | Ga0496101_1517506 | Ga0496101_1517506_25_294 | 89 |
| 910 | 3300048905 | Ga0496102_0003769 | Ga0496102_0003769_7032_7301 | 89 |
| 911 | 3300048905 | Ga0496102_0047197 | Ga0496102_0047197_370_639 | 89 |
| 912 | 3300048905 | Ga0496102_0091024 | Ga0496102_0091024_2445_2726 | 89 |
| 913 | 3300048905 | Ga0496102_0162361 | Ga0496102_0162361_1078_1347 | 89 |
| 914 | 3300048905 | Ga0496102_0519863 | Ga0496102_0519863_190_459 | 89 |
| 915 | 3300048905 | Ga0496102_0606835 | Ga0496102_0606835_570_839 | 89 |
| 916 | 3300048906 | Ga0496103_0015027 | Ga0496103_0015027_4108_4377 | 89 |
| 917 | 3300048906 | Ga0496103_0289702 | Ga0496103_0289702_528_797 | 89 |
| 918 | 3300048907 | Ga0496104_0332646 | Ga0496104_0332646_415_684 | 89 |
| 919 | 3300048907 | Ga0496104_0549034 | Ga0496104_0549034_765_1034 | 89 |
| 920 | 3300048908 | Ga0496105_0074257 | Ga0496105_0074257_1331_1600 | 89 |
| 921 | 3300048909 | Ga0496106_0002791 | Ga0496106_0002791_3920_4189 | 89 |
| 922 | 3300048909 | Ga0496106_0004326 | Ga0496106_0004326_4340_4609 | 89 |
| 923 | 3300048909 | Ga0496106_0147677 | Ga0496106_0147677_1301_1570 | 89 |
| 924 | 3300048909 | Ga0496106_0153849 | Ga0496106_0153849_228_497 | 89 |
| 925 | 3300048909 | Ga0496106_0240050 | Ga0496106_0240050_928_1197 | 89 |
| 926 | 3300048910 | Ga0496107_0002891 | Ga0496107_0002891_5101_5370 | 89 |
| 927 | 3300048910 | Ga0496107_0006827 | Ga0496107_0006827_2898_3167 | 89 |
| 928 | 3300048910 | Ga0496107_0240226 | Ga0496107_0240226_484_765 | 89 |
| 929 | 3300048910 | Ga0496107_0352618 | Ga0496107_0352618_729_998 | 89 |
| 930 | 3300048910 | Ga0496107_0624295 | Ga0496107_0624295_18_287 | 89 |
| 931 | 3300048912 | Ga0496109_0130840 | Ga0496109_0130840_1937_2206 | 89 |
| 932 | 3300048912 | Ga0496109_0165656 | Ga0496109_0165656_363_632 | 89 |
| 933 | 3300048912 | Ga0496109_0512819 | Ga0496109_0512819_493_762 | 89 |
| 934 | 3300048912 | Ga0496109_0859087 | Ga0496109_0859087_261_530 | 89 |
| 935 | 3300048913 | Ga0496110_0220479 | Ga0496110_0220479_924_1193 | 89 |
| 936 | 3300048913 | Ga0496110_0972722 | Ga0496110_0972722_252_521 | 89 |
| 937 | 3300048913 | Ga0496110_1323451 | Ga0496110_1323451_83_352 | 89 |
| 938 | 3300048915 | Ga0496112_0042175 | Ga0496112_0042175_2875_3144 | 89 |
| 939 | 3300048915 | Ga0496112_0300801 | Ga0496112_0300801_804_1073 | 89 |
| 940 | 3300048915 | Ga0496112_1451187 | Ga0496112_1451187_264_533 | 89 |
| 941 | 3300048916 | Ga0496113_0257229 | Ga0496113_0257229_910_1179 | 89 |
| 942 | 3300048916 | Ga0496113_1373480 | Ga0496113_1373480_53_322 | 89 |
| 943 | 3300048917 | Ga0496114_0267935 | Ga0496114_0267935_413_682 | 89 |
| 944 | 3300048917 | Ga0496114_0406893 | Ga0496114_0406893_820_1089 | 89 |
| 945 | 3300048917 | Ga0496114_0799512 | Ga0496114_0799512_113_382 | 89 |
| 946 | 3300048917 | Ga0496114_1320444 | Ga0496114_1320444_303_572 | 89 |
| 947 | 3300048918 | Ga0496115_0001882 | Ga0496115_0001882_5389_5658 | 89 |
| 948 | 3300048918 | Ga0496115_0012290 | Ga0496115_0012290_1643_1912 | 89 |
| 949 | 3300048918 | Ga0496115_0018363 | Ga0496115_0018363_3522_3791 | 89 |
| 950 | 3300048918 | Ga0496115_0091520 | Ga0496115_0091520_870_1139 | 89 |
| 951 | 3300048918 | Ga0496115_0125028 | Ga0496115_0125028_1041_1310 | 89 |
| 952 | 3300048918 | Ga0496115_0142589 | Ga0496115_0142589_101_370 | 89 |
| 953 | 3300048919 | Ga0496116_0034074 | Ga0496116_0034074_222_491 | 89 |
| 954 | 3300048924 | Ga0496121_0006932 | Ga0496121_0006932_451_720 | 89 |
| 955 | 3300048924 | Ga0496121_0025079 | Ga0496121_0025079_4828_5097 | 89 |
| 956 | 3300048924 | Ga0496121_0218763 | Ga0496121_0218763_702_971 | 89 |
| 957 | 3300048924 | Ga0496121_0312755 | Ga0496121_0312755_555_824 | 89 |
| 958 | 3300048925 | Ga0496122_0019200 | Ga0496122_0019200_848_1117 | 89 |
| 959 | 3300048926 | Ga0496123_0003231 | Ga0496123_0003231_4747_5016 | 89 |
| 960 | 3300048927 | Ga0496124_0235773 | Ga0496124_0235773_402_671 | 89 |
| 961 | 3300048927 | Ga0496124_0377040 | Ga0496124_0377040_400_669 | 89 |
| 962 | 3300048927 | Ga0496124_0388020 | Ga0496124_0388020_115_384 | 89 |
| 963 | 3300048927 | Ga0496124_0605547 | Ga0496124_0605547_187_456 | 89 |
| 964 | 3300048928 | Ga0496125_0005019 | Ga0496125_0005019_13347_13616 | 89 |
| 965 | 3300048928 | Ga0496125_0238456 | Ga0496125_0238456_101_370 | 89 |
| 966 | 3300048929 | Ga0496126_0020747 | Ga0496126_0020747_3119_3388 | 89 |
| 967 | 3300048929 | Ga0496126_0281280 | Ga0496126_0281280_490_759 | 89 |
| 968 | 3300048929 | Ga0496126_0695042 | Ga0496126_0695042_308_577 | 89 |
| 969 | 3300048929 | Ga0496126_1333487 | Ga0496126_1333487_182_451 | 89 |
| 970 | 3300049127 | Ga0501306_038842 | Ga0501306_038842_258_527 | 89 |
| 971 | 3300049127 | Ga0501306_055739 | Ga0501306_055739_119_388 | 89 |
| 972 | 3300049127 | Ga0501306_071972 | Ga0501306_071972_76_345 | 89 |
| 973 | 3300049128 | Ga0501308_002052 | Ga0501308_002052_1194_1463 | 89 |
| 974 | 3300049128 | Ga0501308_067183 | Ga0501308_067183_255_524 | 89 |
| 975 | 3300049129 | Ga0501309_055897 | Ga0501309_055897_77_346 | 89 |
| 976 | 3300049160 | Ga0501304_016396 | Ga0501304_016396_175_444 | 89 |
| 977 | 3300049162 | Ga0501307_036794 | Ga0501307_036794_180_449 | 89 |
| 978 | 3300049514 | Ga0501291_110920 | Ga0501291_110920_298_567 | 89 |
| 979 | 3300049521 | Ga0501298_043813 | Ga0501298_043813_580_849 | 89 |
| 980 | 3300049527 | Ga0501311_026657 | Ga0501311_026657_289_558 | 89 |
| 981 | 3300049527 | Ga0501311_071973 | Ga0501311_071973_253_522 | 89 |
| 982 | 3300049528 | Ga0501312_101100 | Ga0501312_101100_253_522 | 89 |
| 983 | 3300049529 | Ga0501313_044659 | Ga0501313_044659_42_311 | 89 |
| 984 | 3300049529 | Ga0501313_060026 | Ga0501313_060026_15_284 | 89 |
| 985 | 3300049530 | Ga0501314_034091 | Ga0501314_034091_67_336 | 89 |
| 986 | 3300049531 | Ga0501315_038122 | Ga0501315_038122_254_523 | 89 |
| 987 | 3300049533 | Ga0501317_069869 | Ga0501317_069869_259_528 | 89 |
| 988 | 3300049535 | Ga0501319_009655 | Ga0501319_009655_198_467 | 89 |
| 989 | 3300049535 | Ga0501319_019549 | Ga0501319_019549_73_342 | 89 |
| 990 | 3300049536 | Ga0501320_010289 | Ga0501320_010289_607_876 | 89 |
| 991 | 3300049536 | Ga0501320_054744 | Ga0501320_054744_193_462 | 89 |
| 992 | 3300049537 | Ga0501321_030466 | Ga0501321_030466_220_489 | 89 |
| 993 | 3300049539 | Ga0501323_020971 | Ga0501323_020971_264_533 | 89 |
| 994 | 3300049540 | Ga0501324_023178 | Ga0501324_023178_253_522 | 89 |
| 995 | 3300049541 | Ga0501325_031814 | Ga0501325_031814_191_460 | 89 |
| 996 | 3300049542 | Ga0501326_10819 | Ga0501326_10819_32_301 | 89 |
| 997 | 3300049548 | Ga0501332_13471 | Ga0501332_13471_246_515 | 89 |
| 998 | 3300049551 | Ga0501335_035084 | Ga0501335_035084_62_331 | 89 |
| 999 | 3300049568 | Ga0501031_0943306 | Ga0501031_0943306_116_385 | 89 |
| 1000 | 3300049569 | Ga0501032_0357693 | Ga0501032_0357693_628_897 | 89 |
| 1001 | 3300049569 | Ga0501032_0629437 | Ga0501032_0629437_98_379 | 89 |
| 1002 | 3300049569 | Ga0501032_0841737 | Ga0501032_0841737_29_298 | 89 |
| 1003 | 3300049570 | Ga0501033_0161773 | Ga0501033_0161773_880_1149 | 89 |
| 1004 | 3300049571 | Ga0501034_0000369 | Ga0501034_0000369_36946_37215 | 89 |
| 1005 | 3300049571 | Ga0501034_0276891 | Ga0501034_0276891_1036_1305 | 89 |
| 1006 | 3300049572 | Ga0501036_0073757 | Ga0501036_0073757_955_1224 | 89 |
| 1007 | 3300049572 | Ga0501036_1154324 | Ga0501036_1154324_132_401 | 89 |
| 1008 | 3300049572 | Ga0501036_1253622 | Ga0501036_1253622_66_335 | 89 |
| 1009 | 3300049572 | Ga0501036_1414920 | Ga0501036_1414920_206_541 | 89 |
| 1010 | 3300049572 | Ga0501036_1689706 | Ga0501036_1689706_29_298 | 89 |
| 1011 | 3300049574 | Ga0501038_0668622 | Ga0501038_0668622_348_617 | 89 |
| 1012 | 3300049575 | Ga0501039_0083327 | Ga0501039_0083327_1554_1823 | 89 |
| 1013 | 3300049577 | Ga0501041_0036376 | Ga0501041_0036376_471_740 | 89 |
| 1014 | 3300049578 | Ga0501042_0421174 | Ga0501042_0421174_515_784 | 89 |
| 1015 | 3300049578 | Ga0501042_1045035 | Ga0501042_1045035_232_501 | 89 |
| 1016 | 3300049579 | Ga0501043_0958466 | Ga0501043_0958466_183_452 | 89 |
| 1017 | 3300049580 | Ga0501046_0011384 | Ga0501046_0011384_7017_7286 | 89 |
| 1018 | 3300049580 | Ga0501046_0241656 | Ga0501046_0241656_244_513 | 89 |
| 1019 | 3300049580 | Ga0501046_0393858 | Ga0501046_0393858_339_608 | 89 |
| 1020 | 3300049581 | Ga0501047_0265028 | Ga0501047_0265028_705_974 | 89 |
| 1021 | 3300049581 | Ga0501047_0313133 | Ga0501047_0313133_56_325 | 89 |
| 1022 | 3300049581 | Ga0501047_0577604 | Ga0501047_0577604_207_476 | 89 |
| 1023 | 3300049581 | Ga0501047_0713866 | Ga0501047_0713866_11_280 | 89 |
| 1024 | 3300049581 | Ga0501047_0881233 | Ga0501047_0881233_424_693 | 89 |
| 1025 | 3300049581 | Ga0501047_0908151 | Ga0501047_0908151_263_532 | 89 |
| 1026 | 3300049581 | Ga0501047_0939092 | Ga0501047_0939092_364_633 | 89 |
| 1027 | 3300049581 | Ga0501047_1267342 | Ga0501047_1267342_141_410 | 89 |
| 1028 | 3300049582 | Ga0501048_0053847 | Ga0501048_0053847_1672_1941 | 89 |
| 1029 | 3300049582 | Ga0501048_0868282 | Ga0501048_0868282_177_446 | 89 |
| 1030 | 3300049583 | Ga0501067_0010065 | Ga0501067_0010065_2857_3126 | 89 |
| 1031 | 3300049583 | Ga0501067_0072493 | Ga0501067_0072493_278_547 | 89 |
| 1032 | 3300049583 | Ga0501067_0232490 | Ga0501067_0232490_144_413 | 89 |
| 1033 | 3300049583 | Ga0501067_0825746 | Ga0501067_0825746_44_313 | 89 |
| 1034 | 3300049584 | Ga0501068_0527927 | Ga0501068_0527927_214_483 | 89 |
| 1035 | 3300049584 | Ga0501068_0857022 | Ga0501068_0857022_277_546 | 89 |
| 1036 | 3300049585 | Ga0501069_0168755 | Ga0501069_0168755_859_1128 | 89 |
| 1037 | 3300049586 | Ga0501070_0711096 | Ga0501070_0711096_36_305 | 89 |
| 1038 | 3300049587 | Ga0501071_0103754 | Ga0501071_0103754_973_1242 | 89 |
| 1039 | 3300049588 | Ga0501072_0130901 | Ga0501072_0130901_354_623 | 89 |
| 1040 | 3300049588 | Ga0501072_0593658 | Ga0501072_0593658_95_364 | 89 |
| 1041 | 3300049589 | Ga0501073_0037252 | Ga0501073_0037252_549_818 | 89 |
| 1042 | 3300049589 | Ga0501073_0469775 | Ga0501073_0469775_317_586 | 89 |
| 1043 | 3300049589 | Ga0501073_0718394 | Ga0501073_0718394_364_633 | 89 |
| 1044 | 3300049590 | Ga0501074_0063730 | Ga0501074_0063730_447_716 | 89 |
| 1045 | 3300049590 | Ga0501074_0084489 | Ga0501074_0084489_1355_1624 | 89 |
| 1046 | 3300049590 | Ga0501074_0601244 | Ga0501074_0601244_49_318 | 89 |
| 1047 | 3300049591 | Ga0501075_0063296 | Ga0501075_0063296_687_956 | 89 |
| 1048 | 3300049592 | Ga0501076_0012239 | Ga0501076_0012239_3313_3582 | 89 |
| 1049 | 3300049592 | Ga0501076_0186261 | Ga0501076_0186261_1394_1663 | 89 |
| 1050 | 3300049592 | Ga0501076_1131097 | Ga0501076_1131097_310_579 | 89 |
| 1051 | 3300049592 | Ga0501076_1270391 | Ga0501076_1270391_26_295 | 89 |
| 1052 | 3300049592 | Ga0501076_1780405 | Ga0501076_1780405_19_288 | 89 |
| 1053 | 3300049593 | Ga0501077_0046071 | Ga0501077_0046071_68_337 | 89 |
| 1054 | 3300049593 | Ga0501077_0060416 | Ga0501077_0060416_107_376 | 89 |
| 1055 | 3300049593 | Ga0501077_1110582 | Ga0501077_1110582_137_406 | 89 |
| 1056 | 3300049671 | Ga0501238_000783 | Ga0501238_000783_2538_2807 | 89 |
| 1057 | 3300049683 | Ga0501253_044110 | Ga0501253_044110_165_434 | 89 |
| 1058 | 3300049741 | Ga0501079_0015930 | Ga0501079_0015930_3791_4060 | 89 |
| 1059 | 3300049741 | Ga0501079_0060588 | Ga0501079_0060588_801_1070 | 89 |
| 1060 | 3300049741 | Ga0501079_0658667 | Ga0501079_0658667_101_370 | 89 |
| 1061 | 3300049742 | Ga0501080_0029716 | Ga0501080_0029716_3987_4256 | 89 |
| 1062 | 3300049742 | Ga0501080_0053127 | Ga0501080_0053127_2200_2469 | 89 |
| 1063 | 3300049742 | Ga0501080_0149278 | Ga0501080_0149278_18_287 | 89 |
| 1064 | 3300049743 | Ga0501081_0059167 | Ga0501081_0059167_1476_1745 | 89 |
| 1065 | 3300049743 | Ga0501081_0060850 | Ga0501081_0060850_2159_2428 | 89 |
| 1066 | 3300049743 | Ga0501081_0115554 | Ga0501081_0115554_1525_1794 | 89 |
| 1067 | 3300049743 | Ga0501081_0309641 | Ga0501081_0309641_169_438 | 89 |
| 1068 | 3300049744 | Ga0501083_0047578 | Ga0501083_0047578_786_1055 | 89 |
| 1069 | 3300049744 | Ga0501083_0274941 | Ga0501083_0274941_501_881 | 89 |
| 1070 | 3300049744 | Ga0501083_0557753 | Ga0501083_0557753_447_716 | 89 |
| 1071 | 3300049744 | Ga0501083_0685066 | Ga0501083_0685066_304_573 | 89 |
| 1072 | 3300049765 | Ga0501268_078994 | Ga0501268_078994_91_360 | 89 |
| 1073 | 3300049776 | Ga0501280_075783 | Ga0501280_075783_190_459 | 89 |
| 1074 | 3300049822 | Ga0501035_0212703 | Ga0501035_0212703_540_809 | 89 |
| 1075 | 3300049822 | Ga0501035_0923031 | Ga0501035_0923031_41_310 | 89 |
| 1076 | 3300049823 | Ga0501044_0003898 | Ga0501044_0003898_6132_6401 | 89 |
| 1077 | 3300049823 | Ga0501044_0330910 | Ga0501044_0330910_630_899 | 89 |
| 1078 | 3300049823 | Ga0501044_0365272 | Ga0501044_0365272_255_536 | 89 |
| 1079 | 3300049823 | Ga0501044_1204031 | Ga0501044_1204031_225_494 | 89 |
| 1080 | 3300049823 | Ga0501044_1471192 | Ga0501044_1471192_164_433 | 89 |
| 1081 | 3300049824 | Ga0501045_0068163 | Ga0501045_0068163_115_384 | 89 |
| 1082 | 3300049824 | Ga0501045_0754348 | Ga0501045_0754348_163_432 | 89 |
| 1083 | 3300050489 | nmdc:mga03683_241070_c1 | nmdc:mga03683_241070_c1_68_337 | 89 |
| 1084 | 3300050489 | nmdc:mga03683_406440_c1 | nmdc:mga03683_406440_c1_209_478 | 89 |
| 1085 | 3300050490 | nmdc:mga03n38_417799_c1 | nmdc:mga03n38_417799_c1_194_463 | 89 |
| 1086 | 3300050490 | nmdc:mga03n38_943733_c1 | nmdc:mga03n38_943733_c1_224_493 | 89 |
| 1087 | 3300050491 | nmdc:mga00v17_1034173_c1 | nmdc:mga00v17_1034173_c1_175_444 | 89 |
| 1088 | 3300050491 | nmdc:mga00v17_266670_c1 | nmdc:mga00v17_266670_c1_403_672 | 89 |
| 1089 | 3300050491 | nmdc:mga00v17_505960_c1 | nmdc:mga00v17_505960_c1_125_403 | 89 |
| 1090 | 3300050491 | nmdc:mga00v17_542613_c1 | nmdc:mga00v17_542613_c1_213_482 | 89 |
| 1091 | 3300050491 | nmdc:mga00v17_966720_c1 | nmdc:mga00v17_966720_c1_157_426 | 89 |
| 1092 | 3300050493 | nmdc:mga0k408_192269_c1 | nmdc:mga0k408_192269_c1_612_881 | 89 |
| 1093 | 3300050493 | nmdc:mga0k408_324476_c1 | nmdc:mga0k408_324476_c1_241_510 | 89 |
| 1094 | 3300050493 | nmdc:mga0k408_407633_c1 | nmdc:mga0k408_407633_c1_353_622 | 89 |
| 1095 | 3300050493 | nmdc:mga0k408_48942_c1 | nmdc:mga0k408_48942_c1_1395_1664 | 89 |
| 1096 | 3300050493 | nmdc:mga0k408_742890_c1 | nmdc:mga0k408_742890_c1_48_317 | 89 |
| 1097 | 3300050496 | nmdc:mga07m45_21235_c1 | nmdc:mga07m45_21235_c1_326_595 | 89 |
| 1098 | 3300050496 | nmdc:mga07m45_343552_c1 | nmdc:mga07m45_343552_c1_331_600 | 89 |
| 1099 | 3300050496 | nmdc:mga07m45_357764_c1 | nmdc:mga07m45_357764_c1_67_336 | 89 |
| 1100 | 3300050507 | nmdc:mga05p37_122797_c1 | nmdc:mga05p37_122797_c1_1286_1555 | 89 |
| 1101 | 3300050507 | nmdc:mga05p37_1467144_c1 | nmdc:mga05p37_1467144_c1_167_436 | 89 |
| 1102 | 3300050507 | nmdc:mga05p37_1848956_c1 | nmdc:mga05p37_1848956_c1_301_570 | 89 |
| 1103 | 3300050507 | nmdc:mga05p37_588696_c1 | nmdc:mga05p37_588696_c1_632_901 | 89 |
| 1104 | 3300050507 | nmdc:mga05p37_71314_c1 | nmdc:mga05p37_71314_c1_243_512 | 89 |
| 1105 | 3300050507 | nmdc:mga05p37_72758_c1 | nmdc:mga05p37_72758_c1_1736_2005 | 89 |
| 1106 | 3300050508 | nmdc:mga09592_158152_c1 | nmdc:mga09592_158152_c1_952_1221 | 89 |
| 1107 | 3300050509 | nmdc:mga0qj67_12510_c2 | nmdc:mga0qj67_12510_c2_3384_3653 | 89 |
| 1108 | 3300050509 | nmdc:mga0qj67_65221_c1 | nmdc:mga0qj67_65221_c1_1295_1564 | 89 |
| 1109 | 3300050510 | nmdc:mga06r32_40836_c1 | nmdc:mga06r32_40836_c1_1555_1824 | 89 |
| 1110 | 3300050510 | nmdc:mga06r32_48597_c1 | nmdc:mga06r32_48597_c1_783_1052 | 89 |
| 1111 | 3300050510 | nmdc:mga06r32_790726_c1 | nmdc:mga06r32_790726_c1_277_546 | 89 |
| 1112 | 3300050511 | nmdc:mga08y16_1051708_c1 | nmdc:mga08y16_1051708_c1_181_450 | 89 |
| 1113 | 3300050511 | nmdc:mga08y16_46873_c1 | nmdc:mga08y16_46873_c1_1534_1803 | 89 |
| 1114 | 3300050512 | nmdc:mga0n895_147281_c1 | nmdc:mga0n895_147281_c1_804_1073 | 89 |
| 1115 | 3300050513 | nmdc:mga0rr50_431955_c1 | nmdc:mga0rr50_431955_c1_556_825 | 89 |
| 1116 | 3300050514 | nmdc:mga08x19_1344177_c1 | nmdc:mga08x19_1344177_c1_21_290 | 89 |
| 1117 | 3300050515 | nmdc:mga0a205_90841_c1 | nmdc:mga0a205_90841_c1_2191_2460 | 89 |
| 1118 | 3300050516 | nmdc:mga0sz30_55512_c1 | nmdc:mga0sz30_55512_c1_484_753 | 89 |
| 1119 | 3300053077 | Ga0495601_0318698 | Ga0495601_0318698_151_420 | 89 |
| 1120 | 3300053084 | Ga0495595_0041871 | Ga0495595_0041871_1135_1404 | 89 |
| 1121 | 3300053085 | Ga0495619_0789782 | Ga0495619_0789782_154_423 | 89 |
| 1122 | 3300053086 | Ga0500578_0000015 | Ga0500578_0000015_107390_107659 | 89 |
| 1123 | 3300053087 | Ga0500643_000968 | Ga0500643_000968_5683_5952 | 89 |
| 1124 | 3300053087 | Ga0500643_001537 | Ga0500643_001537_5140_5409 | 89 |
| 1125 | 3300053087 | Ga0500643_004694 | Ga0500643_004694_836_1105 | 89 |
| 1126 | 3300053087 | Ga0500643_027817 | Ga0500643_027817_698_967 | 89 |
| 1127 | 3300053088 | Ga0500644_0000058 | Ga0500644_0000058_64208_64477 | 89 |
| 1128 | 3300053088 | Ga0500644_0001545 | Ga0500644_0001545_463_732 | 89 |
| 1129 | 3300053091 | Ga0500647_0006857 | Ga0500647_0006857_4154_4423 | 89 |
| 1130 | 3300053093 | Ga0500651_0004155 | Ga0500651_0004155_5351_5620 | 89 |
| 1131 | 3300053093 | Ga0500651_0107595 | Ga0500651_0107595_166_435 | 89 |
| 1132 | 3300053096 | Ga0500641_0000654 | Ga0500641_0000654_8770_9039 | 89 |
| 1133 | 3300053096 | Ga0500641_0002664 | Ga0500641_0002664_1871_2140 | 89 |
| 1134 | 3300053096 | Ga0500641_0031491 | Ga0500641_0031491_845_1114 | 89 |
| 1135 | 3300053096 | Ga0500641_0076092 | Ga0500641_0076092_666_935 | 89 |
| 1136 | 3300053098 | Ga0500650_0170722 | Ga0500650_0170722_242_511 | 89 |
| 1137 | 3300053098 | Ga0500650_0203529 | Ga0500650_0203529_411_680 | 89 |
| 1138 | 3300053098 | Ga0500650_0504894 | Ga0500650_0504894_67_336 | 89 |
| 1139 | 3300053103 | Ga0500555_005991 | Ga0500555_005991_1573_1842 | 89 |
| 1140 | 3300053103 | Ga0500555_051950 | Ga0500555_051950_594_863 | 89 |
| 1141 | 3300053104 | Ga0500556_0003063 | Ga0500556_0003063_2692_2961 | 89 |
| 1142 | 3300053105 | Ga0500557_184260 | Ga0500557_184260_312_581 | 89 |
| 1143 | 3300053108 | Ga0500562_029255 | Ga0500562_029255_479_748 | 89 |
| 1144 | 3300053108 | Ga0500562_055144 | Ga0500562_055144_189_458 | 89 |
| 1145 | 3300053118 | Ga0500594_0008044 | Ga0500594_0008044_533_802 | 89 |
| 1146 | 3300053118 | Ga0500594_0028014 | Ga0500594_0028014_866_1135 | 89 |
| 1147 | 3300053119 | Ga0500595_024261 | Ga0500595_024261_1426_1695 | 89 |
| 1148 | 3300053119 | Ga0500595_052936 | Ga0500595_052936_649_918 | 89 |
| 1149 | 3300053119 | Ga0500595_083273 | Ga0500595_083273_477_746 | 89 |
| 1150 | 3300053120 | Ga0500597_060952 | Ga0500597_060952_1168_1437 | 89 |
| 1151 | 3300053122 | Ga0500608_000471 | Ga0500608_000471_7828_8097 | 89 |
| 1152 | 3300053122 | Ga0500608_057135 | Ga0500608_057135_1075_1344 | 89 |
| 1153 | 3300053125 | Ga0500618_002668 | Ga0500618_002668_18_287 | 89 |
| 1154 | 3300053130 | Ga0500642_0489896 | Ga0500642_0489896_105_374 | 89 |
| 1155 | 3300053131 | Ga0500652_042727 | Ga0500652_042727_612_881 | 89 |
| 1156 | 3300053133 | Ga0500655_034856 | Ga0500655_034856_368_637 | 89 |
| 1157 | 3300053133 | Ga0500655_052680 | Ga0500655_052680_488_757 | 89 |
| 1158 | 3300053134 | Ga0500658_0015841 | Ga0500658_0015841_1751_2020 | 89 |
| 1159 | 3300053136 | Ga0500559_0000004 | Ga0500559_0000004_138248_138517 | 89 |
| 1160 | 3300053136 | Ga0500559_0007940 | Ga0500559_0007940_4028_4297 | 89 |
| 1161 | 3300053136 | Ga0500559_0046749 | Ga0500559_0046749_1437_1706 | 89 |
| 1162 | 3300053136 | Ga0500559_0346057 | Ga0500559_0346057_313_582 | 89 |
| 1163 | 3300053139 | Ga0500568_0105288 | Ga0500568_0105288_455_724 | 89 |
| 1164 | 3300053139 | Ga0500568_0354179 | Ga0500568_0354179_229_498 | 89 |
| 1165 | 3300053140 | Ga0500573_0224389 | Ga0500573_0224389_318_587 | 89 |
| 1166 | 3300053146 | Ga0500588_0410545 | Ga0500588_0410545_101_370 | 89 |
| 1167 | 3300053151 | Ga0500604_0093064 | Ga0500604_0093064_267_536 | 89 |
| 1168 | 3300053151 | Ga0500604_0198816 | Ga0500604_0198816_58_327 | 89 |
| 1169 | 3300053153 | Ga0500616_0013830 | Ga0500616_0013830_913_1182 | 89 |
| 1170 | 3300053153 | Ga0500616_0031769 | Ga0500616_0031769_228_497 | 89 |
| 1171 | 3300053153 | Ga0500616_0034483 | Ga0500616_0034483_1657_1926 | 89 |
| 1172 | 3300053153 | Ga0500616_0102293 | Ga0500616_0102293_1056_1325 | 89 |
| 1173 | 3300053153 | Ga0500616_0404285 | Ga0500616_0404285_182_451 | 89 |
| 1174 | 3300053156 | Ga0500622_0003216 | Ga0500622_0003216_6144_6428 | 89 |
| 1175 | 3300053156 | Ga0500622_0008772 | Ga0500622_0008772_4056_4325 | 89 |
| 1176 | 3300053156 | Ga0500622_0019728 | Ga0500622_0019728_1465_1734 | 89 |
| 1177 | 3300053156 | Ga0500622_0057699 | Ga0500622_0057699_1420_1689 | 89 |
| 1178 | 3300053156 | Ga0500622_0086816 | Ga0500622_0086816_397_666 | 89 |
| 1179 | 3300053157 | Ga0500624_000193 | Ga0500624_000193_21151_21420 | 89 |
| 1180 | 3300053158 | Ga0500627_0001642 | Ga0500627_0001642_2580_2849 | 89 |
| 1181 | 3300053158 | Ga0500627_0155284 | Ga0500627_0155284_742_1011 | 89 |
| 1182 | 3300053160 | Ga0500633_0167837 | Ga0500633_0167837_223_492 | 89 |
| 1183 | 3300053161 | Ga0500634_0147912 | Ga0500634_0147912_11_280 | 89 |
| 1184 | 3300053177 | Ga0500636_0520626 | Ga0500636_0520626_33_302 | 89 |
| 1185 | 3300053178 | Ga0500637_0001689 | Ga0500637_0001689_6494_6763 | 89 |
| 1186 | 3300053727 | Ga0500611_007667 | Ga0500611_007667_32_301 | 89 |
| 1187 | 3300053730 | Ga0500645_000730 | Ga0500645_000730_5688_5957 | 89 |
| 1188 | 3300053730 | Ga0500645_003413 | Ga0500645_003413_5061_5330 | 89 |
| 1189 | 3300053730 | Ga0500645_004984 | Ga0500645_004984_1456_1725 | 89 |
| 1190 | 3300053733 | Ga0500552_005395 | Ga0500552_005395_733_1002 | 89 |
| 1191 | 3300054114 | Ga0501084_0029290 | Ga0501084_0029290_1070_1339 | 89 |
| 1192 | 3300054114 | Ga0501084_0059405 | Ga0501084_0059405_593_862 | 89 |
| 1193 | 3300054114 | Ga0501084_0453374 | Ga0501084_0453374_804_1073 | 89 |
| 1194 | 3300054114 | Ga0501084_0925832 | Ga0501084_0925832_383_652 | 89 |
| 1195 | 3300054114 | Ga0501084_1432218 | Ga0501084_1432218_87_356 | 89 |
| 1196 | 3300059477 | Ga0587084_045345 | Ga0587084_045345_257_526 | 89 |
| 1197 | 3300059477 | Ga0587084_129107 | Ga0587084_129107_32_301 | 89 |
| 1198 | 3300059478 | Ga0587093_108132 | Ga0587093_108132_121_390 | 89 |
| 1199 | 3300059490 | Ga0587066_171539 | Ga0587066_171539_30_299 | 89 |
| 1200 | 3300059491 | Ga0587070_009166 | Ga0587070_009166_258_527 | 89 |
| 1201 | 3300059491 | Ga0587070_196204 | Ga0587070_196204_251_520 | 89 |
| 1202 | 3300059492 | Ga0587073_0198660 | Ga0587073_0198660_27_296 | 89 |
| 1203 | 3300059493 | Ga0587077_078882 | Ga0587077_078882_216_485 | 89 |
| 1204 | 3300059493 | Ga0587077_084621 | Ga0587077_084621_239_508 | 89 |
| 1205 | 3300059493 | Ga0587077_196856 | Ga0587077_196856_16_285 | 89 |
| 1206 | 3300059493 | Ga0587077_268092 | Ga0587077_268092_109_378 | 89 |
| 1207 | 3300059503 | Ga0587080_048073 | Ga0587080_048073_276_545 | 89 |
| 1208 | 3300059503 | Ga0587080_056927 | Ga0587080_056927_237_506 | 89 |
| 1209 | 3300059504 | Ga0587082_062142 | Ga0587082_062142_261_530 | 89 |
| 1210 | 3300059504 | Ga0587082_077604 | Ga0587082_077604_256_525 | 89 |
| 1211 | 3300059504 | Ga0587082_126145 | Ga0587082_126145_257_526 | 89 |
| 1212 | 3300059505 | Ga0587083_0002069 | Ga0587083_0002069_255_524 | 89 |
| 1213 | 3300059505 | Ga0587083_0069149 | Ga0587083_0069149_270_539 | 89 |
| 1214 | 3300059505 | Ga0587083_0130208 | Ga0587083_0130208_311_580 | 89 |
| 1215 | 3300059505 | Ga0587083_0193085 | Ga0587083_0193085_249_518 | 89 |
| 1216 | 3300059505 | Ga0587083_0207277 | Ga0587083_0207277_69_338 | 89 |
| 1217 | 3300059506 | Ga0587085_029109 | Ga0587085_029109_374_643 | 89 |
| 1218 | 3300059506 | Ga0587085_032522 | Ga0587085_032522_327_596 | 89 |
| 1219 | 3300059506 | Ga0587085_040279 | Ga0587085_040279_230_499 | 89 |
| 1220 | 3300059506 | Ga0587085_101280 | Ga0587085_101280_273_542 | 89 |
| 1221 | 3300059506 | Ga0587085_131533 | Ga0587085_131533_253_522 | 89 |
| 1222 | 3300059507 | Ga0587086_019882 | Ga0587086_019882_302_571 | 89 |
| 1223 | 3300059508 | Ga0587088_123448 | Ga0587088_123448_270_539 | 89 |
| 1224 | 3300059510 | Ga0587090_045301 | Ga0587090_045301_258_527 | 89 |
| 1225 | 3300059510 | Ga0587090_097141 | Ga0587090_097141_258_527 | 89 |
| 1226 | 3300059510 | Ga0587090_140730 | Ga0587090_140730_16_285 | 89 |
| 1227 | 3300059511 | Ga0587091_122771 | Ga0587091_122771_251_520 | 89 |
| 1228 | 3300059511 | Ga0587091_198655 | Ga0587091_198655_257_526 | 89 |
| 1229 | 3300059512 | Ga0587092_054154 | Ga0587092_054154_137_406 | 89 |
| 1230 | 3300059512 | Ga0587092_107895 | Ga0587092_107895_258_527 | 89 |
| 1231 | 3300059513 | Ga0587094_010142 | Ga0587094_010142_167_436 | 89 |
| 1232 | 3300059513 | Ga0587094_089105 | Ga0587094_089105_268_537 | 89 |
| 1233 | 3300059604 | Ga0587098_039252 | Ga0587098_039252_246_515 | 89 |
| 1234 | 3300059604 | Ga0587098_052495 | Ga0587098_052495_256_558 | 89 |
| 1235 | 3300059607 | Ga0587125_022605 | Ga0587125_022605_350_619 | 89 |
| 1236 | 3300059623 | Ga0587101_006195 | Ga0587101_006195_258_527 | 89 |
| 1237 | 3300059623 | Ga0587101_061627 | Ga0587101_061627_147_416 | 89 |
| 1238 | 3300059623 | Ga0587101_082685 | Ga0587101_082685_246_515 | 89 |
| 1239 | 3300059623 | Ga0587101_085971 | Ga0587101_085971_130_399 | 89 |
| 1240 | 3300059623 | Ga0587101_093544 | Ga0587101_093544_61_330 | 89 |
| 1241 | 3300059624 | Ga0587109_168549 | Ga0587109_168549_257_526 | 89 |
| 1242 | 3300059624 | Ga0587109_184727 | Ga0587109_184727_255_524 | 89 |
| 1243 | 3300059626 | Ga0587115_076061 | Ga0587115_076061_48_317 | 89 |
| 1244 | 3300059626 | Ga0587115_102520 | Ga0587115_102520_15_284 | 89 |
| 1245 | 3300059630 | Ga0587128_042925 | Ga0587128_042925_256_525 | 89 |
| 1246 | 3300059630 | Ga0587128_094714 | Ga0587128_094714_90_359 | 89 |
| 1247 | 3300059630 | Ga0587128_096287 | Ga0587128_096287_55_324 | 89 |
| 1248 | 3300059639 | Ga0587062_066382 | Ga0587062_066382_256_525 | 89 |
| 1249 | 3300059639 | Ga0587062_071306 | Ga0587062_071306_98_367 | 89 |
| 1250 | 3300059639 | Ga0587062_087157 | Ga0587062_087157_256_525 | 89 |
| 1251 | 3300059641 | Ga0587068_079951 | Ga0587068_079951_88_357 | 89 |
| 1252 | 3300059641 | Ga0587068_110464 | Ga0587068_110464_255_524 | 89 |
| 1253 | 3300059641 | Ga0587068_161699 | Ga0587068_161699_163_432 | 89 |
| 1254 | 3300059641 | Ga0587068_161715 | Ga0587068_161715_229_498 | 89 |
| 1255 | 3300059642 | Ga0587069_102712 | Ga0587069_102712_273_542 | 89 |
| 1256 | 3300059643 | Ga0587072_066045 | Ga0587072_066045_260_529 | 89 |
| 1257 | 3300059643 | Ga0587072_141462 | Ga0587072_141462_257_526 | 89 |
| 1258 | 3300059643 | Ga0587072_203244 | Ga0587072_203244_61_330 | 89 |
| 1259 | 3300059645 | Ga0587076_005924 | Ga0587076_005924_1039_1308 | 89 |
| 1260 | 3300059645 | Ga0587076_177405 | Ga0587076_177405_251_520 | 89 |
| 1261 | 3300059646 | Ga0587078_032556 | Ga0587078_032556_170_439 | 89 |
| 1262 | 3300059647 | Ga0587079_038790 | Ga0587079_038790_302_571 | 89 |
| 1263 | 3300059647 | Ga0587079_072064 | Ga0587079_072064_232_501 | 89 |
| 1264 | 3300059647 | Ga0587079_090939 | Ga0587079_090939_256_525 | 89 |
| 1265 | 3300059651 | Ga0587105_013126 | Ga0587105_013126_258_527 | 89 |
| 1266 | 3300059652 | Ga0587107_012142 | Ga0587107_012142_666_935 | 89 |
| 1267 | 3300059652 | Ga0587107_051188 | Ga0587107_051188_178_447 | 89 |
| 1268 | 3300059653 | Ga0587108_038871 | Ga0587108_038871_32_301 | 89 |
| 1269 | 3300059654 | Ga0587110_018106 | Ga0587110_018106_258_527 | 89 |
| 1270 | 3300059660 | Ga0587124_033986 | Ga0587124_033986_252_521 | 89 |
| 1271 | 3300060344 | Ga0587071_058758 | Ga0587071_058758_270_539 | 89 |
| 1272 | 3300060344 | Ga0587071_118874 | Ga0587071_118874_75_344 | 89 |
| 1273 | 3300060344 | Ga0587071_150537 | Ga0587071_150537_39_308 | 89 |
| 1274 | 3300060346 | Ga0587111_0003255 | Ga0587111_0003255_256_525 | 89 |
| 1275 | 3300060346 | Ga0587111_0009437 | Ga0587111_0009437_1176_1445 | 89 |
| 1276 | 3300060346 | Ga0587111_0026302 | Ga0587111_0026302_361_630 | 89 |
| 1277 | 3300060346 | Ga0587111_0050087 | Ga0587111_0050087_333_602 | 89 |
| 1278 | 3300060346 | Ga0587111_0079645 | Ga0587111_0079645_254_523 | 89 |
| 1279 | 3300060346 | Ga0587111_0120838 | Ga0587111_0120838_311_580 | 89 |
| 1280 | 3300060346 | Ga0587111_0193254 | Ga0587111_0193254_253_522 | 89 |
| 1281 | 3300060346 | Ga0587111_0230872 | Ga0587111_0230872_233_502 | 89 |
| 1282 | 3300060353 | Ga0501082_0007661 | Ga0501082_0007661_1452_1721 | 89 |
| 1283 | 3300060353 | Ga0501082_0020564 | Ga0501082_0020564_4991_5260 | 89 |
| 1284 | 3300060353 | Ga0501082_0038268 | Ga0501082_0038268_2438_2707 | 89 |
| 1285 | 3300060353 | Ga0501082_0041062 | Ga0501082_0041062_3176_3445 | 89 |
| 1286 | 3300060353 | Ga0501082_0332342 | Ga0501082_0332342_537_806 | 89 |
| 1287 | 3300061734 | Ga0530510_0012139 | Ga0530510_0012139_1586_1855 | 89 |
| 1288 | 3300061734 | Ga0530510_0164147 | Ga0530510_0164147_75_344 | 89 |
| 1289 | 3300061734 | Ga0530510_1138423 | Ga0530510_1138423_231_500 | 89 |
| 1290 | 3300061734 | Ga0530510_1501704 | Ga0530510_1501704_49_318 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nhn-assembly1.cif.gz_p | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9943 | 3 | 88 |
| 7p7t-assembly1.cif.gz_p | poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii | 0.9926 | 4 | 88 |
| 7p7u-assembly1.cif.gz_p | e. faecalis 70s ribosome with p-trna, state iv | 0.9926 | 4 | 88 |
| 7p7q-assembly1.cif.gz_p | e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume | 0.9924 | 4 | 88 |
| 8cdu-assembly1.cif.gz_O | rnase r bound to a 30s degradation intermediate (main state) | 0.9914 | 4 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ji4O00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9752 | 2 | 88 | 1.10.287.10 |
| 4dr7O00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9723 | 2 | 89 | 1.10.287.10 |
| 1hnwO00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.972 | 2 | 89 | 1.10.287.10 |
| 1ibkO00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9719 | 2 | 89 | 1.10.287.10 |
| 1iblO00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9715 | 2 | 89 | 1.10.287.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6BZ41-F1-model_v4 | Small ribosomal subunit protein uS15 | 0.9981 | 3 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A0G0N241-F1-model_v4 | Small ribosomal subunit protein uS15 | 0.998 | 2 | 88 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A800EY98-F1-model_v4 | Small ribosomal subunit protein uS15 | 0.9979 | 3 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A645AKY0-F1-model_v4 | 30S ribosomal protein S15 | 0.9979 | 4 | 89 |
GO:0003735
GO:0006412 GO:0022627 |
| AF-A0A2H0W062-F1-model_v4 | Small ribosomal subunit protein uS15 | 0.9971 | 2 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar