F492195
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1251 | 579 | 1175 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100420032|Ga0070680_1004200323 |
| Length | 205 |
| Sequence | MELNVIGASSPAKQALNVSDVVFGGEYKKALIHQVVIAYQATGRAGTKAQLSRGEMSGTTKRFKKQKGGGARHGDYRAPIFIGGGVTFAAKPRSYEQKVNRKAYRIAIRSIFAELIRQDRLKVVDNFGIDTPKTSAMVAKLAELNVSGRVLLVSQDADEAVFLAARNIPYINVLDVMGLNPVSLVGSDHVVMTVEAVKKVEEWLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 4 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 5 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 6 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 7 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 8 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 9 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 10 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 11 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 12 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 13 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 14 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 15 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 16 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 17 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 18 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 19 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 20 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 21 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 22 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 23 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 24 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 25 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 26 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 27 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 28 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 29 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 30 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 31 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 32 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 33 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 34 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 35 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 36 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 37 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 38 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 39 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 40 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 41 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 42 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 43 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 44 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 45 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 46 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 47 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 48 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 49 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 50 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 51 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 52 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 53 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 54 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 55 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 56 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 57 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 58 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 59 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 60 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 61 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 62 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 63 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 64 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 65 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 66 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 67 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 68 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 69 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 70 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 71 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 72 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 73 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 74 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 75 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 76 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 77 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 78 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 79 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 80 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 81 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 82 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 83 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 84 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 85 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 86 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 87 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 88 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 89 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 90 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 91 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 92 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 93 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 94 | 3300003382 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM | Metagenome | Rhizosphere |
| 95 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 96 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 97 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 98 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 99 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 100 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 101 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 103 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 105 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 106 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 107 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 108 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 109 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 110 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 111 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 112 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 113 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 114 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 115 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 116 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 117 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 118 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 119 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 120 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 121 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 123 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 127 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 131 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 133 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 145 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 153 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 154 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 155 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 157 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 163 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 164 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 165 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 166 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 167 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 168 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 169 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 170 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 171 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 172 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 173 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 174 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 175 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 176 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 177 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 178 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 179 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 181 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 182 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 184 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 185 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 198 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 201 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 202 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 203 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 204 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 205 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 217 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 218 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 219 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 220 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 221 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 222 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 223 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 225 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 226 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 227 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 228 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 229 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 230 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 231 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 233 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 234 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 243 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 244 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 245 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 248 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 249 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 251 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 253 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 255 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 258 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 261 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 337 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 338 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 339 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 340 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 341 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 342 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 348 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 349 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 350 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 351 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 352 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 353 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 354 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 355 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 356 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 357 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 358 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 359 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 360 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 361 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 362 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 363 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 364 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 365 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 366 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 367 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 368 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 369 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 370 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 371 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 372 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 373 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 374 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 375 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 376 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 377 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 378 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 379 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 380 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 381 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 382 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 383 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 384 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 385 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 386 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 387 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 388 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 389 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 390 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 391 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 392 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 393 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 394 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 395 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 396 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 397 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 398 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 399 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 400 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 401 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 402 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 403 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 404 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 405 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 406 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 407 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 408 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 409 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 410 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 411 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 412 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 413 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 414 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 415 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 416 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 417 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 418 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 419 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 420 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 421 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 422 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 423 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 424 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 466 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 467 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 468 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 469 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 470 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 471 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 472 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 474 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 475 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 476 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 477 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 478 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 479 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 480 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 481 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 482 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 483 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 484 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 485 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 486 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 487 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 488 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 489 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 490 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 528 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 529 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 530 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 531 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 532 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 533 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 534 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 541 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 542 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 543 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 544 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 545 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 546 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 547 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 548 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 549 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 550 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 551 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 552 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 575 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 576 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 577 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 578 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 579 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.73 |
| Metatranscriptomes | 7.19 |
| Isolates | 6.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.08 |
| Bulb | 0 |
| Endosphere | 13.43 |
| Nodule | 0.08 |
| Rhizoplane | 4.16 |
| Rhizosphere | 70.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004671 | 3300001904 | Bacteria | 2329 |
| 2 | JGI24740J21852_10006264 | 3300001979 | Bacteria | 4944 |
| 3 | JGI24739J22299_10000118 | 3300001989 | Bacteria | 24899 |
| 4 | JGI24739J22299_10027486 | 3300001989 | Bacteria | 1988 |
| 5 | JGI24737J22298_10010174 | 3300001990 | Bacteria | 3112 |
| 6 | JGI24737J22298_10010685 | 3300001990 | Bacteria | 3024 |
| 7 | JGI24737J22298_10037402 | 3300001990 | Bacteria | 1496 |
| 8 | JGI24735J21928_10009574 | 3300002067 | Bacteria | 3107 |
| 9 | JGI24735J21928_10011190 | 3300002067 | Bacteria | 2848 |
| 10 | JGI24738J21930_10000244 | 3300002075 | Bacteria | 14787 |
| 11 | JGI24744J21845_10002487 | 3300002077 | Bacteria | 3757 |
| 12 | JGI25156J39149_1002085 | 3300002705 | Bacteria | 7577 |
| 13 | JGI25156J39149_1002290 | 3300002705 | Bacteria | 7025 |
| 14 | JGI25156J39149_1003296 | 3300002705 | Bacteria | 5346 |
| 15 | JGI25156J39149_1007054 | 3300002705 | Bacteria | 3002 |
| 16 | JGI25162J39368_1003847 | 3300002737 | Bacteria | 3938 |
| 17 | JGI25162J39368_1003864 | 3300002737 | Bacteria | 3912 |
| 18 | JGI25162J39368_1003895 | 3300002737 | Bacteria | 3875 |
| 19 | JGI25162J39368_1008978 | 3300002737 | Bacteria | 1377 |
| 20 | JGI25154J39366_1006144 | 3300002738 | Bacteria | 1800 |
| 21 | JGI25157J39369_1001153 | 3300002741 | Bacteria | 11428 |
| 22 | JGI25157J39369_1001750 | 3300002741 | Bacteria | 7146 |
| 23 | JGI25157J39369_1001921 | 3300002741 | Bacteria | 6268 |
| 24 | JGI25157J39369_1002043 | 3300002741 | Bacteria | 5780 |
| 25 | JGI25157J39369_1002044 | 3300002741 | Bacteria | 5780 |
| 26 | JGI25163J39215_1001413 | 3300002771 | Bacteria | 4010 |
| 27 | JGI25164J39214_1000312 | 3300002772 | Bacteria | 31934 |
| 28 | JGI25164J39214_1000781 | 3300002772 | Bacteria | 11524 |
| 29 | JGI25152J39213_1000284 | 3300002773 | Bacteria | 33794 |
| 30 | JGI25150J39212_1000359 | 3300002774 | Bacteria | 22362 |
| 31 | JGI25151J46595_10000895 | 3300003187 | Bacteria | 23452 |
| 32 | JGI25151J46595_10007643 | 3300003187 | Bacteria | 5275 |
| 33 | JGI25151J46595_10013580 | 3300003187 | Bacteria | 3661 |
| 34 | JGI25165J46597_1000586 | 3300003214 | Bacteria | 31905 |
| 35 | JGI25165J46597_1001532 | 3300003214 | Bacteria | 11524 |
| 36 | JGI25165J46597_1010873 | 3300003214 | Bacteria | 1315 |
| 37 | JGI25153J46596_10000050 | 3300003215 | Bacteria | 140710 |
| 38 | JGI25153J46596_10022417 | 3300003215 | Bacteria | 2328 |
| 39 | Ga0006770J48903_1007534 | 3300003305 | Bacteria | 6179 |
| 40 | rootH2_10028076 | 3300003320 | Bacteria | 2913 |
| 41 | JGI25160J50197_1034172 | 3300003354 | Bacteria | 1266 |
| 42 | JGI26145J50221_1000107 | 3300003371 | Bacteria | 6560 |
| 43 | JGI26139J50223_100733 | 3300003382 | Bacteria | 1056 |
| 44 | Ga0006556J51387_1018520 | 3300003479 | Bacteria | 14040 |
| 45 | Ga0006556J51387_1028196 | 3300003479 | Bacteria | 2681 |
| 46 | Ga0006558J51389_1018313 | 3300003558 | Bacteria | 6898 |
| 47 | Ga0006560J51390_1017170 | 3300003565 | Bacteria | 14049 |
| 48 | Ga0006560J51390_1021707 | 3300003565 | Bacteria | 2646 |
| 49 | Ga0006554J51385_1017088 | 3300003567 | Bacteria | 14046 |
| 50 | Ga0006554J51385_1020490 | 3300003567 | Bacteria | 10124 |
| 51 | Ga0007409J51694_1033072 | 3300003575 | Bacteria | 2330 |
| 52 | Ga0006562J51391_1006869 | 3300003578 | Bacteria | 31335 |
| 53 | Ga0006562J51391_1018587 | 3300003578 | Bacteria | 6552 |
| 54 | Ga0032354_1074945 | 3300003693 | Bacteria | 1191 |
| 55 | Ga0055538_1000680 | 3300003751 | Bacteria | 10513 |
| 56 | Ga0055539_1000456 | 3300003752 | Bacteria | 13948 |
| 57 | Ga0055533_1000432 | 3300003756 | Bacteria | 15970 |
| 58 | Ga0055533_1002319 | 3300003756 | Bacteria | 4392 |
| 59 | Ga0055525_1000111 | 3300003759 | Bacteria | 127836 |
| 60 | Ga0055527_1001178 | 3300003760 | Bacteria | 5917 |
| 61 | Ga0055527_1001334 | 3300003760 | Bacteria | 5331 |
| 62 | Ga0055527_1004708 | 3300003760 | Bacteria | 1842 |
| 63 | Ga0055535_1002650 | 3300003761 | Bacteria | 5917 |
| 64 | Ga0055535_1002929 | 3300003761 | Bacteria | 5298 |
| 65 | Ga0055535_1004862 | 3300003761 | Bacteria | 3121 |
| 66 | Ga0055535_1006090 | 3300003761 | Bacteria | 2508 |
| 67 | Ga0055535_1006166 | 3300003761 | Bacteria | 2478 |
| 68 | Ga0055542_1002512 | 3300003762 | Bacteria | 5917 |
| 69 | Ga0055542_1003780 | 3300003762 | Bacteria | 3938 |
| 70 | Ga0055542_1003848 | 3300003762 | Bacteria | 3875 |
| 71 | Ga0055542_1003932 | 3300003762 | Bacteria | 3807 |
| 72 | Ga0055542_1004903 | 3300003762 | Bacteria | 3121 |
| 73 | Ga0055542_1006542 | 3300003762 | Bacteria | 2478 |
| 74 | Ga0055529_1001670 | 3300003763 | Bacteria | 5780 |
| 75 | Ga0055529_1002584 | 3300003763 | Bacteria | 3389 |
| 76 | Ga0055529_1002611 | 3300003763 | Bacteria | 3349 |
| 77 | Ga0055529_1003204 | 3300003763 | Bacteria | 2799 |
| 78 | Ga0055526_1005867 | 3300003771 | Bacteria | 6888 |
| 79 | Ga0055526_1008536 | 3300003771 | Bacteria | 5088 |
| 80 | Ga0055526_1008987 | 3300003771 | Bacteria | 4886 |
| 81 | Ga0055537_1000851 | 3300003773 | Bacteria | 14843 |
| 82 | Ga0055537_1001096 | 3300003773 | Bacteria | 11761 |
| 83 | Ga0055524_1013601 | 3300003775 | Bacteria | 3064 |
| 84 | Ga0055524_1013602 | 3300003775 | Bacteria | 3064 |
| 85 | Ga0055524_1015666 | 3300003775 | Bacteria | 2753 |
| 86 | Ga0055536_1014260 | 3300003781 | Bacteria | 2806 |
| 87 | Ga0055536_1024910 | 3300003781 | Bacteria | 1719 |
| 88 | Ga0055534_1000766 | 3300003784 | Bacteria | 15218 |
| 89 | Ga0055534_1003331 | 3300003784 | Bacteria | 5088 |
| 90 | Ga0055534_1006907 | 3300003784 | Bacteria | 2790 |
| 91 | Ga0055528_1001961 | 3300003790 | Bacteria | 11621 |
| 92 | Ga0055528_1013611 | 3300003790 | Bacteria | 3070 |
| 93 | Ga0055528_1016393 | 3300003790 | Bacteria | 2622 |
| 94 | Ga0055530_10004966 | 3300003791 | Bacteria | 6579 |
| 95 | Ga0055530_10025415 | 3300003791 | Bacteria | 1654 |
| 96 | Ga0055530_10067608 | 3300003791 | Bacteria | 779 |
| 97 | Ga0055531_10014020 | 3300003794 | Bacteria | 3645 |
| 98 | Ga0055531_10017875 | 3300003794 | Bacteria | 2963 |
| 99 | Ga0055531_10026369 | 3300003794 | Bacteria | 2075 |
| 100 | Ga0058692_1000748 | 3300003856 | Bacteria | 13063 |
| 101 | Ga0058692_1000785 | 3300003856 | Bacteria | 12735 |
| 102 | Ga0058860_10137024 | 3300004801 | Bacteria | 3744 |
| 103 | Ga0065165_1000598 | 3300005262 | Bacteria | 52772 |
| 104 | Ga0065165_1033037 | 3300005262 | Bacteria | 1615 |
| 105 | Ga0065714_10109302 | 3300005288 | Bacteria | 1502 |
| 106 | Ga0065704_10071563 | 3300005289 | Bacteria | 10695 |
| 107 | Ga0070658_10987122 | 3300005327 | Bacteria | 732 |
| 108 | Ga0070683_100194209 | 3300005329 | Bacteria | 1927 |
| 109 | Ga0070670_100015496 | 3300005331 | Bacteria | 6547 |
| 110 | Ga0070670_100045008 | 3300005331 | Bacteria | 3793 |
| 111 | Ga0070670_100143059 | 3300005331 | Bacteria | 2068 |
| 112 | Ga0070670_100360366 | 3300005331 | Bacteria | 1278 |
| 113 | Ga0070670_100385915 | 3300005331 | Bacteria | 1234 |
| 114 | Ga0070670_100407778 | 3300005331 | Bacteria | 1200 |
| 115 | Ga0068869_100043109 | 3300005334 | Bacteria | 3239 |
| 116 | Ga0068869_100843709 | 3300005334 | Bacteria | 790 |
| 117 | Ga0070666_10000012 | 3300005335 | Bacteria | 244720 |
| 118 | Ga0070666_10028752 | 3300005335 | Bacteria | 3650 |
| 119 | Ga0070680_100214844 | 3300005336 | Bacteria | 1623 |
| 120 | Ga0070680_100219981 | 3300005336 | Bacteria | 1603 |
| 121 | Ga0070680_100255720 | 3300005336 | Bacteria | 1481 |
| 122 | Ga0070680_100420032 | 3300005336 | Bacteria | 1141 |
| 123 | Ga0070682_100046558 | 3300005337 | Bacteria | 2692 |
| 124 | Ga0070682_100141710 | 3300005337 | Bacteria | 1639 |
| 125 | Ga0070682_100235089 | 3300005337 | Bacteria | 1312 |
| 126 | Ga0068868_100282839 | 3300005338 | Bacteria | 1404 |
| 127 | Ga0070660_100058257 | 3300005339 | Bacteria | 2994 |
| 128 | Ga0070660_100745227 | 3300005339 | Bacteria | 822 |
| 129 | Ga0070689_100041431 | 3300005340 | Bacteria | 3535 |
| 130 | Ga0070691_10463307 | 3300005341 | Bacteria | 726 |
| 131 | Ga0070661_100015281 | 3300005344 | Bacteria | 5418 |
| 132 | Ga0070661_100028282 | 3300005344 | Bacteria | 4043 |
| 133 | Ga0070661_101015440 | 3300005344 | Bacteria | 688 |
| 134 | Ga0070692_10054766 | 3300005345 | Bacteria | 2084 |
| 135 | Ga0070668_100034720 | 3300005347 | Bacteria | 3843 |
| 136 | Ga0070668_100061248 | 3300005347 | Bacteria | 2915 |
| 137 | Ga0070668_100225982 | 3300005347 | Bacteria | 1546 |
| 138 | Ga0070668_100303029 | 3300005347 | Bacteria | 1341 |
| 139 | Ga0070669_100222301 | 3300005353 | Bacteria | 1493 |
| 140 | Ga0070675_100105895 | 3300005354 | Bacteria | 2373 |
| 141 | Ga0070675_100213624 | 3300005354 | Bacteria | 1678 |
| 142 | Ga0070671_100012931 | 3300005355 | Bacteria | 6725 |
| 143 | Ga0070671_100051737 | 3300005355 | Bacteria | 3416 |
| 144 | Ga0070671_100202548 | 3300005355 | Bacteria | 1683 |
| 145 | Ga0070671_100724727 | 3300005355 | Bacteria | 863 |
| 146 | Ga0070673_100109100 | 3300005364 | Bacteria | 2292 |
| 147 | Ga0070673_100170446 | 3300005364 | Bacteria | 1858 |
| 148 | Ga0070673_100209228 | 3300005364 | Bacteria | 1684 |
| 149 | Ga0070659_100219319 | 3300005366 | Bacteria | 1569 |
| 150 | Ga0070659_100231145 | 3300005366 | Bacteria | 1528 |
| 151 | Ga0070659_100393823 | 3300005366 | Bacteria | 1168 |
| 152 | Ga0070659_100794965 | 3300005366 | Bacteria | 822 |
| 153 | Ga0070667_100075141 | 3300005367 | Bacteria | 2884 |
| 154 | Ga0070667_100797580 | 3300005367 | Bacteria | 877 |
| 155 | Ga0070714_100086583 | 3300005435 | Bacteria | 2738 |
| 156 | Ga0070714_100162027 | 3300005435 | Bacteria | 2024 |
| 157 | Ga0070714_100254633 | 3300005435 | Bacteria | 1624 |
| 158 | Ga0070714_100743036 | 3300005435 | Bacteria | 948 |
| 159 | Ga0070714_100793077 | 3300005435 | Bacteria | 917 |
| 160 | Ga0070713_100008401 | 3300005436 | Bacteria | 7319 |
| 161 | Ga0070710_10040859 | 3300005437 | Bacteria | 2558 |
| 162 | Ga0070710_10099927 | 3300005437 | Bacteria | 1726 |
| 163 | Ga0070710_10793862 | 3300005437 | Bacteria | 676 |
| 164 | Ga0070701_10282652 | 3300005438 | Bacteria | 1014 |
| 165 | Ga0070700_100877305 | 3300005441 | Bacteria | 729 |
| 166 | Ga0070694_100380270 | 3300005444 | Bacteria | 1101 |
| 167 | Ga0070663_100036003 | 3300005455 | Bacteria | 3438 |
| 168 | Ga0070663_100053898 | 3300005455 | Bacteria | 2873 |
| 169 | Ga0070663_100059429 | 3300005455 | Bacteria | 2747 |
| 170 | Ga0070663_100088895 | 3300005455 | Bacteria | 2285 |
| 171 | Ga0070663_100112513 | 3300005455 | Bacteria | 2047 |
| 172 | Ga0070663_100112649 | 3300005455 | Bacteria | 2046 |
| 173 | Ga0070663_100150300 | 3300005455 | Bacteria | 1785 |
| 174 | Ga0070663_100772457 | 3300005455 | Bacteria | 822 |
| 175 | Ga0070678_100729891 | 3300005456 | Bacteria | 895 |
| 176 | Ga0070662_100282610 | 3300005457 | Bacteria | 1343 |
| 177 | Ga0070681_10075723 | 3300005458 | Bacteria | 3325 |
| 178 | Ga0070681_10121502 | 3300005458 | Bacteria | 2546 |
| 179 | Ga0070681_10128522 | 3300005458 | Bacteria | 2466 |
| 180 | Ga0070681_10205910 | 3300005458 | Bacteria | 1884 |
| 181 | Ga0070681_10828609 | 3300005458 | Bacteria | 843 |
| 182 | Ga0070685_10002255 | 3300005466 | Bacteria | 9947 |
| 183 | Ga0070679_100385818 | 3300005530 | Bacteria | 1347 |
| 184 | Ga0070679_100466934 | 3300005530 | Bacteria | 1206 |
| 185 | Ga0070684_101113278 | 3300005535 | Bacteria | 742 |
| 186 | Ga0068853_100116876 | 3300005539 | Bacteria | 2375 |
| 187 | Ga0068853_100191675 | 3300005539 | Bacteria | 1857 |
| 188 | Ga0068853_100317536 | 3300005539 | Bacteria | 1443 |
| 189 | Ga0068853_100340462 | 3300005539 | Bacteria | 1393 |
| 190 | Ga0068853_100387241 | 3300005539 | Bacteria | 1306 |
| 191 | Ga0068853_100449667 | 3300005539 | Bacteria | 1212 |
| 192 | Ga0070672_100228215 | 3300005543 | Bacteria | 1563 |
| 193 | Ga0070672_100451180 | 3300005543 | Bacteria | 1108 |
| 194 | Ga0070696_100010164 | 3300005546 | Bacteria | 6301 |
| 195 | Ga0070696_100128219 | 3300005546 | Bacteria | 1843 |
| 196 | Ga0070696_100612860 | 3300005546 | Bacteria | 879 |
| 197 | Ga0070696_100760455 | 3300005546 | Bacteria | 795 |
| 198 | Ga0070693_100016180 | 3300005547 | Bacteria | 3854 |
| 199 | Ga0070693_100025657 | 3300005547 | Bacteria | 3173 |
| 200 | Ga0070693_100028679 | 3300005547 | Bacteria | 3028 |
| 201 | Ga0070693_100296685 | 3300005547 | Bacteria | 1088 |
| 202 | Ga0070665_100000175 | 3300005548 | Bacteria | 113874 |
| 203 | Ga0070665_100004322 | 3300005548 | Bacteria | 14941 |
| 204 | Ga0070665_100105834 | 3300005548 | Bacteria | 2815 |
| 205 | Ga0070665_100152522 | 3300005548 | Bacteria | 2313 |
| 206 | Ga0070665_100177902 | 3300005548 | Bacteria | 2128 |
| 207 | Ga0070665_100564696 | 3300005548 | Bacteria | 1150 |
| 208 | Ga0070704_100439193 | 3300005549 | Bacteria | 1121 |
| 209 | Ga0068855_100149075 | 3300005563 | Bacteria | 2660 |
| 210 | Ga0068855_100231949 | 3300005563 | Bacteria | 2066 |
| 211 | Ga0068855_100886189 | 3300005563 | Bacteria | 943 |
| 212 | Ga0068855_101018046 | 3300005563 | Bacteria | 869 |
| 213 | Ga0068857_100000998 | 3300005577 | Bacteria | 21742 |
| 214 | Ga0068857_100087151 | 3300005577 | Bacteria | 2792 |
| 215 | Ga0068857_100132398 | 3300005577 | Bacteria | 2249 |
| 216 | Ga0068857_100210127 | 3300005577 | Bacteria | 1776 |
| 217 | Ga0068857_100262434 | 3300005577 | Bacteria | 1585 |
| 218 | Ga0068857_100347807 | 3300005577 | Bacteria | 1372 |
| 219 | Ga0068857_100480645 | 3300005577 | Bacteria | 1164 |
| 220 | Ga0068854_100054495 | 3300005578 | Bacteria | 2876 |
| 221 | Ga0068854_100278013 | 3300005578 | Bacteria | 1347 |
| 222 | Ga0068854_100482745 | 3300005578 | Bacteria | 1041 |
| 223 | Ga0068854_100536279 | 3300005578 | Bacteria | 990 |
| 224 | Ga0068854_100536280 | 3300005578 | Bacteria | 990 |
| 225 | Ga0068854_100559185 | 3300005578 | Bacteria | 971 |
| 226 | Ga0068856_100004797 | 3300005614 | Bacteria | 13405 |
| 227 | Ga0068856_100076451 | 3300005614 | Bacteria | 3317 |
| 228 | Ga0068856_100184419 | 3300005614 | Bacteria | 2100 |
| 229 | Ga0068852_100058397 | 3300005616 | Bacteria | 3342 |
| 230 | Ga0068852_100248113 | 3300005616 | Bacteria | 1704 |
| 231 | Ga0068859_100122263 | 3300005617 | Bacteria | 2670 |
| 232 | Ga0068859_100275251 | 3300005617 | Bacteria | 1776 |
| 233 | Ga0068859_101205008 | 3300005617 | Bacteria | 834 |
| 234 | Ga0068864_100069812 | 3300005618 | Bacteria | 3055 |
| 235 | Ga0068851_10014017 | 3300005834 | Bacteria | 3800 |
| 236 | Ga0068851_10044959 | 3300005834 | Bacteria | 2231 |
| 237 | Ga0068851_10059998 | 3300005834 | Bacteria | 1947 |
| 238 | Ga0068863_100100973 | 3300005841 | Bacteria | 2742 |
| 239 | Ga0068863_100162700 | 3300005841 | Bacteria | 2139 |
| 240 | Ga0068858_100048710 | 3300005842 | Bacteria | 3925 |
| 241 | Ga0068858_100075141 | 3300005842 | Bacteria | 3138 |
| 242 | Ga0068858_100285650 | 3300005842 | Bacteria | 1572 |
| 243 | Ga0068860_100054090 | 3300005843 | Bacteria | 3816 |
| 244 | Ga0068860_100079152 | 3300005843 | Bacteria | 3125 |
| 245 | Ga0068860_100369392 | 3300005843 | Bacteria | 1414 |
| 246 | Ga0068862_100164162 | 3300005844 | Bacteria | 1984 |
| 247 | Ga0068862_100477495 | 3300005844 | Bacteria | 1180 |
| 248 | Ga0081455_10053310 | 3300005937 | Bacteria | 3455 |
| 249 | Ga0081540_1000720 | 3300005983 | Bacteria | 30494 |
| 250 | Ga0081539_10024522 | 3300005985 | Bacteria | 3909 |
| 251 | Ga0075365_10255181 | 3300006038 | Bacteria | 1233 |
| 252 | Ga0075363_100202638 | 3300006048 | Bacteria | 1134 |
| 253 | Ga0070715_10144003 | 3300006163 | Bacteria | 1161 |
| 254 | Ga0070716_100692208 | 3300006173 | Bacteria | 778 |
| 255 | Ga0070712_100527301 | 3300006175 | Bacteria | 993 |
| 256 | Ga0097621_100195694 | 3300006237 | Bacteria | 1753 |
| 257 | Ga0097621_100956787 | 3300006237 | Bacteria | 800 |
| 258 | Ga0068871_100100892 | 3300006358 | Bacteria | 2418 |
| 259 | Ga0068871_100119042 | 3300006358 | Bacteria | 2229 |
| 260 | Ga0068871_100342936 | 3300006358 | Bacteria | 1320 |
| 261 | Ga0068865_100029937 | 3300006881 | Bacteria | 3616 |
| 262 | Ga0068865_100071838 | 3300006881 | Bacteria | 2456 |
| 263 | Ga0097620_100122253 | 3300006931 | Bacteria | 2670 |
| 264 | Ga0097620_100275240 | 3300006931 | Bacteria | 1776 |
| 265 | Ga0097620_100506219 | 3300006931 | Bacteria | 1303 |
| 266 | Ga0097620_101205147 | 3300006931 | Bacteria | 834 |
| 267 | Ga0105251_10003747 | 3300009011 | Bacteria | 10880 |
| 268 | Ga0105251_10018245 | 3300009011 | Bacteria | 3736 |
| 269 | Ga0105244_10014959 | 3300009036 | Bacteria | 4464 |
| 270 | Ga0105244_10048884 | 3300009036 | Bacteria | 2163 |
| 271 | Ga0105240_10257037 | 3300009093 | Bacteria | 2017 |
| 272 | Ga0105240_10699632 | 3300009093 | Bacteria | 1106 |
| 273 | Ga0105240_10699669 | 3300009093 | Bacteria | 1106 |
| 274 | Ga0111539_10329500 | 3300009094 | Bacteria | 1777 |
| 275 | Ga0105245_11928201 | 3300009098 | Bacteria | 644 |
| 276 | Ga0105247_10001324 | 3300009101 | Bacteria | 18074 |
| 277 | Ga0105247_10014280 | 3300009101 | Bacteria | 4767 |
| 278 | Ga0105243_10036695 | 3300009148 | Bacteria | 3806 |
| 279 | Ga0105243_10063811 | 3300009148 | Bacteria | 2953 |
| 280 | Ga0105241_11148800 | 3300009174 | Bacteria | 733 |
| 281 | Ga0105248_10578454 | 3300009177 | Bacteria | 1267 |
| 282 | Ga0105237_10050085 | 3300009545 | Bacteria | 4197 |
| 283 | Ga0105237_10051347 | 3300009545 | Bacteria | 4141 |
| 284 | Ga0105237_10073900 | 3300009545 | Bacteria | 3401 |
| 285 | Ga0105238_10039356 | 3300009551 | Bacteria | 4794 |
| 286 | Ga0105238_10067600 | 3300009551 | Bacteria | 3574 |
| 287 | Ga0105238_10145294 | 3300009551 | Bacteria | 2348 |
| 288 | Ga0105238_10264938 | 3300009551 | Bacteria | 1698 |
| 289 | Ga0105238_10361347 | 3300009551 | Bacteria | 1441 |
| 290 | Ga0105238_10756217 | 3300009551 | Bacteria | 986 |
| 291 | Ga0105032_100517 | 3300009979 | Bacteria | 3853 |
| 292 | Ga0105239_10006660 | 3300010375 | Bacteria | 13359 |
| 293 | Ga0105239_10090407 | 3300010375 | Bacteria | 3378 |
| 294 | Ga0105239_10139444 | 3300010375 | Bacteria | 2701 |
| 295 | Ga0105239_10141288 | 3300010375 | Bacteria | 2683 |
| 296 | Ga0105239_10572982 | 3300010375 | Bacteria | 1286 |
| 297 | Ga0105246_10200918 | 3300011119 | Bacteria | 1549 |
| 298 | Ga0157336_1001516 | 3300012477 | Bacteria | 1215 |
| 299 | Ga0157314_1000456 | 3300012500 | Bacteria | 4009 |
| 300 | Ga0157316_1004643 | 3300012510 | Bacteria | 1051 |
| 301 | Ga0157327_1000560 | 3300012512 | Bacteria | 2034 |
| 302 | Ga0157326_1006833 | 3300012513 | Bacteria | 1224 |
| 303 | Ga0157373_10096936 | 3300013100 | Bacteria | 2076 |
| 304 | Ga0157373_10142986 | 3300013100 | Bacteria | 1683 |
| 305 | Ga0157371_10045126 | 3300013102 | Bacteria | 3137 |
| 306 | Ga0157371_10063110 | 3300013102 | Bacteria | 2626 |
| 307 | Ga0157371_10083622 | 3300013102 | Bacteria | 2260 |
| 308 | Ga0157371_10432117 | 3300013102 | Bacteria | 966 |
| 309 | Ga0157371_10707468 | 3300013102 | Bacteria | 754 |
| 310 | Ga0157370_10062752 | 3300013104 | Bacteria | 3523 |
| 311 | Ga0157370_10069149 | 3300013104 | Bacteria | 3335 |
| 312 | Ga0157370_10104910 | 3300013104 | Bacteria | 2646 |
| 313 | Ga0157370_10119558 | 3300013104 | Bacteria | 2460 |
| 314 | Ga0157370_10125529 | 3300013104 | Bacteria | 2395 |
| 315 | Ga0157370_10285025 | 3300013104 | Bacteria | 1526 |
| 316 | Ga0157369_10004613 | 3300013105 | Bacteria | 16198 |
| 317 | Ga0157369_10036937 | 3300013105 | Bacteria | 5351 |
| 318 | Ga0157369_10097097 | 3300013105 | Bacteria | 3143 |
| 319 | Ga0157369_10107916 | 3300013105 | Bacteria | 2961 |
| 320 | Ga0157369_10312189 | 3300013105 | Bacteria | 1635 |
| 321 | Ga0157369_11175580 | 3300013105 | Bacteria | 783 |
| 322 | Ga0157374_10190512 | 3300013296 | Bacteria | 2006 |
| 323 | Ga0157374_10395321 | 3300013296 | Bacteria | 1378 |
| 324 | Ga0157378_10023199 | 3300013297 | Bacteria | 5461 |
| 325 | Ga0157378_11019923 | 3300013297 | Bacteria | 862 |
| 326 | Ga0163162_10001854 | 3300013306 | Bacteria | 19906 |
| 327 | Ga0163162_10046484 | 3300013306 | Bacteria | 4351 |
| 328 | Ga0163162_10070045 | 3300013306 | Bacteria | 3559 |
| 329 | Ga0163162_10281252 | 3300013306 | Bacteria | 1796 |
| 330 | Ga0157372_10094273 | 3300013307 | Bacteria | 3408 |
| 331 | Ga0157372_10157288 | 3300013307 | Bacteria | 2625 |
| 332 | Ga0157372_10181931 | 3300013307 | Bacteria | 2433 |
| 333 | Ga0157372_10241293 | 3300013307 | Bacteria | 2097 |
| 334 | Ga0157372_10560165 | 3300013307 | Bacteria | 1332 |
| 335 | Ga0157372_10616942 | 3300013307 | Bacteria | 1264 |
| 336 | Ga0157372_10802551 | 3300013307 | Bacteria | 1094 |
| 337 | Ga0157372_10903033 | 3300013307 | Bacteria | 1025 |
| 338 | Ga0157375_10377773 | 3300013308 | Bacteria | 1584 |
| 339 | Ga0157375_10803357 | 3300013308 | Bacteria | 1089 |
| 340 | Ga0163163_10165866 | 3300014325 | Bacteria | 2255 |
| 341 | Ga0163163_10509119 | 3300014325 | Bacteria | 1266 |
| 342 | Ga0157380_10515134 | 3300014326 | Bacteria | 1165 |
| 343 | Ga0182008_10010846 | 3300014497 | Bacteria | 4865 |
| 344 | Ga0182008_10077246 | 3300014497 | Bacteria | 1638 |
| 345 | Ga0182008_10077601 | 3300014497 | Bacteria | 1634 |
| 346 | Ga0182006_1023134 | 3300015261 | Bacteria | 2575 |
| 347 | Ga0182006_1043661 | 3300015261 | Bacteria | 1752 |
| 348 | Ga0182007_10001054 | 3300015262 | Bacteria | 15057 |
| 349 | Ga0182005_1012026 | 3300015265 | Bacteria | 2453 |
| 350 | Ga0182005_1045440 | 3300015265 | Bacteria | 1193 |
| 351 | Ga0182005_1064493 | 3300015265 | Bacteria | 1002 |
| 352 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 353 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 354 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 355 | Ga0163161_10075142 | 3300017792 | Bacteria | 2479 |
| 356 | Ga0163161_10348494 | 3300017792 | Bacteria | 1177 |
| 357 | Ga0197907_10947378 | 3300020069 | Bacteria | 3159 |
| 358 | Ga0206356_10171056 | 3300020070 | Bacteria | 2333 |
| 359 | Ga0206356_10221074 | 3300020070 | Bacteria | 1209 |
| 360 | Ga0206356_10657042 | 3300020070 | Bacteria | 879 |
| 361 | Ga0206349_1346577 | 3300020075 | Bacteria | 1686 |
| 362 | Ga0206349_1852705 | 3300020075 | Bacteria | 1928 |
| 363 | Ga0206355_1315307 | 3300020076 | Bacteria | 2083 |
| 364 | Ga0206355_1347985 | 3300020076 | Bacteria | 4206 |
| 365 | Ga0206355_1642390 | 3300020076 | Bacteria | 747 |
| 366 | Ga0206355_1657004 | 3300020076 | Bacteria | 2465 |
| 367 | Ga0206351_10229607 | 3300020077 | Bacteria | 2662 |
| 368 | Ga0206351_10721784 | 3300020077 | Bacteria | 2811 |
| 369 | Ga0206352_10790062 | 3300020078 | Bacteria | 2532 |
| 370 | Ga0206352_11356790 | 3300020078 | Bacteria | 2706 |
| 371 | Ga0206350_10322002 | 3300020080 | Bacteria | 2103 |
| 372 | Ga0154015_1195220 | 3300020610 | Bacteria | 930 |
| 373 | Ga0224712_10003939 | 3300022467 | Bacteria | 3939 |
| 374 | Ga0224712_10013385 | 3300022467 | Bacteria | 2610 |
| 375 | Ga0209435_101200 | 3300025206 | Bacteria | 3488 |
| 376 | Ga0209435_106506 | 3300025206 | Bacteria | 1299 |
| 377 | Ga0209784_100167 | 3300025224 | Bacteria | 56563 |
| 378 | Ga0209566_103884 | 3300025225 | Bacteria | 2152 |
| 379 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 380 | Ga0209674_100381 | 3300025226 | Bacteria | 23509 |
| 381 | Ga0209674_102055 | 3300025226 | Bacteria | 4611 |
| 382 | Ga0209674_102881 | 3300025226 | Bacteria | 3418 |
| 383 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 384 | Ga0209672_100029 | 3300025228 | Bacteria | 339298 |
| 385 | Ga0209672_101110 | 3300025228 | Bacteria | 11367 |
| 386 | Ga0209672_102109 | 3300025228 | Bacteria | 5311 |
| 387 | Ga0209672_104042 | 3300025228 | Bacteria | 2830 |
| 388 | Ga0209563_100103 | 3300025230 | Bacteria | 151835 |
| 389 | Ga0207427_100144 | 3300025231 | Bacteria | 82742 |
| 390 | Ga0207427_100209 | 3300025231 | Bacteria | 53322 |
| 391 | Ga0207427_100327 | 3300025231 | Bacteria | 31981 |
| 392 | Ga0207427_104741 | 3300025231 | Bacteria | 2153 |
| 393 | Ga0207427_118277 | 3300025231 | Bacteria | 643 |
| 394 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 395 | Ga0209437_100193 | 3300025233 | Bacteria | 122027 |
| 396 | Ga0209437_100256 | 3300025233 | Bacteria | 82734 |
| 397 | Ga0209437_100465 | 3300025233 | Bacteria | 31828 |
| 398 | Ga0209437_103094 | 3300025233 | Bacteria | 3065 |
| 399 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 400 | Ga0209258_100053 | 3300025242 | Bacteria | 339233 |
| 401 | Ga0209258_100149 | 3300025242 | Bacteria | 162184 |
| 402 | Ga0209258_100329 | 3300025242 | Bacteria | 71786 |
| 403 | Ga0209258_103384 | 3300025242 | Bacteria | 3457 |
| 404 | Ga0207425_1000117 | 3300025245 | Bacteria | 74911 |
| 405 | Ga0207425_1005550 | 3300025245 | Bacteria | 3581 |
| 406 | Ga0209646_1000796 | 3300025246 | Bacteria | 10762 |
| 407 | Ga0209646_1002116 | 3300025246 | Bacteria | 4623 |
| 408 | Ga0209646_1006538 | 3300025246 | Bacteria | 1953 |
| 409 | Ga0209026_1000060 | 3300025250 | Bacteria | 220052 |
| 410 | Ga0209026_1000274 | 3300025250 | Bacteria | 61312 |
| 411 | Ga0209026_1000293 | 3300025250 | Bacteria | 55650 |
| 412 | Ga0209026_1000516 | 3300025250 | Bacteria | 27200 |
| 413 | Ga0209026_1001271 | 3300025250 | Bacteria | 11502 |
| 414 | Ga0209026_1006743 | 3300025250 | Bacteria | 2739 |
| 415 | Ga0209026_1022088 | 3300025250 | Bacteria | 977 |
| 416 | Ga0209677_107876 | 3300025253 | Bacteria | 2167 |
| 417 | Ga0209677_121643 | 3300025253 | Bacteria | 734 |
| 418 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 419 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 420 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 421 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 422 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 423 | Ga0209148_1000143 | 3300025254 | Bacteria | 162184 |
| 424 | Ga0209148_1002653 | 3300025254 | Bacteria | 5782 |
| 425 | Ga0209759_1000658 | 3300025256 | Bacteria | 32027 |
| 426 | Ga0209759_1001919 | 3300025256 | Bacteria | 10178 |
| 427 | Ga0209759_1002020 | 3300025256 | Bacteria | 9629 |
| 428 | Ga0209759_1007439 | 3300025256 | Bacteria | 3520 |
| 429 | Ga0209759_1010126 | 3300025256 | Bacteria | 2786 |
| 430 | Ga0209759_1016259 | 3300025256 | Bacteria | 1887 |
| 431 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 432 | Ga0209129_1000835 | 3300025258 | Bacteria | 19351 |
| 433 | Ga0209129_1002898 | 3300025258 | Bacteria | 7887 |
| 434 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 435 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 436 | Ga0209233_1000151 | 3300025261 | Bacteria | 176515 |
| 437 | Ga0209233_1000920 | 3300025261 | Bacteria | 12852 |
| 438 | Ga0209233_1012013 | 3300025261 | Bacteria | 2526 |
| 439 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 440 | Ga0209565_1000415 | 3300025263 | Bacteria | 35224 |
| 441 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 442 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 443 | Ga0209455_1000060 | 3300025272 | Bacteria | 339298 |
| 444 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 445 | Ga0209455_1000095 | 3300025272 | Bacteria | 217487 |
| 446 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 447 | Ga0209673_1000204 | 3300025273 | Bacteria | 119618 |
| 448 | Ga0209673_1002116 | 3300025273 | Bacteria | 14881 |
| 449 | Ga0209130_1003085 | 3300025284 | Bacteria | 7454 |
| 450 | Ga0209130_1007816 | 3300025284 | Bacteria | 3243 |
| 451 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 452 | Ga0209675_1000015 | 3300025291 | Bacteria | 403517 |
| 453 | Ga0209675_1006904 | 3300025291 | Bacteria | 4460 |
| 454 | Ga0209676_1000110 | 3300025292 | Bacteria | 214083 |
| 455 | Ga0209676_1001608 | 3300025292 | Bacteria | 20029 |
| 456 | Ga0209676_1004379 | 3300025292 | Bacteria | 7893 |
| 457 | Ga0209676_1004892 | 3300025292 | Bacteria | 7229 |
| 458 | Ga0209676_1006351 | 3300025292 | Bacteria | 5858 |
| 459 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 460 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 461 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 462 | Ga0209564_1000037 | 3300025295 | Bacteria | 414794 |
| 463 | Ga0209564_1007141 | 3300025295 | Bacteria | 5828 |
| 464 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 465 | Ga0209758_1005974 | 3300025297 | Bacteria | 9015 |
| 466 | Ga0209758_1015882 | 3300025297 | Bacteria | 3866 |
| 467 | Ga0209758_1083243 | 3300025297 | Bacteria | 960 |
| 468 | Ga0209050_1001128 | 3300025298 | Bacteria | 32216 |
| 469 | Ga0209050_1053325 | 3300025298 | Bacteria | 1006 |
| 470 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 471 | Ga0209256_1002932 | 3300025299 | Bacteria | 12813 |
| 472 | Ga0209256_1003821 | 3300025299 | Bacteria | 10090 |
| 473 | Ga0209256_1007814 | 3300025299 | Bacteria | 5148 |
| 474 | Ga0207426_1003657 | 3300025302 | Bacteria | 8109 |
| 475 | Ga0207426_1068355 | 3300025302 | Bacteria | 999 |
| 476 | Ga0209051_1001513 | 3300025303 | Bacteria | 19394 |
| 477 | Ga0209051_1009469 | 3300025303 | Bacteria | 5018 |
| 478 | Ga0209051_1028616 | 3300025303 | Bacteria | 2197 |
| 479 | Ga0209257_1000129 | 3300025304 | Bacteria | 214155 |
| 480 | Ga0209257_1002665 | 3300025304 | Bacteria | 17133 |
| 481 | Ga0209257_1006382 | 3300025304 | Bacteria | 7632 |
| 482 | Ga0209257_1006637 | 3300025304 | Bacteria | 7356 |
| 483 | Ga0207697_10049742 | 3300025315 | Bacteria | 1730 |
| 484 | Ga0207656_10367844 | 3300025321 | Bacteria | 719 |
| 485 | Ga0207655_1022400 | 3300025728 | Bacteria | 3168 |
| 486 | Ga0207655_1039647 | 3300025728 | Bacteria | 2042 |
| 487 | Ga0207713_1000294 | 3300025735 | Bacteria | 57476 |
| 488 | Ga0207713_1004451 | 3300025735 | Bacteria | 9073 |
| 489 | Ga0207682_10033068 | 3300025893 | Bacteria | 2080 |
| 490 | Ga0207692_10016367 | 3300025898 | Bacteria | 3283 |
| 491 | Ga0207692_10056387 | 3300025898 | Bacteria | 2015 |
| 492 | Ga0207680_10000013 | 3300025903 | Bacteria | 244716 |
| 493 | Ga0207680_10002673 | 3300025903 | Bacteria | 8337 |
| 494 | Ga0207647_10011795 | 3300025904 | Bacteria | 6108 |
| 495 | Ga0207647_10032989 | 3300025904 | Bacteria | 3320 |
| 496 | Ga0207647_10047348 | 3300025904 | Bacteria | 2675 |
| 497 | Ga0207647_10062600 | 3300025904 | Bacteria | 2266 |
| 498 | Ga0207647_10094179 | 3300025904 | Bacteria | 1784 |
| 499 | Ga0207647_10096744 | 3300025904 | Bacteria | 1756 |
| 500 | Ga0207645_10015566 | 3300025907 | Bacteria | 5050 |
| 501 | Ga0207645_10107422 | 3300025907 | Bacteria | 1805 |
| 502 | Ga0207643_10160910 | 3300025908 | Bacteria | 1351 |
| 503 | Ga0207705_10031780 | 3300025909 | Bacteria | 3770 |
| 504 | Ga0207705_10060885 | 3300025909 | Bacteria | 2727 |
| 505 | Ga0207705_10512893 | 3300025909 | Bacteria | 931 |
| 506 | Ga0207707_10007311 | 3300025912 | Bacteria | 9616 |
| 507 | Ga0207707_10046392 | 3300025912 | Bacteria | 3784 |
| 508 | Ga0207707_10108295 | 3300025912 | Bacteria | 2429 |
| 509 | Ga0207707_10277754 | 3300025912 | Bacteria | 1451 |
| 510 | Ga0207695_10008130 | 3300025913 | Bacteria | 13192 |
| 511 | Ga0207695_10016662 | 3300025913 | Bacteria | 8588 |
| 512 | Ga0207695_10030817 | 3300025913 | Bacteria | 5900 |
| 513 | Ga0207695_10148552 | 3300025913 | Bacteria | 2285 |
| 514 | Ga0207695_10581056 | 3300025913 | Bacteria | 1002 |
| 515 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 516 | Ga0207671_10028839 | 3300025914 | Bacteria | 4146 |
| 517 | Ga0207671_10054495 | 3300025914 | Bacteria | 2963 |
| 518 | Ga0207693_10196988 | 3300025915 | Bacteria | 1584 |
| 519 | Ga0207663_10652633 | 3300025916 | Bacteria | 830 |
| 520 | Ga0207660_10067512 | 3300025917 | Bacteria | 2590 |
| 521 | Ga0207660_10533695 | 3300025917 | Bacteria | 953 |
| 522 | Ga0207657_10006384 | 3300025919 | Bacteria | 12243 |
| 523 | Ga0207657_10174148 | 3300025919 | Bacteria | 1742 |
| 524 | Ga0207657_10174180 | 3300025919 | Bacteria | 1742 |
| 525 | Ga0207649_10065071 | 3300025920 | Bacteria | 2307 |
| 526 | Ga0207649_10147830 | 3300025920 | Bacteria | 1615 |
| 527 | Ga0207649_10533300 | 3300025920 | Bacteria | 896 |
| 528 | Ga0207652_10055937 | 3300025921 | Bacteria | 3395 |
| 529 | Ga0207652_10097888 | 3300025921 | Bacteria | 2586 |
| 530 | Ga0207652_10557595 | 3300025921 | Bacteria | 1029 |
| 531 | Ga0207681_10248036 | 3300025923 | Bacteria | 1389 |
| 532 | Ga0207681_10417210 | 3300025923 | Bacteria | 1087 |
| 533 | Ga0207694_10016063 | 3300025924 | Bacteria | 5648 |
| 534 | Ga0207694_10088183 | 3300025924 | Bacteria | 2445 |
| 535 | Ga0207694_10093128 | 3300025924 | Bacteria | 2379 |
| 536 | Ga0207694_10152495 | 3300025924 | Bacteria | 1862 |
| 537 | Ga0207694_10190862 | 3300025924 | Bacteria | 1664 |
| 538 | Ga0207694_10333983 | 3300025924 | Bacteria | 1253 |
| 539 | Ga0207650_10004000 | 3300025925 | Bacteria | 10085 |
| 540 | Ga0207650_10023595 | 3300025925 | Bacteria | 4364 |
| 541 | Ga0207650_10288516 | 3300025925 | Bacteria | 1337 |
| 542 | Ga0207659_10242293 | 3300025926 | Bacteria | 1459 |
| 543 | Ga0207700_10741499 | 3300025928 | Bacteria | 878 |
| 544 | Ga0207664_10001884 | 3300025929 | Bacteria | 13792 |
| 545 | Ga0207664_10728135 | 3300025929 | Bacteria | 892 |
| 546 | Ga0207664_10775667 | 3300025929 | Bacteria | 862 |
| 547 | Ga0207644_10004894 | 3300025931 | Bacteria | 8728 |
| 548 | Ga0207644_10011422 | 3300025931 | Bacteria | 5875 |
| 549 | Ga0207644_10090873 | 3300025931 | Bacteria | 2275 |
| 550 | Ga0207690_10000291 | 3300025932 | Bacteria | 35587 |
| 551 | Ga0207690_10207151 | 3300025932 | Bacteria | 1493 |
| 552 | Ga0207690_10543009 | 3300025932 | Bacteria | 944 |
| 553 | Ga0207690_10694490 | 3300025932 | Bacteria | 836 |
| 554 | Ga0207706_10100114 | 3300025933 | Bacteria | 2550 |
| 555 | Ga0207706_10638697 | 3300025933 | Bacteria | 912 |
| 556 | Ga0207709_10000421 | 3300025935 | Bacteria | 41092 |
| 557 | Ga0207709_10044385 | 3300025935 | Bacteria | 2685 |
| 558 | Ga0207670_10123040 | 3300025936 | Bacteria | 1889 |
| 559 | Ga0207670_10342728 | 3300025936 | Bacteria | 1181 |
| 560 | Ga0207669_10885421 | 3300025937 | Bacteria | 745 |
| 561 | Ga0207704_10017680 | 3300025938 | Bacteria | 3703 |
| 562 | Ga0207704_10088244 | 3300025938 | Bacteria | 2028 |
| 563 | Ga0207665_10101234 | 3300025939 | Bacteria | 2011 |
| 564 | Ga0207691_10036108 | 3300025940 | Bacteria | 4580 |
| 565 | Ga0207691_10441264 | 3300025940 | Bacteria | 1108 |
| 566 | Ga0207711_10073580 | 3300025941 | Bacteria | 2970 |
| 567 | Ga0207689_10034156 | 3300025942 | Bacteria | 4224 |
| 568 | Ga0207689_10136777 | 3300025942 | Bacteria | 2018 |
| 569 | Ga0207689_10856643 | 3300025942 | Bacteria | 767 |
| 570 | Ga0207661_10169487 | 3300025944 | Bacteria | 1900 |
| 571 | Ga0207661_10594956 | 3300025944 | Bacteria | 1015 |
| 572 | Ga0207679_10174503 | 3300025945 | Bacteria | 1773 |
| 573 | Ga0207667_10034827 | 3300025949 | Bacteria | 5404 |
| 574 | Ga0207667_10053962 | 3300025949 | Bacteria | 4228 |
| 575 | Ga0207667_10095216 | 3300025949 | Bacteria | 3074 |
| 576 | Ga0207667_10128195 | 3300025949 | Bacteria | 2613 |
| 577 | Ga0207667_10128231 | 3300025949 | Bacteria | 2613 |
| 578 | Ga0207667_10419728 | 3300025949 | Bacteria | 1361 |
| 579 | Ga0207667_10428679 | 3300025949 | Bacteria | 1345 |
| 580 | Ga0207667_11510937 | 3300025949 | Bacteria | 642 |
| 581 | Ga0207651_10066649 | 3300025960 | Bacteria | 2531 |
| 582 | Ga0207668_10008750 | 3300025972 | Bacteria | 6049 |
| 583 | Ga0207668_10013075 | 3300025972 | Bacteria | 5100 |
| 584 | Ga0207668_10091449 | 3300025972 | Bacteria | 2236 |
| 585 | Ga0207668_10422846 | 3300025972 | Bacteria | 1131 |
| 586 | Ga0207668_11155648 | 3300025972 | Bacteria | 695 |
| 587 | Ga0207640_10003058 | 3300025981 | Bacteria | 9010 |
| 588 | Ga0207640_10054936 | 3300025981 | Bacteria | 2606 |
| 589 | Ga0207640_10075585 | 3300025981 | Bacteria | 2284 |
| 590 | Ga0207640_10196461 | 3300025981 | Bacteria | 1525 |
| 591 | Ga0207640_10532998 | 3300025981 | Bacteria | 983 |
| 592 | Ga0207640_10894600 | 3300025981 | Bacteria | 775 |
| 593 | Ga0207658_10033742 | 3300025986 | Bacteria | 3652 |
| 594 | Ga0207658_10148113 | 3300025986 | Bacteria | 1909 |
| 595 | Ga0207658_10269171 | 3300025986 | Bacteria | 1455 |
| 596 | Ga0207658_10308229 | 3300025986 | Bacteria | 1366 |
| 597 | Ga0207658_10353974 | 3300025986 | Bacteria | 1279 |
| 598 | Ga0207677_10264744 | 3300026023 | Bacteria | 1403 |
| 599 | Ga0207677_10446954 | 3300026023 | Bacteria | 1107 |
| 600 | Ga0207703_10108063 | 3300026035 | Bacteria | 2369 |
| 601 | Ga0207703_10127293 | 3300026035 | Bacteria | 2195 |
| 602 | Ga0207639_10077238 | 3300026041 | Bacteria | 2624 |
| 603 | Ga0207639_10249512 | 3300026041 | Bacteria | 1547 |
| 604 | Ga0207639_11079581 | 3300026041 | Bacteria | 753 |
| 605 | Ga0207678_10016758 | 3300026067 | Bacteria | 6435 |
| 606 | Ga0207678_10049236 | 3300026067 | Bacteria | 3642 |
| 607 | Ga0207678_10049696 | 3300026067 | Bacteria | 3624 |
| 608 | Ga0207678_10054333 | 3300026067 | Bacteria | 3449 |
| 609 | Ga0207678_10085559 | 3300026067 | Bacteria | 2695 |
| 610 | Ga0207678_10572241 | 3300026067 | Bacteria | 989 |
| 611 | Ga0207702_10000517 | 3300026078 | Bacteria | 43478 |
| 612 | Ga0207702_10000852 | 3300026078 | Bacteria | 31897 |
| 613 | Ga0207702_10091382 | 3300026078 | Bacteria | 2665 |
| 614 | Ga0207641_10009230 | 3300026088 | Bacteria | 8134 |
| 615 | Ga0207641_10104276 | 3300026088 | Bacteria | 2503 |
| 616 | Ga0207648_10084850 | 3300026089 | Bacteria | 2762 |
| 617 | Ga0207676_10059226 | 3300026095 | Bacteria | 3023 |
| 618 | Ga0207676_10162686 | 3300026095 | Bacteria | 1935 |
| 619 | Ga0207676_10731242 | 3300026095 | Bacteria | 961 |
| 620 | Ga0207674_10024573 | 3300026116 | Bacteria | 6435 |
| 621 | Ga0207674_10111246 | 3300026116 | Bacteria | 2713 |
| 622 | Ga0207674_10142271 | 3300026116 | Bacteria | 2358 |
| 623 | Ga0207674_10235613 | 3300026116 | Bacteria | 1778 |
| 624 | Ga0207674_10353015 | 3300026116 | Bacteria | 1422 |
| 625 | Ga0207674_10357035 | 3300026116 | Bacteria | 1413 |
| 626 | Ga0207675_100428514 | 3300026118 | Bacteria | 1307 |
| 627 | Ga0207683_10335929 | 3300026121 | Bacteria | 1385 |
| 628 | Ga0207698_10071585 | 3300026142 | Bacteria | 2752 |
| 629 | Ga0207698_10145533 | 3300026142 | Bacteria | 2049 |
| 630 | Ga0207698_10450120 | 3300026142 | Bacteria | 1243 |
| 631 | Ga0209973_1001982 | 3300027252 | Bacteria | 1860 |
| 632 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 633 | Ga0209371_1000294 | 3300027312 | Bacteria | 56307 |
| 634 | Ga0209969_1000918 | 3300027360 | Bacteria | 3988 |
| 635 | Ga0209967_1002362 | 3300027364 | Bacteria | 2443 |
| 636 | Ga0209967_1009133 | 3300027364 | Bacteria | 1372 |
| 637 | Ga0209984_1000306 | 3300027424 | Bacteria | 5580 |
| 638 | Ga0210000_1004942 | 3300027462 | Bacteria | 1931 |
| 639 | Ga0209995_1000770 | 3300027471 | Bacteria | 4923 |
| 640 | Ga0209999_1002797 | 3300027543 | Bacteria | 3088 |
| 641 | Ga0209999_1020896 | 3300027543 | Bacteria | 1202 |
| 642 | Ga0209982_1000032 | 3300027552 | Bacteria | 12541 |
| 643 | Ga0209982_1051017 | 3300027552 | Bacteria | 667 |
| 644 | Ga0209970_1038066 | 3300027614 | Bacteria | 850 |
| 645 | Ga0209983_1000295 | 3300027665 | Bacteria | 10386 |
| 646 | Ga0209971_1000410 | 3300027682 | Bacteria | 11534 |
| 647 | Ga0209974_10010367 | 3300027876 | Bacteria | 3144 |
| 648 | Ga0209974_10074748 | 3300027876 | Bacteria | 1160 |
| 649 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 650 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 651 | Ga0268266_10030836 | 3300028379 | Bacteria | 4553 |
| 652 | Ga0268266_10100303 | 3300028379 | Bacteria | 2550 |
| 653 | Ga0268266_10168036 | 3300028379 | Bacteria | 1989 |
| 654 | Ga0268266_10170446 | 3300028379 | Bacteria | 1975 |
| 655 | Ga0268266_10210115 | 3300028379 | Bacteria | 1784 |
| 656 | Ga0268265_10115242 | 3300028380 | Bacteria | 2202 |
| 657 | Ga0268265_10162232 | 3300028380 | Bacteria | 1900 |
| 658 | Ga0268264_10023204 | 3300028381 | Bacteria | 5063 |
| 659 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 660 | Ga0268256_1000258 | 3300030500 | Bacteria | 56249 |
| 661 | Ga0316177_1042582 | 3300030731 | Bacteria | 1493 |
| 662 | Ga0316176_1015742 | 3300030732 | Bacteria | 2508 |
| 663 | Ga0316176_1213588 | 3300030732 | Bacteria | 1389 |
| 664 | Ga0316183_1139965 | 3300030742 | Bacteria | 4016 |
| 665 | Ga0316181_1164435 | 3300030744 | Bacteria | 1550 |
| 666 | Ga0316182_1088536 | 3300030745 | Bacteria | 722 |
| 667 | Ga0316182_1183376 | 3300030745 | Bacteria | 1522 |
| 668 | Ga0265763_1007233 | 3300030763 | Bacteria | 970 |
| 669 | Ga0265766_1000306 | 3300030863 | Bacteria | 2014 |
| 670 | Ga0265769_100430 | 3300030888 | Bacteria | 1714 |
| 671 | Ga0265761_100106 | 3300030889 | Bacteria | 2671 |
| 672 | Ga0265774_100076 | 3300031011 | Bacteria | 2339 |
| 673 | Ga0307513_10521493 | 3300031456 | Bacteria | 903 |
| 674 | Ga0307509_10199035 | 3300031507 | Bacteria | 1843 |
| 675 | Ga0307408_100181171 | 3300031548 | Bacteria | 1689 |
| 676 | Ga0307408_101204677 | 3300031548 | Bacteria | 706 |
| 677 | Ga0307508_10105773 | 3300031616 | Bacteria | 2412 |
| 678 | Ga0316575_10015025 | 3300031665 | Bacteria | 2915 |
| 679 | Ga0307516_10007119 | 3300031730 | Bacteria | 12924 |
| 680 | Ga0307405_10142144 | 3300031731 | Bacteria | 1675 |
| 681 | Ga0307405_10146342 | 3300031731 | Bacteria | 1655 |
| 682 | Ga0307413_10037133 | 3300031824 | Bacteria | 2811 |
| 683 | Ga0307413_10047867 | 3300031824 | Bacteria | 2552 |
| 684 | Ga0307413_10081955 | 3300031824 | Bacteria | 2070 |
| 685 | Ga0307413_10279926 | 3300031824 | Bacteria | 1254 |
| 686 | Ga0307413_10280806 | 3300031824 | Bacteria | 1252 |
| 687 | Ga0307410_10028499 | 3300031852 | Bacteria | 3543 |
| 688 | Ga0307406_10068752 | 3300031901 | Bacteria | 2313 |
| 689 | Ga0307406_10093487 | 3300031901 | Bacteria | 2030 |
| 690 | Ga0307407_10034741 | 3300031903 | Bacteria | 2763 |
| 691 | Ga0307407_10089439 | 3300031903 | Bacteria | 1883 |
| 692 | Ga0307412_10019091 | 3300031911 | Bacteria | 4141 |
| 693 | Ga0307412_10028293 | 3300031911 | Bacteria | 3505 |
| 694 | Ga0307412_10042944 | 3300031911 | Bacteria | 2941 |
| 695 | Ga0307409_100024348 | 3300031995 | Bacteria | 4220 |
| 696 | Ga0307409_101638881 | 3300031995 | Bacteria | 672 |
| 697 | Ga0307416_100079046 | 3300032002 | Bacteria | 2770 |
| 698 | Ga0307416_100404694 | 3300032002 | Bacteria | 1403 |
| 699 | Ga0307414_10002120 | 3300032004 | Bacteria | 10346 |
| 700 | Ga0307414_10007179 | 3300032004 | Bacteria | 6251 |
| 701 | Ga0307414_10020644 | 3300032004 | Bacteria | 4110 |
| 702 | Ga0307414_10046872 | 3300032004 | Bacteria | 2970 |
| 703 | Ga0307414_10063463 | 3300032004 | Bacteria | 2625 |
| 704 | Ga0307414_10178231 | 3300032004 | Bacteria | 1706 |
| 705 | Ga0307414_10187955 | 3300032004 | Bacteria | 1668 |
| 706 | Ga0307414_10258340 | 3300032004 | Bacteria | 1452 |
| 707 | Ga0307414_10305106 | 3300032004 | Bacteria | 1348 |
| 708 | Ga0307414_10913289 | 3300032004 | Bacteria | 805 |
| 709 | Ga0307414_11303549 | 3300032004 | Bacteria | 674 |
| 710 | Ga0307414_11306492 | 3300032004 | Bacteria | 673 |
| 711 | Ga0307411_10015295 | 3300032005 | Bacteria | 4303 |
| 712 | Ga0307411_10390319 | 3300032005 | Bacteria | 1147 |
| 713 | Ga0307411_10953077 | 3300032005 | Bacteria | 765 |
| 714 | Ga0307415_100292343 | 3300032126 | Bacteria | 1345 |
| 715 | Ga0307510_10002916 | 3300033180 | Bacteria | 19686 |
| 716 | Ga0373930_0069596 | 3300034816 | Bacteria | 798 |
| 717 | Ga0373931_0421997 | 3300035691 | Bacteria | 848 |
| 718 | Ga0310112_000276 | 3300036458 | Bacteria | 4093 |
| 719 | Ga0395899_0001959 | 3300037312 | Bacteria | 16927 |
| 720 | Ga0395899_0012521 | 3300037312 | Bacteria | 6499 |
| 721 | Ga0395899_0022053 | 3300037312 | Bacteria | 4829 |
| 722 | Ga0395899_0091130 | 3300037312 | Bacteria | 2209 |
| 723 | Ga0395899_0423649 | 3300037312 | Bacteria | 876 |
| 724 | Ga0395899_0562413 | 3300037312 | Bacteria | 731 |
| 725 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 726 | Ga0395900_0036642 | 3300037418 | Bacteria | 5057 |
| 727 | Ga0395900_0080209 | 3300037418 | Bacteria | 3353 |
| 728 | Ga0395900_0089318 | 3300037418 | Bacteria | 3167 |
| 729 | Ga0395900_0241648 | 3300037418 | Bacteria | 1811 |
| 730 | Ga0395900_0765478 | 3300037418 | Bacteria | 895 |
| 731 | Ga0395900_0934356 | 3300037418 | Bacteria | 789 |
| 732 | Ga0395898_0000558 | 3300037466 | Bacteria | 69802 |
| 733 | Ga0395898_0000600 | 3300037466 | Bacteria | 66858 |
| 734 | Ga0395898_0006608 | 3300037466 | Bacteria | 12359 |
| 735 | Ga0395898_0180698 | 3300037466 | Bacteria | 2016 |
| 736 | Ga0395898_0258265 | 3300037466 | Bacteria | 1661 |
| 737 | Ga0395898_0587291 | 3300037466 | Bacteria | 1056 |
| 738 | Ga0395898_0745825 | 3300037466 | Bacteria | 920 |
| 739 | Ga0395898_0796265 | 3300037466 | Bacteria | 885 |
| 740 | Ga0395905_0110752 | 3300037471 | Bacteria | 2578 |
| 741 | Ga0395905_0293167 | 3300037471 | Bacteria | 1514 |
| 742 | Ga0395905_0298452 | 3300037471 | Bacteria | 1498 |
| 743 | Ga0395901_0002939 | 3300038443 | Bacteria | 17197 |
| 744 | Ga0395901_0011584 | 3300038443 | Bacteria | 8935 |
| 745 | Ga0395901_0075079 | 3300038443 | Bacteria | 3526 |
| 746 | Ga0395901_0143647 | 3300038443 | Bacteria | 2508 |
| 747 | Ga0395901_0866142 | 3300038443 | Bacteria | 887 |
| 748 | Ga0237819_00026 | 3300038705 | Bacteria | 50539 |
| 749 | Ga0237819_05137 | 3300038705 | Bacteria | 2080 |
| 750 | Ga0439436_0000027 | 3300041404 | Bacteria | 53417 |
| 751 | Ga0439436_0020558 | 3300041404 | Bacteria | 1966 |
| 752 | Ga0439436_0044395 | 3300041404 | Bacteria | 1266 |
| 753 | Ga0439436_0110206 | 3300041404 | Bacteria | 768 |
| 754 | Ga0439439_0004561 | 3300041406 | Bacteria | 3133 |
| 755 | Ga0439447_013961 | 3300041407 | Bacteria | 2264 |
| 756 | Ga0439465_0000141 | 3300041413 | Bacteria | 17802 |
| 757 | Ga0439465_0005524 | 3300041413 | Bacteria | 4031 |
| 758 | Ga0451788_24495 | 3300041442 | Bacteria | 761 |
| 759 | Ga0451790_10956 | 3300041444 | Bacteria | 1249 |
| 760 | Ga0451794_20311 | 3300041446 | Bacteria | 790 |
| 761 | Ga0451793_0190021 | 3300041452 | Bacteria | 871 |
| 762 | Ga0451793_0393032 | 3300041452 | Bacteria | 3643 |
| 763 | Ga0451793_1506933 | 3300041452 | Bacteria | 1244 |
| 764 | Ga0451801_19993 | 3300041455 | Bacteria | 3054 |
| 765 | Ga0451795_0694995 | 3300041456 | Bacteria | 1293 |
| 766 | Ga0451798_0875692 | 3300041458 | Bacteria | 1219 |
| 767 | Ga0451800_0893000 | 3300041459 | Bacteria | 1382 |
| 768 | Ga0451800_1044717 | 3300041459 | Bacteria | 770 |
| 769 | Ga0451800_1057945 | 3300041459 | Bacteria | 15810 |
| 770 | Ga0451805_028824 | 3300041461 | Bacteria | 1147 |
| 771 | Ga0451805_049393 | 3300041461 | Bacteria | 1172 |
| 772 | Ga0451805_075358 | 3300041461 | Bacteria | 774 |
| 773 | Ga0451806_234332 | 3300041462 | Bacteria | 19745 |
| 774 | Ga0451804_0524950 | 3300041463 | Bacteria | 2306 |
| 775 | Ga0451807_1035554 | 3300041486 | Bacteria | 6707 |
| 776 | Ga0451837_0104937 | 3300041494 | Bacteria | 661 |
| 777 | Ga0451837_0822369 | 3300041494 | Bacteria | 1529 |
| 778 | Ga0451843_0242471 | 3300041509 | Bacteria | 1507 |
| 779 | Ga0451843_0922492 | 3300041509 | Bacteria | 1261 |
| 780 | Ga0451843_1758148 | 3300041509 | Bacteria | 744 |
| 781 | Ga0451853_2750802 | 3300041512 | Bacteria | 1113 |
| 782 | Ga0439431_0008628 | 3300041997 | Bacteria | 2294 |
| 783 | Ga0439433_0083311 | 3300041999 | Bacteria | 780 |
| 784 | Ga0439437_001431 | 3300042000 | Bacteria | 2515 |
| 785 | Ga0439445_0011454 | 3300042004 | Bacteria | 2116 |
| 786 | Ga0439445_0076000 | 3300042004 | Bacteria | 934 |
| 787 | Ga0439449_0011871 | 3300042007 | Bacteria | 3274 |
| 788 | Ga0439449_0039601 | 3300042007 | Bacteria | 1752 |
| 789 | Ga0439449_0050566 | 3300042007 | Bacteria | 1537 |
| 790 | Ga0439449_0052843 | 3300042007 | Bacteria | 1502 |
| 791 | Ga0439449_0059877 | 3300042007 | Bacteria | 1405 |
| 792 | Ga0439452_041628 | 3300042010 | Bacteria | 1080 |
| 793 | Ga0450897_006886 | 3300042128 | Bacteria | 1026 |
| 794 | Ga0439446_0036071 | 3300042156 | Bacteria | 1444 |
| 795 | Ga0450908_002110 | 3300042184 | Bacteria | 3892 |
| 796 | Ga0439434_0071617 | 3300042435 | Bacteria | 1092 |
| 797 | Ga0439434_0194142 | 3300042435 | Bacteria | 683 |
| 798 | Ga0451577_0065354 | 3300042876 | Bacteria | 3244 |
| 799 | Ga0451577_0182922 | 3300042876 | Bacteria | 1890 |
| 800 | Ga0439440_0015463 | 3300042993 | Bacteria | 1659 |
| 801 | Ga0466969_0008348 | 3300044656 | Bacteria | 5490 |
| 802 | Ga0466969_0008941 | 3300044656 | Bacteria | 5311 |
| 803 | Ga0466969_0086989 | 3300044656 | Bacteria | 1484 |
| 804 | Ga0466972_0024571 | 3300044658 | Bacteria | 2989 |
| 805 | Ga0466975_0199194 | 3300044661 | Bacteria | 1359 |
| 806 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 807 | Ga0466982_0000210 | 3300044672 | Bacteria | 15368 |
| 808 | Ga0466965_0003853 | 3300044683 | Bacteria | 6624 |
| 809 | Ga0466966_0002549 | 3300044684 | Bacteria | 11933 |
| 810 | Ga0466966_0069760 | 3300044684 | Bacteria | 2204 |
| 811 | Ga0466961_0010336 | 3300044693 | Bacteria | 5951 |
| 812 | Ga0466961_0015293 | 3300044693 | Bacteria | 4928 |
| 813 | Ga0466961_0079218 | 3300044693 | Bacteria | 2080 |
| 814 | Ga0466961_0085616 | 3300044693 | Bacteria | 1992 |
| 815 | Ga0466961_0265280 | 3300044693 | Bacteria | 1052 |
| 816 | Ga0466963_0052819 | 3300044694 | Bacteria | 2697 |
| 817 | Ga0466963_0151824 | 3300044694 | Bacteria | 1609 |
| 818 | Ga0466963_0588989 | 3300044694 | Bacteria | 785 |
| 819 | Ga0466964_0018986 | 3300044706 | Bacteria | 2641 |
| 820 | Ga0466964_0142737 | 3300044706 | Bacteria | 1102 |
| 821 | Ga0466964_0322127 | 3300044706 | Bacteria | 786 |
| 822 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 823 | Ga0466971_0000338 | 3300044719 | Bacteria | 17942 |
| 824 | Ga0466971_0006109 | 3300044719 | Bacteria | 5237 |
| 825 | Ga0466971_0033841 | 3300044719 | Bacteria | 2290 |
| 826 | Ga0466968_0000409 | 3300044735 | Bacteria | 14226 |
| 827 | Ga0466968_0048557 | 3300044735 | Bacteria | 1807 |
| 828 | Ga0466970_0001896 | 3300044765 | Bacteria | 10104 |
| 829 | Ga0466970_0215617 | 3300044765 | Bacteria | 1070 |
| 830 | Ga0466957_0003550 | 3300044842 | Bacteria | 8589 |
| 831 | Ga0466957_0019946 | 3300044842 | Bacteria | 3945 |
| 832 | Ga0466957_0075171 | 3300044842 | Bacteria | 2096 |
| 833 | Ga0466960_0002345 | 3300044901 | Bacteria | 7115 |
| 834 | Ga0466959_0033759 | 3300045049 | Bacteria | 3784 |
| 835 | Ga0466959_0043319 | 3300045049 | Bacteria | 3317 |
| 836 | Ga0466959_0072597 | 3300045049 | Bacteria | 2490 |
| 837 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 838 | Ga0466958_0005279 | 3300045836 | Bacteria | 6926 |
| 839 | Ga0466958_0045436 | 3300045836 | Bacteria | 2649 |
| 840 | Ga0466958_0054129 | 3300045836 | Bacteria | 2433 |
| 841 | Ga0466958_0067609 | 3300045836 | Bacteria | 2183 |
| 842 | Ga0466958_0080493 | 3300045836 | Bacteria | 2004 |
| 843 | Ga0466967_0075901 | 3300045976 | Bacteria | 3022 |
| 844 | Ga0495617_005550 | 3300046452 | Bacteria | 4464 |
| 845 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 846 | Ga0495638_0029717 | 3300046460 | Bacteria | 3523 |
| 847 | Ga0495638_0055083 | 3300046460 | Bacteria | 2470 |
| 848 | Ga0495650_0000202 | 3300046471 | Bacteria | 129910 |
| 849 | Ga0495650_0011898 | 3300046471 | Bacteria | 4717 |
| 850 | Ga0495650_0021446 | 3300046471 | Bacteria | 3122 |
| 851 | Ga0495584_0021982 | 3300046491 | Bacteria | 3238 |
| 852 | Ga0495585_0013800 | 3300046492 | Bacteria | 4720 |
| 853 | Ga0495607_0007223 | 3300046501 | Bacteria | 7709 |
| 854 | Ga0495607_0026377 | 3300046501 | Bacteria | 3605 |
| 855 | Ga0495607_0100086 | 3300046501 | Bacteria | 1554 |
| 856 | Ga0495607_0154297 | 3300046501 | Bacteria | 1172 |
| 857 | Ga0495606_0001329 | 3300046507 | Bacteria | 33751 |
| 858 | Ga0495606_0035985 | 3300046507 | Bacteria | 3378 |
| 859 | Ga0495610_0011764 | 3300046512 | Bacteria | 5316 |
| 860 | Ga0495616_0007049 | 3300046513 | Bacteria | 6755 |
| 861 | Ga0495620_0015281 | 3300046515 | Bacteria | 3879 |
| 862 | Ga0495631_0026344 | 3300046518 | Bacteria | 2671 |
| 863 | Ga0495632_0005327 | 3300046519 | Bacteria | 8538 |
| 864 | Ga0495632_0019213 | 3300046519 | Bacteria | 3728 |
| 865 | Ga0495637_0009169 | 3300046520 | Bacteria | 4831 |
| 866 | Ga0495643_0018809 | 3300046522 | Bacteria | 4003 |
| 867 | Ga0495648_0013709 | 3300046524 | Bacteria | 5976 |
| 868 | Ga0495663_0004473 | 3300046525 | Bacteria | 3926 |
| 869 | Ga0495663_0102121 | 3300046525 | Bacteria | 945 |
| 870 | Ga0495609_0001578 | 3300046538 | Bacteria | 14896 |
| 871 | Ga0495621_0001470 | 3300046539 | Bacteria | 6111 |
| 872 | Ga0495622_0058718 | 3300046557 | Bacteria | 1782 |
| 873 | Ga0495656_0006174 | 3300046615 | Bacteria | 4190 |
| 874 | Ga0495656_0140966 | 3300046615 | Bacteria | 1156 |
| 875 | Ga0495668_0021331 | 3300046616 | Bacteria | 3716 |
| 876 | Ga0495668_0033171 | 3300046616 | Bacteria | 2901 |
| 877 | Ga0495611_0000029 | 3300046648 | Bacteria | 115887 |
| 878 | Ga0495611_0080006 | 3300046648 | Bacteria | 1501 |
| 879 | Ga0495625_0001724 | 3300046660 | Bacteria | 25395 |
| 880 | Ga0495625_0016676 | 3300046660 | Bacteria | 5771 |
| 881 | Ga0495625_0139135 | 3300046660 | Bacteria | 1639 |
| 882 | Ga0495661_0008049 | 3300046665 | Bacteria | 7318 |
| 883 | Ga0495588_0151180 | 3300046674 | Bacteria | 1227 |
| 884 | Ga0495670_0039605 | 3300046691 | Bacteria | 2350 |
| 885 | Ga0495670_0046353 | 3300046691 | Bacteria | 2171 |
| 886 | Ga0495670_0101413 | 3300046691 | Bacteria | 1482 |
| 887 | Ga0495670_0262669 | 3300046691 | Bacteria | 921 |
| 888 | Ga0495671_0005114 | 3300046692 | Bacteria | 7717 |
| 889 | Ga0495649_0000383 | 3300046694 | Bacteria | 38398 |
| 890 | Ga0495649_0006659 | 3300046694 | Bacteria | 7174 |
| 891 | Ga0495589_0000144 | 3300046794 | Bacteria | 65654 |
| 892 | Ga0495660_0003242 | 3300046810 | Bacteria | 10114 |
| 893 | Ga0495660_0080856 | 3300046810 | Bacteria | 1704 |
| 894 | Ga0495636_0052343 | 3300047318 | Bacteria | 1712 |
| 895 | Ga0495672_0018426 | 3300047320 | Bacteria | 4634 |
| 896 | Ga0495676_0620206 | 3300047321 | Bacteria | 703 |
| 897 | Ga0495683_0004657 | 3300047323 | Bacteria | 7733 |
| 898 | Ga0495677_0149460 | 3300047445 | Bacteria | 899 |
| 899 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 900 | Ga0495673_0004383 | 3300047469 | Bacteria | 8851 |
| 901 | Ga0495673_0005855 | 3300047469 | Bacteria | 7350 |
| 902 | Ga0495681_0080605 | 3300047470 | Bacteria | 1454 |
| 903 | Ga0495681_0124862 | 3300047470 | Bacteria | 1101 |
| 904 | Ga0495686_0002623 | 3300047472 | Bacteria | 16652 |
| 905 | Ga0495686_0036720 | 3300047472 | Bacteria | 3143 |
| 906 | Ga0496100_0006795 | 3300048903 | Bacteria | 6268 |
| 907 | Ga0496100_0732691 | 3300048903 | Bacteria | 772 |
| 908 | Ga0496101_0009854 | 3300048904 | Bacteria | 6293 |
| 909 | Ga0496101_0090873 | 3300048904 | Bacteria | 2271 |
| 910 | Ga0496101_0243688 | 3300048904 | Bacteria | 1399 |
| 911 | Ga0496102_0109999 | 3300048905 | Bacteria | 2568 |
| 912 | Ga0496103_0145760 | 3300048906 | Bacteria | 1515 |
| 913 | Ga0496103_0296905 | 3300048906 | Bacteria | 1039 |
| 914 | Ga0496104_0045988 | 3300048907 | Bacteria | 4107 |
| 915 | Ga0496104_0159892 | 3300048907 | Bacteria | 2161 |
| 916 | Ga0496105_0041905 | 3300048908 | Bacteria | 3773 |
| 917 | Ga0496106_0003988 | 3300048909 | Bacteria | 11030 |
| 918 | Ga0496107_0011190 | 3300048910 | Bacteria | 6245 |
| 919 | Ga0496107_0034298 | 3300048910 | Bacteria | 3635 |
| 920 | Ga0496107_0189985 | 3300048910 | Bacteria | 1526 |
| 921 | Ga0496108_0001932 | 3300048911 | Bacteria | 16608 |
| 922 | Ga0496108_0100619 | 3300048911 | Bacteria | 2465 |
| 923 | Ga0496108_0143885 | 3300048911 | Bacteria | 2055 |
| 924 | Ga0496109_0062064 | 3300048912 | Bacteria | 3417 |
| 925 | Ga0496109_0085316 | 3300048912 | Bacteria | 2914 |
| 926 | Ga0496109_0571328 | 3300048912 | Bacteria | 1066 |
| 927 | Ga0496110_0011371 | 3300048913 | Bacteria | 7282 |
| 928 | Ga0496111_0003793 | 3300048914 | Bacteria | 9425 |
| 929 | Ga0496112_0025726 | 3300048915 | Bacteria | 5652 |
| 930 | Ga0496112_0240221 | 3300048915 | Bacteria | 1764 |
| 931 | Ga0496113_0067298 | 3300048916 | Bacteria | 2715 |
| 932 | Ga0496113_0471490 | 3300048916 | Bacteria | 1009 |
| 933 | Ga0496114_0025860 | 3300048917 | Bacteria | 4801 |
| 934 | Ga0496114_0055393 | 3300048917 | Bacteria | 3307 |
| 935 | Ga0496115_0002269 | 3300048918 | Bacteria | 13760 |
| 936 | Ga0496115_0002549 | 3300048918 | Bacteria | 13090 |
| 937 | Ga0496115_0137021 | 3300048918 | Bacteria | 2018 |
| 938 | Ga0496115_0323400 | 3300048918 | Bacteria | 1261 |
| 939 | Ga0496115_0367309 | 3300048918 | Bacteria | 1172 |
| 940 | Ga0496116_0085191 | 3300048919 | Bacteria | 1943 |
| 941 | Ga0496116_0129825 | 3300048919 | Bacteria | 1439 |
| 942 | Ga0496117_0028524 | 3300048920 | Bacteria | 4321 |
| 943 | Ga0496117_0063248 | 3300048920 | Bacteria | 2530 |
| 944 | Ga0496117_0360569 | 3300048920 | Bacteria | 747 |
| 945 | Ga0496118_0008397 | 3300048921 | Bacteria | 10682 |
| 946 | Ga0496118_0024725 | 3300048921 | Bacteria | 5173 |
| 947 | Ga0496118_0028854 | 3300048921 | Bacteria | 4664 |
| 948 | Ga0496118_0041939 | 3300048921 | Bacteria | 3617 |
| 949 | Ga0496118_0092393 | 3300048921 | Bacteria | 2077 |
| 950 | Ga0496118_0099530 | 3300048921 | Bacteria | 1970 |
| 951 | Ga0496118_0155303 | 3300048921 | Bacteria | 1425 |
| 952 | Ga0496119_0014507 | 3300048922 | Bacteria | 6158 |
| 953 | Ga0496119_0016519 | 3300048922 | Bacteria | 5611 |
| 954 | Ga0496119_0267452 | 3300048922 | Bacteria | 855 |
| 955 | Ga0496120_0024106 | 3300048923 | Bacteria | 3798 |
| 956 | Ga0496121_0000290 | 3300048924 | Bacteria | 104280 |
| 957 | Ga0496121_0005001 | 3300048924 | Bacteria | 17352 |
| 958 | Ga0496121_0016314 | 3300048924 | Bacteria | 7676 |
| 959 | Ga0496121_0053526 | 3300048924 | Bacteria | 3380 |
| 960 | Ga0496121_0056865 | 3300048924 | Bacteria | 3246 |
| 961 | Ga0496122_0079528 | 3300048925 | Bacteria | 2290 |
| 962 | Ga0496122_0097842 | 3300048925 | Bacteria | 1973 |
| 963 | Ga0496122_0176593 | 3300048925 | Bacteria | 1279 |
| 964 | Ga0496123_0022702 | 3300048926 | Bacteria | 4826 |
| 965 | Ga0496123_0031047 | 3300048926 | Bacteria | 3897 |
| 966 | Ga0496123_0033327 | 3300048926 | Bacteria | 3709 |
| 967 | Ga0496123_0070780 | 3300048926 | Bacteria | 2180 |
| 968 | Ga0496123_0094978 | 3300048926 | Bacteria | 1755 |
| 969 | Ga0496123_0146817 | 3300048926 | Bacteria | 1279 |
| 970 | Ga0496123_0259638 | 3300048926 | Bacteria | 852 |
| 971 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 972 | Ga0496124_0000472 | 3300048927 | Bacteria | 69226 |
| 973 | Ga0496124_0107957 | 3300048927 | Bacteria | 2245 |
| 974 | Ga0496125_0000379 | 3300048928 | Bacteria | 83187 |
| 975 | Ga0496125_0024621 | 3300048928 | Bacteria | 5530 |
| 976 | Ga0496125_0042644 | 3300048928 | Bacteria | 3862 |
| 977 | Ga0496126_0000033 | 3300048929 | Bacteria | 368851 |
| 978 | Ga0496126_0006212 | 3300048929 | Bacteria | 13367 |
| 979 | Ga0496126_0028743 | 3300048929 | Bacteria | 5292 |
| 980 | Ga0496126_0119779 | 3300048929 | Bacteria | 2284 |
| 981 | Ga0496126_0655193 | 3300048929 | Bacteria | 821 |
| 982 | Ga0501308_000035 | 3300049128 | Bacteria | 5438 |
| 983 | Ga0501309_003449 | 3300049129 | Bacteria | 1791 |
| 984 | Ga0501310_000986 | 3300049130 | Bacteria | 2538 |
| 985 | Ga0501307_000579 | 3300049162 | Bacteria | 2601 |
| 986 | Ga0501307_005239 | 3300049162 | Bacteria | 1360 |
| 987 | Ga0501307_006548 | 3300049162 | Bacteria | 1262 |
| 988 | Ga0495678_004567 | 3300049459 | Bacteria | 7963 |
| 989 | Ga0495678_016742 | 3300049459 | Bacteria | 3341 |
| 990 | Ga0495682_0073233 | 3300049460 | Bacteria | 1232 |
| 991 | Ga0501311_003051 | 3300049527 | Bacteria | 1672 |
| 992 | Ga0501312_002244 | 3300049528 | Bacteria | 2061 |
| 993 | Ga0501312_002447 | 3300049528 | Bacteria | 2006 |
| 994 | Ga0501312_007104 | 3300049528 | Bacteria | 1418 |
| 995 | Ga0501315_004415 | 3300049531 | Bacteria | 1470 |
| 996 | Ga0501317_001762 | 3300049533 | Bacteria | 1934 |
| 997 | Ga0501317_006218 | 3300049533 | Bacteria | 1304 |
| 998 | Ga0501318_000528 | 3300049534 | Bacteria | 2495 |
| 999 | Ga0501319_000070 | 3300049535 | Bacteria | 3471 |
| 1000 | Ga0501321_005366 | 3300049537 | Bacteria | 1264 |
| 1001 | Ga0501323_000068 | 3300049539 | Bacteria | 5160 |
| 1002 | Ga0501323_000101 | 3300049539 | Bacteria | 4591 |
| 1003 | Ga0501324_014225 | 3300049540 | Bacteria | 761 |
| 1004 | Ga0501031_0025141 | 3300049568 | Bacteria | 3884 |
| 1005 | Ga0501031_0047206 | 3300049568 | Bacteria | 2807 |
| 1006 | Ga0501031_0063611 | 3300049568 | Bacteria | 2403 |
| 1007 | Ga0501031_0096163 | 3300049568 | Bacteria | 1933 |
| 1008 | Ga0501031_0101188 | 3300049568 | Bacteria | 1880 |
| 1009 | Ga0501032_0020602 | 3300049569 | Bacteria | 4590 |
| 1010 | Ga0501032_0025237 | 3300049569 | Bacteria | 4098 |
| 1011 | Ga0501032_0045411 | 3300049569 | Bacteria | 2971 |
| 1012 | Ga0501033_0000337 | 3300049570 | Bacteria | 44892 |
| 1013 | Ga0501033_0060996 | 3300049570 | Bacteria | 2780 |
| 1014 | Ga0501033_0075593 | 3300049570 | Bacteria | 2472 |
| 1015 | Ga0501033_0123272 | 3300049570 | Bacteria | 1879 |
| 1016 | Ga0501034_0008263 | 3300049571 | Bacteria | 11016 |
| 1017 | Ga0501034_0021966 | 3300049571 | Bacteria | 6502 |
| 1018 | Ga0501034_0025504 | 3300049571 | Bacteria | 6019 |
| 1019 | Ga0501034_0056333 | 3300049571 | Bacteria | 3955 |
| 1020 | Ga0501034_0066470 | 3300049571 | Bacteria | 3618 |
| 1021 | Ga0501034_0099165 | 3300049571 | Bacteria | 2908 |
| 1022 | Ga0501034_0120372 | 3300049571 | Bacteria | 2611 |
| 1023 | Ga0501034_0377238 | 3300049571 | Bacteria | 1343 |
| 1024 | Ga0501036_0030355 | 3300049572 | Bacteria | 4566 |
| 1025 | Ga0501036_0037846 | 3300049572 | Bacteria | 4080 |
| 1026 | Ga0501036_0066357 | 3300049572 | Bacteria | 3053 |
| 1027 | Ga0501036_0665537 | 3300049572 | Bacteria | 861 |
| 1028 | Ga0501037_0019227 | 3300049573 | Bacteria | 5034 |
| 1029 | Ga0501037_0127086 | 3300049573 | Bacteria | 1829 |
| 1030 | Ga0501037_0204211 | 3300049573 | Bacteria | 1395 |
| 1031 | Ga0501038_0002396 | 3300049574 | Bacteria | 17463 |
| 1032 | Ga0501038_0013134 | 3300049574 | Bacteria | 7553 |
| 1033 | Ga0501038_0026720 | 3300049574 | Bacteria | 5139 |
| 1034 | Ga0501038_0055414 | 3300049574 | Bacteria | 3405 |
| 1035 | Ga0501038_0283895 | 3300049574 | Bacteria | 1302 |
| 1036 | Ga0501038_0326070 | 3300049574 | Bacteria | 1200 |
| 1037 | Ga0501039_0013271 | 3300049575 | Bacteria | 6300 |
| 1038 | Ga0501039_0036074 | 3300049575 | Bacteria | 3814 |
| 1039 | Ga0501039_0128008 | 3300049575 | Bacteria | 1992 |
| 1040 | Ga0501039_0811864 | 3300049575 | Bacteria | 729 |
| 1041 | Ga0501040_0187968 | 3300049576 | Bacteria | 1465 |
| 1042 | Ga0501042_0056670 | 3300049578 | Bacteria | 2796 |
| 1043 | Ga0501042_0160846 | 3300049578 | Bacteria | 1620 |
| 1044 | Ga0501043_0016278 | 3300049579 | Bacteria | 5832 |
| 1045 | Ga0501043_0030616 | 3300049579 | Bacteria | 4230 |
| 1046 | Ga0501043_0111378 | 3300049579 | Bacteria | 2149 |
| 1047 | Ga0501043_0113617 | 3300049579 | Bacteria | 2126 |
| 1048 | Ga0501043_0141105 | 3300049579 | Bacteria | 1887 |
| 1049 | Ga0501043_0147266 | 3300049579 | Bacteria | 1843 |
| 1050 | Ga0501043_0269409 | 3300049579 | Bacteria | 1307 |
| 1051 | Ga0501046_0025093 | 3300049580 | Bacteria | 4882 |
| 1052 | Ga0501046_0034206 | 3300049580 | Bacteria | 4102 |
| 1053 | Ga0501046_0067782 | 3300049580 | Bacteria | 2778 |
| 1054 | Ga0501046_0100330 | 3300049580 | Bacteria | 2221 |
| 1055 | Ga0501046_0113833 | 3300049580 | Bacteria | 2064 |
| 1056 | Ga0501046_0470696 | 3300049580 | Bacteria | 902 |
| 1057 | Ga0501047_0000250 | 3300049581 | Bacteria | 63699 |
| 1058 | Ga0501047_0045199 | 3300049581 | Bacteria | 4257 |
| 1059 | Ga0501047_0100864 | 3300049581 | Bacteria | 2766 |
| 1060 | Ga0501047_0103968 | 3300049581 | Bacteria | 2720 |
| 1061 | Ga0501047_0136357 | 3300049581 | Bacteria | 2334 |
| 1062 | Ga0501047_0221275 | 3300049581 | Bacteria | 1749 |
| 1063 | Ga0501047_0383280 | 3300049581 | Bacteria | 1240 |
| 1064 | Ga0501047_0629767 | 3300049581 | Bacteria | 893 |
| 1065 | Ga0501048_0021518 | 3300049582 | Bacteria | 4723 |
| 1066 | Ga0501048_0029557 | 3300049582 | Bacteria | 3972 |
| 1067 | Ga0501048_0132280 | 3300049582 | Bacteria | 1763 |
| 1068 | Ga0501067_0015294 | 3300049583 | Bacteria | 4246 |
| 1069 | Ga0501067_0019365 | 3300049583 | Bacteria | 3766 |
| 1070 | Ga0501069_0036066 | 3300049585 | Bacteria | 2725 |
| 1071 | Ga0501069_0095297 | 3300049585 | Bacteria | 1685 |
| 1072 | Ga0501070_0022172 | 3300049586 | Bacteria | 5319 |
| 1073 | Ga0501070_0033585 | 3300049586 | Bacteria | 4293 |
| 1074 | Ga0501070_0038865 | 3300049586 | Bacteria | 3971 |
| 1075 | Ga0501070_0042967 | 3300049586 | Bacteria | 3762 |
| 1076 | Ga0501070_0086782 | 3300049586 | Bacteria | 2590 |
| 1077 | Ga0501070_0130993 | 3300049586 | Bacteria | 2071 |
| 1078 | Ga0501070_0153676 | 3300049586 | Bacteria | 1898 |
| 1079 | Ga0501070_0162900 | 3300049586 | Bacteria | 1838 |
| 1080 | Ga0501070_0198353 | 3300049586 | Bacteria | 1648 |
| 1081 | Ga0501071_0037161 | 3300049587 | Bacteria | 3476 |
| 1082 | Ga0501071_0088182 | 3300049587 | Bacteria | 2276 |
| 1083 | Ga0501071_0441656 | 3300049587 | Bacteria | 995 |
| 1084 | Ga0501072_0021878 | 3300049588 | Bacteria | 4960 |
| 1085 | Ga0501073_0000196 | 3300049589 | Bacteria | 40033 |
| 1086 | Ga0501073_0029914 | 3300049589 | Bacteria | 3889 |
| 1087 | Ga0501073_0068309 | 3300049589 | Bacteria | 2477 |
| 1088 | Ga0501073_0078475 | 3300049589 | Bacteria | 2297 |
| 1089 | Ga0501073_0210261 | 3300049589 | Bacteria | 1344 |
| 1090 | Ga0501074_0031616 | 3300049590 | Bacteria | 3834 |
| 1091 | Ga0501074_0034673 | 3300049590 | Bacteria | 3658 |
| 1092 | Ga0501074_0074903 | 3300049590 | Bacteria | 2430 |
| 1093 | Ga0501074_0148950 | 3300049590 | Bacteria | 1673 |
| 1094 | Ga0501074_0154724 | 3300049590 | Bacteria | 1638 |
| 1095 | Ga0501074_0685815 | 3300049590 | Bacteria | 723 |
| 1096 | Ga0501075_0321697 | 3300049591 | Bacteria | 1179 |
| 1097 | Ga0501202_018155 | 3300049652 | Bacteria | 1379 |
| 1098 | Ga0501223_032298 | 3300049663 | Bacteria | 1018 |
| 1099 | Ga0501239_002487 | 3300049672 | Bacteria | 1676 |
| 1100 | Ga0501242_009218 | 3300049674 | Bacteria | 1165 |
| 1101 | Ga0501247_029292 | 3300049677 | Bacteria | 746 |
| 1102 | Ga0501249_021629 | 3300049679 | Bacteria | 1404 |
| 1103 | Ga0501252_008250 | 3300049682 | Bacteria | 1194 |
| 1104 | Ga0501080_0005488 | 3300049742 | Bacteria | 11318 |
| 1105 | Ga0501080_0016130 | 3300049742 | Bacteria | 6896 |
| 1106 | Ga0501080_0018310 | 3300049742 | Bacteria | 6482 |
| 1107 | Ga0501080_0045089 | 3300049742 | Bacteria | 4104 |
| 1108 | Ga0501080_0049719 | 3300049742 | Bacteria | 3902 |
| 1109 | Ga0501080_0075188 | 3300049742 | Bacteria | 3142 |
| 1110 | Ga0501080_0107130 | 3300049742 | Bacteria | 2590 |
| 1111 | Ga0501080_0290833 | 3300049742 | Bacteria | 1483 |
| 1112 | Ga0501081_0073960 | 3300049743 | Bacteria | 2377 |
| 1113 | Ga0501083_0021386 | 3300049744 | Bacteria | 4495 |
| 1114 | Ga0501083_0057300 | 3300049744 | Bacteria | 2608 |
| 1115 | Ga0501083_0240929 | 3300049744 | Bacteria | 1177 |
| 1116 | Ga0501035_0021041 | 3300049822 | Bacteria | 5996 |
| 1117 | Ga0501035_0039431 | 3300049822 | Bacteria | 4274 |
| 1118 | Ga0501035_0043368 | 3300049822 | Bacteria | 4053 |
| 1119 | Ga0501035_0213194 | 3300049822 | Bacteria | 1651 |
| 1120 | Ga0501035_0627844 | 3300049822 | Bacteria | 873 |
| 1121 | Ga0501035_0828346 | 3300049822 | Bacteria | 737 |
| 1122 | Ga0501044_0003730 | 3300049823 | Bacteria | 17110 |
| 1123 | Ga0501044_0031982 | 3300049823 | Bacteria | 5532 |
| 1124 | Ga0501044_0053687 | 3300049823 | Bacteria | 4145 |
| 1125 | Ga0501044_0128002 | 3300049823 | Bacteria | 2535 |
| 1126 | Ga0501044_0154075 | 3300049823 | Bacteria | 2278 |
| 1127 | Ga0501044_0312859 | 3300049823 | Bacteria | 1496 |
| 1128 | Ga0501044_0446143 | 3300049823 | Bacteria | 1201 |
| 1129 | Ga0501044_0453222 | 3300049823 | Bacteria | 1189 |
| 1130 | Ga0501044_0583195 | 3300049823 | Bacteria | 1012 |
| 1131 | Ga0501045_0042206 | 3300049824 | Bacteria | 3320 |
| 1132 | nmdc:mga00v17_16326_c1 | 3300050491 | Bacteria | 4186 |
| 1133 | Ga0500643_000120 | 3300053087 | Bacteria | 81701 |
| 1134 | Ga0500646_0022488 | 3300053090 | Bacteria | 1686 |
| 1135 | Ga0500651_0000131 | 3300053093 | Bacteria | 46394 |
| 1136 | Ga0500555_001368 | 3300053103 | Bacteria | 7599 |
| 1137 | Ga0500597_115201 | 3300053120 | Bacteria | 1166 |
| 1138 | Ga0500568_0019513 | 3300053139 | Bacteria | 2945 |
| 1139 | Ga0500619_094029 | 3300053154 | Bacteria | 1014 |
| 1140 | Ga0500633_0000338 | 3300053160 | Bacteria | 7069 |
| 1141 | Ga0500634_0003199 | 3300053161 | Bacteria | 7212 |
| 1142 | Ga0500645_004128 | 3300053730 | Bacteria | 5663 |
| 1143 | Ga0501084_0245529 | 3300054114 | Bacteria | 1511 |
| 1144 | Ga0587093_001690 | 3300059478 | Bacteria | 1922 |
| 1145 | Ga0587073_0001891 | 3300059492 | Bacteria | 2575 |
| 1146 | Ga0587073_0022645 | 3300059492 | Bacteria | 1222 |
| 1147 | Ga0587080_001372 | 3300059503 | Bacteria | 2617 |
| 1148 | Ga0587080_003084 | 3300059503 | Bacteria | 2036 |
| 1149 | Ga0587082_000933 | 3300059504 | Bacteria | 2775 |
| 1150 | Ga0587083_0050429 | 3300059505 | Bacteria | 905 |
| 1151 | Ga0587088_000941 | 3300059508 | Bacteria | 2784 |
| 1152 | Ga0587088_001539 | 3300059508 | Bacteria | 2415 |
| 1153 | Ga0587090_000930 | 3300059510 | Bacteria | 2750 |
| 1154 | Ga0587090_008934 | 3300059510 | Bacteria | 1356 |
| 1155 | Ga0587091_013769 | 3300059511 | Bacteria | 1306 |
| 1156 | Ga0587094_012935 | 3300059513 | Bacteria | 1121 |
| 1157 | Ga0587106_000089 | 3300059605 | Bacteria | 4305 |
| 1158 | Ga0587099_000319 | 3300059622 | Bacteria | 2599 |
| 1159 | Ga0587101_004567 | 3300059623 | Bacteria | 1486 |
| 1160 | Ga0587113_000588 | 3300059625 | Bacteria | 2012 |
| 1161 | Ga0587128_002799 | 3300059630 | Bacteria | 1859 |
| 1162 | Ga0587067_000398 | 3300059640 | Bacteria | 3711 |
| 1163 | Ga0587072_001885 | 3300059643 | Bacteria | 2710 |
| 1164 | Ga0587075_002127 | 3300059644 | Bacteria | 2052 |
| 1165 | Ga0587078_000692 | 3300059646 | Bacteria | 2693 |
| 1166 | Ga0587078_001522 | 3300059646 | Bacteria | 2090 |
| 1167 | Ga0587079_003247 | 3300059647 | Bacteria | 2100 |
| 1168 | Ga0587120_001142 | 3300059659 | Bacteria | 1591 |
| 1169 | Ga0587071_002066 | 3300060344 | Bacteria | 2656 |
| 1170 | Ga0587071_018773 | 3300060344 | Bacteria | 1246 |
| 1171 | Ga0501082_0017750 | 3300060353 | Bacteria | 6128 |
| 1172 | Ga0501082_0146414 | 3300060353 | Bacteria | 2050 |
| 1173 | Ga0466962_0007521 | 3300061719 | Bacteria | 5225 |
| 1174 | Ga0466962_0021946 | 3300061719 | Bacteria | 3065 |
| 1175 | Ga0466962_0039986 | 3300061719 | Bacteria | 2245 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049663 | Ga0501223_032298 | Ga0501223_032298_493_1008 | 161 |
| 2 | 3300025303 | Ga0209051_1009469 | Ga0209051_10094693 | 171 |
| 3 | 3300048921 | Ga0496118_0008397 | Ga0496118_0008397_314_916 | 172 |
| 4 | 3300006038 | Ga0075365_10255181 | Ga0075365_102551812 | 174 |
| 5 | 3300041494 | Ga0451837_0104937 | Ga0451837_0104937_21_626 | 174 |
| 6 | 3300050491 | nmdc:mga00v17_16326_c1 | nmdc:mga00v17_16326_c1_2845_3450 | 174 |
| 7 | 3300033180 | Ga0307510_10002916 | Ga0307510_1000291630 | 177 |
| 8 | 3300046471 | Ga0495650_0011898 | Ga0495650_0011898_1126_1728 | 177 |
| 9 | 3300049652 | Ga0501202_018155 | Ga0501202_018155_798_1364 | 178 |
| 10 | 3300002075 | JGI24738J21930_10000244 | JGI24738J21930_100002443 | 180 |
| 11 | 3300003575 | Ga0007409J51694_1033072 | Ga0007409J51694_10330724 | 180 |
| 12 | 3300003693 | Ga0032354_1074945 | Ga0032354_10749452 | 180 |
| 13 | 3300013308 | Ga0157375_10803357 | Ga0157375_108033571 | 180 |
| 14 | 3300014497 | Ga0182008_10010846 | Ga0182008_100108462 | 180 |
| 15 | 3300014497 | Ga0182008_10077246 | Ga0182008_100772462 | 180 |
| 16 | 3300015261 | Ga0182006_1023134 | Ga0182006_10231342 | 180 |
| 17 | 3300015261 | Ga0182006_1043661 | Ga0182006_10436612 | 180 |
| 18 | 3300015262 | Ga0182007_10001054 | Ga0182007_1000105424 | 180 |
| 19 | 3300015265 | Ga0182005_1064493 | Ga0182005_10644932 | 180 |
| 20 | 3300031731 | Ga0307405_10146342 | Ga0307405_101463423 | 180 |
| 21 | 3300031911 | Ga0307412_10019091 | Ga0307412_100190913 | 180 |
| 22 | 3300041404 | Ga0439436_0000027 | Ga0439436_0000027_48587_49189 | 180 |
| 23 | 3300041413 | Ga0439465_0000141 | Ga0439465_0000141_2297_2899 | 180 |
| 24 | 3300041446 | Ga0451794_20311 | Ga0451794_20311_150_752 | 180 |
| 25 | 3300041461 | Ga0451805_075358 | Ga0451805_075358_10_582 | 180 |
| 26 | 3300042004 | Ga0439445_0076000 | Ga0439445_0076000_235_837 | 180 |
| 27 | 3300046471 | Ga0495650_0021446 | Ga0495650_0021446_1559_2161 | 180 |
| 28 | 3300046491 | Ga0495584_0021982 | Ga0495584_0021982_2278_2880 | 180 |
| 29 | 3300046492 | Ga0495585_0013800 | Ga0495585_0013800_2308_2910 | 180 |
| 30 | 3300046512 | Ga0495610_0011764 | Ga0495610_0011764_326_928 | 180 |
| 31 | 3300046515 | Ga0495620_0015281 | Ga0495620_0015281_2126_2728 | 180 |
| 32 | 3300046518 | Ga0495631_0026344 | Ga0495631_0026344_438_1040 | 180 |
| 33 | 3300046519 | Ga0495632_0019213 | Ga0495632_0019213_1442_2044 | 180 |
| 34 | 3300046522 | Ga0495643_0018809 | Ga0495643_0018809_1898_2500 | 180 |
| 35 | 3300046524 | Ga0495648_0013709 | Ga0495648_0013709_2290_2892 | 180 |
| 36 | 3300046557 | Ga0495622_0058718 | Ga0495622_0058718_559_1161 | 180 |
| 37 | 3300046616 | Ga0495668_0021331 | Ga0495668_0021331_3017_3619 | 180 |
| 38 | 3300046648 | Ga0495611_0080006 | Ga0495611_0080006_300_902 | 180 |
| 39 | 3300046665 | Ga0495661_0008049 | Ga0495661_0008049_1708_2310 | 180 |
| 40 | 3300046691 | Ga0495670_0039605 | Ga0495670_0039605_1704_2306 | 180 |
| 41 | 3300046691 | Ga0495670_0046353 | Ga0495670_0046353_416_1018 | 180 |
| 42 | 3300046694 | Ga0495649_0006659 | Ga0495649_0006659_775_1377 | 180 |
| 43 | 3300046810 | Ga0495660_0080856 | Ga0495660_0080856_972_1574 | 180 |
| 44 | 3300047323 | Ga0495683_0004657 | Ga0495683_0004657_2139_2741 | 180 |
| 45 | 3300047469 | Ga0495673_0004383 | Ga0495673_0004383_2157_2759 | 180 |
| 46 | 3300047469 | Ga0495673_0005855 | Ga0495673_0005855_5043_5645 | 180 |
| 47 | 3300047472 | Ga0495686_0036720 | Ga0495686_0036720_2277_2879 | 180 |
| 48 | 3300048910 | Ga0496107_0189985 | Ga0496107_0189985_717_1319 | 180 |
| 49 | 3300048922 | Ga0496119_0014507 | Ga0496119_0014507_518_1120 | 180 |
| 50 | 3300053154 | Ga0500619_094029 | Ga0500619_094029_389_991 | 180 |
| 51 | 3300053160 | Ga0500633_0000338 | Ga0500633_0000338_1570_2172 | 180 |
| 52 | 3300053730 | Ga0500645_004128 | Ga0500645_004128_3498_4100 | 180 |
| 53 | 3300026067 | Ga0207678_10085559 | Ga0207678_100855594 | 183 |
| 54 | 3300025254 | Ga0209148_1002653 | Ga0209148_10026536 | 185 |
| 55 | 3300005344 | Ga0070661_100028282 | Ga0070661_1000282823 | 186 |
| 56 | 3300005455 | Ga0070663_100036003 | Ga0070663_1000360034 | 186 |
| 57 | 3300009101 | Ga0105247_10001324 | Ga0105247_100013244 | 186 |
| 58 | 3300013306 | Ga0163162_10281252 | Ga0163162_102812523 | 186 |
| 59 | 3300017792 | Ga0163161_10075142 | Ga0163161_100751423 | 186 |
| 60 | 3300026067 | Ga0207678_10049696 | Ga0207678_100496964 | 186 |
| 61 | 3300009177 | Ga0105248_10578454 | Ga0105248_105784541 | 187 |
| 62 | 3300003214 | JGI25165J46597_1010873 | JGI25165J46597_10108733 | 188 |
| 63 | 3300005548 | Ga0070665_100004322 | Ga0070665_10000432227 | 188 |
| 64 | 3300009551 | Ga0105238_10039356 | Ga0105238_100393564 | 188 |
| 65 | 3300013306 | Ga0163162_10001854 | Ga0163162_100018544 | 188 |
| 66 | 3300025924 | Ga0207694_10016063 | Ga0207694_100160634 | 188 |
| 67 | 3300028379 | Ga0268266_10000021 | Ga0268266_100000214 | 188 |
| 68 | 3300044842 | Ga0466957_0003550 | Ga0466957_0003550_8011_8577 | 188 |
| 69 | 3300048929 | Ga0496126_0006212 | Ga0496126_0006212_11440_12042 | 188 |
| 70 | 3300003771 | Ga0055526_1005867 | Ga0055526_10058673 | 189 |
| 71 | 3300003773 | Ga0055537_1000851 | Ga0055537_10008514 | 189 |
| 72 | 3300003775 | Ga0055524_1013601 | Ga0055524_10136014 | 189 |
| 73 | 3300003781 | Ga0055536_1014260 | Ga0055536_10142603 | 189 |
| 74 | 3300003781 | Ga0055536_1024910 | Ga0055536_10249102 | 189 |
| 75 | 3300003784 | Ga0055534_1000766 | Ga0055534_10007663 | 189 |
| 76 | 3300003790 | Ga0055528_1001961 | Ga0055528_10019614 | 189 |
| 77 | 3300003791 | Ga0055530_10025415 | Ga0055530_100254152 | 189 |
| 78 | 3300003791 | Ga0055530_10067608 | Ga0055530_100676081 | 189 |
| 79 | 3300003794 | Ga0055531_10026369 | Ga0055531_100263692 | 189 |
| 80 | 3300003856 | Ga0058692_1000785 | Ga0058692_10007853 | 189 |
| 81 | 3300005288 | Ga0065714_10109302 | Ga0065714_101093023 | 189 |
| 82 | 3300005347 | Ga0070668_100303029 | Ga0070668_1003030293 | 189 |
| 83 | 3300005355 | Ga0070671_100012931 | Ga0070671_10001293112 | 189 |
| 84 | 3300005367 | Ga0070667_100797580 | Ga0070667_1007975801 | 189 |
| 85 | 3300005437 | Ga0070710_10793862 | Ga0070710_107938621 | 189 |
| 86 | 3300005548 | Ga0070665_100177902 | Ga0070665_1001779024 | 189 |
| 87 | 3300005985 | Ga0081539_10024522 | Ga0081539_100245224 | 189 |
| 88 | 3300006048 | Ga0075363_100202638 | Ga0075363_1002026382 | 189 |
| 89 | 3300006237 | Ga0097621_100195694 | Ga0097621_1001956942 | 189 |
| 90 | 3300009011 | Ga0105251_10003747 | Ga0105251_1000374722 | 189 |
| 91 | 3300009036 | Ga0105244_10014959 | Ga0105244_100149596 | 189 |
| 92 | 3300009036 | Ga0105244_10048884 | Ga0105244_100488843 | 189 |
| 93 | 3300009148 | Ga0105243_10036695 | Ga0105243_100366955 | 189 |
| 94 | 3300025263 | Ga0209565_1000415 | Ga0209565_100041543 | 189 |
| 95 | 3300025273 | Ga0209673_1000204 | Ga0209673_100020417 | 189 |
| 96 | 3300025284 | Ga0209130_1003085 | Ga0209130_100308513 | 189 |
| 97 | 3300025291 | Ga0209675_1000015 | Ga0209675_100001558 | 189 |
| 98 | 3300025292 | Ga0209676_1000110 | Ga0209676_10001104 | 189 |
| 99 | 3300025292 | Ga0209676_1004379 | Ga0209676_100437917 | 189 |
| 100 | 3300025292 | Ga0209676_1006351 | Ga0209676_100635111 | 189 |
| 101 | 3300025295 | Ga0209564_1000037 | Ga0209564_1000037310 | 189 |
| 102 | 3300025298 | Ga0209050_1053325 | Ga0209050_10533252 | 189 |
| 103 | 3300025299 | Ga0209256_1007814 | Ga0209256_10078143 | 189 |
| 104 | 3300025303 | Ga0209051_1001513 | Ga0209051_100151329 | 189 |
| 105 | 3300025304 | Ga0209257_1000129 | Ga0209257_10001294 | 189 |
| 106 | 3300025304 | Ga0209257_1006637 | Ga0209257_10066373 | 189 |
| 107 | 3300025728 | Ga0207655_1022400 | Ga0207655_10224003 | 189 |
| 108 | 3300025728 | Ga0207655_1039647 | Ga0207655_10396473 | 189 |
| 109 | 3300025735 | Ga0207713_1004451 | Ga0207713_100445117 | 189 |
| 110 | 3300025893 | Ga0207682_10033068 | Ga0207682_100330683 | 189 |
| 111 | 3300025931 | Ga0207644_10011422 | Ga0207644_100114224 | 189 |
| 112 | 3300025935 | Ga0207709_10000421 | Ga0207709_1000042123 | 189 |
| 113 | 3300025972 | Ga0207668_11155648 | Ga0207668_111556481 | 189 |
| 114 | 3300025986 | Ga0207658_10148113 | Ga0207658_101481133 | 189 |
| 115 | 3300027312 | Ga0209371_1000004 | Ga0209371_10000041043 | 189 |
| 116 | 3300028379 | Ga0268266_10030836 | Ga0268266_100308366 | 189 |
| 117 | 3300028379 | Ga0268266_10170446 | Ga0268266_101704464 | 189 |
| 118 | 3300030500 | Ga0268256_1000005 | Ga0268256_10000054 | 189 |
| 119 | 3300030731 | Ga0316177_1042582 | Ga0316177_10425823 | 189 |
| 120 | 3300030732 | Ga0316176_1015742 | Ga0316176_10157424 | 189 |
| 121 | 3300030742 | Ga0316183_1139965 | Ga0316183_11399652 | 189 |
| 122 | 3300030745 | Ga0316182_1183376 | Ga0316182_11833763 | 189 |
| 123 | 3300031824 | Ga0307413_10081955 | Ga0307413_100819551 | 189 |
| 124 | 3300031995 | Ga0307409_101638881 | Ga0307409_1016388811 | 189 |
| 125 | 3300032004 | Ga0307414_10007179 | Ga0307414_100071794 | 189 |
| 126 | 3300032004 | Ga0307414_10063463 | Ga0307414_100634632 | 189 |
| 127 | 3300032004 | Ga0307414_10187955 | Ga0307414_101879553 | 189 |
| 128 | 3300032004 | Ga0307414_10913289 | Ga0307414_109132892 | 189 |
| 129 | 3300032004 | Ga0307414_11303549 | Ga0307414_113035491 | 189 |
| 130 | 3300032004 | Ga0307414_11306492 | Ga0307414_113064921 | 189 |
| 131 | 3300037312 | Ga0395899_0091130 | Ga0395899_0091130_311_919 | 189 |
| 132 | 3300037312 | Ga0395899_0562413 | Ga0395899_0562413_112_720 | 189 |
| 133 | 3300037418 | Ga0395900_0241648 | Ga0395900_0241648_244_852 | 189 |
| 134 | 3300037466 | Ga0395898_0587291 | Ga0395898_0587291_183_791 | 189 |
| 135 | 3300037471 | Ga0395905_0110752 | Ga0395905_0110752_819_1427 | 189 |
| 136 | 3300038443 | Ga0395901_0143647 | Ga0395901_0143647_1771_2379 | 189 |
| 137 | 3300038705 | Ga0237819_05137 | Ga0237819_05137_781_1392 | 189 |
| 138 | 3300041452 | Ga0451793_1506933 | Ga0451793_1506933_109_711 | 189 |
| 139 | 3300041455 | Ga0451801_19993 | Ga0451801_19993_1143_1754 | 189 |
| 140 | 3300041458 | Ga0451798_0875692 | Ga0451798_0875692_335_946 | 189 |
| 141 | 3300041459 | Ga0451800_1057945 | Ga0451800_1057945_1572_2183 | 189 |
| 142 | 3300041462 | Ga0451806_234332 | Ga0451806_234332_17563_18174 | 189 |
| 143 | 3300041486 | Ga0451807_1035554 | Ga0451807_1035554_1336_1947 | 189 |
| 144 | 3300041494 | Ga0451837_0822369 | Ga0451837_0822369_720_1331 | 189 |
| 145 | 3300042007 | Ga0439449_0059877 | Ga0439449_0059877_259_879 | 189 |
| 146 | 3300046501 | Ga0495607_0154297 | Ga0495607_0154297_461_1069 | 189 |
| 147 | 3300046507 | Ga0495606_0035985 | Ga0495606_0035985_1994_2602 | 189 |
| 148 | 3300046660 | Ga0495625_0139135 | Ga0495625_0139135_215_817 | 189 |
| 149 | 3300047470 | Ga0495681_0080605 | Ga0495681_0080605_229_834 | 189 |
| 150 | 3300047470 | Ga0495681_0124862 | Ga0495681_0124862_411_1016 | 189 |
| 151 | 3300048911 | Ga0496108_0100619 | Ga0496108_0100619_1290_1892 | 189 |
| 152 | 3300048912 | Ga0496109_0062064 | Ga0496109_0062064_783_1391 | 189 |
| 153 | 3300048915 | Ga0496112_0025726 | Ga0496112_0025726_3498_4106 | 189 |
| 154 | 3300048916 | Ga0496113_0067298 | Ga0496113_0067298_1547_2155 | 189 |
| 155 | 3300048918 | Ga0496115_0367309 | Ga0496115_0367309_381_989 | 189 |
| 156 | 3300049571 | Ga0501034_0021966 | Ga0501034_0021966_1526_2131 | 189 |
| 157 | 3300049823 | Ga0501044_0446143 | Ga0501044_0446143_461_1063 | 189 |
| 158 | 3300053090 | Ga0500646_0022488 | Ga0500646_0022488_678_1280 | 189 |
| 159 | 3300002773 | JGI25152J39213_1000284 | JGI25152J39213_100028441 | 190 |
| 160 | 3300002774 | JGI25150J39212_1000359 | JGI25150J39212_10003593 | 190 |
| 161 | 3300003187 | JGI25151J46595_10000895 | JGI25151J46595_1000089533 | 190 |
| 162 | 3300003187 | JGI25151J46595_10007643 | JGI25151J46595_100076435 | 190 |
| 163 | 3300003187 | JGI25151J46595_10013580 | JGI25151J46595_100135803 | 190 |
| 164 | 3300003215 | JGI25153J46596_10000050 | JGI25153J46596_10000050154 | 190 |
| 165 | 3300003371 | JGI26145J50221_1000107 | JGI26145J50221_10001073 | 190 |
| 166 | 3300003382 | JGI26139J50223_100733 | JGI26139J50223_1007332 | 190 |
| 167 | 3300003771 | Ga0055526_1008536 | Ga0055526_10085363 | 190 |
| 168 | 3300003771 | Ga0055526_1008987 | Ga0055526_10089873 | 190 |
| 169 | 3300003773 | Ga0055537_1001096 | Ga0055537_10010963 | 190 |
| 170 | 3300003775 | Ga0055524_1013602 | Ga0055524_10136023 | 190 |
| 171 | 3300003775 | Ga0055524_1015666 | Ga0055524_10156663 | 190 |
| 172 | 3300003784 | Ga0055534_1003331 | Ga0055534_10033317 | 190 |
| 173 | 3300003784 | Ga0055534_1006907 | Ga0055534_10069073 | 190 |
| 174 | 3300003790 | Ga0055528_1013611 | Ga0055528_10136113 | 190 |
| 175 | 3300003790 | Ga0055528_1016393 | Ga0055528_10163933 | 190 |
| 176 | 3300003791 | Ga0055530_10004966 | Ga0055530_100049665 | 190 |
| 177 | 3300003794 | Ga0055531_10014020 | Ga0055531_100140204 | 190 |
| 178 | 3300003794 | Ga0055531_10017875 | Ga0055531_100178753 | 190 |
| 179 | 3300003856 | Ga0058692_1000748 | Ga0058692_10007483 | 190 |
| 180 | 3300005289 | Ga0065704_10071563 | Ga0065704_1007156314 | 190 |
| 181 | 3300005327 | Ga0070658_10987122 | Ga0070658_109871221 | 190 |
| 182 | 3300005329 | Ga0070683_100194209 | Ga0070683_1001942092 | 190 |
| 183 | 3300005331 | Ga0070670_100015496 | Ga0070670_1000154966 | 190 |
| 184 | 3300005331 | Ga0070670_100143059 | Ga0070670_1001430592 | 190 |
| 185 | 3300005331 | Ga0070670_100360366 | Ga0070670_1003603662 | 190 |
| 186 | 3300005334 | Ga0068869_100843709 | Ga0068869_1008437091 | 190 |
| 187 | 3300005336 | Ga0070680_100255720 | Ga0070680_1002557203 | 190 |
| 188 | 3300005339 | Ga0070660_100058257 | Ga0070660_1000582572 | 190 |
| 189 | 3300005347 | Ga0070668_100034720 | Ga0070668_1000347204 | 190 |
| 190 | 3300005347 | Ga0070668_100061248 | Ga0070668_1000612483 | 190 |
| 191 | 3300005353 | Ga0070669_100222301 | Ga0070669_1002223011 | 190 |
| 192 | 3300005354 | Ga0070675_100105895 | Ga0070675_1001058952 | 190 |
| 193 | 3300005354 | Ga0070675_100213624 | Ga0070675_1002136242 | 190 |
| 194 | 3300005355 | Ga0070671_100051737 | Ga0070671_1000517374 | 190 |
| 195 | 3300005355 | Ga0070671_100202548 | Ga0070671_1002025483 | 190 |
| 196 | 3300005355 | Ga0070671_100724727 | Ga0070671_1007247272 | 190 |
| 197 | 3300005364 | Ga0070673_100209228 | Ga0070673_1002092282 | 190 |
| 198 | 3300005366 | Ga0070659_100231145 | Ga0070659_1002311453 | 190 |
| 199 | 3300005435 | Ga0070714_100793077 | Ga0070714_1007930771 | 190 |
| 200 | 3300005438 | Ga0070701_10282652 | Ga0070701_102826522 | 190 |
| 201 | 3300005441 | Ga0070700_100877305 | Ga0070700_1008773051 | 190 |
| 202 | 3300005456 | Ga0070678_100729891 | Ga0070678_1007298911 | 190 |
| 203 | 3300005457 | Ga0070662_100282610 | Ga0070662_1002826103 | 190 |
| 204 | 3300005458 | Ga0070681_10205910 | Ga0070681_102059102 | 190 |
| 205 | 3300005530 | Ga0070679_100385818 | Ga0070679_1003858183 | 190 |
| 206 | 3300005530 | Ga0070679_100466934 | Ga0070679_1004669341 | 190 |
| 207 | 3300005539 | Ga0068853_100449667 | Ga0068853_1004496672 | 190 |
| 208 | 3300005546 | Ga0070696_100760455 | Ga0070696_1007604551 | 190 |
| 209 | 3300005548 | Ga0070665_100152522 | Ga0070665_1001525223 | 190 |
| 210 | 3300005618 | Ga0068864_100069812 | Ga0068864_1000698122 | 190 |
| 211 | 3300005841 | Ga0068863_100162700 | Ga0068863_1001627003 | 190 |
| 212 | 3300005844 | Ga0068862_100477495 | Ga0068862_1004774952 | 190 |
| 213 | 3300009011 | Ga0105251_10018245 | Ga0105251_100182454 | 190 |
| 214 | 3300009148 | Ga0105243_10063811 | Ga0105243_100638115 | 190 |
| 215 | 3300009979 | Ga0105032_100517 | Ga0105032_1005173 | 190 |
| 216 | 3300012510 | Ga0157316_1004643 | Ga0157316_10046432 | 190 |
| 217 | 3300012512 | Ga0157327_1000560 | Ga0157327_10005602 | 190 |
| 218 | 3300012513 | Ga0157326_1006833 | Ga0157326_10068332 | 190 |
| 219 | 3300013100 | Ga0157373_10142986 | Ga0157373_101429862 | 190 |
| 220 | 3300013102 | Ga0157371_10083622 | Ga0157371_100836222 | 190 |
| 221 | 3300013102 | Ga0157371_10707468 | Ga0157371_107074682 | 190 |
| 222 | 3300013105 | Ga0157369_10312189 | Ga0157369_103121892 | 190 |
| 223 | 3300013297 | Ga0157378_11019923 | Ga0157378_110199232 | 190 |
| 224 | 3300013307 | Ga0157372_10616942 | Ga0157372_106169422 | 190 |
| 225 | 3300013307 | Ga0157372_10903033 | Ga0157372_109030332 | 190 |
| 226 | 3300013308 | Ga0157375_10377773 | Ga0157375_103777732 | 190 |
| 227 | 3300014326 | Ga0157380_10515134 | Ga0157380_105151342 | 190 |
| 228 | 3300015265 | Ga0182005_1045440 | Ga0182005_10454402 | 190 |
| 229 | 3300015689 | Ga0183360_10001 | Ga0183360_100012727 | 190 |
| 230 | 3300017792 | Ga0163161_10348494 | Ga0163161_103484942 | 190 |
| 231 | 3300020075 | Ga0206349_1852705 | Ga0206349_18527053 | 190 |
| 232 | 3300025245 | Ga0207425_1000117 | Ga0207425_100011741 | 190 |
| 233 | 3300025245 | Ga0207425_1005550 | Ga0207425_10055504 | 190 |
| 234 | 3300025258 | Ga0209129_1000011 | Ga0209129_1000011340 | 190 |
| 235 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011146 | 190 |
| 236 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011146 | 190 |
| 237 | 3300025273 | Ga0209673_1002116 | Ga0209673_100211624 | 190 |
| 238 | 3300025284 | Ga0209130_1007816 | Ga0209130_10078166 | 190 |
| 239 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011387 | 190 |
| 240 | 3300025291 | Ga0209675_1006904 | Ga0209675_10069046 | 190 |
| 241 | 3300025292 | Ga0209676_1001608 | Ga0209676_100160830 | 190 |
| 242 | 3300025292 | Ga0209676_1004892 | Ga0209676_10048923 | 190 |
| 243 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002458 | 190 |
| 244 | 3300025294 | Ga0209025_1000006 | Ga0209025_100000622 | 190 |
| 245 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011549 | 190 |
| 246 | 3300025295 | Ga0209564_1007141 | Ga0209564_100714110 | 190 |
| 247 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003465 | 190 |
| 248 | 3300025297 | Ga0209758_1083243 | Ga0209758_10832432 | 190 |
| 249 | 3300025298 | Ga0209050_1001128 | Ga0209050_100112839 | 190 |
| 250 | 3300025299 | Ga0209256_1000002 | Ga0209256_10000024 | 190 |
| 251 | 3300025299 | Ga0209256_1003821 | Ga0209256_10038214 | 190 |
| 252 | 3300025302 | Ga0207426_1068355 | Ga0207426_10683552 | 190 |
| 253 | 3300025303 | Ga0209051_1028616 | Ga0209051_10286162 | 190 |
| 254 | 3300025304 | Ga0209257_1002665 | Ga0209257_100266527 | 190 |
| 255 | 3300025304 | Ga0209257_1006382 | Ga0209257_100638216 | 190 |
| 256 | 3300025315 | Ga0207697_10049742 | Ga0207697_100497422 | 190 |
| 257 | 3300025321 | Ga0207656_10367844 | Ga0207656_103678441 | 190 |
| 258 | 3300025735 | Ga0207713_1000294 | Ga0207713_100029437 | 190 |
| 259 | 3300025907 | Ga0207645_10107422 | Ga0207645_101074223 | 190 |
| 260 | 3300025908 | Ga0207643_10160910 | Ga0207643_101609103 | 190 |
| 261 | 3300025909 | Ga0207705_10060885 | Ga0207705_100608853 | 190 |
| 262 | 3300025912 | Ga0207707_10277754 | Ga0207707_102777542 | 190 |
| 263 | 3300025919 | Ga0207657_10006384 | Ga0207657_100063844 | 190 |
| 264 | 3300025921 | Ga0207652_10097888 | Ga0207652_100978883 | 190 |
| 265 | 3300025923 | Ga0207681_10248036 | Ga0207681_102480362 | 190 |
| 266 | 3300025925 | Ga0207650_10004000 | Ga0207650_100040004 | 190 |
| 267 | 3300025925 | Ga0207650_10023595 | Ga0207650_100235953 | 190 |
| 268 | 3300025926 | Ga0207659_10242293 | Ga0207659_102422932 | 190 |
| 269 | 3300025929 | Ga0207664_10775667 | Ga0207664_107756672 | 190 |
| 270 | 3300025931 | Ga0207644_10004894 | Ga0207644_100048944 | 190 |
| 271 | 3300025935 | Ga0207709_10044385 | Ga0207709_100443852 | 190 |
| 272 | 3300025941 | Ga0207711_10073580 | Ga0207711_100735805 | 190 |
| 273 | 3300025942 | Ga0207689_10856643 | Ga0207689_108566432 | 190 |
| 274 | 3300025944 | Ga0207661_10169487 | Ga0207661_101694871 | 190 |
| 275 | 3300025949 | Ga0207667_10419728 | Ga0207667_104197282 | 190 |
| 276 | 3300025972 | Ga0207668_10008750 | Ga0207668_100087506 | 190 |
| 277 | 3300025972 | Ga0207668_10013075 | Ga0207668_100130756 | 190 |
| 278 | 3300025981 | Ga0207640_10532998 | Ga0207640_105329982 | 190 |
| 279 | 3300026023 | Ga0207677_10446954 | Ga0207677_104469542 | 190 |
| 280 | 3300026041 | Ga0207639_11079581 | Ga0207639_110795812 | 190 |
| 281 | 3300026088 | Ga0207641_10104276 | Ga0207641_101042763 | 190 |
| 282 | 3300026089 | Ga0207648_10084850 | Ga0207648_100848504 | 190 |
| 283 | 3300026095 | Ga0207676_10059226 | Ga0207676_100592265 | 190 |
| 284 | 3300026118 | Ga0207675_100428514 | Ga0207675_1004285142 | 190 |
| 285 | 3300026142 | Ga0207698_10450120 | Ga0207698_104501203 | 190 |
| 286 | 3300027252 | Ga0209973_1001982 | Ga0209973_10019821 | 190 |
| 287 | 3300027312 | Ga0209371_1000294 | Ga0209371_100029464 | 190 |
| 288 | 3300027360 | Ga0209969_1000918 | Ga0209969_10009185 | 190 |
| 289 | 3300027364 | Ga0209967_1002362 | Ga0209967_10023625 | 190 |
| 290 | 3300027364 | Ga0209967_1009133 | Ga0209967_10091332 | 190 |
| 291 | 3300027424 | Ga0209984_1000306 | Ga0209984_10003066 | 190 |
| 292 | 3300027462 | Ga0210000_1004942 | Ga0210000_10049423 | 190 |
| 293 | 3300027471 | Ga0209995_1000770 | Ga0209995_10007707 | 190 |
| 294 | 3300027543 | Ga0209999_1002797 | Ga0209999_10027972 | 190 |
| 295 | 3300027543 | Ga0209999_1020896 | Ga0209999_10208962 | 190 |
| 296 | 3300027552 | Ga0209982_1000032 | Ga0209982_10000326 | 190 |
| 297 | 3300027552 | Ga0209982_1051017 | Ga0209982_10510171 | 190 |
| 298 | 3300027614 | Ga0209970_1038066 | Ga0209970_10380661 | 190 |
| 299 | 3300027665 | Ga0209983_1000295 | Ga0209983_100029520 | 190 |
| 300 | 3300027682 | Ga0209971_1000410 | Ga0209971_100041021 | 190 |
| 301 | 3300027876 | Ga0209974_10010367 | Ga0209974_100103673 | 190 |
| 302 | 3300027876 | Ga0209974_10074748 | Ga0209974_100747482 | 190 |
| 303 | 3300028379 | Ga0268266_10168036 | Ga0268266_101680363 | 190 |
| 304 | 3300028380 | Ga0268265_10162232 | Ga0268265_101622323 | 190 |
| 305 | 3300030500 | Ga0268256_1000258 | Ga0268256_10002584 | 190 |
| 306 | 3300030732 | Ga0316176_1213588 | Ga0316176_12135882 | 190 |
| 307 | 3300030744 | Ga0316181_1164435 | Ga0316181_11644352 | 190 |
| 308 | 3300031456 | Ga0307513_10521493 | Ga0307513_105214932 | 190 |
| 309 | 3300031548 | Ga0307408_100181171 | Ga0307408_1001811712 | 190 |
| 310 | 3300031548 | Ga0307408_101204677 | Ga0307408_1012046771 | 190 |
| 311 | 3300031731 | Ga0307405_10142144 | Ga0307405_101421443 | 190 |
| 312 | 3300031824 | Ga0307413_10037133 | Ga0307413_100371333 | 190 |
| 313 | 3300031824 | Ga0307413_10047867 | Ga0307413_100478673 | 190 |
| 314 | 3300031824 | Ga0307413_10279926 | Ga0307413_102799262 | 190 |
| 315 | 3300031824 | Ga0307413_10280806 | Ga0307413_102808062 | 190 |
| 316 | 3300031852 | Ga0307410_10028499 | Ga0307410_100284992 | 190 |
| 317 | 3300031901 | Ga0307406_10068752 | Ga0307406_100687522 | 190 |
| 318 | 3300031903 | Ga0307407_10034741 | Ga0307407_100347413 | 190 |
| 319 | 3300031903 | Ga0307407_10089439 | Ga0307407_100894392 | 190 |
| 320 | 3300031911 | Ga0307412_10042944 | Ga0307412_100429445 | 190 |
| 321 | 3300031995 | Ga0307409_100024348 | Ga0307409_1000243486 | 190 |
| 322 | 3300032002 | Ga0307416_100404694 | Ga0307416_1004046943 | 190 |
| 323 | 3300032004 | Ga0307414_10002120 | Ga0307414_1000212020 | 190 |
| 324 | 3300032004 | Ga0307414_10020644 | Ga0307414_100206446 | 190 |
| 325 | 3300032004 | Ga0307414_10046872 | Ga0307414_100468723 | 190 |
| 326 | 3300032004 | Ga0307414_10178231 | Ga0307414_101782313 | 190 |
| 327 | 3300032004 | Ga0307414_10258340 | Ga0307414_102583403 | 190 |
| 328 | 3300032004 | Ga0307414_10305106 | Ga0307414_103051063 | 190 |
| 329 | 3300032005 | Ga0307411_10015295 | Ga0307411_1001529510 | 190 |
| 330 | 3300032005 | Ga0307411_10390319 | Ga0307411_103903192 | 190 |
| 331 | 3300032005 | Ga0307411_10953077 | Ga0307411_109530772 | 190 |
| 332 | 3300032126 | Ga0307415_100292343 | Ga0307415_1002923433 | 190 |
| 333 | 3300034816 | Ga0373930_0069596 | Ga0373930_0069596_110_715 | 190 |
| 334 | 3300037418 | Ga0395900_0036642 | Ga0395900_0036642_4110_4715 | 190 |
| 335 | 3300037418 | Ga0395900_0765478 | Ga0395900_0765478_183_788 | 190 |
| 336 | 3300037466 | Ga0395898_0180698 | Ga0395898_0180698_129_734 | 190 |
| 337 | 3300037471 | Ga0395905_0293167 | Ga0395905_0293167_745_1350 | 190 |
| 338 | 3300037471 | Ga0395905_0298452 | Ga0395905_0298452_723_1328 | 190 |
| 339 | 3300038705 | Ga0237819_00026 | Ga0237819_00026_48152_48763 | 190 |
| 340 | 3300041404 | Ga0439436_0020558 | Ga0439436_0020558_412_1020 | 190 |
| 341 | 3300041404 | Ga0439436_0044395 | Ga0439436_0044395_71_676 | 190 |
| 342 | 3300041404 | Ga0439436_0110206 | Ga0439436_0110206_69_674 | 190 |
| 343 | 3300041406 | Ga0439439_0004561 | Ga0439439_0004561_793_1398 | 190 |
| 344 | 3300041407 | Ga0439447_013961 | Ga0439447_013961_1079_1690 | 190 |
| 345 | 3300041413 | Ga0439465_0005524 | Ga0439465_0005524_2645_3253 | 190 |
| 346 | 3300041444 | Ga0451790_10956 | Ga0451790_10956_183_794 | 190 |
| 347 | 3300041452 | Ga0451793_0190021 | Ga0451793_0190021_130_738 | 190 |
| 348 | 3300041456 | Ga0451795_0694995 | Ga0451795_0694995_302_910 | 190 |
| 349 | 3300041461 | Ga0451805_049393 | Ga0451805_049393_443_1051 | 190 |
| 350 | 3300041463 | Ga0451804_0524950 | Ga0451804_0524950_223_831 | 190 |
| 351 | 3300041509 | Ga0451843_0242471 | Ga0451843_0242471_164_775 | 190 |
| 352 | 3300041509 | Ga0451843_0922492 | Ga0451843_0922492_133_744 | 190 |
| 353 | 3300041997 | Ga0439431_0008628 | Ga0439431_0008628_1327_1935 | 190 |
| 354 | 3300042004 | Ga0439445_0011454 | Ga0439445_0011454_1432_2037 | 190 |
| 355 | 3300042007 | Ga0439449_0011871 | Ga0439449_0011871_1714_2319 | 190 |
| 356 | 3300042007 | Ga0439449_0039601 | Ga0439449_0039601_739_1347 | 190 |
| 357 | 3300042007 | Ga0439449_0050566 | Ga0439449_0050566_63_671 | 190 |
| 358 | 3300042007 | Ga0439449_0052843 | Ga0439449_0052843_557_1168 | 190 |
| 359 | 3300042010 | Ga0439452_041628 | Ga0439452_041628_377_985 | 190 |
| 360 | 3300042128 | Ga0450897_006886 | Ga0450897_006886_309_920 | 190 |
| 361 | 3300042156 | Ga0439446_0036071 | Ga0439446_0036071_278_886 | 190 |
| 362 | 3300042435 | Ga0439434_0194142 | Ga0439434_0194142_35_640 | 190 |
| 363 | 3300042993 | Ga0439440_0015463 | Ga0439440_0015463_249_857 | 190 |
| 364 | 3300046525 | Ga0495663_0004473 | Ga0495663_0004473_753_1361 | 190 |
| 365 | 3300046525 | Ga0495663_0102121 | Ga0495663_0102121_214_819 | 190 |
| 366 | 3300046539 | Ga0495621_0001470 | Ga0495621_0001470_4076_4681 | 190 |
| 367 | 3300046615 | Ga0495656_0006174 | Ga0495656_0006174_3521_4129 | 190 |
| 368 | 3300046615 | Ga0495656_0140966 | Ga0495656_0140966_418_1023 | 190 |
| 369 | 3300046616 | Ga0495668_0033171 | Ga0495668_0033171_1770_2375 | 190 |
| 370 | 3300046691 | Ga0495670_0101413 | Ga0495670_0101413_449_1060 | 190 |
| 371 | 3300047318 | Ga0495636_0052343 | Ga0495636_0052343_733_1344 | 190 |
| 372 | 3300047445 | Ga0495677_0149460 | Ga0495677_0149460_147_752 | 190 |
| 373 | 3300048903 | Ga0496100_0732691 | Ga0496100_0732691_37_645 | 190 |
| 374 | 3300048904 | Ga0496101_0090873 | Ga0496101_0090873_1634_2239 | 190 |
| 375 | 3300048905 | Ga0496102_0109999 | Ga0496102_0109999_1439_2044 | 190 |
| 376 | 3300048906 | Ga0496103_0145760 | Ga0496103_0145760_493_1098 | 190 |
| 377 | 3300048909 | Ga0496106_0003988 | Ga0496106_0003988_1399_2004 | 190 |
| 378 | 3300048910 | Ga0496107_0011190 | Ga0496107_0011190_4274_4879 | 190 |
| 379 | 3300048911 | Ga0496108_0001932 | Ga0496108_0001932_1511_2116 | 190 |
| 380 | 3300048912 | Ga0496109_0085316 | Ga0496109_0085316_1493_2098 | 190 |
| 381 | 3300048913 | Ga0496110_0011371 | Ga0496110_0011371_5128_5733 | 190 |
| 382 | 3300048914 | Ga0496111_0003793 | Ga0496111_0003793_1384_1989 | 190 |
| 383 | 3300048915 | Ga0496112_0240221 | Ga0496112_0240221_756_1361 | 190 |
| 384 | 3300048917 | Ga0496114_0025860 | Ga0496114_0025860_323_928 | 190 |
| 385 | 3300048920 | Ga0496117_0028524 | Ga0496117_0028524_2119_2730 | 190 |
| 386 | 3300048921 | Ga0496118_0099530 | Ga0496118_0099530_1286_1897 | 190 |
| 387 | 3300048922 | Ga0496119_0267452 | Ga0496119_0267452_207_818 | 190 |
| 388 | 3300048923 | Ga0496120_0024106 | Ga0496120_0024106_1592_2203 | 190 |
| 389 | 3300048924 | Ga0496121_0005001 | Ga0496121_0005001_15316_15927 | 190 |
| 390 | 3300048925 | Ga0496122_0079528 | Ga0496122_0079528_212_820 | 190 |
| 391 | 3300048925 | Ga0496122_0097842 | Ga0496122_0097842_892_1500 | 190 |
| 392 | 3300048926 | Ga0496123_0022702 | Ga0496123_0022702_632_1240 | 190 |
| 393 | 3300048926 | Ga0496123_0031047 | Ga0496123_0031047_1601_2212 | 190 |
| 394 | 3300048926 | Ga0496123_0146817 | Ga0496123_0146817_488_1096 | 190 |
| 395 | 3300048927 | Ga0496124_0000018 | Ga0496124_0000018_440814_441422 | 190 |
| 396 | 3300048927 | Ga0496124_0107957 | Ga0496124_0107957_1461_2069 | 190 |
| 397 | 3300049128 | Ga0501308_000035 | Ga0501308_000035_1663_2271 | 190 |
| 398 | 3300049129 | Ga0501309_003449 | Ga0501309_003449_224_829 | 190 |
| 399 | 3300049130 | Ga0501310_000986 | Ga0501310_000986_921_1526 | 190 |
| 400 | 3300049162 | Ga0501307_000579 | Ga0501307_000579_238_846 | 190 |
| 401 | 3300049162 | Ga0501307_006548 | Ga0501307_006548_132_737 | 190 |
| 402 | 3300049527 | Ga0501311_003051 | Ga0501311_003051_624_1229 | 190 |
| 403 | 3300049528 | Ga0501312_002244 | Ga0501312_002244_116_724 | 190 |
| 404 | 3300049528 | Ga0501312_002447 | Ga0501312_002447_1010_1615 | 190 |
| 405 | 3300049528 | Ga0501312_007104 | Ga0501312_007104_169_774 | 190 |
| 406 | 3300049531 | Ga0501315_004415 | Ga0501315_004415_609_1214 | 190 |
| 407 | 3300049533 | Ga0501317_001762 | Ga0501317_001762_340_945 | 190 |
| 408 | 3300049533 | Ga0501317_006218 | Ga0501317_006218_76_684 | 190 |
| 409 | 3300049534 | Ga0501318_000528 | Ga0501318_000528_921_1526 | 190 |
| 410 | 3300049535 | Ga0501319_000070 | Ga0501319_000070_142_750 | 190 |
| 411 | 3300049537 | Ga0501321_005366 | Ga0501321_005366_104_709 | 190 |
| 412 | 3300049539 | Ga0501323_000068 | Ga0501323_000068_4187_4792 | 190 |
| 413 | 3300049539 | Ga0501323_000101 | Ga0501323_000101_3954_4562 | 190 |
| 414 | 3300049540 | Ga0501324_014225 | Ga0501324_014225_27_635 | 190 |
| 415 | 3300049568 | Ga0501031_0025141 | Ga0501031_0025141_2901_3509 | 190 |
| 416 | 3300049568 | Ga0501031_0101188 | Ga0501031_0101188_1033_1635 | 190 |
| 417 | 3300049570 | Ga0501033_0075593 | Ga0501033_0075593_352_960 | 190 |
| 418 | 3300049570 | Ga0501033_0123272 | Ga0501033_0123272_1168_1770 | 190 |
| 419 | 3300049571 | Ga0501034_0099165 | Ga0501034_0099165_1871_2479 | 190 |
| 420 | 3300049571 | Ga0501034_0120372 | Ga0501034_0120372_995_1603 | 190 |
| 421 | 3300049572 | Ga0501036_0066357 | Ga0501036_0066357_786_1394 | 190 |
| 422 | 3300049574 | Ga0501038_0002396 | Ga0501038_0002396_1622_2230 | 190 |
| 423 | 3300049574 | Ga0501038_0026720 | Ga0501038_0026720_1418_2020 | 190 |
| 424 | 3300049575 | Ga0501039_0013271 | Ga0501039_0013271_3322_3930 | 190 |
| 425 | 3300049579 | Ga0501043_0030616 | Ga0501043_0030616_2134_2745 | 190 |
| 426 | 3300049581 | Ga0501047_0221275 | Ga0501047_0221275_499_1107 | 190 |
| 427 | 3300049586 | Ga0501070_0198353 | Ga0501070_0198353_968_1570 | 190 |
| 428 | 3300049587 | Ga0501071_0037161 | Ga0501071_0037161_237_845 | 190 |
| 429 | 3300049589 | Ga0501073_0068309 | Ga0501073_0068309_830_1432 | 190 |
| 430 | 3300049672 | Ga0501239_002487 | Ga0501239_002487_687_1295 | 190 |
| 431 | 3300049674 | Ga0501242_009218 | Ga0501242_009218_472_1077 | 190 |
| 432 | 3300049677 | Ga0501247_029292 | Ga0501247_029292_64_669 | 190 |
| 433 | 3300049679 | Ga0501249_021629 | Ga0501249_021629_514_1122 | 190 |
| 434 | 3300049682 | Ga0501252_008250 | Ga0501252_008250_76_684 | 190 |
| 435 | 3300049742 | Ga0501080_0018310 | Ga0501080_0018310_4935_5543 | 190 |
| 436 | 3300049822 | Ga0501035_0039431 | Ga0501035_0039431_1148_1756 | 190 |
| 437 | 3300049823 | Ga0501044_0003730 | Ga0501044_0003730_117_725 | 190 |
| 438 | 3300049823 | Ga0501044_0154075 | Ga0501044_0154075_954_1556 | 190 |
| 439 | 3300053161 | Ga0500634_0003199 | Ga0500634_0003199_4963_5574 | 190 |
| 440 | 3300059510 | Ga0587090_008934 | Ga0587090_008934_138_746 | 190 |
| 441 | 3300005331 | Ga0070670_100385915 | Ga0070670_1003859153 | 191 |
| 442 | 3300005539 | Ga0068853_100116876 | Ga0068853_1001168762 | 191 |
| 443 | 3300012477 | Ga0157336_1001516 | Ga0157336_10015162 | 191 |
| 444 | 3300026121 | Ga0207683_10335929 | Ga0207683_103359293 | 191 |
| 445 | 3300048929 | Ga0496126_0655193 | Ga0496126_0655193_88_693 | 191 |
| 446 | 3300005543 | Ga0070672_100451180 | Ga0070672_1004511802 | 192 |
| 447 | 3300005547 | Ga0070693_100016180 | Ga0070693_1000161804 | 192 |
| 448 | 3300025909 | Ga0207705_10512893 | Ga0207705_105128931 | 192 |
| 449 | 3300025940 | Ga0207691_10441264 | Ga0207691_104412642 | 192 |
| 450 | 3300053120 | Ga0500597_115201 | Ga0500597_115201_138_749 | 192 |
| 451 | iso_pu_bacteria | 2537561836 | 2538834131 | 196 |
| 452 | iso_pu_bacteria | 2547132130 | 2547502383 | 196 |
| 453 | iso_pu_bacteria | 2571042365 | 2572256415 | 196 |
| 454 | iso_pu_bacteria | 2576861471 | 2578459523 | 196 |
| 455 | iso_pu_bacteria | 2593339238 | 2595448046 | 196 |
| 456 | iso_pu_bacteria | 2593339239 | 2595451342 | 196 |
| 457 | iso_pu_bacteria | 2643221559 | 2643816128 | 196 |
| 458 | iso_pu_bacteria | 2643221562 | 2643829525 | 196 |
| 459 | iso_pu_bacteria | 2643221573 | 2643877934 | 196 |
| 460 | iso_pu_bacteria | 2643221577 | 2643895220 | 196 |
| 461 | iso_pu_bacteria | 2643221581 | 2643915222 | 196 |
| 462 | iso_pu_bacteria | 2643221586 | 2643938156 | 196 |
| 463 | iso_pu_bacteria | 2643221593 | 2643975361 | 196 |
| 464 | iso_pu_bacteria | 2643221612 | 2644077728 | 196 |
| 465 | iso_pu_bacteria | 2643221685 | 2644477379 | 196 |
| 466 | iso_pu_bacteria | 2643221695 | 2644530917 | 196 |
| 467 | iso_pu_bacteria | 2643221720 | 2644659244 | 196 |
| 468 | iso_pu_bacteria | 2643221727 | 2644695979 | 196 |
| 469 | iso_pu_bacteria | 2643221728 | 2644698582 | 196 |
| 470 | iso_pu_bacteria | 2687453130 | 2687584040 | 196 |
| 471 | iso_pu_bacteria | 2718218334 | 2721028623 | 196 |
| 472 | iso_pu_bacteria | 2734482264 | 2735835786 | 196 |
| 473 | iso_pu_bacteria | 2738543009 | 2739227009 | 196 |
| 474 | iso_pu_bacteria | 2739367700 | 2739732123 | 196 |
| 475 | iso_pu_bacteria | 2747842428 | 2747950328 | 196 |
| 476 | iso_pu_bacteria | 2747842501 | 2748018122 | 196 |
| 477 | iso_pu_bacteria | 2765235840 | 2765577783 | 196 |
| 478 | iso_pu_bacteria | 2816332141 | 2816515846 | 196 |
| 479 | iso_pu_bacteria | 2818991440 | 2819566530 | 196 |
| 480 | iso_pu_bacteria | 2818991457 | 2819660642 | 196 |
| 481 | iso_pu_bacteria | 2842391507 | 2842394170 | 196 |
| 482 | iso_pu_bacteria | 2842757796 | 2842759739 | 196 |
| 483 | iso_pu_bacteria | 2842780639 | 2842781649 | 196 |
| 484 | iso_pu_bacteria | 2842914999 | 2842915002 | 196 |
| 485 | iso_pu_bacteria | 2842918807 | 2842922236 | 196 |
| 486 | iso_pu_bacteria | 2852649853 | 2852653100 | 196 |
| 487 | iso_pu_bacteria | 2852684882 | 2852688818 | 196 |
| 488 | iso_pu_bacteria | 2857442823 | 2857445084 | 196 |
| 489 | iso_pu_bacteria | 2874220319 | 2874220388 | 196 |
| 490 | iso_pu_bacteria | 2884338543 | 2884339564 | 196 |
| 491 | iso_pu_bacteria | 2884411467 | 2884413729 | 196 |
| 492 | iso_pu_bacteria | 2894414249 | 2894414495 | 196 |
| 493 | iso_pu_bacteria | 2895395659 | 2895397475 | 196 |
| 494 | iso_pu_bacteria | 2904463128 | 2904467186 | 196 |
| 495 | iso_pu_bacteria | 2919085039 | 2919086799 | 196 |
| 496 | iso_pu_bacteria | 2919089067 | 2919091658 | 196 |
| 497 | iso_pu_bacteria | 2919130084 | 2919130087 | 196 |
| 498 | iso_pu_bacteria | 2919134579 | 2919134935 | 196 |
| 499 | iso_pu_bacteria | 2919404418 | 2919404421 | 196 |
| 500 | iso_pu_bacteria | 2919513703 | 2919515163 | 196 |
| 501 | iso_pu_bacteria | 2919675420 | 2919678180 | 196 |
| 502 | iso_pu_bacteria | 2923516293 | 2923519228 | 196 |
| 503 | iso_pu_bacteria | 2928496128 | 2928498478 | 196 |
| 504 | iso_pu_bacteria | 2928963466 | 2928964821 | 196 |
| 505 | iso_pu_bacteria | 2929195423 | 2929198918 | 196 |
| 506 | iso_pu_bacteria | 2931380184 | 2931381955 | 196 |
| 507 | iso_pu_bacteria | 2937610967 | 2937611279 | 196 |
| 508 | iso_pu_bacteria | 2939589442 | 2939591859 | 196 |
| 509 | iso_pu_bacteria | 2939611941 | 2939612732 | 196 |
| 510 | iso_pu_bacteria | 2939622612 | 2939625885 | 196 |
| 511 | iso_pu_bacteria | 2939626828 | 2939631014 | 196 |
| 512 | iso_pu_bacteria | 2941471342 | 2941473850 | 196 |
| 513 | iso_pu_bacteria | 2941475908 | 2941477278 | 196 |
| 514 | iso_pu_bacteria | 2953994433 | 2953997353 | 196 |
| 515 | iso_pu_bacteria | 2961047084 | 2961047153 | 196 |
| 516 | iso_pu_bacteria | 2961064222 | 2961068523 | 196 |
| 517 | iso_pu_bacteria | 2974307012 | 2974309976 | 196 |
| 518 | iso_pu_bacteria | 2977247770 | 2977250711 | 196 |
| 519 | iso_pu_bacteria | 2984514374 | 2984514804 | 196 |
| 520 | iso_pu_bacteria | 2987605356 | 2987605648 | 196 |
| 521 | iso_pu_bacteria | 2995948881 | 2995950364 | 196 |
| 522 | iso_pu_bacteria | 8002869464 | 8002871445 | 196 |
| 523 | iso_pu_bacteria | 8003014200 | 8003015002 | 196 |
| 524 | iso_pu_bacteria | 8021622325 | 8021626350 | 196 |
| 525 | iso_pu_bacteria | 8021626552 | 8021629643 | 196 |
| 526 | iso_pu_bacteria | 8021648035 | 8021649684 | 196 |
| 527 | 3300002077 | JGI24744J21845_10002487 | JGI24744J21845_100024872 | 198 |
| 528 | 3300005335 | Ga0070666_10028752 | Ga0070666_100287522 | 198 |
| 529 | 3300005834 | Ga0068851_10059998 | Ga0068851_100599983 | 198 |
| 530 | 3300006358 | Ga0068871_100342936 | Ga0068871_1003429362 | 198 |
| 531 | 3300009098 | Ga0105245_11928201 | Ga0105245_119282011 | 198 |
| 532 | 3300013296 | Ga0157374_10190512 | Ga0157374_101905123 | 198 |
| 533 | 3300013306 | Ga0163162_10046484 | Ga0163162_100464846 | 198 |
| 534 | 3300014325 | Ga0163163_10165866 | Ga0163163_101658663 | 198 |
| 535 | 3300025903 | Ga0207680_10002673 | Ga0207680_100026731 | 198 |
| 536 | 3300025928 | Ga0207700_10741499 | Ga0207700_107414992 | 198 |
| 537 | 3300031616 | Ga0307508_10105773 | Ga0307508_101057734 | 198 |
| 538 | 3300048906 | Ga0496103_0296905 | Ga0496103_0296905_37_636 | 198 |
| 539 | 3300048918 | Ga0496115_0002549 | Ga0496115_0002549_1209_1808 | 198 |
| 540 | 3300048929 | Ga0496126_0000033 | Ga0496126_0000033_31638_32237 | 198 |
| 541 | 3300049568 | Ga0501031_0096163 | Ga0501031_0096163_1118_1717 | 198 |
| 542 | 3300049569 | Ga0501032_0045411 | Ga0501032_0045411_1512_2111 | 198 |
| 543 | 3300049571 | Ga0501034_0056333 | Ga0501034_0056333_2193_2792 | 198 |
| 544 | 3300049571 | Ga0501034_0066470 | Ga0501034_0066470_1853_2452 | 198 |
| 545 | 3300049571 | Ga0501034_0377238 | Ga0501034_0377238_640_1239 | 198 |
| 546 | 3300049575 | Ga0501039_0811864 | Ga0501039_0811864_51_650 | 198 |
| 547 | 3300049579 | Ga0501043_0111378 | Ga0501043_0111378_807_1406 | 198 |
| 548 | 3300049580 | Ga0501046_0067782 | Ga0501046_0067782_927_1526 | 198 |
| 549 | 3300049580 | Ga0501046_0470696 | Ga0501046_0470696_146_745 | 198 |
| 550 | 3300049581 | Ga0501047_0000250 | Ga0501047_0000250_1146_1745 | 198 |
| 551 | 3300049581 | Ga0501047_0045199 | Ga0501047_0045199_2157_2756 | 198 |
| 552 | 3300049581 | Ga0501047_0100864 | Ga0501047_0100864_835_1434 | 198 |
| 553 | 3300049583 | Ga0501067_0019365 | Ga0501067_0019365_1168_1767 | 198 |
| 554 | 3300049585 | Ga0501069_0095297 | Ga0501069_0095297_765_1364 | 198 |
| 555 | 3300049586 | Ga0501070_0042967 | Ga0501070_0042967_1996_2595 | 198 |
| 556 | 3300049586 | Ga0501070_0086782 | Ga0501070_0086782_656_1255 | 198 |
| 557 | 3300049586 | Ga0501070_0153676 | Ga0501070_0153676_224_823 | 198 |
| 558 | 3300049586 | Ga0501070_0162900 | Ga0501070_0162900_76_675 | 198 |
| 559 | 3300049588 | Ga0501072_0021878 | Ga0501072_0021878_3195_3794 | 198 |
| 560 | 3300049589 | Ga0501073_0000196 | Ga0501073_0000196_38267_38866 | 198 |
| 561 | 3300049589 | Ga0501073_0210261 | Ga0501073_0210261_569_1168 | 198 |
| 562 | 3300049590 | Ga0501074_0031616 | Ga0501074_0031616_1067_1666 | 198 |
| 563 | 3300049590 | Ga0501074_0034673 | Ga0501074_0034673_64_663 | 198 |
| 564 | 3300049590 | Ga0501074_0154724 | Ga0501074_0154724_695_1294 | 198 |
| 565 | 3300049742 | Ga0501080_0005488 | Ga0501080_0005488_1168_1767 | 198 |
| 566 | 3300049742 | Ga0501080_0075188 | Ga0501080_0075188_665_1264 | 198 |
| 567 | 3300049742 | Ga0501080_0107130 | Ga0501080_0107130_944_1543 | 198 |
| 568 | 3300049742 | Ga0501080_0290833 | Ga0501080_0290833_231_830 | 198 |
| 569 | 3300049744 | Ga0501083_0021386 | Ga0501083_0021386_1167_1766 | 198 |
| 570 | 3300049823 | Ga0501044_0031982 | Ga0501044_0031982_615_1214 | 198 |
| 571 | 3300054114 | Ga0501084_0245529 | Ga0501084_0245529_22_621 | 198 |
| 572 | 3300009094 | Ga0111539_10329500 | Ga0111539_103295002 | 199 |
| 573 | 3300025936 | Ga0207670_10342728 | Ga0207670_103427282 | 199 |
| 574 | 3300030745 | Ga0316182_1088536 | Ga0316182_10885361 | 199 |
| 575 | 3300031730 | Ga0307516_10007119 | Ga0307516_100071199 | 199 |
| 576 | 3300041999 | Ga0439433_0083311 | Ga0439433_0083311_12_614 | 199 |
| 577 | 3300042876 | Ga0451577_0065354 | Ga0451577_0065354_127_729 | 199 |
| 578 | 3300042876 | Ga0451577_0182922 | Ga0451577_0182922_832_1434 | 199 |
| 579 | 3300044712 | Ga0453684_0000136 | Ga0453684_0000136_321626_322228 | 199 |
| 580 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_105663_106265 | 199 |
| 581 | 3300049162 | Ga0501307_005239 | Ga0501307_005239_716_1318 | 199 |
| 582 | 3300001904 | JGI24736J21556_1004671 | JGI24736J21556_10046713 | 200 |
| 583 | 3300001979 | JGI24740J21852_10006264 | JGI24740J21852_100062644 | 200 |
| 584 | 3300001989 | JGI24739J22299_10000118 | JGI24739J22299_100001182 | 200 |
| 585 | 3300001989 | JGI24739J22299_10027486 | JGI24739J22299_100274862 | 200 |
| 586 | 3300001990 | JGI24737J22298_10010174 | JGI24737J22298_100101746 | 200 |
| 587 | 3300001990 | JGI24737J22298_10010685 | JGI24737J22298_100106855 | 200 |
| 588 | 3300001990 | JGI24737J22298_10037402 | JGI24737J22298_100374022 | 200 |
| 589 | 3300002067 | JGI24735J21928_10009574 | JGI24735J21928_100095742 | 200 |
| 590 | 3300002067 | JGI24735J21928_10011190 | JGI24735J21928_100111902 | 200 |
| 591 | 3300002705 | JGI25156J39149_1002085 | JGI25156J39149_100208512 | 200 |
| 592 | 3300002705 | JGI25156J39149_1002290 | JGI25156J39149_10022904 | 200 |
| 593 | 3300002705 | JGI25156J39149_1003296 | JGI25156J39149_10032965 | 200 |
| 594 | 3300002705 | JGI25156J39149_1007054 | JGI25156J39149_10070543 | 200 |
| 595 | 3300002737 | JGI25162J39368_1003847 | JGI25162J39368_10038474 | 200 |
| 596 | 3300002737 | JGI25162J39368_1003864 | JGI25162J39368_10038645 | 200 |
| 597 | 3300002737 | JGI25162J39368_1003895 | JGI25162J39368_10038953 | 200 |
| 598 | 3300002737 | JGI25162J39368_1008978 | JGI25162J39368_10089783 | 200 |
| 599 | 3300002738 | JGI25154J39366_1006144 | JGI25154J39366_10061442 | 200 |
| 600 | 3300002741 | JGI25157J39369_1001153 | JGI25157J39369_10011534 | 200 |
| 601 | 3300002741 | JGI25157J39369_1001750 | JGI25157J39369_100175012 | 200 |
| 602 | 3300002741 | JGI25157J39369_1001921 | JGI25157J39369_10019213 | 200 |
| 603 | 3300002741 | JGI25157J39369_1002043 | JGI25157J39369_100204310 | 200 |
| 604 | 3300002741 | JGI25157J39369_1002044 | JGI25157J39369_10020444 | 200 |
| 605 | 3300002771 | JGI25163J39215_1001413 | JGI25163J39215_10014135 | 200 |
| 606 | 3300002772 | JGI25164J39214_1000312 | JGI25164J39214_100031236 | 200 |
| 607 | 3300002772 | JGI25164J39214_1000781 | JGI25164J39214_10007814 | 200 |
| 608 | 3300003214 | JGI25165J46597_1000586 | JGI25165J46597_100058636 | 200 |
| 609 | 3300003214 | JGI25165J46597_1001532 | JGI25165J46597_100153220 | 200 |
| 610 | 3300003215 | JGI25153J46596_10022417 | JGI25153J46596_100224173 | 200 |
| 611 | 3300003305 | Ga0006770J48903_1007534 | Ga0006770J48903_10075343 | 200 |
| 612 | 3300003320 | rootH2_10028076 | rootH2_100280765 | 200 |
| 613 | 3300003354 | JGI25160J50197_1034172 | JGI25160J50197_10341721 | 200 |
| 614 | 3300003479 | Ga0006556J51387_1018520 | Ga0006556J51387_10185203 | 200 |
| 615 | 3300003479 | Ga0006556J51387_1028196 | Ga0006556J51387_10281964 | 200 |
| 616 | 3300003558 | Ga0006558J51389_1018313 | Ga0006558J51389_10183133 | 200 |
| 617 | 3300003565 | Ga0006560J51390_1017170 | Ga0006560J51390_10171703 | 200 |
| 618 | 3300003565 | Ga0006560J51390_1021707 | Ga0006560J51390_10217074 | 200 |
| 619 | 3300003567 | Ga0006554J51385_1017088 | Ga0006554J51385_10170883 | 200 |
| 620 | 3300003567 | Ga0006554J51385_1020490 | Ga0006554J51385_10204904 | 200 |
| 621 | 3300003578 | Ga0006562J51391_1006869 | Ga0006562J51391_100686916 | 200 |
| 622 | 3300003578 | Ga0006562J51391_1018587 | Ga0006562J51391_10185873 | 200 |
| 623 | 3300003751 | Ga0055538_1000680 | Ga0055538_100068021 | 200 |
| 624 | 3300003752 | Ga0055539_1000456 | Ga0055539_10004564 | 200 |
| 625 | 3300003756 | Ga0055533_1000432 | Ga0055533_100043226 | 200 |
| 626 | 3300003756 | Ga0055533_1002319 | Ga0055533_10023193 | 200 |
| 627 | 3300003759 | Ga0055525_1000111 | Ga0055525_100011137 | 200 |
| 628 | 3300003760 | Ga0055527_1001178 | Ga0055527_10011783 | 200 |
| 629 | 3300003760 | Ga0055527_1001334 | Ga0055527_10013343 | 200 |
| 630 | 3300003760 | Ga0055527_1004708 | Ga0055527_10047083 | 200 |
| 631 | 3300003761 | Ga0055535_1002650 | Ga0055535_100265010 | 200 |
| 632 | 3300003761 | Ga0055535_1002929 | Ga0055535_10029298 | 200 |
| 633 | 3300003761 | Ga0055535_1004862 | Ga0055535_10048625 | 200 |
| 634 | 3300003761 | Ga0055535_1006090 | Ga0055535_10060905 | 200 |
| 635 | 3300003761 | Ga0055535_1006166 | Ga0055535_10061661 | 200 |
| 636 | 3300003762 | Ga0055542_1002512 | Ga0055542_10025123 | 200 |
| 637 | 3300003762 | Ga0055542_1003780 | Ga0055542_10037804 | 200 |
| 638 | 3300003762 | Ga0055542_1003848 | Ga0055542_10038485 | 200 |
| 639 | 3300003762 | Ga0055542_1003932 | Ga0055542_10039328 | 200 |
| 640 | 3300003762 | Ga0055542_1004903 | Ga0055542_10049032 | 200 |
| 641 | 3300003762 | Ga0055542_1006542 | Ga0055542_10065421 | 200 |
| 642 | 3300003763 | Ga0055529_1001670 | Ga0055529_100167010 | 200 |
| 643 | 3300003763 | Ga0055529_1002584 | Ga0055529_10025843 | 200 |
| 644 | 3300003763 | Ga0055529_1002611 | Ga0055529_10026113 | 200 |
| 645 | 3300003763 | Ga0055529_1003204 | Ga0055529_10032043 | 200 |
| 646 | 3300004801 | Ga0058860_10137024 | Ga0058860_101370245 | 200 |
| 647 | 3300005262 | Ga0065165_1000598 | Ga0065165_100059859 | 200 |
| 648 | 3300005262 | Ga0065165_1033037 | Ga0065165_10330372 | 200 |
| 649 | 3300005331 | Ga0070670_100045008 | Ga0070670_1000450087 | 200 |
| 650 | 3300005331 | Ga0070670_100407778 | Ga0070670_1004077783 | 200 |
| 651 | 3300005334 | Ga0068869_100043109 | Ga0068869_1000431094 | 200 |
| 652 | 3300005335 | Ga0070666_10000012 | Ga0070666_100000124 | 200 |
| 653 | 3300005336 | Ga0070680_100214844 | Ga0070680_1002148441 | 200 |
| 654 | 3300005336 | Ga0070680_100219981 | Ga0070680_1002199813 | 200 |
| 655 | 3300005336 | Ga0070680_100420032 | Ga0070680_1004200323 | 200 |
| 656 | 3300005337 | Ga0070682_100046558 | Ga0070682_1000465582 | 200 |
| 657 | 3300005337 | Ga0070682_100141710 | Ga0070682_1001417102 | 200 |
| 658 | 3300005337 | Ga0070682_100235089 | Ga0070682_1002350891 | 200 |
| 659 | 3300005338 | Ga0068868_100282839 | Ga0068868_1002828392 | 200 |
| 660 | 3300005339 | Ga0070660_100745227 | Ga0070660_1007452272 | 200 |
| 661 | 3300005340 | Ga0070689_100041431 | Ga0070689_1000414316 | 200 |
| 662 | 3300005341 | Ga0070691_10463307 | Ga0070691_104633071 | 200 |
| 663 | 3300005344 | Ga0070661_100015281 | Ga0070661_1000152818 | 200 |
| 664 | 3300005344 | Ga0070661_101015440 | Ga0070661_1010154401 | 200 |
| 665 | 3300005345 | Ga0070692_10054766 | Ga0070692_100547662 | 200 |
| 666 | 3300005347 | Ga0070668_100225982 | Ga0070668_1002259822 | 200 |
| 667 | 3300005364 | Ga0070673_100109100 | Ga0070673_1001091003 | 200 |
| 668 | 3300005364 | Ga0070673_100170446 | Ga0070673_1001704463 | 200 |
| 669 | 3300005366 | Ga0070659_100219319 | Ga0070659_1002193192 | 200 |
| 670 | 3300005366 | Ga0070659_100393823 | Ga0070659_1003938232 | 200 |
| 671 | 3300005366 | Ga0070659_100794965 | Ga0070659_1007949652 | 200 |
| 672 | 3300005367 | Ga0070667_100075141 | Ga0070667_1000751412 | 200 |
| 673 | 3300005435 | Ga0070714_100086583 | Ga0070714_1000865835 | 200 |
| 674 | 3300005435 | Ga0070714_100162027 | Ga0070714_1001620271 | 200 |
| 675 | 3300005435 | Ga0070714_100254633 | Ga0070714_1002546332 | 200 |
| 676 | 3300005435 | Ga0070714_100743036 | Ga0070714_1007430361 | 200 |
| 677 | 3300005436 | Ga0070713_100008401 | Ga0070713_1000084014 | 200 |
| 678 | 3300005437 | Ga0070710_10040859 | Ga0070710_100408594 | 200 |
| 679 | 3300005437 | Ga0070710_10099927 | Ga0070710_100999273 | 200 |
| 680 | 3300005444 | Ga0070694_100380270 | Ga0070694_1003802702 | 200 |
| 681 | 3300005455 | Ga0070663_100053898 | Ga0070663_1000538985 | 200 |
| 682 | 3300005455 | Ga0070663_100059429 | Ga0070663_1000594291 | 200 |
| 683 | 3300005455 | Ga0070663_100088895 | Ga0070663_1000888953 | 200 |
| 684 | 3300005455 | Ga0070663_100112513 | Ga0070663_1001125131 | 200 |
| 685 | 3300005455 | Ga0070663_100112649 | Ga0070663_1001126492 | 200 |
| 686 | 3300005455 | Ga0070663_100150300 | Ga0070663_1001503002 | 200 |
| 687 | 3300005455 | Ga0070663_100772457 | Ga0070663_1007724571 | 200 |
| 688 | 3300005458 | Ga0070681_10075723 | Ga0070681_100757236 | 200 |
| 689 | 3300005458 | Ga0070681_10121502 | Ga0070681_101215022 | 200 |
| 690 | 3300005458 | Ga0070681_10128522 | Ga0070681_101285222 | 200 |
| 691 | 3300005458 | Ga0070681_10828609 | Ga0070681_108286092 | 200 |
| 692 | 3300005466 | Ga0070685_10002255 | Ga0070685_100022552 | 200 |
| 693 | 3300005535 | Ga0070684_101113278 | Ga0070684_1011132781 | 200 |
| 694 | 3300005539 | Ga0068853_100191675 | Ga0068853_1001916752 | 200 |
| 695 | 3300005539 | Ga0068853_100317536 | Ga0068853_1003175363 | 200 |
| 696 | 3300005539 | Ga0068853_100340462 | Ga0068853_1003404621 | 200 |
| 697 | 3300005539 | Ga0068853_100387241 | Ga0068853_1003872412 | 200 |
| 698 | 3300005543 | Ga0070672_100228215 | Ga0070672_1002282153 | 200 |
| 699 | 3300005546 | Ga0070696_100010164 | Ga0070696_10001016413 | 200 |
| 700 | 3300005546 | Ga0070696_100128219 | Ga0070696_1001282192 | 200 |
| 701 | 3300005546 | Ga0070696_100612860 | Ga0070696_1006128602 | 200 |
| 702 | 3300005547 | Ga0070693_100025657 | Ga0070693_1000256576 | 200 |
| 703 | 3300005547 | Ga0070693_100028679 | Ga0070693_1000286796 | 200 |
| 704 | 3300005547 | Ga0070693_100296685 | Ga0070693_1002966852 | 200 |
| 705 | 3300005548 | Ga0070665_100000175 | Ga0070665_100000175111 | 200 |
| 706 | 3300005548 | Ga0070665_100105834 | Ga0070665_1001058344 | 200 |
| 707 | 3300005548 | Ga0070665_100564696 | Ga0070665_1005646962 | 200 |
| 708 | 3300005549 | Ga0070704_100439193 | Ga0070704_1004391931 | 200 |
| 709 | 3300005563 | Ga0068855_100149075 | Ga0068855_1001490752 | 200 |
| 710 | 3300005563 | Ga0068855_100231949 | Ga0068855_1002319493 | 200 |
| 711 | 3300005563 | Ga0068855_100886189 | Ga0068855_1008861891 | 200 |
| 712 | 3300005563 | Ga0068855_101018046 | Ga0068855_1010180461 | 200 |
| 713 | 3300005577 | Ga0068857_100000998 | Ga0068857_10000099833 | 200 |
| 714 | 3300005577 | Ga0068857_100087151 | Ga0068857_1000871513 | 200 |
| 715 | 3300005577 | Ga0068857_100132398 | Ga0068857_1001323983 | 200 |
| 716 | 3300005577 | Ga0068857_100210127 | Ga0068857_1002101272 | 200 |
| 717 | 3300005577 | Ga0068857_100262434 | Ga0068857_1002624343 | 200 |
| 718 | 3300005577 | Ga0068857_100347807 | Ga0068857_1003478072 | 200 |
| 719 | 3300005577 | Ga0068857_100480645 | Ga0068857_1004806452 | 200 |
| 720 | 3300005578 | Ga0068854_100054495 | Ga0068854_1000544952 | 200 |
| 721 | 3300005578 | Ga0068854_100278013 | Ga0068854_1002780133 | 200 |
| 722 | 3300005578 | Ga0068854_100482745 | Ga0068854_1004827452 | 200 |
| 723 | 3300005578 | Ga0068854_100536279 | Ga0068854_1005362791 | 200 |
| 724 | 3300005578 | Ga0068854_100536280 | Ga0068854_1005362801 | 200 |
| 725 | 3300005578 | Ga0068854_100559185 | Ga0068854_1005591851 | 200 |
| 726 | 3300005614 | Ga0068856_100004797 | Ga0068856_1000047974 | 200 |
| 727 | 3300005614 | Ga0068856_100076451 | Ga0068856_1000764515 | 200 |
| 728 | 3300005614 | Ga0068856_100184419 | Ga0068856_1001844193 | 200 |
| 729 | 3300005616 | Ga0068852_100058397 | Ga0068852_1000583972 | 200 |
| 730 | 3300005616 | Ga0068852_100248113 | Ga0068852_1002481132 | 200 |
| 731 | 3300005617 | Ga0068859_100122263 | Ga0068859_1001222634 | 200 |
| 732 | 3300005617 | Ga0068859_100275251 | Ga0068859_1002752512 | 200 |
| 733 | 3300005617 | Ga0068859_101205008 | Ga0068859_1012050082 | 200 |
| 734 | 3300005834 | Ga0068851_10014017 | Ga0068851_100140176 | 200 |
| 735 | 3300005834 | Ga0068851_10044959 | Ga0068851_100449592 | 200 |
| 736 | 3300005841 | Ga0068863_100100973 | Ga0068863_1001009733 | 200 |
| 737 | 3300005842 | Ga0068858_100048710 | Ga0068858_1000487106 | 200 |
| 738 | 3300005842 | Ga0068858_100075141 | Ga0068858_1000751414 | 200 |
| 739 | 3300005842 | Ga0068858_100285650 | Ga0068858_1002856502 | 200 |
| 740 | 3300005843 | Ga0068860_100054090 | Ga0068860_1000540902 | 200 |
| 741 | 3300005843 | Ga0068860_100079152 | Ga0068860_1000791526 | 200 |
| 742 | 3300005843 | Ga0068860_100369392 | Ga0068860_1003693922 | 200 |
| 743 | 3300005844 | Ga0068862_100164162 | Ga0068862_1001641624 | 200 |
| 744 | 3300005937 | Ga0081455_10053310 | Ga0081455_100533103 | 200 |
| 745 | 3300005983 | Ga0081540_1000720 | Ga0081540_100072011 | 200 |
| 746 | 3300006163 | Ga0070715_10144003 | Ga0070715_101440031 | 200 |
| 747 | 3300006173 | Ga0070716_100692208 | Ga0070716_1006922081 | 200 |
| 748 | 3300006175 | Ga0070712_100527301 | Ga0070712_1005273012 | 200 |
| 749 | 3300006237 | Ga0097621_100956787 | Ga0097621_1009567871 | 200 |
| 750 | 3300006358 | Ga0068871_100100892 | Ga0068871_1001008923 | 200 |
| 751 | 3300006358 | Ga0068871_100119042 | Ga0068871_1001190423 | 200 |
| 752 | 3300006881 | Ga0068865_100029937 | Ga0068865_1000299376 | 200 |
| 753 | 3300006881 | Ga0068865_100071838 | Ga0068865_1000718382 | 200 |
| 754 | 3300006931 | Ga0097620_100122253 | Ga0097620_1001222534 | 200 |
| 755 | 3300006931 | Ga0097620_100275240 | Ga0097620_1002752402 | 200 |
| 756 | 3300006931 | Ga0097620_100506219 | Ga0097620_1005062192 | 200 |
| 757 | 3300006931 | Ga0097620_101205147 | Ga0097620_1012051472 | 200 |
| 758 | 3300009093 | Ga0105240_10257037 | Ga0105240_102570373 | 200 |
| 759 | 3300009093 | Ga0105240_10699632 | Ga0105240_106996322 | 200 |
| 760 | 3300009093 | Ga0105240_10699669 | Ga0105240_106996692 | 200 |
| 761 | 3300009101 | Ga0105247_10014280 | Ga0105247_100142803 | 200 |
| 762 | 3300009174 | Ga0105241_11148800 | Ga0105241_111488001 | 200 |
| 763 | 3300009545 | Ga0105237_10050085 | Ga0105237_100500854 | 200 |
| 764 | 3300009545 | Ga0105237_10051347 | Ga0105237_100513474 | 200 |
| 765 | 3300009545 | Ga0105237_10073900 | Ga0105237_100739004 | 200 |
| 766 | 3300009551 | Ga0105238_10067600 | Ga0105238_100676003 | 200 |
| 767 | 3300009551 | Ga0105238_10145294 | Ga0105238_101452944 | 200 |
| 768 | 3300009551 | Ga0105238_10264938 | Ga0105238_102649383 | 200 |
| 769 | 3300009551 | Ga0105238_10361347 | Ga0105238_103613473 | 200 |
| 770 | 3300009551 | Ga0105238_10756217 | Ga0105238_107562172 | 200 |
| 771 | 3300010375 | Ga0105239_10006660 | Ga0105239_100066604 | 200 |
| 772 | 3300010375 | Ga0105239_10090407 | Ga0105239_100904074 | 200 |
| 773 | 3300010375 | Ga0105239_10139444 | Ga0105239_101394443 | 200 |
| 774 | 3300010375 | Ga0105239_10141288 | Ga0105239_101412884 | 200 |
| 775 | 3300010375 | Ga0105239_10572982 | Ga0105239_105729822 | 200 |
| 776 | 3300011119 | Ga0105246_10200918 | Ga0105246_102009183 | 200 |
| 777 | 3300012500 | Ga0157314_1000456 | Ga0157314_10004564 | 200 |
| 778 | 3300013100 | Ga0157373_10096936 | Ga0157373_100969362 | 200 |
| 779 | 3300013102 | Ga0157371_10045126 | Ga0157371_100451264 | 200 |
| 780 | 3300013102 | Ga0157371_10063110 | Ga0157371_100631104 | 200 |
| 781 | 3300013102 | Ga0157371_10432117 | Ga0157371_104321172 | 200 |
| 782 | 3300013104 | Ga0157370_10062752 | Ga0157370_100627526 | 200 |
| 783 | 3300013104 | Ga0157370_10069149 | Ga0157370_100691494 | 200 |
| 784 | 3300013104 | Ga0157370_10104910 | Ga0157370_101049104 | 200 |
| 785 | 3300013104 | Ga0157370_10119558 | Ga0157370_101195582 | 200 |
| 786 | 3300013104 | Ga0157370_10125529 | Ga0157370_101255292 | 200 |
| 787 | 3300013104 | Ga0157370_10285025 | Ga0157370_102850253 | 200 |
| 788 | 3300013105 | Ga0157369_10004613 | Ga0157369_100046133 | 200 |
| 789 | 3300013105 | Ga0157369_10036937 | Ga0157369_100369374 | 200 |
| 790 | 3300013105 | Ga0157369_10097097 | Ga0157369_100970976 | 200 |
| 791 | 3300013105 | Ga0157369_10107916 | Ga0157369_101079163 | 200 |
| 792 | 3300013105 | Ga0157369_11175580 | Ga0157369_111755802 | 200 |
| 793 | 3300013296 | Ga0157374_10395321 | Ga0157374_103953212 | 200 |
| 794 | 3300013297 | Ga0157378_10023199 | Ga0157378_1002319912 | 200 |
| 795 | 3300013306 | Ga0163162_10070045 | Ga0163162_100700454 | 200 |
| 796 | 3300013307 | Ga0157372_10094273 | Ga0157372_100942734 | 200 |
| 797 | 3300013307 | Ga0157372_10157288 | Ga0157372_101572884 | 200 |
| 798 | 3300013307 | Ga0157372_10181931 | Ga0157372_101819312 | 200 |
| 799 | 3300013307 | Ga0157372_10241293 | Ga0157372_102412932 | 200 |
| 800 | 3300013307 | Ga0157372_10560165 | Ga0157372_105601653 | 200 |
| 801 | 3300013307 | Ga0157372_10802551 | Ga0157372_108025512 | 200 |
| 802 | 3300014325 | Ga0163163_10509119 | Ga0163163_105091192 | 200 |
| 803 | 3300014497 | Ga0182008_10077601 | Ga0182008_100776012 | 200 |
| 804 | 3300015265 | Ga0182005_1012026 | Ga0182005_10120262 | 200 |
| 805 | 3300015685 | Ga0183369_1007 | Ga0183369_1007153 | 200 |
| 806 | 3300015687 | Ga0183368_1002 | Ga0183368_1002395 | 200 |
| 807 | 3300020069 | Ga0197907_10947378 | Ga0197907_109473784 | 200 |
| 808 | 3300020070 | Ga0206356_10171056 | Ga0206356_101710564 | 200 |
| 809 | 3300020070 | Ga0206356_10221074 | Ga0206356_102210741 | 200 |
| 810 | 3300020070 | Ga0206356_10657042 | Ga0206356_106570422 | 200 |
| 811 | 3300020075 | Ga0206349_1346577 | Ga0206349_13465771 | 200 |
| 812 | 3300020076 | Ga0206355_1315307 | Ga0206355_13153073 | 200 |
| 813 | 3300020076 | Ga0206355_1347985 | Ga0206355_13479854 | 200 |
| 814 | 3300020076 | Ga0206355_1642390 | Ga0206355_16423901 | 200 |
| 815 | 3300020076 | Ga0206355_1657004 | Ga0206355_16570043 | 200 |
| 816 | 3300020077 | Ga0206351_10229607 | Ga0206351_102296073 | 200 |
| 817 | 3300020077 | Ga0206351_10721784 | Ga0206351_107217845 | 200 |
| 818 | 3300020078 | Ga0206352_10790062 | Ga0206352_107900623 | 200 |
| 819 | 3300020078 | Ga0206352_11356790 | Ga0206352_113567903 | 200 |
| 820 | 3300020080 | Ga0206350_10322002 | Ga0206350_103220023 | 200 |
| 821 | 3300020610 | Ga0154015_1195220 | Ga0154015_11952201 | 200 |
| 822 | 3300022467 | Ga0224712_10003939 | Ga0224712_100039396 | 200 |
| 823 | 3300022467 | Ga0224712_10013385 | Ga0224712_100133853 | 200 |
| 824 | 3300025206 | Ga0209435_101200 | Ga0209435_1012002 | 200 |
| 825 | 3300025206 | Ga0209435_106506 | Ga0209435_1065061 | 200 |
| 826 | 3300025224 | Ga0209784_100167 | Ga0209784_10016761 | 200 |
| 827 | 3300025225 | Ga0209566_103884 | Ga0209566_1038843 | 200 |
| 828 | 3300025226 | Ga0209674_100043 | Ga0209674_100043363 | 200 |
| 829 | 3300025226 | Ga0209674_100381 | Ga0209674_10038133 | 200 |
| 830 | 3300025226 | Ga0209674_102055 | Ga0209674_1020553 | 200 |
| 831 | 3300025226 | Ga0209674_102881 | Ga0209674_1028814 | 200 |
| 832 | 3300025228 | Ga0209672_100004 | Ga0209672_1000041296 | 200 |
| 833 | 3300025228 | Ga0209672_100029 | Ga0209672_1000294 | 200 |
| 834 | 3300025228 | Ga0209672_101110 | Ga0209672_10111020 | 200 |
| 835 | 3300025228 | Ga0209672_102109 | Ga0209672_1021096 | 200 |
| 836 | 3300025228 | Ga0209672_104042 | Ga0209672_1040425 | 200 |
| 837 | 3300025230 | Ga0209563_100103 | Ga0209563_10010337 | 200 |
| 838 | 3300025231 | Ga0207427_100144 | Ga0207427_1001444 | 200 |
| 839 | 3300025231 | Ga0207427_100209 | Ga0207427_1002094 | 200 |
| 840 | 3300025231 | Ga0207427_100327 | Ga0207427_1003274 | 200 |
| 841 | 3300025231 | Ga0207427_104741 | Ga0207427_1047412 | 200 |
| 842 | 3300025231 | Ga0207427_118277 | Ga0207427_1182771 | 200 |
| 843 | 3300025233 | Ga0209437_100020 | Ga0209437_100020622 | 200 |
| 844 | 3300025233 | Ga0209437_100193 | Ga0209437_100193107 | 200 |
| 845 | 3300025233 | Ga0209437_100256 | Ga0209437_10025685 | 200 |
| 846 | 3300025233 | Ga0209437_100465 | Ga0209437_10046536 | 200 |
| 847 | 3300025233 | Ga0209437_103094 | Ga0209437_1030943 | 200 |
| 848 | 3300025242 | Ga0209258_100003 | Ga0209258_1000031296 | 200 |
| 849 | 3300025242 | Ga0209258_100053 | Ga0209258_100053326 | 200 |
| 850 | 3300025242 | Ga0209258_100149 | Ga0209258_100149158 | 200 |
| 851 | 3300025242 | Ga0209258_100329 | Ga0209258_1003294 | 200 |
| 852 | 3300025242 | Ga0209258_103384 | Ga0209258_1033843 | 200 |
| 853 | 3300025246 | Ga0209646_1000796 | Ga0209646_100079615 | 200 |
| 854 | 3300025246 | Ga0209646_1002116 | Ga0209646_100211611 | 200 |
| 855 | 3300025246 | Ga0209646_1006538 | Ga0209646_10065382 | 200 |
| 856 | 3300025250 | Ga0209026_1000060 | Ga0209026_10000604 | 200 |
| 857 | 3300025250 | Ga0209026_1000274 | Ga0209026_100027449 | 200 |
| 858 | 3300025250 | Ga0209026_1000293 | Ga0209026_100029361 | 200 |
| 859 | 3300025250 | Ga0209026_1000516 | Ga0209026_10005164 | 200 |
| 860 | 3300025250 | Ga0209026_1001271 | Ga0209026_10012714 | 200 |
| 861 | 3300025250 | Ga0209026_1006743 | Ga0209026_10067433 | 200 |
| 862 | 3300025250 | Ga0209026_1022088 | Ga0209026_10220881 | 200 |
| 863 | 3300025253 | Ga0209677_107876 | Ga0209677_1078764 | 200 |
| 864 | 3300025253 | Ga0209677_121643 | Ga0209677_1216431 | 200 |
| 865 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021282 | 200 |
| 866 | 3300025254 | Ga0209148_1000009 | Ga0209148_10000094 | 200 |
| 867 | 3300025254 | Ga0209148_1000010 | Ga0209148_10000101165 | 200 |
| 868 | 3300025254 | Ga0209148_1000025 | Ga0209148_1000025600 | 200 |
| 869 | 3300025254 | Ga0209148_1000039 | Ga0209148_10000393 | 200 |
| 870 | 3300025254 | Ga0209148_1000143 | Ga0209148_1000143158 | 200 |
| 871 | 3300025256 | Ga0209759_1000658 | Ga0209759_100065836 | 200 |
| 872 | 3300025256 | Ga0209759_1001919 | Ga0209759_10019194 | 200 |
| 873 | 3300025256 | Ga0209759_1002020 | Ga0209759_10020204 | 200 |
| 874 | 3300025256 | Ga0209759_1007439 | Ga0209759_10074396 | 200 |
| 875 | 3300025256 | Ga0209759_1010126 | Ga0209759_10101264 | 200 |
| 876 | 3300025256 | Ga0209759_1016259 | Ga0209759_10162592 | 200 |
| 877 | 3300025258 | Ga0209129_1000835 | Ga0209129_100083513 | 200 |
| 878 | 3300025258 | Ga0209129_1002898 | Ga0209129_10028989 | 200 |
| 879 | 3300025261 | Ga0209233_1000009 | Ga0209233_10000094 | 200 |
| 880 | 3300025261 | Ga0209233_1000020 | Ga0209233_10000204 | 200 |
| 881 | 3300025261 | Ga0209233_1000151 | Ga0209233_1000151168 | 200 |
| 882 | 3300025261 | Ga0209233_1000920 | Ga0209233_100092024 | 200 |
| 883 | 3300025261 | Ga0209233_1012013 | Ga0209233_10120132 | 200 |
| 884 | 3300025272 | Ga0209455_1000004 | Ga0209455_10000041296 | 200 |
| 885 | 3300025272 | Ga0209455_1000034 | Ga0209455_10000344 | 200 |
| 886 | 3300025272 | Ga0209455_1000060 | Ga0209455_10000604 | 200 |
| 887 | 3300025272 | Ga0209455_1000086 | Ga0209455_10000864 | 200 |
| 888 | 3300025272 | Ga0209455_1000095 | Ga0209455_100009570 | 200 |
| 889 | 3300025297 | Ga0209758_1005974 | Ga0209758_100597416 | 200 |
| 890 | 3300025297 | Ga0209758_1015882 | Ga0209758_10158827 | 200 |
| 891 | 3300025299 | Ga0209256_1002932 | Ga0209256_10029325 | 200 |
| 892 | 3300025302 | Ga0207426_1003657 | Ga0207426_10036575 | 200 |
| 893 | 3300025898 | Ga0207692_10016367 | Ga0207692_100163674 | 200 |
| 894 | 3300025898 | Ga0207692_10056387 | Ga0207692_100563873 | 200 |
| 895 | 3300025903 | Ga0207680_10000013 | Ga0207680_100000134 | 200 |
| 896 | 3300025904 | Ga0207647_10011795 | Ga0207647_1001179511 | 200 |
| 897 | 3300025904 | Ga0207647_10032989 | Ga0207647_100329892 | 200 |
| 898 | 3300025904 | Ga0207647_10047348 | Ga0207647_100473483 | 200 |
| 899 | 3300025904 | Ga0207647_10062600 | Ga0207647_100626003 | 200 |
| 900 | 3300025904 | Ga0207647_10094179 | Ga0207647_100941792 | 200 |
| 901 | 3300025904 | Ga0207647_10096744 | Ga0207647_100967443 | 200 |
| 902 | 3300025907 | Ga0207645_10015566 | Ga0207645_100155669 | 200 |
| 903 | 3300025909 | Ga0207705_10031780 | Ga0207705_100317805 | 200 |
| 904 | 3300025912 | Ga0207707_10007311 | Ga0207707_1000731116 | 200 |
| 905 | 3300025912 | Ga0207707_10046392 | Ga0207707_100463924 | 200 |
| 906 | 3300025912 | Ga0207707_10108295 | Ga0207707_101082953 | 200 |
| 907 | 3300025913 | Ga0207695_10008130 | Ga0207695_100081309 | 200 |
| 908 | 3300025913 | Ga0207695_10016662 | Ga0207695_1001666216 | 200 |
| 909 | 3300025913 | Ga0207695_10030817 | Ga0207695_100308171 | 200 |
| 910 | 3300025913 | Ga0207695_10148552 | Ga0207695_101485521 | 200 |
| 911 | 3300025913 | Ga0207695_10581056 | Ga0207695_105810562 | 200 |
| 912 | 3300025914 | Ga0207671_10000021 | Ga0207671_100000214 | 200 |
| 913 | 3300025914 | Ga0207671_10028839 | Ga0207671_100288394 | 200 |
| 914 | 3300025914 | Ga0207671_10054495 | Ga0207671_100544953 | 200 |
| 915 | 3300025915 | Ga0207693_10196988 | Ga0207693_101969883 | 200 |
| 916 | 3300025916 | Ga0207663_10652633 | Ga0207663_106526332 | 200 |
| 917 | 3300025917 | Ga0207660_10067512 | Ga0207660_100675123 | 200 |
| 918 | 3300025917 | Ga0207660_10533695 | Ga0207660_105336952 | 200 |
| 919 | 3300025919 | Ga0207657_10174148 | Ga0207657_101741481 | 200 |
| 920 | 3300025919 | Ga0207657_10174180 | Ga0207657_101741803 | 200 |
| 921 | 3300025920 | Ga0207649_10065071 | Ga0207649_100650711 | 200 |
| 922 | 3300025920 | Ga0207649_10147830 | Ga0207649_101478302 | 200 |
| 923 | 3300025920 | Ga0207649_10533300 | Ga0207649_105333001 | 200 |
| 924 | 3300025921 | Ga0207652_10055937 | Ga0207652_100559376 | 200 |
| 925 | 3300025921 | Ga0207652_10557595 | Ga0207652_105575952 | 200 |
| 926 | 3300025923 | Ga0207681_10417210 | Ga0207681_104172102 | 200 |
| 927 | 3300025924 | Ga0207694_10088183 | Ga0207694_100881833 | 200 |
| 928 | 3300025924 | Ga0207694_10093128 | Ga0207694_100931283 | 200 |
| 929 | 3300025924 | Ga0207694_10152495 | Ga0207694_101524953 | 200 |
| 930 | 3300025924 | Ga0207694_10190862 | Ga0207694_101908622 | 200 |
| 931 | 3300025924 | Ga0207694_10333983 | Ga0207694_103339832 | 200 |
| 932 | 3300025925 | Ga0207650_10288516 | Ga0207650_102885162 | 200 |
| 933 | 3300025929 | Ga0207664_10001884 | Ga0207664_100018844 | 200 |
| 934 | 3300025929 | Ga0207664_10728135 | Ga0207664_107281352 | 200 |
| 935 | 3300025931 | Ga0207644_10090873 | Ga0207644_100908733 | 200 |
| 936 | 3300025932 | Ga0207690_10000291 | Ga0207690_1000029128 | 200 |
| 937 | 3300025932 | Ga0207690_10207151 | Ga0207690_102071512 | 200 |
| 938 | 3300025932 | Ga0207690_10543009 | Ga0207690_105430092 | 200 |
| 939 | 3300025932 | Ga0207690_10694490 | Ga0207690_106944901 | 200 |
| 940 | 3300025933 | Ga0207706_10100114 | Ga0207706_101001144 | 200 |
| 941 | 3300025933 | Ga0207706_10638697 | Ga0207706_106386972 | 200 |
| 942 | 3300025936 | Ga0207670_10123040 | Ga0207670_101230403 | 200 |
| 943 | 3300025937 | Ga0207669_10885421 | Ga0207669_108854211 | 200 |
| 944 | 3300025938 | Ga0207704_10017680 | Ga0207704_100176807 | 200 |
| 945 | 3300025938 | Ga0207704_10088244 | Ga0207704_100882443 | 200 |
| 946 | 3300025939 | Ga0207665_10101234 | Ga0207665_101012344 | 200 |
| 947 | 3300025940 | Ga0207691_10036108 | Ga0207691_1003610810 | 200 |
| 948 | 3300025942 | Ga0207689_10034156 | Ga0207689_100341566 | 200 |
| 949 | 3300025942 | Ga0207689_10136777 | Ga0207689_101367774 | 200 |
| 950 | 3300025944 | Ga0207661_10594956 | Ga0207661_105949562 | 200 |
| 951 | 3300025945 | Ga0207679_10174503 | Ga0207679_101745033 | 200 |
| 952 | 3300025949 | Ga0207667_10034827 | Ga0207667_100348278 | 200 |
| 953 | 3300025949 | Ga0207667_10053962 | Ga0207667_100539624 | 200 |
| 954 | 3300025949 | Ga0207667_10095216 | Ga0207667_100952163 | 200 |
| 955 | 3300025949 | Ga0207667_10128195 | Ga0207667_101281953 | 200 |
| 956 | 3300025949 | Ga0207667_10128231 | Ga0207667_101282313 | 200 |
| 957 | 3300025949 | Ga0207667_10428679 | Ga0207667_104286792 | 200 |
| 958 | 3300025949 | Ga0207667_11510937 | Ga0207667_115109371 | 200 |
| 959 | 3300025960 | Ga0207651_10066649 | Ga0207651_100666493 | 200 |
| 960 | 3300025972 | Ga0207668_10091449 | Ga0207668_100914493 | 200 |
| 961 | 3300025972 | Ga0207668_10422846 | Ga0207668_104228462 | 200 |
| 962 | 3300025981 | Ga0207640_10003058 | Ga0207640_100030584 | 200 |
| 963 | 3300025981 | Ga0207640_10054936 | Ga0207640_100549363 | 200 |
| 964 | 3300025981 | Ga0207640_10075585 | Ga0207640_100755851 | 200 |
| 965 | 3300025981 | Ga0207640_10196461 | Ga0207640_101964612 | 200 |
| 966 | 3300025981 | Ga0207640_10894600 | Ga0207640_108946002 | 200 |
| 967 | 3300025986 | Ga0207658_10033742 | Ga0207658_100337423 | 200 |
| 968 | 3300025986 | Ga0207658_10269171 | Ga0207658_102691712 | 200 |
| 969 | 3300025986 | Ga0207658_10308229 | Ga0207658_103082292 | 200 |
| 970 | 3300025986 | Ga0207658_10353974 | Ga0207658_103539742 | 200 |
| 971 | 3300026023 | Ga0207677_10264744 | Ga0207677_102647443 | 200 |
| 972 | 3300026035 | Ga0207703_10108063 | Ga0207703_101080633 | 200 |
| 973 | 3300026035 | Ga0207703_10127293 | Ga0207703_101272933 | 200 |
| 974 | 3300026041 | Ga0207639_10077238 | Ga0207639_100772383 | 200 |
| 975 | 3300026041 | Ga0207639_10249512 | Ga0207639_102495123 | 200 |
| 976 | 3300026067 | Ga0207678_10016758 | Ga0207678_100167583 | 200 |
| 977 | 3300026067 | Ga0207678_10049236 | Ga0207678_100492365 | 200 |
| 978 | 3300026067 | Ga0207678_10054333 | Ga0207678_100543337 | 200 |
| 979 | 3300026067 | Ga0207678_10572241 | Ga0207678_105722412 | 200 |
| 980 | 3300026078 | Ga0207702_10000517 | Ga0207702_1000051730 | 200 |
| 981 | 3300026078 | Ga0207702_10000852 | Ga0207702_1000085219 | 200 |
| 982 | 3300026078 | Ga0207702_10091382 | Ga0207702_100913824 | 200 |
| 983 | 3300026088 | Ga0207641_10009230 | Ga0207641_1000923017 | 200 |
| 984 | 3300026095 | Ga0207676_10162686 | Ga0207676_101626863 | 200 |
| 985 | 3300026095 | Ga0207676_10731242 | Ga0207676_107312422 | 200 |
| 986 | 3300026116 | Ga0207674_10024573 | Ga0207674_100245734 | 200 |
| 987 | 3300026116 | Ga0207674_10111246 | Ga0207674_101112464 | 200 |
| 988 | 3300026116 | Ga0207674_10142271 | Ga0207674_101422713 | 200 |
| 989 | 3300026116 | Ga0207674_10235613 | Ga0207674_102356132 | 200 |
| 990 | 3300026116 | Ga0207674_10353015 | Ga0207674_103530152 | 200 |
| 991 | 3300026116 | Ga0207674_10357035 | Ga0207674_103570353 | 200 |
| 992 | 3300026142 | Ga0207698_10071585 | Ga0207698_100715855 | 200 |
| 993 | 3300026142 | Ga0207698_10145533 | Ga0207698_101455333 | 200 |
| 994 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000013284 | 200 |
| 995 | 3300028379 | Ga0268266_10100303 | Ga0268266_101003032 | 200 |
| 996 | 3300028379 | Ga0268266_10210115 | Ga0268266_102101152 | 200 |
| 997 | 3300028380 | Ga0268265_10115242 | Ga0268265_101152423 | 200 |
| 998 | 3300028381 | Ga0268264_10023204 | Ga0268264_100232043 | 200 |
| 999 | 3300030763 | Ga0265763_1007233 | Ga0265763_10072332 | 200 |
| 1000 | 3300030863 | Ga0265766_1000306 | Ga0265766_10003062 | 200 |
| 1001 | 3300030888 | Ga0265769_100430 | Ga0265769_1004302 | 200 |
| 1002 | 3300030889 | Ga0265761_100106 | Ga0265761_1001065 | 200 |
| 1003 | 3300031011 | Ga0265774_100076 | Ga0265774_1000763 | 200 |
| 1004 | 3300031507 | Ga0307509_10199035 | Ga0307509_101990353 | 200 |
| 1005 | 3300031665 | Ga0316575_10015025 | Ga0316575_100150254 | 200 |
| 1006 | 3300031901 | Ga0307406_10093487 | Ga0307406_100934873 | 200 |
| 1007 | 3300031911 | Ga0307412_10028293 | Ga0307412_100282936 | 200 |
| 1008 | 3300032002 | Ga0307416_100079046 | Ga0307416_1000790463 | 200 |
| 1009 | 3300035691 | Ga0373931_0421997 | Ga0373931_0421997_153_758 | 200 |
| 1010 | 3300036458 | Ga0310112_000276 | Ga0310112_000276_2087_2689 | 200 |
| 1011 | 3300037312 | Ga0395899_0001959 | Ga0395899_0001959_14592_15194 | 200 |
| 1012 | 3300037312 | Ga0395899_0012521 | Ga0395899_0012521_1494_2096 | 200 |
| 1013 | 3300037312 | Ga0395899_0022053 | Ga0395899_0022053_3878_4480 | 200 |
| 1014 | 3300037312 | Ga0395899_0423649 | Ga0395899_0423649_181_783 | 200 |
| 1015 | 3300037418 | Ga0395900_0000012 | Ga0395900_0000012_43430_44032 | 200 |
| 1016 | 3300037418 | Ga0395900_0080209 | Ga0395900_0080209_1188_1790 | 200 |
| 1017 | 3300037418 | Ga0395900_0089318 | Ga0395900_0089318_1188_1790 | 200 |
| 1018 | 3300037418 | Ga0395900_0934356 | Ga0395900_0934356_72_674 | 200 |
| 1019 | 3300037466 | Ga0395898_0000558 | Ga0395898_0000558_1713_2315 | 200 |
| 1020 | 3300037466 | Ga0395898_0000600 | Ga0395898_0000600_1520_2122 | 200 |
| 1021 | 3300037466 | Ga0395898_0006608 | Ga0395898_0006608_11664_12266 | 200 |
| 1022 | 3300037466 | Ga0395898_0258265 | Ga0395898_0258265_966_1568 | 200 |
| 1023 | 3300037466 | Ga0395898_0745825 | Ga0395898_0745825_81_683 | 200 |
| 1024 | 3300037466 | Ga0395898_0796265 | Ga0395898_0796265_192_794 | 200 |
| 1025 | 3300038443 | Ga0395901_0002939 | Ga0395901_0002939_1654_2256 | 200 |
| 1026 | 3300038443 | Ga0395901_0011584 | Ga0395901_0011584_1555_2157 | 200 |
| 1027 | 3300038443 | Ga0395901_0075079 | Ga0395901_0075079_593_1195 | 200 |
| 1028 | 3300038443 | Ga0395901_0866142 | Ga0395901_0866142_192_794 | 200 |
| 1029 | 3300041442 | Ga0451788_24495 | Ga0451788_24495_84_686 | 200 |
| 1030 | 3300041452 | Ga0451793_0393032 | Ga0451793_0393032_1480_2082 | 200 |
| 1031 | 3300041459 | Ga0451800_0893000 | Ga0451800_0893000_527_1129 | 200 |
| 1032 | 3300041459 | Ga0451800_1044717 | Ga0451800_1044717_32_640 | 200 |
| 1033 | 3300041461 | Ga0451805_028824 | Ga0451805_028824_532_1137 | 200 |
| 1034 | 3300041509 | Ga0451843_1758148 | Ga0451843_1758148_36_641 | 200 |
| 1035 | 3300041512 | Ga0451853_2750802 | Ga0451853_2750802_263_865 | 200 |
| 1036 | 3300042000 | Ga0439437_001431 | Ga0439437_001431_705_1307 | 200 |
| 1037 | 3300042184 | Ga0450908_002110 | Ga0450908_002110_688_1290 | 200 |
| 1038 | 3300042435 | Ga0439434_0071617 | Ga0439434_0071617_82_687 | 200 |
| 1039 | 3300044656 | Ga0466969_0008348 | Ga0466969_0008348_1568_2170 | 200 |
| 1040 | 3300044656 | Ga0466969_0008941 | Ga0466969_0008941_3306_3908 | 200 |
| 1041 | 3300044656 | Ga0466969_0086989 | Ga0466969_0086989_850_1452 | 200 |
| 1042 | 3300044658 | Ga0466972_0024571 | Ga0466972_0024571_844_1446 | 200 |
| 1043 | 3300044661 | Ga0466975_0199194 | Ga0466975_0199194_567_1169 | 200 |
| 1044 | 3300044672 | Ga0466982_0000005 | Ga0466982_0000005_99584_100186 | 200 |
| 1045 | 3300044672 | Ga0466982_0000210 | Ga0466982_0000210_12933_13535 | 200 |
| 1046 | 3300044683 | Ga0466965_0003853 | Ga0466965_0003853_5061_5663 | 200 |
| 1047 | 3300044684 | Ga0466966_0002549 | Ga0466966_0002549_1504_2106 | 200 |
| 1048 | 3300044684 | Ga0466966_0069760 | Ga0466966_0069760_182_784 | 200 |
| 1049 | 3300044693 | Ga0466961_0010336 | Ga0466961_0010336_3445_4047 | 200 |
| 1050 | 3300044693 | Ga0466961_0015293 | Ga0466961_0015293_1006_1608 | 200 |
| 1051 | 3300044693 | Ga0466961_0079218 | Ga0466961_0079218_648_1250 | 200 |
| 1052 | 3300044693 | Ga0466961_0085616 | Ga0466961_0085616_385_987 | 200 |
| 1053 | 3300044693 | Ga0466961_0265280 | Ga0466961_0265280_240_842 | 200 |
| 1054 | 3300044694 | Ga0466963_0052819 | Ga0466963_0052819_1207_1809 | 200 |
| 1055 | 3300044694 | Ga0466963_0151824 | Ga0466963_0151824_683_1285 | 200 |
| 1056 | 3300044694 | Ga0466963_0588989 | Ga0466963_0588989_118_720 | 200 |
| 1057 | 3300044706 | Ga0466964_0018986 | Ga0466964_0018986_613_1215 | 200 |
| 1058 | 3300044706 | Ga0466964_0142737 | Ga0466964_0142737_102_704 | 200 |
| 1059 | 3300044706 | Ga0466964_0322127 | Ga0466964_0322127_162_764 | 200 |
| 1060 | 3300044719 | Ga0466971_0000338 | Ga0466971_0000338_9318_9920 | 200 |
| 1061 | 3300044719 | Ga0466971_0006109 | Ga0466971_0006109_1508_2110 | 200 |
| 1062 | 3300044719 | Ga0466971_0033841 | Ga0466971_0033841_890_1492 | 200 |
| 1063 | 3300044735 | Ga0466968_0000409 | Ga0466968_0000409_13377_13979 | 200 |
| 1064 | 3300044735 | Ga0466968_0048557 | Ga0466968_0048557_365_967 | 200 |
| 1065 | 3300044765 | Ga0466970_0001896 | Ga0466970_0001896_1478_2080 | 200 |
| 1066 | 3300044765 | Ga0466970_0215617 | Ga0466970_0215617_255_857 | 200 |
| 1067 | 3300044842 | Ga0466957_0019946 | Ga0466957_0019946_184_786 | 200 |
| 1068 | 3300044842 | Ga0466957_0075171 | Ga0466957_0075171_1382_1984 | 200 |
| 1069 | 3300044901 | Ga0466960_0002345 | Ga0466960_0002345_1503_2105 | 200 |
| 1070 | 3300045049 | Ga0466959_0033759 | Ga0466959_0033759_1529_2131 | 200 |
| 1071 | 3300045049 | Ga0466959_0043319 | Ga0466959_0043319_535_1137 | 200 |
| 1072 | 3300045049 | Ga0466959_0072597 | Ga0466959_0072597_385_987 | 200 |
| 1073 | 3300045836 | Ga0466958_0005279 | Ga0466958_0005279_1503_2105 | 200 |
| 1074 | 3300045836 | Ga0466958_0045436 | Ga0466958_0045436_1976_2578 | 200 |
| 1075 | 3300045836 | Ga0466958_0054129 | Ga0466958_0054129_1033_1635 | 200 |
| 1076 | 3300045836 | Ga0466958_0067609 | Ga0466958_0067609_1294_1896 | 200 |
| 1077 | 3300045836 | Ga0466958_0080493 | Ga0466958_0080493_1169_1771 | 200 |
| 1078 | 3300045976 | Ga0466967_0075901 | Ga0466967_0075901_79_681 | 200 |
| 1079 | 3300046452 | Ga0495617_005550 | Ga0495617_005550_3075_3677 | 200 |
| 1080 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_599566_600168 | 200 |
| 1081 | 3300046460 | Ga0495638_0029717 | Ga0495638_0029717_1177_1779 | 200 |
| 1082 | 3300046460 | Ga0495638_0055083 | Ga0495638_0055083_1821_2423 | 200 |
| 1083 | 3300046471 | Ga0495650_0000202 | Ga0495650_0000202_12476_13078 | 200 |
| 1084 | 3300046501 | Ga0495607_0007223 | Ga0495607_0007223_4379_4981 | 200 |
| 1085 | 3300046501 | Ga0495607_0026377 | Ga0495607_0026377_2233_2835 | 200 |
| 1086 | 3300046501 | Ga0495607_0100086 | Ga0495607_0100086_908_1510 | 200 |
| 1087 | 3300046507 | Ga0495606_0001329 | Ga0495606_0001329_31401_32003 | 200 |
| 1088 | 3300046513 | Ga0495616_0007049 | Ga0495616_0007049_1714_2316 | 200 |
| 1089 | 3300046519 | Ga0495632_0005327 | Ga0495632_0005327_1595_2197 | 200 |
| 1090 | 3300046520 | Ga0495637_0009169 | Ga0495637_0009169_1936_2538 | 200 |
| 1091 | 3300046538 | Ga0495609_0001578 | Ga0495609_0001578_12634_13236 | 200 |
| 1092 | 3300046648 | Ga0495611_0000029 | Ga0495611_0000029_100774_101376 | 200 |
| 1093 | 3300046660 | Ga0495625_0001724 | Ga0495625_0001724_14512_15114 | 200 |
| 1094 | 3300046660 | Ga0495625_0016676 | Ga0495625_0016676_2031_2633 | 200 |
| 1095 | 3300046674 | Ga0495588_0151180 | Ga0495588_0151180_149_751 | 200 |
| 1096 | 3300046691 | Ga0495670_0262669 | Ga0495670_0262669_275_877 | 200 |
| 1097 | 3300046692 | Ga0495671_0005114 | Ga0495671_0005114_1838_2440 | 200 |
| 1098 | 3300046694 | Ga0495649_0000383 | Ga0495649_0000383_1947_2549 | 200 |
| 1099 | 3300046794 | Ga0495589_0000144 | Ga0495589_0000144_22162_22764 | 200 |
| 1100 | 3300046810 | Ga0495660_0003242 | Ga0495660_0003242_7799_8401 | 200 |
| 1101 | 3300047320 | Ga0495672_0018426 | Ga0495672_0018426_640_1245 | 200 |
| 1102 | 3300047321 | Ga0495676_0620206 | Ga0495676_0620206_13_615 | 200 |
| 1103 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_1605222_1605824 | 200 |
| 1104 | 3300047472 | Ga0495686_0002623 | Ga0495686_0002623_1557_2159 | 200 |
| 1105 | 3300048903 | Ga0496100_0006795 | Ga0496100_0006795_4092_4694 | 200 |
| 1106 | 3300048904 | Ga0496101_0009854 | Ga0496101_0009854_655_1257 | 200 |
| 1107 | 3300048904 | Ga0496101_0243688 | Ga0496101_0243688_161_763 | 200 |
| 1108 | 3300048907 | Ga0496104_0045988 | Ga0496104_0045988_3399_4001 | 200 |
| 1109 | 3300048907 | Ga0496104_0159892 | Ga0496104_0159892_660_1262 | 200 |
| 1110 | 3300048908 | Ga0496105_0041905 | Ga0496105_0041905_1413_2015 | 200 |
| 1111 | 3300048910 | Ga0496107_0034298 | Ga0496107_0034298_283_885 | 200 |
| 1112 | 3300048911 | Ga0496108_0143885 | Ga0496108_0143885_517_1119 | 200 |
| 1113 | 3300048912 | Ga0496109_0571328 | Ga0496109_0571328_101_703 | 200 |
| 1114 | 3300048916 | Ga0496113_0471490 | Ga0496113_0471490_13_615 | 200 |
| 1115 | 3300048917 | Ga0496114_0055393 | Ga0496114_0055393_1353_1955 | 200 |
| 1116 | 3300048918 | Ga0496115_0002269 | Ga0496115_0002269_11596_12198 | 200 |
| 1117 | 3300048918 | Ga0496115_0137021 | Ga0496115_0137021_1128_1730 | 200 |
| 1118 | 3300048918 | Ga0496115_0323400 | Ga0496115_0323400_125_727 | 200 |
| 1119 | 3300048919 | Ga0496116_0085191 | Ga0496116_0085191_422_1024 | 200 |
| 1120 | 3300048919 | Ga0496116_0129825 | Ga0496116_0129825_776_1378 | 200 |
| 1121 | 3300048920 | Ga0496117_0063248 | Ga0496117_0063248_1039_1641 | 200 |
| 1122 | 3300048920 | Ga0496117_0360569 | Ga0496117_0360569_53_655 | 200 |
| 1123 | 3300048921 | Ga0496118_0024725 | Ga0496118_0024725_4437_5039 | 200 |
| 1124 | 3300048921 | Ga0496118_0028854 | Ga0496118_0028854_3122_3724 | 200 |
| 1125 | 3300048921 | Ga0496118_0041939 | Ga0496118_0041939_1210_1812 | 200 |
| 1126 | 3300048921 | Ga0496118_0092393 | Ga0496118_0092393_291_893 | 200 |
| 1127 | 3300048921 | Ga0496118_0155303 | Ga0496118_0155303_657_1259 | 200 |
| 1128 | 3300048922 | Ga0496119_0016519 | Ga0496119_0016519_1880_2482 | 200 |
| 1129 | 3300048924 | Ga0496121_0000290 | Ga0496121_0000290_9980_10582 | 200 |
| 1130 | 3300048924 | Ga0496121_0016314 | Ga0496121_0016314_2713_3315 | 200 |
| 1131 | 3300048924 | Ga0496121_0053526 | Ga0496121_0053526_1445_2047 | 200 |
| 1132 | 3300048924 | Ga0496121_0056865 | Ga0496121_0056865_1703_2305 | 200 |
| 1133 | 3300048925 | Ga0496122_0176593 | Ga0496122_0176593_62_664 | 200 |
| 1134 | 3300048926 | Ga0496123_0033327 | Ga0496123_0033327_2156_2758 | 200 |
| 1135 | 3300048926 | Ga0496123_0070780 | Ga0496123_0070780_637_1239 | 200 |
| 1136 | 3300048926 | Ga0496123_0094978 | Ga0496123_0094978_930_1532 | 200 |
| 1137 | 3300048926 | Ga0496123_0259638 | Ga0496123_0259638_22_624 | 200 |
| 1138 | 3300048927 | Ga0496124_0000472 | Ga0496124_0000472_1694_2296 | 200 |
| 1139 | 3300048928 | Ga0496125_0000379 | Ga0496125_0000379_81022_81624 | 200 |
| 1140 | 3300048928 | Ga0496125_0024621 | Ga0496125_0024621_3546_4148 | 200 |
| 1141 | 3300048928 | Ga0496125_0042644 | Ga0496125_0042644_494_1096 | 200 |
| 1142 | 3300048929 | Ga0496126_0028743 | Ga0496126_0028743_2184_2786 | 200 |
| 1143 | 3300048929 | Ga0496126_0119779 | Ga0496126_0119779_354_956 | 200 |
| 1144 | 3300049459 | Ga0495678_004567 | Ga0495678_004567_2355_2957 | 200 |
| 1145 | 3300049459 | Ga0495678_016742 | Ga0495678_016742_1659_2261 | 200 |
| 1146 | 3300049460 | Ga0495682_0073233 | Ga0495682_0073233_496_1098 | 200 |
| 1147 | 3300049568 | Ga0501031_0047206 | Ga0501031_0047206_2057_2659 | 200 |
| 1148 | 3300049568 | Ga0501031_0063611 | Ga0501031_0063611_915_1517 | 200 |
| 1149 | 3300049569 | Ga0501032_0020602 | Ga0501032_0020602_2575_3177 | 200 |
| 1150 | 3300049569 | Ga0501032_0025237 | Ga0501032_0025237_1975_2577 | 200 |
| 1151 | 3300049570 | Ga0501033_0000337 | Ga0501033_0000337_1415_2017 | 200 |
| 1152 | 3300049570 | Ga0501033_0060996 | Ga0501033_0060996_98_715 | 200 |
| 1153 | 3300049571 | Ga0501034_0008263 | Ga0501034_0008263_8892_9494 | 200 |
| 1154 | 3300049571 | Ga0501034_0025504 | Ga0501034_0025504_1414_2016 | 200 |
| 1155 | 3300049572 | Ga0501036_0030355 | Ga0501036_0030355_3816_4418 | 200 |
| 1156 | 3300049572 | Ga0501036_0037846 | Ga0501036_0037846_2104_2706 | 200 |
| 1157 | 3300049572 | Ga0501036_0665537 | Ga0501036_0665537_59_661 | 200 |
| 1158 | 3300049573 | Ga0501037_0019227 | Ga0501037_0019227_710_1312 | 200 |
| 1159 | 3300049573 | Ga0501037_0127086 | Ga0501037_0127086_322_924 | 200 |
| 1160 | 3300049573 | Ga0501037_0204211 | Ga0501037_0204211_549_1151 | 200 |
| 1161 | 3300049574 | Ga0501038_0013134 | Ga0501038_0013134_2183_2785 | 200 |
| 1162 | 3300049574 | Ga0501038_0055414 | Ga0501038_0055414_1391_1993 | 200 |
| 1163 | 3300049574 | Ga0501038_0283895 | Ga0501038_0283895_424_1026 | 200 |
| 1164 | 3300049574 | Ga0501038_0326070 | Ga0501038_0326070_575_1177 | 200 |
| 1165 | 3300049575 | Ga0501039_0036074 | Ga0501039_0036074_1477_2079 | 200 |
| 1166 | 3300049575 | Ga0501039_0128008 | Ga0501039_0128008_548_1150 | 200 |
| 1167 | 3300049576 | Ga0501040_0187968 | Ga0501040_0187968_641_1243 | 200 |
| 1168 | 3300049578 | Ga0501042_0056670 | Ga0501042_0056670_548_1150 | 200 |
| 1169 | 3300049578 | Ga0501042_0160846 | Ga0501042_0160846_834_1436 | 200 |
| 1170 | 3300049579 | Ga0501043_0016278 | Ga0501043_0016278_1478_2095 | 200 |
| 1171 | 3300049579 | Ga0501043_0113617 | Ga0501043_0113617_1415_2017 | 200 |
| 1172 | 3300049579 | Ga0501043_0141105 | Ga0501043_0141105_990_1592 | 200 |
| 1173 | 3300049579 | Ga0501043_0147266 | Ga0501043_0147266_437_1039 | 200 |
| 1174 | 3300049579 | Ga0501043_0269409 | Ga0501043_0269409_670_1272 | 200 |
| 1175 | 3300049580 | Ga0501046_0025093 | Ga0501046_0025093_2794_3396 | 200 |
| 1176 | 3300049580 | Ga0501046_0034206 | Ga0501046_0034206_1720_2322 | 200 |
| 1177 | 3300049580 | Ga0501046_0100330 | Ga0501046_0100330_1358_1960 | 200 |
| 1178 | 3300049580 | Ga0501046_0113833 | Ga0501046_0113833_1215_1817 | 200 |
| 1179 | 3300049581 | Ga0501047_0103968 | Ga0501047_0103968_750_1352 | 200 |
| 1180 | 3300049581 | Ga0501047_0136357 | Ga0501047_0136357_1131_1733 | 200 |
| 1181 | 3300049581 | Ga0501047_0383280 | Ga0501047_0383280_277_879 | 200 |
| 1182 | 3300049581 | Ga0501047_0629767 | Ga0501047_0629767_125_727 | 200 |
| 1183 | 3300049582 | Ga0501048_0021518 | Ga0501048_0021518_2756_3358 | 200 |
| 1184 | 3300049582 | Ga0501048_0029557 | Ga0501048_0029557_2342_2944 | 200 |
| 1185 | 3300049582 | Ga0501048_0132280 | Ga0501048_0132280_316_918 | 200 |
| 1186 | 3300049583 | Ga0501067_0015294 | Ga0501067_0015294_2502_3104 | 200 |
| 1187 | 3300049585 | Ga0501069_0036066 | Ga0501069_0036066_149_751 | 200 |
| 1188 | 3300049586 | Ga0501070_0022172 | Ga0501070_0022172_905_1513 | 200 |
| 1189 | 3300049586 | Ga0501070_0033585 | Ga0501070_0033585_2557_3159 | 200 |
| 1190 | 3300049586 | Ga0501070_0038865 | Ga0501070_0038865_1568_2170 | 200 |
| 1191 | 3300049586 | Ga0501070_0130993 | Ga0501070_0130993_1230_1832 | 200 |
| 1192 | 3300049587 | Ga0501071_0088182 | Ga0501071_0088182_290_892 | 200 |
| 1193 | 3300049587 | Ga0501071_0441656 | Ga0501071_0441656_290_892 | 200 |
| 1194 | 3300049589 | Ga0501073_0029914 | Ga0501073_0029914_1033_1635 | 200 |
| 1195 | 3300049589 | Ga0501073_0078475 | Ga0501073_0078475_1359_1961 | 200 |
| 1196 | 3300049590 | Ga0501074_0074903 | Ga0501074_0074903_277_879 | 200 |
| 1197 | 3300049590 | Ga0501074_0148950 | Ga0501074_0148950_322_924 | 200 |
| 1198 | 3300049590 | Ga0501074_0685815 | Ga0501074_0685815_95_697 | 200 |
| 1199 | 3300049591 | Ga0501075_0321697 | Ga0501075_0321697_432_1034 | 200 |
| 1200 | 3300049742 | Ga0501080_0016130 | Ga0501080_0016130_4902_5510 | 200 |
| 1201 | 3300049742 | Ga0501080_0045089 | Ga0501080_0045089_2114_2716 | 200 |
| 1202 | 3300049742 | Ga0501080_0049719 | Ga0501080_0049719_1326_1928 | 200 |
| 1203 | 3300049743 | Ga0501081_0073960 | Ga0501081_0073960_819_1421 | 200 |
| 1204 | 3300049744 | Ga0501083_0057300 | Ga0501083_0057300_1101_1703 | 200 |
| 1205 | 3300049744 | Ga0501083_0240929 | Ga0501083_0240929_85_687 | 200 |
| 1206 | 3300049822 | Ga0501035_0021041 | Ga0501035_0021041_3630_4232 | 200 |
| 1207 | 3300049822 | Ga0501035_0043368 | Ga0501035_0043368_2344_2946 | 200 |
| 1208 | 3300049822 | Ga0501035_0213194 | Ga0501035_0213194_620_1222 | 200 |
| 1209 | 3300049822 | Ga0501035_0627844 | Ga0501035_0627844_154_756 | 200 |
| 1210 | 3300049822 | Ga0501035_0828346 | Ga0501035_0828346_77_694 | 200 |
| 1211 | 3300049823 | Ga0501044_0053687 | Ga0501044_0053687_2018_2620 | 200 |
| 1212 | 3300049823 | Ga0501044_0128002 | Ga0501044_0128002_1392_1994 | 200 |
| 1213 | 3300049823 | Ga0501044_0312859 | Ga0501044_0312859_290_892 | 200 |
| 1214 | 3300049823 | Ga0501044_0453222 | Ga0501044_0453222_537_1139 | 200 |
| 1215 | 3300049823 | Ga0501044_0583195 | Ga0501044_0583195_265_867 | 200 |
| 1216 | 3300049824 | Ga0501045_0042206 | Ga0501045_0042206_2561_3163 | 200 |
| 1217 | 3300053087 | Ga0500643_000120 | Ga0500643_000120_41341_41943 | 200 |
| 1218 | 3300053093 | Ga0500651_0000131 | Ga0500651_0000131_24903_25505 | 200 |
| 1219 | 3300053103 | Ga0500555_001368 | Ga0500555_001368_5005_5607 | 200 |
| 1220 | 3300053139 | Ga0500568_0019513 | Ga0500568_0019513_1161_1763 | 200 |
| 1221 | 3300059478 | Ga0587093_001690 | Ga0587093_001690_1214_1816 | 200 |
| 1222 | 3300059492 | Ga0587073_0001891 | Ga0587073_0001891_1235_1837 | 200 |
| 1223 | 3300059492 | Ga0587073_0022645 | Ga0587073_0022645_173_775 | 200 |
| 1224 | 3300059503 | Ga0587080_001372 | Ga0587080_001372_717_1319 | 200 |
| 1225 | 3300059503 | Ga0587080_003084 | Ga0587080_003084_527_1129 | 200 |
| 1226 | 3300059504 | Ga0587082_000933 | Ga0587082_000933_877_1479 | 200 |
| 1227 | 3300059505 | Ga0587083_0050429 | Ga0587083_0050429_184_786 | 200 |
| 1228 | 3300059508 | Ga0587088_000941 | Ga0587088_000941_889_1491 | 200 |
| 1229 | 3300059508 | Ga0587088_001539 | Ga0587088_001539_541_1143 | 200 |
| 1230 | 3300059510 | Ga0587090_000930 | Ga0587090_000930_1372_1974 | 200 |
| 1231 | 3300059511 | Ga0587091_013769 | Ga0587091_013769_58_660 | 200 |
| 1232 | 3300059513 | Ga0587094_012935 | Ga0587094_012935_177_779 | 200 |
| 1233 | 3300059605 | Ga0587106_000089 | Ga0587106_000089_1479_2081 | 200 |
| 1234 | 3300059622 | Ga0587099_000319 | Ga0587099_000319_1265_1867 | 200 |
| 1235 | 3300059623 | Ga0587101_004567 | Ga0587101_004567_123_725 | 200 |
| 1236 | 3300059625 | Ga0587113_000588 | Ga0587113_000588_1209_1811 | 200 |
| 1237 | 3300059630 | Ga0587128_002799 | Ga0587128_002799_23_625 | 200 |
| 1238 | 3300059640 | Ga0587067_000398 | Ga0587067_000398_1836_2438 | 200 |
| 1239 | 3300059643 | Ga0587072_001885 | Ga0587072_001885_823_1425 | 200 |
| 1240 | 3300059644 | Ga0587075_002127 | Ga0587075_002127_201_803 | 200 |
| 1241 | 3300059646 | Ga0587078_000692 | Ga0587078_000692_795_1397 | 200 |
| 1242 | 3300059646 | Ga0587078_001522 | Ga0587078_001522_949_1551 | 200 |
| 1243 | 3300059647 | Ga0587079_003247 | Ga0587079_003247_174_776 | 200 |
| 1244 | 3300059659 | Ga0587120_001142 | Ga0587120_001142_254_856 | 200 |
| 1245 | 3300060344 | Ga0587071_002066 | Ga0587071_002066_1210_1812 | 200 |
| 1246 | 3300060344 | Ga0587071_018773 | Ga0587071_018773_514_1116 | 200 |
| 1247 | 3300060353 | Ga0501082_0017750 | Ga0501082_0017750_1182_1784 | 200 |
| 1248 | 3300060353 | Ga0501082_0146414 | Ga0501082_0146414_81_683 | 200 |
| 1249 | 3300061719 | Ga0466962_0007521 | Ga0466962_0007521_2053_2655 | 200 |
| 1250 | 3300061719 | Ga0466962_0021946 | Ga0466962_0021946_1130_1732 | 200 |
| 1251 | 3300061719 | Ga0466962_0039986 | Ga0466962_0039986_1005_1607 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9418 | 1 | 200 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9357 | 1 | 200 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9322 | 1 | 200 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9262 | 1 | 200 |
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9183 | 7 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7824 | 8 | 200 | 3.40.1370.10 |
| af_P60723_1_201_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7793 | 1 | 200 | 3.40.1370.10 |
| af_P60723_1_201_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7762 | 1 | 200 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.758 | 8 | 198 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7513 | 10 | 199 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536U9H5-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9813 | 94 | 200 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A845JRC5-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9726 | 99 | 199 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A536U9H5-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9723 | 94 | 200 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-X0W5J0-F1-model_v4 | 50S ribosomal protein L4 | 0.9678 | 106 | 198 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-C8N6G3-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9677 | 99 | 200 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar