F492195

General Info

Members Datasets Scaffolds Average Seq Length
1251 579 1175 196

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100420032|Ga0070680_1004200323
Length 205
Sequence MELNVIGASSPAKQALNVSDVVFGGEYKKALIHQVVIAYQATGRAGTKAQLSRGEMSGTTKRFKKQKGGGARHGDYRAPIFIGGGVTFAAKPRSYEQKVNRKAYRIAIRSIFAELIRQDRLKVVDNFGIDTPKTSAMVAKLAELNVSGRVLLVSQDADEAVFLAARNIPYINVLDVMGLNPVSLVGSDHVVMTVEAVKKVEEWLA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2643221559 Lysobacter sp. Root559 Isolate Unclassified
8 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
9 2643221573 Lysobacter sp. Root604 Isolate Unclassified
10 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
11 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
12 2643221586 Lysobacter sp. Root667 Isolate Unclassified
13 2643221593 Lysobacter sp. Root690 Isolate Unclassified
14 2643221612 Lysobacter sp. Root76 Isolate Unclassified
15 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
16 2643221695 Lysobacter sp. Root494 Isolate Unclassified
17 2643221720 Lysobacter sp. Root916 Isolate Unclassified
18 2643221727 Lysobacter sp. Root96 Isolate Unclassified
19 2643221728 Lysobacter sp. Root983 Isolate Unclassified
20 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
21 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
22 2734482264 Dyella sp. AD052 Isolate Unclassified
23 2738543009 Luteibacter sp. OK325 Isolate Unclassified
24 2739367700 Dyella sp. YR388 Isolate Unclassified
25 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
26 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
27 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
28 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
29 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
30 2818991457 Xanthomonas translucens 569 Isolate Unclassified
31 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
32 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
33 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
34 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
35 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
36 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
37 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
38 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
39 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
40 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
41 2884411467 Dyella sp. AD56 Isolate Rhizosphere
42 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
43 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
44 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
45 2919085039 Luteibacter sp. 1214 Isolate Unclassified
46 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
47 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
48 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
49 2919404418 Luteibacter sp. 3190 Isolate Unclassified
50 2919513703 Luteimonas sp. 3794 Isolate Unclassified
51 2919675420 Luteimonas terrae 4099 Isolate Unclassified
52 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
53 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
54 2928963466 Dyella japonica 1073 Isolate Unclassified
55 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
56 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
57 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
58 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
59 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
60 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
61 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
62 2941471342 Luteibacter sp. 621 Isolate Unclassified
63 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
64 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
65 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
66 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
67 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
68 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
69 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
70 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
71 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
72 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
73 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
74 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
75 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
76 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
77 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
78 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
81 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
82 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
83 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
84 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
85 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
86 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
87 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
88 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
89 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
90 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
91 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
92 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
93 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
94 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
95 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
96 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
97 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
98 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
99 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
100 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
101 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
103 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
104 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
105 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
106 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
107 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
108 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
109 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
110 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
111 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
112 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
113 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
114 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
115 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
116 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
117 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
118 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
119 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
120 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
121 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
122 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
123 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
124 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
125 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
126 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
127 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
128 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
129 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
130 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
131 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
132 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
133 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
134 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
135 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
136 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
137 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
138 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
139 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
140 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
141 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
142 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
143 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
144 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
145 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
146 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
147 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
148 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
149 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
150 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
151 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
152 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
153 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
154 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
155 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
156 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
157 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
158 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
159 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
160 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
161 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
162 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
163 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
164 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
165 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
166 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
167 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
168 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
169 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
170 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
171 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
172 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
173 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
174 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
175 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
176 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
177 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
178 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
179 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
180 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
181 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
182 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
184 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
185 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
186 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
187 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
188 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
189 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
191 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
197 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
198 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
199 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
200 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
201 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
202 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
203 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
204 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
205 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
206 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
207 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
208 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
209 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
210 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
211 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
212 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
213 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
214 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
215 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
216 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
217 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
218 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
219 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
220 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
221 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
222 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
223 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
224 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
228 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
229 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
233 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
234 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
240 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
241 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
243 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
244 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
245 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
248 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
249 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
250 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
254 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
257 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
259 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
262 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
337 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
338 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
339 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
340 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
341 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
342 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
348 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
349 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
350 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
351 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
352 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
353 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
354 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
355 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
356 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
357 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
358 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
359 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
360 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
361 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
362 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
363 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
364 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
365 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
366 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
367 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
368 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
369 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
370 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
371 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
372 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
373 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
374 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
375 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
376 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
377 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
378 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
379 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
380 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
381 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
382 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
383 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
384 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
385 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
386 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
387 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
388 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
389 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
390 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
391 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
392 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
393 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
394 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
395 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
396 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
397 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
398 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
399 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
400 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
401 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
402 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
403 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
404 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
405 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
406 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
407 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
408 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
409 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
410 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
411 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
412 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
413 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
414 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
415 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
416 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
417 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
418 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
419 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
420 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
421 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
422 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
423 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
424 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
425 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
426 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
427 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
428 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
429 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
430 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
431 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
432 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
433 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
434 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
435 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
436 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
437 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
438 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
439 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
440 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
441 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
442 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
443 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
444 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
445 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
446 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
447 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
448 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
449 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
450 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
451 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
452 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
453 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
454 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
455 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
456 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
457 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
458 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
459 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
460 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
461 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
462 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
463 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
464 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
465 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
466 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
467 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
468 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
469 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
470 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
471 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
472 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
473 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
474 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
475 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
476 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
477 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
478 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
479 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
480 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
481 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
482 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
483 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
484 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
485 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
486 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
487 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
488 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
489 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
490 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
495 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
496 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
508 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
520 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
521 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
522 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
523 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
524 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
525 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
526 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
527 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
528 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
529 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
530 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
531 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
532 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
533 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
534 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
535 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
536 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
537 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
538 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
540 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
541 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
542 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
543 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
544 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
545 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
546 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
547 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
548 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
549 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
550 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
551 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
552 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
574 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
575 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
576 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
577 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
578 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
579 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.73
Metatranscriptomes 7.19
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 13.43
Nodule 0.08
Rhizoplane 4.16
Rhizosphere 70.82
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004671 3300001904 Bacteria 2329
2 JGI24740J21852_10006264 3300001979 Bacteria 4944
3 JGI24739J22299_10000118 3300001989 Bacteria 24899
4 JGI24739J22299_10027486 3300001989 Bacteria 1988
5 JGI24737J22298_10010174 3300001990 Bacteria 3112
6 JGI24737J22298_10010685 3300001990 Bacteria 3024
7 JGI24737J22298_10037402 3300001990 Bacteria 1496
8 JGI24735J21928_10009574 3300002067 Bacteria 3107
9 JGI24735J21928_10011190 3300002067 Bacteria 2848
10 JGI24738J21930_10000244 3300002075 Bacteria 14787
11 JGI24744J21845_10002487 3300002077 Bacteria 3757
12 JGI25156J39149_1002085 3300002705 Bacteria 7577
13 JGI25156J39149_1002290 3300002705 Bacteria 7025
14 JGI25156J39149_1003296 3300002705 Bacteria 5346
15 JGI25156J39149_1007054 3300002705 Bacteria 3002
16 JGI25162J39368_1003847 3300002737 Bacteria 3938
17 JGI25162J39368_1003864 3300002737 Bacteria 3912
18 JGI25162J39368_1003895 3300002737 Bacteria 3875
19 JGI25162J39368_1008978 3300002737 Bacteria 1377
20 JGI25154J39366_1006144 3300002738 Bacteria 1800
21 JGI25157J39369_1001153 3300002741 Bacteria 11428
22 JGI25157J39369_1001750 3300002741 Bacteria 7146
23 JGI25157J39369_1001921 3300002741 Bacteria 6268
24 JGI25157J39369_1002043 3300002741 Bacteria 5780
25 JGI25157J39369_1002044 3300002741 Bacteria 5780
26 JGI25163J39215_1001413 3300002771 Bacteria 4010
27 JGI25164J39214_1000312 3300002772 Bacteria 31934
28 JGI25164J39214_1000781 3300002772 Bacteria 11524
29 JGI25152J39213_1000284 3300002773 Bacteria 33794
30 JGI25150J39212_1000359 3300002774 Bacteria 22362
31 JGI25151J46595_10000895 3300003187 Bacteria 23452
32 JGI25151J46595_10007643 3300003187 Bacteria 5275
33 JGI25151J46595_10013580 3300003187 Bacteria 3661
34 JGI25165J46597_1000586 3300003214 Bacteria 31905
35 JGI25165J46597_1001532 3300003214 Bacteria 11524
36 JGI25165J46597_1010873 3300003214 Bacteria 1315
37 JGI25153J46596_10000050 3300003215 Bacteria 140710
38 JGI25153J46596_10022417 3300003215 Bacteria 2328
39 Ga0006770J48903_1007534 3300003305 Bacteria 6179
40 rootH2_10028076 3300003320 Bacteria 2913
41 JGI25160J50197_1034172 3300003354 Bacteria 1266
42 JGI26145J50221_1000107 3300003371 Bacteria 6560
43 JGI26139J50223_100733 3300003382 Bacteria 1056
44 Ga0006556J51387_1018520 3300003479 Bacteria 14040
45 Ga0006556J51387_1028196 3300003479 Bacteria 2681
46 Ga0006558J51389_1018313 3300003558 Bacteria 6898
47 Ga0006560J51390_1017170 3300003565 Bacteria 14049
48 Ga0006560J51390_1021707 3300003565 Bacteria 2646
49 Ga0006554J51385_1017088 3300003567 Bacteria 14046
50 Ga0006554J51385_1020490 3300003567 Bacteria 10124
51 Ga0007409J51694_1033072 3300003575 Bacteria 2330
52 Ga0006562J51391_1006869 3300003578 Bacteria 31335
53 Ga0006562J51391_1018587 3300003578 Bacteria 6552
54 Ga0032354_1074945 3300003693 Bacteria 1191
55 Ga0055538_1000680 3300003751 Bacteria 10513
56 Ga0055539_1000456 3300003752 Bacteria 13948
57 Ga0055533_1000432 3300003756 Bacteria 15970
58 Ga0055533_1002319 3300003756 Bacteria 4392
59 Ga0055525_1000111 3300003759 Bacteria 127836
60 Ga0055527_1001178 3300003760 Bacteria 5917
61 Ga0055527_1001334 3300003760 Bacteria 5331
62 Ga0055527_1004708 3300003760 Bacteria 1842
63 Ga0055535_1002650 3300003761 Bacteria 5917
64 Ga0055535_1002929 3300003761 Bacteria 5298
65 Ga0055535_1004862 3300003761 Bacteria 3121
66 Ga0055535_1006090 3300003761 Bacteria 2508
67 Ga0055535_1006166 3300003761 Bacteria 2478
68 Ga0055542_1002512 3300003762 Bacteria 5917
69 Ga0055542_1003780 3300003762 Bacteria 3938
70 Ga0055542_1003848 3300003762 Bacteria 3875
71 Ga0055542_1003932 3300003762 Bacteria 3807
72 Ga0055542_1004903 3300003762 Bacteria 3121
73 Ga0055542_1006542 3300003762 Bacteria 2478
74 Ga0055529_1001670 3300003763 Bacteria 5780
75 Ga0055529_1002584 3300003763 Bacteria 3389
76 Ga0055529_1002611 3300003763 Bacteria 3349
77 Ga0055529_1003204 3300003763 Bacteria 2799
78 Ga0055526_1005867 3300003771 Bacteria 6888
79 Ga0055526_1008536 3300003771 Bacteria 5088
80 Ga0055526_1008987 3300003771 Bacteria 4886
81 Ga0055537_1000851 3300003773 Bacteria 14843
82 Ga0055537_1001096 3300003773 Bacteria 11761
83 Ga0055524_1013601 3300003775 Bacteria 3064
84 Ga0055524_1013602 3300003775 Bacteria 3064
85 Ga0055524_1015666 3300003775 Bacteria 2753
86 Ga0055536_1014260 3300003781 Bacteria 2806
87 Ga0055536_1024910 3300003781 Bacteria 1719
88 Ga0055534_1000766 3300003784 Bacteria 15218
89 Ga0055534_1003331 3300003784 Bacteria 5088
90 Ga0055534_1006907 3300003784 Bacteria 2790
91 Ga0055528_1001961 3300003790 Bacteria 11621
92 Ga0055528_1013611 3300003790 Bacteria 3070
93 Ga0055528_1016393 3300003790 Bacteria 2622
94 Ga0055530_10004966 3300003791 Bacteria 6579
95 Ga0055530_10025415 3300003791 Bacteria 1654
96 Ga0055530_10067608 3300003791 Bacteria 779
97 Ga0055531_10014020 3300003794 Bacteria 3645
98 Ga0055531_10017875 3300003794 Bacteria 2963
99 Ga0055531_10026369 3300003794 Bacteria 2075
100 Ga0058692_1000748 3300003856 Bacteria 13063
101 Ga0058692_1000785 3300003856 Bacteria 12735
102 Ga0058860_10137024 3300004801 Bacteria 3744
103 Ga0065165_1000598 3300005262 Bacteria 52772
104 Ga0065165_1033037 3300005262 Bacteria 1615
105 Ga0065714_10109302 3300005288 Bacteria 1502
106 Ga0065704_10071563 3300005289 Bacteria 10695
107 Ga0070658_10987122 3300005327 Bacteria 732
108 Ga0070683_100194209 3300005329 Bacteria 1927
109 Ga0070670_100015496 3300005331 Bacteria 6547
110 Ga0070670_100045008 3300005331 Bacteria 3793
111 Ga0070670_100143059 3300005331 Bacteria 2068
112 Ga0070670_100360366 3300005331 Bacteria 1278
113 Ga0070670_100385915 3300005331 Bacteria 1234
114 Ga0070670_100407778 3300005331 Bacteria 1200
115 Ga0068869_100043109 3300005334 Bacteria 3239
116 Ga0068869_100843709 3300005334 Bacteria 790
117 Ga0070666_10000012 3300005335 Bacteria 244720
118 Ga0070666_10028752 3300005335 Bacteria 3650
119 Ga0070680_100214844 3300005336 Bacteria 1623
120 Ga0070680_100219981 3300005336 Bacteria 1603
121 Ga0070680_100255720 3300005336 Bacteria 1481
122 Ga0070680_100420032 3300005336 Bacteria 1141
123 Ga0070682_100046558 3300005337 Bacteria 2692
124 Ga0070682_100141710 3300005337 Bacteria 1639
125 Ga0070682_100235089 3300005337 Bacteria 1312
126 Ga0068868_100282839 3300005338 Bacteria 1404
127 Ga0070660_100058257 3300005339 Bacteria 2994
128 Ga0070660_100745227 3300005339 Bacteria 822
129 Ga0070689_100041431 3300005340 Bacteria 3535
130 Ga0070691_10463307 3300005341 Bacteria 726
131 Ga0070661_100015281 3300005344 Bacteria 5418
132 Ga0070661_100028282 3300005344 Bacteria 4043
133 Ga0070661_101015440 3300005344 Bacteria 688
134 Ga0070692_10054766 3300005345 Bacteria 2084
135 Ga0070668_100034720 3300005347 Bacteria 3843
136 Ga0070668_100061248 3300005347 Bacteria 2915
137 Ga0070668_100225982 3300005347 Bacteria 1546
138 Ga0070668_100303029 3300005347 Bacteria 1341
139 Ga0070669_100222301 3300005353 Bacteria 1493
140 Ga0070675_100105895 3300005354 Bacteria 2373
141 Ga0070675_100213624 3300005354 Bacteria 1678
142 Ga0070671_100012931 3300005355 Bacteria 6725
143 Ga0070671_100051737 3300005355 Bacteria 3416
144 Ga0070671_100202548 3300005355 Bacteria 1683
145 Ga0070671_100724727 3300005355 Bacteria 863
146 Ga0070673_100109100 3300005364 Bacteria 2292
147 Ga0070673_100170446 3300005364 Bacteria 1858
148 Ga0070673_100209228 3300005364 Bacteria 1684
149 Ga0070659_100219319 3300005366 Bacteria 1569
150 Ga0070659_100231145 3300005366 Bacteria 1528
151 Ga0070659_100393823 3300005366 Bacteria 1168
152 Ga0070659_100794965 3300005366 Bacteria 822
153 Ga0070667_100075141 3300005367 Bacteria 2884
154 Ga0070667_100797580 3300005367 Bacteria 877
155 Ga0070714_100086583 3300005435 Bacteria 2738
156 Ga0070714_100162027 3300005435 Bacteria 2024
157 Ga0070714_100254633 3300005435 Bacteria 1624
158 Ga0070714_100743036 3300005435 Bacteria 948
159 Ga0070714_100793077 3300005435 Bacteria 917
160 Ga0070713_100008401 3300005436 Bacteria 7319
161 Ga0070710_10040859 3300005437 Bacteria 2558
162 Ga0070710_10099927 3300005437 Bacteria 1726
163 Ga0070710_10793862 3300005437 Bacteria 676
164 Ga0070701_10282652 3300005438 Bacteria 1014
165 Ga0070700_100877305 3300005441 Bacteria 729
166 Ga0070694_100380270 3300005444 Bacteria 1101
167 Ga0070663_100036003 3300005455 Bacteria 3438
168 Ga0070663_100053898 3300005455 Bacteria 2873
169 Ga0070663_100059429 3300005455 Bacteria 2747
170 Ga0070663_100088895 3300005455 Bacteria 2285
171 Ga0070663_100112513 3300005455 Bacteria 2047
172 Ga0070663_100112649 3300005455 Bacteria 2046
173 Ga0070663_100150300 3300005455 Bacteria 1785
174 Ga0070663_100772457 3300005455 Bacteria 822
175 Ga0070678_100729891 3300005456 Bacteria 895
176 Ga0070662_100282610 3300005457 Bacteria 1343
177 Ga0070681_10075723 3300005458 Bacteria 3325
178 Ga0070681_10121502 3300005458 Bacteria 2546
179 Ga0070681_10128522 3300005458 Bacteria 2466
180 Ga0070681_10205910 3300005458 Bacteria 1884
181 Ga0070681_10828609 3300005458 Bacteria 843
182 Ga0070685_10002255 3300005466 Bacteria 9947
183 Ga0070679_100385818 3300005530 Bacteria 1347
184 Ga0070679_100466934 3300005530 Bacteria 1206
185 Ga0070684_101113278 3300005535 Bacteria 742
186 Ga0068853_100116876 3300005539 Bacteria 2375
187 Ga0068853_100191675 3300005539 Bacteria 1857
188 Ga0068853_100317536 3300005539 Bacteria 1443
189 Ga0068853_100340462 3300005539 Bacteria 1393
190 Ga0068853_100387241 3300005539 Bacteria 1306
191 Ga0068853_100449667 3300005539 Bacteria 1212
192 Ga0070672_100228215 3300005543 Bacteria 1563
193 Ga0070672_100451180 3300005543 Bacteria 1108
194 Ga0070696_100010164 3300005546 Bacteria 6301
195 Ga0070696_100128219 3300005546 Bacteria 1843
196 Ga0070696_100612860 3300005546 Bacteria 879
197 Ga0070696_100760455 3300005546 Bacteria 795
198 Ga0070693_100016180 3300005547 Bacteria 3854
199 Ga0070693_100025657 3300005547 Bacteria 3173
200 Ga0070693_100028679 3300005547 Bacteria 3028
201 Ga0070693_100296685 3300005547 Bacteria 1088
202 Ga0070665_100000175 3300005548 Bacteria 113874
203 Ga0070665_100004322 3300005548 Bacteria 14941
204 Ga0070665_100105834 3300005548 Bacteria 2815
205 Ga0070665_100152522 3300005548 Bacteria 2313
206 Ga0070665_100177902 3300005548 Bacteria 2128
207 Ga0070665_100564696 3300005548 Bacteria 1150
208 Ga0070704_100439193 3300005549 Bacteria 1121
209 Ga0068855_100149075 3300005563 Bacteria 2660
210 Ga0068855_100231949 3300005563 Bacteria 2066
211 Ga0068855_100886189 3300005563 Bacteria 943
212 Ga0068855_101018046 3300005563 Bacteria 869
213 Ga0068857_100000998 3300005577 Bacteria 21742
214 Ga0068857_100087151 3300005577 Bacteria 2792
215 Ga0068857_100132398 3300005577 Bacteria 2249
216 Ga0068857_100210127 3300005577 Bacteria 1776
217 Ga0068857_100262434 3300005577 Bacteria 1585
218 Ga0068857_100347807 3300005577 Bacteria 1372
219 Ga0068857_100480645 3300005577 Bacteria 1164
220 Ga0068854_100054495 3300005578 Bacteria 2876
221 Ga0068854_100278013 3300005578 Bacteria 1347
222 Ga0068854_100482745 3300005578 Bacteria 1041
223 Ga0068854_100536279 3300005578 Bacteria 990
224 Ga0068854_100536280 3300005578 Bacteria 990
225 Ga0068854_100559185 3300005578 Bacteria 971
226 Ga0068856_100004797 3300005614 Bacteria 13405
227 Ga0068856_100076451 3300005614 Bacteria 3317
228 Ga0068856_100184419 3300005614 Bacteria 2100
229 Ga0068852_100058397 3300005616 Bacteria 3342
230 Ga0068852_100248113 3300005616 Bacteria 1704
231 Ga0068859_100122263 3300005617 Bacteria 2670
232 Ga0068859_100275251 3300005617 Bacteria 1776
233 Ga0068859_101205008 3300005617 Bacteria 834
234 Ga0068864_100069812 3300005618 Bacteria 3055
235 Ga0068851_10014017 3300005834 Bacteria 3800
236 Ga0068851_10044959 3300005834 Bacteria 2231
237 Ga0068851_10059998 3300005834 Bacteria 1947
238 Ga0068863_100100973 3300005841 Bacteria 2742
239 Ga0068863_100162700 3300005841 Bacteria 2139
240 Ga0068858_100048710 3300005842 Bacteria 3925
241 Ga0068858_100075141 3300005842 Bacteria 3138
242 Ga0068858_100285650 3300005842 Bacteria 1572
243 Ga0068860_100054090 3300005843 Bacteria 3816
244 Ga0068860_100079152 3300005843 Bacteria 3125
245 Ga0068860_100369392 3300005843 Bacteria 1414
246 Ga0068862_100164162 3300005844 Bacteria 1984
247 Ga0068862_100477495 3300005844 Bacteria 1180
248 Ga0081455_10053310 3300005937 Bacteria 3455
249 Ga0081540_1000720 3300005983 Bacteria 30494
250 Ga0081539_10024522 3300005985 Bacteria 3909
251 Ga0075365_10255181 3300006038 Bacteria 1233
252 Ga0075363_100202638 3300006048 Bacteria 1134
253 Ga0070715_10144003 3300006163 Bacteria 1161
254 Ga0070716_100692208 3300006173 Bacteria 778
255 Ga0070712_100527301 3300006175 Bacteria 993
256 Ga0097621_100195694 3300006237 Bacteria 1753
257 Ga0097621_100956787 3300006237 Bacteria 800
258 Ga0068871_100100892 3300006358 Bacteria 2418
259 Ga0068871_100119042 3300006358 Bacteria 2229
260 Ga0068871_100342936 3300006358 Bacteria 1320
261 Ga0068865_100029937 3300006881 Bacteria 3616
262 Ga0068865_100071838 3300006881 Bacteria 2456
263 Ga0097620_100122253 3300006931 Bacteria 2670
264 Ga0097620_100275240 3300006931 Bacteria 1776
265 Ga0097620_100506219 3300006931 Bacteria 1303
266 Ga0097620_101205147 3300006931 Bacteria 834
267 Ga0105251_10003747 3300009011 Bacteria 10880
268 Ga0105251_10018245 3300009011 Bacteria 3736
269 Ga0105244_10014959 3300009036 Bacteria 4464
270 Ga0105244_10048884 3300009036 Bacteria 2163
271 Ga0105240_10257037 3300009093 Bacteria 2017
272 Ga0105240_10699632 3300009093 Bacteria 1106
273 Ga0105240_10699669 3300009093 Bacteria 1106
274 Ga0111539_10329500 3300009094 Bacteria 1777
275 Ga0105245_11928201 3300009098 Bacteria 644
276 Ga0105247_10001324 3300009101 Bacteria 18074
277 Ga0105247_10014280 3300009101 Bacteria 4767
278 Ga0105243_10036695 3300009148 Bacteria 3806
279 Ga0105243_10063811 3300009148 Bacteria 2953
280 Ga0105241_11148800 3300009174 Bacteria 733
281 Ga0105248_10578454 3300009177 Bacteria 1267
282 Ga0105237_10050085 3300009545 Bacteria 4197
283 Ga0105237_10051347 3300009545 Bacteria 4141
284 Ga0105237_10073900 3300009545 Bacteria 3401
285 Ga0105238_10039356 3300009551 Bacteria 4794
286 Ga0105238_10067600 3300009551 Bacteria 3574
287 Ga0105238_10145294 3300009551 Bacteria 2348
288 Ga0105238_10264938 3300009551 Bacteria 1698
289 Ga0105238_10361347 3300009551 Bacteria 1441
290 Ga0105238_10756217 3300009551 Bacteria 986
291 Ga0105032_100517 3300009979 Bacteria 3853
292 Ga0105239_10006660 3300010375 Bacteria 13359
293 Ga0105239_10090407 3300010375 Bacteria 3378
294 Ga0105239_10139444 3300010375 Bacteria 2701
295 Ga0105239_10141288 3300010375 Bacteria 2683
296 Ga0105239_10572982 3300010375 Bacteria 1286
297 Ga0105246_10200918 3300011119 Bacteria 1549
298 Ga0157336_1001516 3300012477 Bacteria 1215
299 Ga0157314_1000456 3300012500 Bacteria 4009
300 Ga0157316_1004643 3300012510 Bacteria 1051
301 Ga0157327_1000560 3300012512 Bacteria 2034
302 Ga0157326_1006833 3300012513 Bacteria 1224
303 Ga0157373_10096936 3300013100 Bacteria 2076
304 Ga0157373_10142986 3300013100 Bacteria 1683
305 Ga0157371_10045126 3300013102 Bacteria 3137
306 Ga0157371_10063110 3300013102 Bacteria 2626
307 Ga0157371_10083622 3300013102 Bacteria 2260
308 Ga0157371_10432117 3300013102 Bacteria 966
309 Ga0157371_10707468 3300013102 Bacteria 754
310 Ga0157370_10062752 3300013104 Bacteria 3523
311 Ga0157370_10069149 3300013104 Bacteria 3335
312 Ga0157370_10104910 3300013104 Bacteria 2646
313 Ga0157370_10119558 3300013104 Bacteria 2460
314 Ga0157370_10125529 3300013104 Bacteria 2395
315 Ga0157370_10285025 3300013104 Bacteria 1526
316 Ga0157369_10004613 3300013105 Bacteria 16198
317 Ga0157369_10036937 3300013105 Bacteria 5351
318 Ga0157369_10097097 3300013105 Bacteria 3143
319 Ga0157369_10107916 3300013105 Bacteria 2961
320 Ga0157369_10312189 3300013105 Bacteria 1635
321 Ga0157369_11175580 3300013105 Bacteria 783
322 Ga0157374_10190512 3300013296 Bacteria 2006
323 Ga0157374_10395321 3300013296 Bacteria 1378
324 Ga0157378_10023199 3300013297 Bacteria 5461
325 Ga0157378_11019923 3300013297 Bacteria 862
326 Ga0163162_10001854 3300013306 Bacteria 19906
327 Ga0163162_10046484 3300013306 Bacteria 4351
328 Ga0163162_10070045 3300013306 Bacteria 3559
329 Ga0163162_10281252 3300013306 Bacteria 1796
330 Ga0157372_10094273 3300013307 Bacteria 3408
331 Ga0157372_10157288 3300013307 Bacteria 2625
332 Ga0157372_10181931 3300013307 Bacteria 2433
333 Ga0157372_10241293 3300013307 Bacteria 2097
334 Ga0157372_10560165 3300013307 Bacteria 1332
335 Ga0157372_10616942 3300013307 Bacteria 1264
336 Ga0157372_10802551 3300013307 Bacteria 1094
337 Ga0157372_10903033 3300013307 Bacteria 1025
338 Ga0157375_10377773 3300013308 Bacteria 1584
339 Ga0157375_10803357 3300013308 Bacteria 1089
340 Ga0163163_10165866 3300014325 Bacteria 2255
341 Ga0163163_10509119 3300014325 Bacteria 1266
342 Ga0157380_10515134 3300014326 Bacteria 1165
343 Ga0182008_10010846 3300014497 Bacteria 4865
344 Ga0182008_10077246 3300014497 Bacteria 1638
345 Ga0182008_10077601 3300014497 Bacteria 1634
346 Ga0182006_1023134 3300015261 Bacteria 2575
347 Ga0182006_1043661 3300015261 Bacteria 1752
348 Ga0182007_10001054 3300015262 Bacteria 15057
349 Ga0182005_1012026 3300015265 Bacteria 2453
350 Ga0182005_1045440 3300015265 Bacteria 1193
351 Ga0182005_1064493 3300015265 Bacteria 1002
352 Ga0183369_1007 3300015685 Bacteria 414878
353 Ga0183368_1002 3300015687 Bacteria 1865598
354 Ga0183360_10001 3300015689 Bacteria 3943671
355 Ga0163161_10075142 3300017792 Bacteria 2479
356 Ga0163161_10348494 3300017792 Bacteria 1177
357 Ga0197907_10947378 3300020069 Bacteria 3159
358 Ga0206356_10171056 3300020070 Bacteria 2333
359 Ga0206356_10221074 3300020070 Bacteria 1209
360 Ga0206356_10657042 3300020070 Bacteria 879
361 Ga0206349_1346577 3300020075 Bacteria 1686
362 Ga0206349_1852705 3300020075 Bacteria 1928
363 Ga0206355_1315307 3300020076 Bacteria 2083
364 Ga0206355_1347985 3300020076 Bacteria 4206
365 Ga0206355_1642390 3300020076 Bacteria 747
366 Ga0206355_1657004 3300020076 Bacteria 2465
367 Ga0206351_10229607 3300020077 Bacteria 2662
368 Ga0206351_10721784 3300020077 Bacteria 2811
369 Ga0206352_10790062 3300020078 Bacteria 2532
370 Ga0206352_11356790 3300020078 Bacteria 2706
371 Ga0206350_10322002 3300020080 Bacteria 2103
372 Ga0154015_1195220 3300020610 Bacteria 930
373 Ga0224712_10003939 3300022467 Bacteria 3939
374 Ga0224712_10013385 3300022467 Bacteria 2610
375 Ga0209435_101200 3300025206 Bacteria 3488
376 Ga0209435_106506 3300025206 Bacteria 1299
377 Ga0209784_100167 3300025224 Bacteria 56563
378 Ga0209566_103884 3300025225 Bacteria 2152
379 Ga0209674_100043 3300025226 Bacteria 369728
380 Ga0209674_100381 3300025226 Bacteria 23509
381 Ga0209674_102055 3300025226 Bacteria 4611
382 Ga0209674_102881 3300025226 Bacteria 3418
383 Ga0209672_100004 3300025228 Bacteria 1467504
384 Ga0209672_100029 3300025228 Bacteria 339298
385 Ga0209672_101110 3300025228 Bacteria 11367
386 Ga0209672_102109 3300025228 Bacteria 5311
387 Ga0209672_104042 3300025228 Bacteria 2830
388 Ga0209563_100103 3300025230 Bacteria 151835
389 Ga0207427_100144 3300025231 Bacteria 82742
390 Ga0207427_100209 3300025231 Bacteria 53322
391 Ga0207427_100327 3300025231 Bacteria 31981
392 Ga0207427_104741 3300025231 Bacteria 2153
393 Ga0207427_118277 3300025231 Bacteria 643
394 Ga0209437_100020 3300025233 Bacteria 656374
395 Ga0209437_100193 3300025233 Bacteria 122027
396 Ga0209437_100256 3300025233 Bacteria 82734
397 Ga0209437_100465 3300025233 Bacteria 31828
398 Ga0209437_103094 3300025233 Bacteria 3065
399 Ga0209258_100003 3300025242 Bacteria 1467504
400 Ga0209258_100053 3300025242 Bacteria 339233
401 Ga0209258_100149 3300025242 Bacteria 162184
402 Ga0209258_100329 3300025242 Bacteria 71786
403 Ga0209258_103384 3300025242 Bacteria 3457
404 Ga0207425_1000117 3300025245 Bacteria 74911
405 Ga0207425_1005550 3300025245 Bacteria 3581
406 Ga0209646_1000796 3300025246 Bacteria 10762
407 Ga0209646_1002116 3300025246 Bacteria 4623
408 Ga0209646_1006538 3300025246 Bacteria 1953
409 Ga0209026_1000060 3300025250 Bacteria 220052
410 Ga0209026_1000274 3300025250 Bacteria 61312
411 Ga0209026_1000293 3300025250 Bacteria 55650
412 Ga0209026_1000516 3300025250 Bacteria 27200
413 Ga0209026_1001271 3300025250 Bacteria 11502
414 Ga0209026_1006743 3300025250 Bacteria 2739
415 Ga0209026_1022088 3300025250 Bacteria 977
416 Ga0209677_107876 3300025253 Bacteria 2167
417 Ga0209677_121643 3300025253 Bacteria 734
418 Ga0209148_1000002 3300025254 Bacteria 2399500
419 Ga0209148_1000009 3300025254 Bacteria 1395625
420 Ga0209148_1000010 3300025254 Bacteria 1265567
421 Ga0209148_1000025 3300025254 Bacteria 663262
422 Ga0209148_1000039 3300025254 Bacteria 482479
423 Ga0209148_1000143 3300025254 Bacteria 162184
424 Ga0209148_1002653 3300025254 Bacteria 5782
425 Ga0209759_1000658 3300025256 Bacteria 32027
426 Ga0209759_1001919 3300025256 Bacteria 10178
427 Ga0209759_1002020 3300025256 Bacteria 9629
428 Ga0209759_1007439 3300025256 Bacteria 3520
429 Ga0209759_1010126 3300025256 Bacteria 2786
430 Ga0209759_1016259 3300025256 Bacteria 1887
431 Ga0209129_1000011 3300025258 Bacteria 568657
432 Ga0209129_1000835 3300025258 Bacteria 19351
433 Ga0209129_1002898 3300025258 Bacteria 7887
434 Ga0209233_1000009 3300025261 Bacteria 1265567
435 Ga0209233_1000020 3300025261 Bacteria 798224
436 Ga0209233_1000151 3300025261 Bacteria 176515
437 Ga0209233_1000920 3300025261 Bacteria 12852
438 Ga0209233_1012013 3300025261 Bacteria 2526
439 Ga0209565_1000001 3300025263 Bacteria 2950419
440 Ga0209565_1000415 3300025263 Bacteria 35224
441 Ga0209455_1000004 3300025272 Bacteria 1467504
442 Ga0209455_1000034 3300025272 Bacteria 483129
443 Ga0209455_1000060 3300025272 Bacteria 339298
444 Ga0209455_1000086 3300025272 Bacteria 244650
445 Ga0209455_1000095 3300025272 Bacteria 217487
446 Ga0209673_1000001 3300025273 Bacteria 3176258
447 Ga0209673_1000204 3300025273 Bacteria 119618
448 Ga0209673_1002116 3300025273 Bacteria 14881
449 Ga0209130_1003085 3300025284 Bacteria 7454
450 Ga0209130_1007816 3300025284 Bacteria 3243
451 Ga0209675_1000001 3300025291 Bacteria 2950293
452 Ga0209675_1000015 3300025291 Bacteria 403517
453 Ga0209675_1006904 3300025291 Bacteria 4460
454 Ga0209676_1000110 3300025292 Bacteria 214083
455 Ga0209676_1001608 3300025292 Bacteria 20029
456 Ga0209676_1004379 3300025292 Bacteria 7893
457 Ga0209676_1004892 3300025292 Bacteria 7229
458 Ga0209676_1006351 3300025292 Bacteria 5858
459 Ga0209025_1000002 3300025294 Bacteria 1393142
460 Ga0209025_1000006 3300025294 Bacteria 1153444
461 Ga0209564_1000001 3300025295 Bacteria 3176258
462 Ga0209564_1000037 3300025295 Bacteria 414794
463 Ga0209564_1007141 3300025295 Bacteria 5828
464 Ga0209758_1000003 3300025297 Bacteria 1398533
465 Ga0209758_1005974 3300025297 Bacteria 9015
466 Ga0209758_1015882 3300025297 Bacteria 3866
467 Ga0209758_1083243 3300025297 Bacteria 960
468 Ga0209050_1001128 3300025298 Bacteria 32216
469 Ga0209050_1053325 3300025298 Bacteria 1006
470 Ga0209256_1000002 3300025299 Bacteria 1906740
471 Ga0209256_1002932 3300025299 Bacteria 12813
472 Ga0209256_1003821 3300025299 Bacteria 10090
473 Ga0209256_1007814 3300025299 Bacteria 5148
474 Ga0207426_1003657 3300025302 Bacteria 8109
475 Ga0207426_1068355 3300025302 Bacteria 999
476 Ga0209051_1001513 3300025303 Bacteria 19394
477 Ga0209051_1009469 3300025303 Bacteria 5018
478 Ga0209051_1028616 3300025303 Bacteria 2197
479 Ga0209257_1000129 3300025304 Bacteria 214155
480 Ga0209257_1002665 3300025304 Bacteria 17133
481 Ga0209257_1006382 3300025304 Bacteria 7632
482 Ga0209257_1006637 3300025304 Bacteria 7356
483 Ga0207697_10049742 3300025315 Bacteria 1730
484 Ga0207656_10367844 3300025321 Bacteria 719
485 Ga0207655_1022400 3300025728 Bacteria 3168
486 Ga0207655_1039647 3300025728 Bacteria 2042
487 Ga0207713_1000294 3300025735 Bacteria 57476
488 Ga0207713_1004451 3300025735 Bacteria 9073
489 Ga0207682_10033068 3300025893 Bacteria 2080
490 Ga0207692_10016367 3300025898 Bacteria 3283
491 Ga0207692_10056387 3300025898 Bacteria 2015
492 Ga0207680_10000013 3300025903 Bacteria 244716
493 Ga0207680_10002673 3300025903 Bacteria 8337
494 Ga0207647_10011795 3300025904 Bacteria 6108
495 Ga0207647_10032989 3300025904 Bacteria 3320
496 Ga0207647_10047348 3300025904 Bacteria 2675
497 Ga0207647_10062600 3300025904 Bacteria 2266
498 Ga0207647_10094179 3300025904 Bacteria 1784
499 Ga0207647_10096744 3300025904 Bacteria 1756
500 Ga0207645_10015566 3300025907 Bacteria 5050
501 Ga0207645_10107422 3300025907 Bacteria 1805
502 Ga0207643_10160910 3300025908 Bacteria 1351
503 Ga0207705_10031780 3300025909 Bacteria 3770
504 Ga0207705_10060885 3300025909 Bacteria 2727
505 Ga0207705_10512893 3300025909 Bacteria 931
506 Ga0207707_10007311 3300025912 Bacteria 9616
507 Ga0207707_10046392 3300025912 Bacteria 3784
508 Ga0207707_10108295 3300025912 Bacteria 2429
509 Ga0207707_10277754 3300025912 Bacteria 1451
510 Ga0207695_10008130 3300025913 Bacteria 13192
511 Ga0207695_10016662 3300025913 Bacteria 8588
512 Ga0207695_10030817 3300025913 Bacteria 5900
513 Ga0207695_10148552 3300025913 Bacteria 2285
514 Ga0207695_10581056 3300025913 Bacteria 1002
515 Ga0207671_10000021 3300025914 Bacteria 300409
516 Ga0207671_10028839 3300025914 Bacteria 4146
517 Ga0207671_10054495 3300025914 Bacteria 2963
518 Ga0207693_10196988 3300025915 Bacteria 1584
519 Ga0207663_10652633 3300025916 Bacteria 830
520 Ga0207660_10067512 3300025917 Bacteria 2590
521 Ga0207660_10533695 3300025917 Bacteria 953
522 Ga0207657_10006384 3300025919 Bacteria 12243
523 Ga0207657_10174148 3300025919 Bacteria 1742
524 Ga0207657_10174180 3300025919 Bacteria 1742
525 Ga0207649_10065071 3300025920 Bacteria 2307
526 Ga0207649_10147830 3300025920 Bacteria 1615
527 Ga0207649_10533300 3300025920 Bacteria 896
528 Ga0207652_10055937 3300025921 Bacteria 3395
529 Ga0207652_10097888 3300025921 Bacteria 2586
530 Ga0207652_10557595 3300025921 Bacteria 1029
531 Ga0207681_10248036 3300025923 Bacteria 1389
532 Ga0207681_10417210 3300025923 Bacteria 1087
533 Ga0207694_10016063 3300025924 Bacteria 5648
534 Ga0207694_10088183 3300025924 Bacteria 2445
535 Ga0207694_10093128 3300025924 Bacteria 2379
536 Ga0207694_10152495 3300025924 Bacteria 1862
537 Ga0207694_10190862 3300025924 Bacteria 1664
538 Ga0207694_10333983 3300025924 Bacteria 1253
539 Ga0207650_10004000 3300025925 Bacteria 10085
540 Ga0207650_10023595 3300025925 Bacteria 4364
541 Ga0207650_10288516 3300025925 Bacteria 1337
542 Ga0207659_10242293 3300025926 Bacteria 1459
543 Ga0207700_10741499 3300025928 Bacteria 878
544 Ga0207664_10001884 3300025929 Bacteria 13792
545 Ga0207664_10728135 3300025929 Bacteria 892
546 Ga0207664_10775667 3300025929 Bacteria 862
547 Ga0207644_10004894 3300025931 Bacteria 8728
548 Ga0207644_10011422 3300025931 Bacteria 5875
549 Ga0207644_10090873 3300025931 Bacteria 2275
550 Ga0207690_10000291 3300025932 Bacteria 35587
551 Ga0207690_10207151 3300025932 Bacteria 1493
552 Ga0207690_10543009 3300025932 Bacteria 944
553 Ga0207690_10694490 3300025932 Bacteria 836
554 Ga0207706_10100114 3300025933 Bacteria 2550
555 Ga0207706_10638697 3300025933 Bacteria 912
556 Ga0207709_10000421 3300025935 Bacteria 41092
557 Ga0207709_10044385 3300025935 Bacteria 2685
558 Ga0207670_10123040 3300025936 Bacteria 1889
559 Ga0207670_10342728 3300025936 Bacteria 1181
560 Ga0207669_10885421 3300025937 Bacteria 745
561 Ga0207704_10017680 3300025938 Bacteria 3703
562 Ga0207704_10088244 3300025938 Bacteria 2028
563 Ga0207665_10101234 3300025939 Bacteria 2011
564 Ga0207691_10036108 3300025940 Bacteria 4580
565 Ga0207691_10441264 3300025940 Bacteria 1108
566 Ga0207711_10073580 3300025941 Bacteria 2970
567 Ga0207689_10034156 3300025942 Bacteria 4224
568 Ga0207689_10136777 3300025942 Bacteria 2018
569 Ga0207689_10856643 3300025942 Bacteria 767
570 Ga0207661_10169487 3300025944 Bacteria 1900
571 Ga0207661_10594956 3300025944 Bacteria 1015
572 Ga0207679_10174503 3300025945 Bacteria 1773
573 Ga0207667_10034827 3300025949 Bacteria 5404
574 Ga0207667_10053962 3300025949 Bacteria 4228
575 Ga0207667_10095216 3300025949 Bacteria 3074
576 Ga0207667_10128195 3300025949 Bacteria 2613
577 Ga0207667_10128231 3300025949 Bacteria 2613
578 Ga0207667_10419728 3300025949 Bacteria 1361
579 Ga0207667_10428679 3300025949 Bacteria 1345
580 Ga0207667_11510937 3300025949 Bacteria 642
581 Ga0207651_10066649 3300025960 Bacteria 2531
582 Ga0207668_10008750 3300025972 Bacteria 6049
583 Ga0207668_10013075 3300025972 Bacteria 5100
584 Ga0207668_10091449 3300025972 Bacteria 2236
585 Ga0207668_10422846 3300025972 Bacteria 1131
586 Ga0207668_11155648 3300025972 Bacteria 695
587 Ga0207640_10003058 3300025981 Bacteria 9010
588 Ga0207640_10054936 3300025981 Bacteria 2606
589 Ga0207640_10075585 3300025981 Bacteria 2284
590 Ga0207640_10196461 3300025981 Bacteria 1525
591 Ga0207640_10532998 3300025981 Bacteria 983
592 Ga0207640_10894600 3300025981 Bacteria 775
593 Ga0207658_10033742 3300025986 Bacteria 3652
594 Ga0207658_10148113 3300025986 Bacteria 1909
595 Ga0207658_10269171 3300025986 Bacteria 1455
596 Ga0207658_10308229 3300025986 Bacteria 1366
597 Ga0207658_10353974 3300025986 Bacteria 1279
598 Ga0207677_10264744 3300026023 Bacteria 1403
599 Ga0207677_10446954 3300026023 Bacteria 1107
600 Ga0207703_10108063 3300026035 Bacteria 2369
601 Ga0207703_10127293 3300026035 Bacteria 2195
602 Ga0207639_10077238 3300026041 Bacteria 2624
603 Ga0207639_10249512 3300026041 Bacteria 1547
604 Ga0207639_11079581 3300026041 Bacteria 753
605 Ga0207678_10016758 3300026067 Bacteria 6435
606 Ga0207678_10049236 3300026067 Bacteria 3642
607 Ga0207678_10049696 3300026067 Bacteria 3624
608 Ga0207678_10054333 3300026067 Bacteria 3449
609 Ga0207678_10085559 3300026067 Bacteria 2695
610 Ga0207678_10572241 3300026067 Bacteria 989
611 Ga0207702_10000517 3300026078 Bacteria 43478
612 Ga0207702_10000852 3300026078 Bacteria 31897
613 Ga0207702_10091382 3300026078 Bacteria 2665
614 Ga0207641_10009230 3300026088 Bacteria 8134
615 Ga0207641_10104276 3300026088 Bacteria 2503
616 Ga0207648_10084850 3300026089 Bacteria 2762
617 Ga0207676_10059226 3300026095 Bacteria 3023
618 Ga0207676_10162686 3300026095 Bacteria 1935
619 Ga0207676_10731242 3300026095 Bacteria 961
620 Ga0207674_10024573 3300026116 Bacteria 6435
621 Ga0207674_10111246 3300026116 Bacteria 2713
622 Ga0207674_10142271 3300026116 Bacteria 2358
623 Ga0207674_10235613 3300026116 Bacteria 1778
624 Ga0207674_10353015 3300026116 Bacteria 1422
625 Ga0207674_10357035 3300026116 Bacteria 1413
626 Ga0207675_100428514 3300026118 Bacteria 1307
627 Ga0207683_10335929 3300026121 Bacteria 1385
628 Ga0207698_10071585 3300026142 Bacteria 2752
629 Ga0207698_10145533 3300026142 Bacteria 2049
630 Ga0207698_10450120 3300026142 Bacteria 1243
631 Ga0209973_1001982 3300027252 Bacteria 1860
632 Ga0209371_1000004 3300027312 Bacteria 1098197
633 Ga0209371_1000294 3300027312 Bacteria 56307
634 Ga0209969_1000918 3300027360 Bacteria 3988
635 Ga0209967_1002362 3300027364 Bacteria 2443
636 Ga0209967_1009133 3300027364 Bacteria 1372
637 Ga0209984_1000306 3300027424 Bacteria 5580
638 Ga0210000_1004942 3300027462 Bacteria 1931
639 Ga0209995_1000770 3300027471 Bacteria 4923
640 Ga0209999_1002797 3300027543 Bacteria 3088
641 Ga0209999_1020896 3300027543 Bacteria 1202
642 Ga0209982_1000032 3300027552 Bacteria 12541
643 Ga0209982_1051017 3300027552 Bacteria 667
644 Ga0209970_1038066 3300027614 Bacteria 850
645 Ga0209983_1000295 3300027665 Bacteria 10386
646 Ga0209971_1000410 3300027682 Bacteria 11534
647 Ga0209974_10010367 3300027876 Bacteria 3144
648 Ga0209974_10074748 3300027876 Bacteria 1160
649 Ga0268266_10000001 3300028379 Bacteria 4040580
650 Ga0268266_10000021 3300028379 Bacteria 522453
651 Ga0268266_10030836 3300028379 Bacteria 4553
652 Ga0268266_10100303 3300028379 Bacteria 2550
653 Ga0268266_10168036 3300028379 Bacteria 1989
654 Ga0268266_10170446 3300028379 Bacteria 1975
655 Ga0268266_10210115 3300028379 Bacteria 1784
656 Ga0268265_10115242 3300028380 Bacteria 2202
657 Ga0268265_10162232 3300028380 Bacteria 1900
658 Ga0268264_10023204 3300028381 Bacteria 5063
659 Ga0268256_1000005 3300030500 Bacteria 1082342
660 Ga0268256_1000258 3300030500 Bacteria 56249
661 Ga0316177_1042582 3300030731 Bacteria 1493
662 Ga0316176_1015742 3300030732 Bacteria 2508
663 Ga0316176_1213588 3300030732 Bacteria 1389
664 Ga0316183_1139965 3300030742 Bacteria 4016
665 Ga0316181_1164435 3300030744 Bacteria 1550
666 Ga0316182_1088536 3300030745 Bacteria 722
667 Ga0316182_1183376 3300030745 Bacteria 1522
668 Ga0265763_1007233 3300030763 Bacteria 970
669 Ga0265766_1000306 3300030863 Bacteria 2014
670 Ga0265769_100430 3300030888 Bacteria 1714
671 Ga0265761_100106 3300030889 Bacteria 2671
672 Ga0265774_100076 3300031011 Bacteria 2339
673 Ga0307513_10521493 3300031456 Bacteria 903
674 Ga0307509_10199035 3300031507 Bacteria 1843
675 Ga0307408_100181171 3300031548 Bacteria 1689
676 Ga0307408_101204677 3300031548 Bacteria 706
677 Ga0307508_10105773 3300031616 Bacteria 2412
678 Ga0316575_10015025 3300031665 Bacteria 2915
679 Ga0307516_10007119 3300031730 Bacteria 12924
680 Ga0307405_10142144 3300031731 Bacteria 1675
681 Ga0307405_10146342 3300031731 Bacteria 1655
682 Ga0307413_10037133 3300031824 Bacteria 2811
683 Ga0307413_10047867 3300031824 Bacteria 2552
684 Ga0307413_10081955 3300031824 Bacteria 2070
685 Ga0307413_10279926 3300031824 Bacteria 1254
686 Ga0307413_10280806 3300031824 Bacteria 1252
687 Ga0307410_10028499 3300031852 Bacteria 3543
688 Ga0307406_10068752 3300031901 Bacteria 2313
689 Ga0307406_10093487 3300031901 Bacteria 2030
690 Ga0307407_10034741 3300031903 Bacteria 2763
691 Ga0307407_10089439 3300031903 Bacteria 1883
692 Ga0307412_10019091 3300031911 Bacteria 4141
693 Ga0307412_10028293 3300031911 Bacteria 3505
694 Ga0307412_10042944 3300031911 Bacteria 2941
695 Ga0307409_100024348 3300031995 Bacteria 4220
696 Ga0307409_101638881 3300031995 Bacteria 672
697 Ga0307416_100079046 3300032002 Bacteria 2770
698 Ga0307416_100404694 3300032002 Bacteria 1403
699 Ga0307414_10002120 3300032004 Bacteria 10346
700 Ga0307414_10007179 3300032004 Bacteria 6251
701 Ga0307414_10020644 3300032004 Bacteria 4110
702 Ga0307414_10046872 3300032004 Bacteria 2970
703 Ga0307414_10063463 3300032004 Bacteria 2625
704 Ga0307414_10178231 3300032004 Bacteria 1706
705 Ga0307414_10187955 3300032004 Bacteria 1668
706 Ga0307414_10258340 3300032004 Bacteria 1452
707 Ga0307414_10305106 3300032004 Bacteria 1348
708 Ga0307414_10913289 3300032004 Bacteria 805
709 Ga0307414_11303549 3300032004 Bacteria 674
710 Ga0307414_11306492 3300032004 Bacteria 673
711 Ga0307411_10015295 3300032005 Bacteria 4303
712 Ga0307411_10390319 3300032005 Bacteria 1147
713 Ga0307411_10953077 3300032005 Bacteria 765
714 Ga0307415_100292343 3300032126 Bacteria 1345
715 Ga0307510_10002916 3300033180 Bacteria 19686
716 Ga0373930_0069596 3300034816 Bacteria 798
717 Ga0373931_0421997 3300035691 Bacteria 848
718 Ga0310112_000276 3300036458 Bacteria 4093
719 Ga0395899_0001959 3300037312 Bacteria 16927
720 Ga0395899_0012521 3300037312 Bacteria 6499
721 Ga0395899_0022053 3300037312 Bacteria 4829
722 Ga0395899_0091130 3300037312 Bacteria 2209
723 Ga0395899_0423649 3300037312 Bacteria 876
724 Ga0395899_0562413 3300037312 Bacteria 731
725 Ga0395900_0000012 3300037418 Bacteria 401198
726 Ga0395900_0036642 3300037418 Bacteria 5057
727 Ga0395900_0080209 3300037418 Bacteria 3353
728 Ga0395900_0089318 3300037418 Bacteria 3167
729 Ga0395900_0241648 3300037418 Bacteria 1811
730 Ga0395900_0765478 3300037418 Bacteria 895
731 Ga0395900_0934356 3300037418 Bacteria 789
732 Ga0395898_0000558 3300037466 Bacteria 69802
733 Ga0395898_0000600 3300037466 Bacteria 66858
734 Ga0395898_0006608 3300037466 Bacteria 12359
735 Ga0395898_0180698 3300037466 Bacteria 2016
736 Ga0395898_0258265 3300037466 Bacteria 1661
737 Ga0395898_0587291 3300037466 Bacteria 1056
738 Ga0395898_0745825 3300037466 Bacteria 920
739 Ga0395898_0796265 3300037466 Bacteria 885
740 Ga0395905_0110752 3300037471 Bacteria 2578
741 Ga0395905_0293167 3300037471 Bacteria 1514
742 Ga0395905_0298452 3300037471 Bacteria 1498
743 Ga0395901_0002939 3300038443 Bacteria 17197
744 Ga0395901_0011584 3300038443 Bacteria 8935
745 Ga0395901_0075079 3300038443 Bacteria 3526
746 Ga0395901_0143647 3300038443 Bacteria 2508
747 Ga0395901_0866142 3300038443 Bacteria 887
748 Ga0237819_00026 3300038705 Bacteria 50539
749 Ga0237819_05137 3300038705 Bacteria 2080
750 Ga0439436_0000027 3300041404 Bacteria 53417
751 Ga0439436_0020558 3300041404 Bacteria 1966
752 Ga0439436_0044395 3300041404 Bacteria 1266
753 Ga0439436_0110206 3300041404 Bacteria 768
754 Ga0439439_0004561 3300041406 Bacteria 3133
755 Ga0439447_013961 3300041407 Bacteria 2264
756 Ga0439465_0000141 3300041413 Bacteria 17802
757 Ga0439465_0005524 3300041413 Bacteria 4031
758 Ga0451788_24495 3300041442 Bacteria 761
759 Ga0451790_10956 3300041444 Bacteria 1249
760 Ga0451794_20311 3300041446 Bacteria 790
761 Ga0451793_0190021 3300041452 Bacteria 871
762 Ga0451793_0393032 3300041452 Bacteria 3643
763 Ga0451793_1506933 3300041452 Bacteria 1244
764 Ga0451801_19993 3300041455 Bacteria 3054
765 Ga0451795_0694995 3300041456 Bacteria 1293
766 Ga0451798_0875692 3300041458 Bacteria 1219
767 Ga0451800_0893000 3300041459 Bacteria 1382
768 Ga0451800_1044717 3300041459 Bacteria 770
769 Ga0451800_1057945 3300041459 Bacteria 15810
770 Ga0451805_028824 3300041461 Bacteria 1147
771 Ga0451805_049393 3300041461 Bacteria 1172
772 Ga0451805_075358 3300041461 Bacteria 774
773 Ga0451806_234332 3300041462 Bacteria 19745
774 Ga0451804_0524950 3300041463 Bacteria 2306
775 Ga0451807_1035554 3300041486 Bacteria 6707
776 Ga0451837_0104937 3300041494 Bacteria 661
777 Ga0451837_0822369 3300041494 Bacteria 1529
778 Ga0451843_0242471 3300041509 Bacteria 1507
779 Ga0451843_0922492 3300041509 Bacteria 1261
780 Ga0451843_1758148 3300041509 Bacteria 744
781 Ga0451853_2750802 3300041512 Bacteria 1113
782 Ga0439431_0008628 3300041997 Bacteria 2294
783 Ga0439433_0083311 3300041999 Bacteria 780
784 Ga0439437_001431 3300042000 Bacteria 2515
785 Ga0439445_0011454 3300042004 Bacteria 2116
786 Ga0439445_0076000 3300042004 Bacteria 934
787 Ga0439449_0011871 3300042007 Bacteria 3274
788 Ga0439449_0039601 3300042007 Bacteria 1752
789 Ga0439449_0050566 3300042007 Bacteria 1537
790 Ga0439449_0052843 3300042007 Bacteria 1502
791 Ga0439449_0059877 3300042007 Bacteria 1405
792 Ga0439452_041628 3300042010 Bacteria 1080
793 Ga0450897_006886 3300042128 Bacteria 1026
794 Ga0439446_0036071 3300042156 Bacteria 1444
795 Ga0450908_002110 3300042184 Bacteria 3892
796 Ga0439434_0071617 3300042435 Bacteria 1092
797 Ga0439434_0194142 3300042435 Bacteria 683
798 Ga0451577_0065354 3300042876 Bacteria 3244
799 Ga0451577_0182922 3300042876 Bacteria 1890
800 Ga0439440_0015463 3300042993 Bacteria 1659
801 Ga0466969_0008348 3300044656 Bacteria 5490
802 Ga0466969_0008941 3300044656 Bacteria 5311
803 Ga0466969_0086989 3300044656 Bacteria 1484
804 Ga0466972_0024571 3300044658 Bacteria 2989
805 Ga0466975_0199194 3300044661 Bacteria 1359
806 Ga0466982_0000005 3300044672 Bacteria 364340
807 Ga0466982_0000210 3300044672 Bacteria 15368
808 Ga0466965_0003853 3300044683 Bacteria 6624
809 Ga0466966_0002549 3300044684 Bacteria 11933
810 Ga0466966_0069760 3300044684 Bacteria 2204
811 Ga0466961_0010336 3300044693 Bacteria 5951
812 Ga0466961_0015293 3300044693 Bacteria 4928
813 Ga0466961_0079218 3300044693 Bacteria 2080
814 Ga0466961_0085616 3300044693 Bacteria 1992
815 Ga0466961_0265280 3300044693 Bacteria 1052
816 Ga0466963_0052819 3300044694 Bacteria 2697
817 Ga0466963_0151824 3300044694 Bacteria 1609
818 Ga0466963_0588989 3300044694 Bacteria 785
819 Ga0466964_0018986 3300044706 Bacteria 2641
820 Ga0466964_0142737 3300044706 Bacteria 1102
821 Ga0466964_0322127 3300044706 Bacteria 786
822 Ga0453684_0000136 3300044712 Bacteria 323402
823 Ga0466971_0000338 3300044719 Bacteria 17942
824 Ga0466971_0006109 3300044719 Bacteria 5237
825 Ga0466971_0033841 3300044719 Bacteria 2290
826 Ga0466968_0000409 3300044735 Bacteria 14226
827 Ga0466968_0048557 3300044735 Bacteria 1807
828 Ga0466970_0001896 3300044765 Bacteria 10104
829 Ga0466970_0215617 3300044765 Bacteria 1070
830 Ga0466957_0003550 3300044842 Bacteria 8589
831 Ga0466957_0019946 3300044842 Bacteria 3945
832 Ga0466957_0075171 3300044842 Bacteria 2096
833 Ga0466960_0002345 3300044901 Bacteria 7115
834 Ga0466959_0033759 3300045049 Bacteria 3784
835 Ga0466959_0043319 3300045049 Bacteria 3317
836 Ga0466959_0072597 3300045049 Bacteria 2490
837 Ga0451576_0000025 3300045051 Bacteria 427980
838 Ga0466958_0005279 3300045836 Bacteria 6926
839 Ga0466958_0045436 3300045836 Bacteria 2649
840 Ga0466958_0054129 3300045836 Bacteria 2433
841 Ga0466958_0067609 3300045836 Bacteria 2183
842 Ga0466958_0080493 3300045836 Bacteria 2004
843 Ga0466967_0075901 3300045976 Bacteria 3022
844 Ga0495617_005550 3300046452 Bacteria 4464
845 Ga0495638_0000007 3300046460 Bacteria 602783
846 Ga0495638_0029717 3300046460 Bacteria 3523
847 Ga0495638_0055083 3300046460 Bacteria 2470
848 Ga0495650_0000202 3300046471 Bacteria 129910
849 Ga0495650_0011898 3300046471 Bacteria 4717
850 Ga0495650_0021446 3300046471 Bacteria 3122
851 Ga0495584_0021982 3300046491 Bacteria 3238
852 Ga0495585_0013800 3300046492 Bacteria 4720
853 Ga0495607_0007223 3300046501 Bacteria 7709
854 Ga0495607_0026377 3300046501 Bacteria 3605
855 Ga0495607_0100086 3300046501 Bacteria 1554
856 Ga0495607_0154297 3300046501 Bacteria 1172
857 Ga0495606_0001329 3300046507 Bacteria 33751
858 Ga0495606_0035985 3300046507 Bacteria 3378
859 Ga0495610_0011764 3300046512 Bacteria 5316
860 Ga0495616_0007049 3300046513 Bacteria 6755
861 Ga0495620_0015281 3300046515 Bacteria 3879
862 Ga0495631_0026344 3300046518 Bacteria 2671
863 Ga0495632_0005327 3300046519 Bacteria 8538
864 Ga0495632_0019213 3300046519 Bacteria 3728
865 Ga0495637_0009169 3300046520 Bacteria 4831
866 Ga0495643_0018809 3300046522 Bacteria 4003
867 Ga0495648_0013709 3300046524 Bacteria 5976
868 Ga0495663_0004473 3300046525 Bacteria 3926
869 Ga0495663_0102121 3300046525 Bacteria 945
870 Ga0495609_0001578 3300046538 Bacteria 14896
871 Ga0495621_0001470 3300046539 Bacteria 6111
872 Ga0495622_0058718 3300046557 Bacteria 1782
873 Ga0495656_0006174 3300046615 Bacteria 4190
874 Ga0495656_0140966 3300046615 Bacteria 1156
875 Ga0495668_0021331 3300046616 Bacteria 3716
876 Ga0495668_0033171 3300046616 Bacteria 2901
877 Ga0495611_0000029 3300046648 Bacteria 115887
878 Ga0495611_0080006 3300046648 Bacteria 1501
879 Ga0495625_0001724 3300046660 Bacteria 25395
880 Ga0495625_0016676 3300046660 Bacteria 5771
881 Ga0495625_0139135 3300046660 Bacteria 1639
882 Ga0495661_0008049 3300046665 Bacteria 7318
883 Ga0495588_0151180 3300046674 Bacteria 1227
884 Ga0495670_0039605 3300046691 Bacteria 2350
885 Ga0495670_0046353 3300046691 Bacteria 2171
886 Ga0495670_0101413 3300046691 Bacteria 1482
887 Ga0495670_0262669 3300046691 Bacteria 921
888 Ga0495671_0005114 3300046692 Bacteria 7717
889 Ga0495649_0000383 3300046694 Bacteria 38398
890 Ga0495649_0006659 3300046694 Bacteria 7174
891 Ga0495589_0000144 3300046794 Bacteria 65654
892 Ga0495660_0003242 3300046810 Bacteria 10114
893 Ga0495660_0080856 3300046810 Bacteria 1704
894 Ga0495636_0052343 3300047318 Bacteria 1712
895 Ga0495672_0018426 3300047320 Bacteria 4634
896 Ga0495676_0620206 3300047321 Bacteria 703
897 Ga0495683_0004657 3300047323 Bacteria 7733
898 Ga0495677_0149460 3300047445 Bacteria 899
899 Ga0495679_000001 3300047446 Bacteria 1607568
900 Ga0495673_0004383 3300047469 Bacteria 8851
901 Ga0495673_0005855 3300047469 Bacteria 7350
902 Ga0495681_0080605 3300047470 Bacteria 1454
903 Ga0495681_0124862 3300047470 Bacteria 1101
904 Ga0495686_0002623 3300047472 Bacteria 16652
905 Ga0495686_0036720 3300047472 Bacteria 3143
906 Ga0496100_0006795 3300048903 Bacteria 6268
907 Ga0496100_0732691 3300048903 Bacteria 772
908 Ga0496101_0009854 3300048904 Bacteria 6293
909 Ga0496101_0090873 3300048904 Bacteria 2271
910 Ga0496101_0243688 3300048904 Bacteria 1399
911 Ga0496102_0109999 3300048905 Bacteria 2568
912 Ga0496103_0145760 3300048906 Bacteria 1515
913 Ga0496103_0296905 3300048906 Bacteria 1039
914 Ga0496104_0045988 3300048907 Bacteria 4107
915 Ga0496104_0159892 3300048907 Bacteria 2161
916 Ga0496105_0041905 3300048908 Bacteria 3773
917 Ga0496106_0003988 3300048909 Bacteria 11030
918 Ga0496107_0011190 3300048910 Bacteria 6245
919 Ga0496107_0034298 3300048910 Bacteria 3635
920 Ga0496107_0189985 3300048910 Bacteria 1526
921 Ga0496108_0001932 3300048911 Bacteria 16608
922 Ga0496108_0100619 3300048911 Bacteria 2465
923 Ga0496108_0143885 3300048911 Bacteria 2055
924 Ga0496109_0062064 3300048912 Bacteria 3417
925 Ga0496109_0085316 3300048912 Bacteria 2914
926 Ga0496109_0571328 3300048912 Bacteria 1066
927 Ga0496110_0011371 3300048913 Bacteria 7282
928 Ga0496111_0003793 3300048914 Bacteria 9425
929 Ga0496112_0025726 3300048915 Bacteria 5652
930 Ga0496112_0240221 3300048915 Bacteria 1764
931 Ga0496113_0067298 3300048916 Bacteria 2715
932 Ga0496113_0471490 3300048916 Bacteria 1009
933 Ga0496114_0025860 3300048917 Bacteria 4801
934 Ga0496114_0055393 3300048917 Bacteria 3307
935 Ga0496115_0002269 3300048918 Bacteria 13760
936 Ga0496115_0002549 3300048918 Bacteria 13090
937 Ga0496115_0137021 3300048918 Bacteria 2018
938 Ga0496115_0323400 3300048918 Bacteria 1261
939 Ga0496115_0367309 3300048918 Bacteria 1172
940 Ga0496116_0085191 3300048919 Bacteria 1943
941 Ga0496116_0129825 3300048919 Bacteria 1439
942 Ga0496117_0028524 3300048920 Bacteria 4321
943 Ga0496117_0063248 3300048920 Bacteria 2530
944 Ga0496117_0360569 3300048920 Bacteria 747
945 Ga0496118_0008397 3300048921 Bacteria 10682
946 Ga0496118_0024725 3300048921 Bacteria 5173
947 Ga0496118_0028854 3300048921 Bacteria 4664
948 Ga0496118_0041939 3300048921 Bacteria 3617
949 Ga0496118_0092393 3300048921 Bacteria 2077
950 Ga0496118_0099530 3300048921 Bacteria 1970
951 Ga0496118_0155303 3300048921 Bacteria 1425
952 Ga0496119_0014507 3300048922 Bacteria 6158
953 Ga0496119_0016519 3300048922 Bacteria 5611
954 Ga0496119_0267452 3300048922 Bacteria 855
955 Ga0496120_0024106 3300048923 Bacteria 3798
956 Ga0496121_0000290 3300048924 Bacteria 104280
957 Ga0496121_0005001 3300048924 Bacteria 17352
958 Ga0496121_0016314 3300048924 Bacteria 7676
959 Ga0496121_0053526 3300048924 Bacteria 3380
960 Ga0496121_0056865 3300048924 Bacteria 3246
961 Ga0496122_0079528 3300048925 Bacteria 2290
962 Ga0496122_0097842 3300048925 Bacteria 1973
963 Ga0496122_0176593 3300048925 Bacteria 1279
964 Ga0496123_0022702 3300048926 Bacteria 4826
965 Ga0496123_0031047 3300048926 Bacteria 3897
966 Ga0496123_0033327 3300048926 Bacteria 3709
967 Ga0496123_0070780 3300048926 Bacteria 2180
968 Ga0496123_0094978 3300048926 Bacteria 1755
969 Ga0496123_0146817 3300048926 Bacteria 1279
970 Ga0496123_0259638 3300048926 Bacteria 852
971 Ga0496124_0000018 3300048927 Bacteria 442940
972 Ga0496124_0000472 3300048927 Bacteria 69226
973 Ga0496124_0107957 3300048927 Bacteria 2245
974 Ga0496125_0000379 3300048928 Bacteria 83187
975 Ga0496125_0024621 3300048928 Bacteria 5530
976 Ga0496125_0042644 3300048928 Bacteria 3862
977 Ga0496126_0000033 3300048929 Bacteria 368851
978 Ga0496126_0006212 3300048929 Bacteria 13367
979 Ga0496126_0028743 3300048929 Bacteria 5292
980 Ga0496126_0119779 3300048929 Bacteria 2284
981 Ga0496126_0655193 3300048929 Bacteria 821
982 Ga0501308_000035 3300049128 Bacteria 5438
983 Ga0501309_003449 3300049129 Bacteria 1791
984 Ga0501310_000986 3300049130 Bacteria 2538
985 Ga0501307_000579 3300049162 Bacteria 2601
986 Ga0501307_005239 3300049162 Bacteria 1360
987 Ga0501307_006548 3300049162 Bacteria 1262
988 Ga0495678_004567 3300049459 Bacteria 7963
989 Ga0495678_016742 3300049459 Bacteria 3341
990 Ga0495682_0073233 3300049460 Bacteria 1232
991 Ga0501311_003051 3300049527 Bacteria 1672
992 Ga0501312_002244 3300049528 Bacteria 2061
993 Ga0501312_002447 3300049528 Bacteria 2006
994 Ga0501312_007104 3300049528 Bacteria 1418
995 Ga0501315_004415 3300049531 Bacteria 1470
996 Ga0501317_001762 3300049533 Bacteria 1934
997 Ga0501317_006218 3300049533 Bacteria 1304
998 Ga0501318_000528 3300049534 Bacteria 2495
999 Ga0501319_000070 3300049535 Bacteria 3471
1000 Ga0501321_005366 3300049537 Bacteria 1264
1001 Ga0501323_000068 3300049539 Bacteria 5160
1002 Ga0501323_000101 3300049539 Bacteria 4591
1003 Ga0501324_014225 3300049540 Bacteria 761
1004 Ga0501031_0025141 3300049568 Bacteria 3884
1005 Ga0501031_0047206 3300049568 Bacteria 2807
1006 Ga0501031_0063611 3300049568 Bacteria 2403
1007 Ga0501031_0096163 3300049568 Bacteria 1933
1008 Ga0501031_0101188 3300049568 Bacteria 1880
1009 Ga0501032_0020602 3300049569 Bacteria 4590
1010 Ga0501032_0025237 3300049569 Bacteria 4098
1011 Ga0501032_0045411 3300049569 Bacteria 2971
1012 Ga0501033_0000337 3300049570 Bacteria 44892
1013 Ga0501033_0060996 3300049570 Bacteria 2780
1014 Ga0501033_0075593 3300049570 Bacteria 2472
1015 Ga0501033_0123272 3300049570 Bacteria 1879
1016 Ga0501034_0008263 3300049571 Bacteria 11016
1017 Ga0501034_0021966 3300049571 Bacteria 6502
1018 Ga0501034_0025504 3300049571 Bacteria 6019
1019 Ga0501034_0056333 3300049571 Bacteria 3955
1020 Ga0501034_0066470 3300049571 Bacteria 3618
1021 Ga0501034_0099165 3300049571 Bacteria 2908
1022 Ga0501034_0120372 3300049571 Bacteria 2611
1023 Ga0501034_0377238 3300049571 Bacteria 1343
1024 Ga0501036_0030355 3300049572 Bacteria 4566
1025 Ga0501036_0037846 3300049572 Bacteria 4080
1026 Ga0501036_0066357 3300049572 Bacteria 3053
1027 Ga0501036_0665537 3300049572 Bacteria 861
1028 Ga0501037_0019227 3300049573 Bacteria 5034
1029 Ga0501037_0127086 3300049573 Bacteria 1829
1030 Ga0501037_0204211 3300049573 Bacteria 1395
1031 Ga0501038_0002396 3300049574 Bacteria 17463
1032 Ga0501038_0013134 3300049574 Bacteria 7553
1033 Ga0501038_0026720 3300049574 Bacteria 5139
1034 Ga0501038_0055414 3300049574 Bacteria 3405
1035 Ga0501038_0283895 3300049574 Bacteria 1302
1036 Ga0501038_0326070 3300049574 Bacteria 1200
1037 Ga0501039_0013271 3300049575 Bacteria 6300
1038 Ga0501039_0036074 3300049575 Bacteria 3814
1039 Ga0501039_0128008 3300049575 Bacteria 1992
1040 Ga0501039_0811864 3300049575 Bacteria 729
1041 Ga0501040_0187968 3300049576 Bacteria 1465
1042 Ga0501042_0056670 3300049578 Bacteria 2796
1043 Ga0501042_0160846 3300049578 Bacteria 1620
1044 Ga0501043_0016278 3300049579 Bacteria 5832
1045 Ga0501043_0030616 3300049579 Bacteria 4230
1046 Ga0501043_0111378 3300049579 Bacteria 2149
1047 Ga0501043_0113617 3300049579 Bacteria 2126
1048 Ga0501043_0141105 3300049579 Bacteria 1887
1049 Ga0501043_0147266 3300049579 Bacteria 1843
1050 Ga0501043_0269409 3300049579 Bacteria 1307
1051 Ga0501046_0025093 3300049580 Bacteria 4882
1052 Ga0501046_0034206 3300049580 Bacteria 4102
1053 Ga0501046_0067782 3300049580 Bacteria 2778
1054 Ga0501046_0100330 3300049580 Bacteria 2221
1055 Ga0501046_0113833 3300049580 Bacteria 2064
1056 Ga0501046_0470696 3300049580 Bacteria 902
1057 Ga0501047_0000250 3300049581 Bacteria 63699
1058 Ga0501047_0045199 3300049581 Bacteria 4257
1059 Ga0501047_0100864 3300049581 Bacteria 2766
1060 Ga0501047_0103968 3300049581 Bacteria 2720
1061 Ga0501047_0136357 3300049581 Bacteria 2334
1062 Ga0501047_0221275 3300049581 Bacteria 1749
1063 Ga0501047_0383280 3300049581 Bacteria 1240
1064 Ga0501047_0629767 3300049581 Bacteria 893
1065 Ga0501048_0021518 3300049582 Bacteria 4723
1066 Ga0501048_0029557 3300049582 Bacteria 3972
1067 Ga0501048_0132280 3300049582 Bacteria 1763
1068 Ga0501067_0015294 3300049583 Bacteria 4246
1069 Ga0501067_0019365 3300049583 Bacteria 3766
1070 Ga0501069_0036066 3300049585 Bacteria 2725
1071 Ga0501069_0095297 3300049585 Bacteria 1685
1072 Ga0501070_0022172 3300049586 Bacteria 5319
1073 Ga0501070_0033585 3300049586 Bacteria 4293
1074 Ga0501070_0038865 3300049586 Bacteria 3971
1075 Ga0501070_0042967 3300049586 Bacteria 3762
1076 Ga0501070_0086782 3300049586 Bacteria 2590
1077 Ga0501070_0130993 3300049586 Bacteria 2071
1078 Ga0501070_0153676 3300049586 Bacteria 1898
1079 Ga0501070_0162900 3300049586 Bacteria 1838
1080 Ga0501070_0198353 3300049586 Bacteria 1648
1081 Ga0501071_0037161 3300049587 Bacteria 3476
1082 Ga0501071_0088182 3300049587 Bacteria 2276
1083 Ga0501071_0441656 3300049587 Bacteria 995
1084 Ga0501072_0021878 3300049588 Bacteria 4960
1085 Ga0501073_0000196 3300049589 Bacteria 40033
1086 Ga0501073_0029914 3300049589 Bacteria 3889
1087 Ga0501073_0068309 3300049589 Bacteria 2477
1088 Ga0501073_0078475 3300049589 Bacteria 2297
1089 Ga0501073_0210261 3300049589 Bacteria 1344
1090 Ga0501074_0031616 3300049590 Bacteria 3834
1091 Ga0501074_0034673 3300049590 Bacteria 3658
1092 Ga0501074_0074903 3300049590 Bacteria 2430
1093 Ga0501074_0148950 3300049590 Bacteria 1673
1094 Ga0501074_0154724 3300049590 Bacteria 1638
1095 Ga0501074_0685815 3300049590 Bacteria 723
1096 Ga0501075_0321697 3300049591 Bacteria 1179
1097 Ga0501202_018155 3300049652 Bacteria 1379
1098 Ga0501223_032298 3300049663 Bacteria 1018
1099 Ga0501239_002487 3300049672 Bacteria 1676
1100 Ga0501242_009218 3300049674 Bacteria 1165
1101 Ga0501247_029292 3300049677 Bacteria 746
1102 Ga0501249_021629 3300049679 Bacteria 1404
1103 Ga0501252_008250 3300049682 Bacteria 1194
1104 Ga0501080_0005488 3300049742 Bacteria 11318
1105 Ga0501080_0016130 3300049742 Bacteria 6896
1106 Ga0501080_0018310 3300049742 Bacteria 6482
1107 Ga0501080_0045089 3300049742 Bacteria 4104
1108 Ga0501080_0049719 3300049742 Bacteria 3902
1109 Ga0501080_0075188 3300049742 Bacteria 3142
1110 Ga0501080_0107130 3300049742 Bacteria 2590
1111 Ga0501080_0290833 3300049742 Bacteria 1483
1112 Ga0501081_0073960 3300049743 Bacteria 2377
1113 Ga0501083_0021386 3300049744 Bacteria 4495
1114 Ga0501083_0057300 3300049744 Bacteria 2608
1115 Ga0501083_0240929 3300049744 Bacteria 1177
1116 Ga0501035_0021041 3300049822 Bacteria 5996
1117 Ga0501035_0039431 3300049822 Bacteria 4274
1118 Ga0501035_0043368 3300049822 Bacteria 4053
1119 Ga0501035_0213194 3300049822 Bacteria 1651
1120 Ga0501035_0627844 3300049822 Bacteria 873
1121 Ga0501035_0828346 3300049822 Bacteria 737
1122 Ga0501044_0003730 3300049823 Bacteria 17110
1123 Ga0501044_0031982 3300049823 Bacteria 5532
1124 Ga0501044_0053687 3300049823 Bacteria 4145
1125 Ga0501044_0128002 3300049823 Bacteria 2535
1126 Ga0501044_0154075 3300049823 Bacteria 2278
1127 Ga0501044_0312859 3300049823 Bacteria 1496
1128 Ga0501044_0446143 3300049823 Bacteria 1201
1129 Ga0501044_0453222 3300049823 Bacteria 1189
1130 Ga0501044_0583195 3300049823 Bacteria 1012
1131 Ga0501045_0042206 3300049824 Bacteria 3320
1132 nmdc:mga00v17_16326_c1 3300050491 Bacteria 4186
1133 Ga0500643_000120 3300053087 Bacteria 81701
1134 Ga0500646_0022488 3300053090 Bacteria 1686
1135 Ga0500651_0000131 3300053093 Bacteria 46394
1136 Ga0500555_001368 3300053103 Bacteria 7599
1137 Ga0500597_115201 3300053120 Bacteria 1166
1138 Ga0500568_0019513 3300053139 Bacteria 2945
1139 Ga0500619_094029 3300053154 Bacteria 1014
1140 Ga0500633_0000338 3300053160 Bacteria 7069
1141 Ga0500634_0003199 3300053161 Bacteria 7212
1142 Ga0500645_004128 3300053730 Bacteria 5663
1143 Ga0501084_0245529 3300054114 Bacteria 1511
1144 Ga0587093_001690 3300059478 Bacteria 1922
1145 Ga0587073_0001891 3300059492 Bacteria 2575
1146 Ga0587073_0022645 3300059492 Bacteria 1222
1147 Ga0587080_001372 3300059503 Bacteria 2617
1148 Ga0587080_003084 3300059503 Bacteria 2036
1149 Ga0587082_000933 3300059504 Bacteria 2775
1150 Ga0587083_0050429 3300059505 Bacteria 905
1151 Ga0587088_000941 3300059508 Bacteria 2784
1152 Ga0587088_001539 3300059508 Bacteria 2415
1153 Ga0587090_000930 3300059510 Bacteria 2750
1154 Ga0587090_008934 3300059510 Bacteria 1356
1155 Ga0587091_013769 3300059511 Bacteria 1306
1156 Ga0587094_012935 3300059513 Bacteria 1121
1157 Ga0587106_000089 3300059605 Bacteria 4305
1158 Ga0587099_000319 3300059622 Bacteria 2599
1159 Ga0587101_004567 3300059623 Bacteria 1486
1160 Ga0587113_000588 3300059625 Bacteria 2012
1161 Ga0587128_002799 3300059630 Bacteria 1859
1162 Ga0587067_000398 3300059640 Bacteria 3711
1163 Ga0587072_001885 3300059643 Bacteria 2710
1164 Ga0587075_002127 3300059644 Bacteria 2052
1165 Ga0587078_000692 3300059646 Bacteria 2693
1166 Ga0587078_001522 3300059646 Bacteria 2090
1167 Ga0587079_003247 3300059647 Bacteria 2100
1168 Ga0587120_001142 3300059659 Bacteria 1591
1169 Ga0587071_002066 3300060344 Bacteria 2656
1170 Ga0587071_018773 3300060344 Bacteria 1246
1171 Ga0501082_0017750 3300060353 Bacteria 6128
1172 Ga0501082_0146414 3300060353 Bacteria 2050
1173 Ga0466962_0007521 3300061719 Bacteria 5225
1174 Ga0466962_0021946 3300061719 Bacteria 3065
1175 Ga0466962_0039986 3300061719 Bacteria 2245

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049663 Ga0501223_032298 Ga0501223_032298_493_1008 161
2 3300025303 Ga0209051_1009469 Ga0209051_10094693 171
3 3300048921 Ga0496118_0008397 Ga0496118_0008397_314_916 172
4 3300006038 Ga0075365_10255181 Ga0075365_102551812 174
5 3300041494 Ga0451837_0104937 Ga0451837_0104937_21_626 174
6 3300050491 nmdc:mga00v17_16326_c1 nmdc:mga00v17_16326_c1_2845_3450 174
7 3300033180 Ga0307510_10002916 Ga0307510_1000291630 177
8 3300046471 Ga0495650_0011898 Ga0495650_0011898_1126_1728 177
9 3300049652 Ga0501202_018155 Ga0501202_018155_798_1364 178
10 3300002075 JGI24738J21930_10000244 JGI24738J21930_100002443 180
11 3300003575 Ga0007409J51694_1033072 Ga0007409J51694_10330724 180
12 3300003693 Ga0032354_1074945 Ga0032354_10749452 180
13 3300013308 Ga0157375_10803357 Ga0157375_108033571 180
14 3300014497 Ga0182008_10010846 Ga0182008_100108462 180
15 3300014497 Ga0182008_10077246 Ga0182008_100772462 180
16 3300015261 Ga0182006_1023134 Ga0182006_10231342 180
17 3300015261 Ga0182006_1043661 Ga0182006_10436612 180
18 3300015262 Ga0182007_10001054 Ga0182007_1000105424 180
19 3300015265 Ga0182005_1064493 Ga0182005_10644932 180
20 3300031731 Ga0307405_10146342 Ga0307405_101463423 180
21 3300031911 Ga0307412_10019091 Ga0307412_100190913 180
22 3300041404 Ga0439436_0000027 Ga0439436_0000027_48587_49189 180
23 3300041413 Ga0439465_0000141 Ga0439465_0000141_2297_2899 180
24 3300041446 Ga0451794_20311 Ga0451794_20311_150_752 180
25 3300041461 Ga0451805_075358 Ga0451805_075358_10_582 180
26 3300042004 Ga0439445_0076000 Ga0439445_0076000_235_837 180
27 3300046471 Ga0495650_0021446 Ga0495650_0021446_1559_2161 180
28 3300046491 Ga0495584_0021982 Ga0495584_0021982_2278_2880 180
29 3300046492 Ga0495585_0013800 Ga0495585_0013800_2308_2910 180
30 3300046512 Ga0495610_0011764 Ga0495610_0011764_326_928 180
31 3300046515 Ga0495620_0015281 Ga0495620_0015281_2126_2728 180
32 3300046518 Ga0495631_0026344 Ga0495631_0026344_438_1040 180
33 3300046519 Ga0495632_0019213 Ga0495632_0019213_1442_2044 180
34 3300046522 Ga0495643_0018809 Ga0495643_0018809_1898_2500 180
35 3300046524 Ga0495648_0013709 Ga0495648_0013709_2290_2892 180
36 3300046557 Ga0495622_0058718 Ga0495622_0058718_559_1161 180
37 3300046616 Ga0495668_0021331 Ga0495668_0021331_3017_3619 180
38 3300046648 Ga0495611_0080006 Ga0495611_0080006_300_902 180
39 3300046665 Ga0495661_0008049 Ga0495661_0008049_1708_2310 180
40 3300046691 Ga0495670_0039605 Ga0495670_0039605_1704_2306 180
41 3300046691 Ga0495670_0046353 Ga0495670_0046353_416_1018 180
42 3300046694 Ga0495649_0006659 Ga0495649_0006659_775_1377 180
43 3300046810 Ga0495660_0080856 Ga0495660_0080856_972_1574 180
44 3300047323 Ga0495683_0004657 Ga0495683_0004657_2139_2741 180
45 3300047469 Ga0495673_0004383 Ga0495673_0004383_2157_2759 180
46 3300047469 Ga0495673_0005855 Ga0495673_0005855_5043_5645 180
47 3300047472 Ga0495686_0036720 Ga0495686_0036720_2277_2879 180
48 3300048910 Ga0496107_0189985 Ga0496107_0189985_717_1319 180
49 3300048922 Ga0496119_0014507 Ga0496119_0014507_518_1120 180
50 3300053154 Ga0500619_094029 Ga0500619_094029_389_991 180
51 3300053160 Ga0500633_0000338 Ga0500633_0000338_1570_2172 180
52 3300053730 Ga0500645_004128 Ga0500645_004128_3498_4100 180
53 3300026067 Ga0207678_10085559 Ga0207678_100855594 183
54 3300025254 Ga0209148_1002653 Ga0209148_10026536 185
55 3300005344 Ga0070661_100028282 Ga0070661_1000282823 186
56 3300005455 Ga0070663_100036003 Ga0070663_1000360034 186
57 3300009101 Ga0105247_10001324 Ga0105247_100013244 186
58 3300013306 Ga0163162_10281252 Ga0163162_102812523 186
59 3300017792 Ga0163161_10075142 Ga0163161_100751423 186
60 3300026067 Ga0207678_10049696 Ga0207678_100496964 186
61 3300009177 Ga0105248_10578454 Ga0105248_105784541 187
62 3300003214 JGI25165J46597_1010873 JGI25165J46597_10108733 188
63 3300005548 Ga0070665_100004322 Ga0070665_10000432227 188
64 3300009551 Ga0105238_10039356 Ga0105238_100393564 188
65 3300013306 Ga0163162_10001854 Ga0163162_100018544 188
66 3300025924 Ga0207694_10016063 Ga0207694_100160634 188
67 3300028379 Ga0268266_10000021 Ga0268266_100000214 188
68 3300044842 Ga0466957_0003550 Ga0466957_0003550_8011_8577 188
69 3300048929 Ga0496126_0006212 Ga0496126_0006212_11440_12042 188
70 3300003771 Ga0055526_1005867 Ga0055526_10058673 189
71 3300003773 Ga0055537_1000851 Ga0055537_10008514 189
72 3300003775 Ga0055524_1013601 Ga0055524_10136014 189
73 3300003781 Ga0055536_1014260 Ga0055536_10142603 189
74 3300003781 Ga0055536_1024910 Ga0055536_10249102 189
75 3300003784 Ga0055534_1000766 Ga0055534_10007663 189
76 3300003790 Ga0055528_1001961 Ga0055528_10019614 189
77 3300003791 Ga0055530_10025415 Ga0055530_100254152 189
78 3300003791 Ga0055530_10067608 Ga0055530_100676081 189
79 3300003794 Ga0055531_10026369 Ga0055531_100263692 189
80 3300003856 Ga0058692_1000785 Ga0058692_10007853 189
81 3300005288 Ga0065714_10109302 Ga0065714_101093023 189
82 3300005347 Ga0070668_100303029 Ga0070668_1003030293 189
83 3300005355 Ga0070671_100012931 Ga0070671_10001293112 189
84 3300005367 Ga0070667_100797580 Ga0070667_1007975801 189
85 3300005437 Ga0070710_10793862 Ga0070710_107938621 189
86 3300005548 Ga0070665_100177902 Ga0070665_1001779024 189
87 3300005985 Ga0081539_10024522 Ga0081539_100245224 189
88 3300006048 Ga0075363_100202638 Ga0075363_1002026382 189
89 3300006237 Ga0097621_100195694 Ga0097621_1001956942 189
90 3300009011 Ga0105251_10003747 Ga0105251_1000374722 189
91 3300009036 Ga0105244_10014959 Ga0105244_100149596 189
92 3300009036 Ga0105244_10048884 Ga0105244_100488843 189
93 3300009148 Ga0105243_10036695 Ga0105243_100366955 189
94 3300025263 Ga0209565_1000415 Ga0209565_100041543 189
95 3300025273 Ga0209673_1000204 Ga0209673_100020417 189
96 3300025284 Ga0209130_1003085 Ga0209130_100308513 189
97 3300025291 Ga0209675_1000015 Ga0209675_100001558 189
98 3300025292 Ga0209676_1000110 Ga0209676_10001104 189
99 3300025292 Ga0209676_1004379 Ga0209676_100437917 189
100 3300025292 Ga0209676_1006351 Ga0209676_100635111 189
101 3300025295 Ga0209564_1000037 Ga0209564_1000037310 189
102 3300025298 Ga0209050_1053325 Ga0209050_10533252 189
103 3300025299 Ga0209256_1007814 Ga0209256_10078143 189
104 3300025303 Ga0209051_1001513 Ga0209051_100151329 189
105 3300025304 Ga0209257_1000129 Ga0209257_10001294 189
106 3300025304 Ga0209257_1006637 Ga0209257_10066373 189
107 3300025728 Ga0207655_1022400 Ga0207655_10224003 189
108 3300025728 Ga0207655_1039647 Ga0207655_10396473 189
109 3300025735 Ga0207713_1004451 Ga0207713_100445117 189
110 3300025893 Ga0207682_10033068 Ga0207682_100330683 189
111 3300025931 Ga0207644_10011422 Ga0207644_100114224 189
112 3300025935 Ga0207709_10000421 Ga0207709_1000042123 189
113 3300025972 Ga0207668_11155648 Ga0207668_111556481 189
114 3300025986 Ga0207658_10148113 Ga0207658_101481133 189
115 3300027312 Ga0209371_1000004 Ga0209371_10000041043 189
116 3300028379 Ga0268266_10030836 Ga0268266_100308366 189
117 3300028379 Ga0268266_10170446 Ga0268266_101704464 189
118 3300030500 Ga0268256_1000005 Ga0268256_10000054 189
119 3300030731 Ga0316177_1042582 Ga0316177_10425823 189
120 3300030732 Ga0316176_1015742 Ga0316176_10157424 189
121 3300030742 Ga0316183_1139965 Ga0316183_11399652 189
122 3300030745 Ga0316182_1183376 Ga0316182_11833763 189
123 3300031824 Ga0307413_10081955 Ga0307413_100819551 189
124 3300031995 Ga0307409_101638881 Ga0307409_1016388811 189
125 3300032004 Ga0307414_10007179 Ga0307414_100071794 189
126 3300032004 Ga0307414_10063463 Ga0307414_100634632 189
127 3300032004 Ga0307414_10187955 Ga0307414_101879553 189
128 3300032004 Ga0307414_10913289 Ga0307414_109132892 189
129 3300032004 Ga0307414_11303549 Ga0307414_113035491 189
130 3300032004 Ga0307414_11306492 Ga0307414_113064921 189
131 3300037312 Ga0395899_0091130 Ga0395899_0091130_311_919 189
132 3300037312 Ga0395899_0562413 Ga0395899_0562413_112_720 189
133 3300037418 Ga0395900_0241648 Ga0395900_0241648_244_852 189
134 3300037466 Ga0395898_0587291 Ga0395898_0587291_183_791 189
135 3300037471 Ga0395905_0110752 Ga0395905_0110752_819_1427 189
136 3300038443 Ga0395901_0143647 Ga0395901_0143647_1771_2379 189
137 3300038705 Ga0237819_05137 Ga0237819_05137_781_1392 189
138 3300041452 Ga0451793_1506933 Ga0451793_1506933_109_711 189
139 3300041455 Ga0451801_19993 Ga0451801_19993_1143_1754 189
140 3300041458 Ga0451798_0875692 Ga0451798_0875692_335_946 189
141 3300041459 Ga0451800_1057945 Ga0451800_1057945_1572_2183 189
142 3300041462 Ga0451806_234332 Ga0451806_234332_17563_18174 189
143 3300041486 Ga0451807_1035554 Ga0451807_1035554_1336_1947 189
144 3300041494 Ga0451837_0822369 Ga0451837_0822369_720_1331 189
145 3300042007 Ga0439449_0059877 Ga0439449_0059877_259_879 189
146 3300046501 Ga0495607_0154297 Ga0495607_0154297_461_1069 189
147 3300046507 Ga0495606_0035985 Ga0495606_0035985_1994_2602 189
148 3300046660 Ga0495625_0139135 Ga0495625_0139135_215_817 189
149 3300047470 Ga0495681_0080605 Ga0495681_0080605_229_834 189
150 3300047470 Ga0495681_0124862 Ga0495681_0124862_411_1016 189
151 3300048911 Ga0496108_0100619 Ga0496108_0100619_1290_1892 189
152 3300048912 Ga0496109_0062064 Ga0496109_0062064_783_1391 189
153 3300048915 Ga0496112_0025726 Ga0496112_0025726_3498_4106 189
154 3300048916 Ga0496113_0067298 Ga0496113_0067298_1547_2155 189
155 3300048918 Ga0496115_0367309 Ga0496115_0367309_381_989 189
156 3300049571 Ga0501034_0021966 Ga0501034_0021966_1526_2131 189
157 3300049823 Ga0501044_0446143 Ga0501044_0446143_461_1063 189
158 3300053090 Ga0500646_0022488 Ga0500646_0022488_678_1280 189
159 3300002773 JGI25152J39213_1000284 JGI25152J39213_100028441 190
160 3300002774 JGI25150J39212_1000359 JGI25150J39212_10003593 190
161 3300003187 JGI25151J46595_10000895 JGI25151J46595_1000089533 190
162 3300003187 JGI25151J46595_10007643 JGI25151J46595_100076435 190
163 3300003187 JGI25151J46595_10013580 JGI25151J46595_100135803 190
164 3300003215 JGI25153J46596_10000050 JGI25153J46596_10000050154 190
165 3300003371 JGI26145J50221_1000107 JGI26145J50221_10001073 190
166 3300003382 JGI26139J50223_100733 JGI26139J50223_1007332 190
167 3300003771 Ga0055526_1008536 Ga0055526_10085363 190
168 3300003771 Ga0055526_1008987 Ga0055526_10089873 190
169 3300003773 Ga0055537_1001096 Ga0055537_10010963 190
170 3300003775 Ga0055524_1013602 Ga0055524_10136023 190
171 3300003775 Ga0055524_1015666 Ga0055524_10156663 190
172 3300003784 Ga0055534_1003331 Ga0055534_10033317 190
173 3300003784 Ga0055534_1006907 Ga0055534_10069073 190
174 3300003790 Ga0055528_1013611 Ga0055528_10136113 190
175 3300003790 Ga0055528_1016393 Ga0055528_10163933 190
176 3300003791 Ga0055530_10004966 Ga0055530_100049665 190
177 3300003794 Ga0055531_10014020 Ga0055531_100140204 190
178 3300003794 Ga0055531_10017875 Ga0055531_100178753 190
179 3300003856 Ga0058692_1000748 Ga0058692_10007483 190
180 3300005289 Ga0065704_10071563 Ga0065704_1007156314 190
181 3300005327 Ga0070658_10987122 Ga0070658_109871221 190
182 3300005329 Ga0070683_100194209 Ga0070683_1001942092 190
183 3300005331 Ga0070670_100015496 Ga0070670_1000154966 190
184 3300005331 Ga0070670_100143059 Ga0070670_1001430592 190
185 3300005331 Ga0070670_100360366 Ga0070670_1003603662 190
186 3300005334 Ga0068869_100843709 Ga0068869_1008437091 190
187 3300005336 Ga0070680_100255720 Ga0070680_1002557203 190
188 3300005339 Ga0070660_100058257 Ga0070660_1000582572 190
189 3300005347 Ga0070668_100034720 Ga0070668_1000347204 190
190 3300005347 Ga0070668_100061248 Ga0070668_1000612483 190
191 3300005353 Ga0070669_100222301 Ga0070669_1002223011 190
192 3300005354 Ga0070675_100105895 Ga0070675_1001058952 190
193 3300005354 Ga0070675_100213624 Ga0070675_1002136242 190
194 3300005355 Ga0070671_100051737 Ga0070671_1000517374 190
195 3300005355 Ga0070671_100202548 Ga0070671_1002025483 190
196 3300005355 Ga0070671_100724727 Ga0070671_1007247272 190
197 3300005364 Ga0070673_100209228 Ga0070673_1002092282 190
198 3300005366 Ga0070659_100231145 Ga0070659_1002311453 190
199 3300005435 Ga0070714_100793077 Ga0070714_1007930771 190
200 3300005438 Ga0070701_10282652 Ga0070701_102826522 190
201 3300005441 Ga0070700_100877305 Ga0070700_1008773051 190
202 3300005456 Ga0070678_100729891 Ga0070678_1007298911 190
203 3300005457 Ga0070662_100282610 Ga0070662_1002826103 190
204 3300005458 Ga0070681_10205910 Ga0070681_102059102 190
205 3300005530 Ga0070679_100385818 Ga0070679_1003858183 190
206 3300005530 Ga0070679_100466934 Ga0070679_1004669341 190
207 3300005539 Ga0068853_100449667 Ga0068853_1004496672 190
208 3300005546 Ga0070696_100760455 Ga0070696_1007604551 190
209 3300005548 Ga0070665_100152522 Ga0070665_1001525223 190
210 3300005618 Ga0068864_100069812 Ga0068864_1000698122 190
211 3300005841 Ga0068863_100162700 Ga0068863_1001627003 190
212 3300005844 Ga0068862_100477495 Ga0068862_1004774952 190
213 3300009011 Ga0105251_10018245 Ga0105251_100182454 190
214 3300009148 Ga0105243_10063811 Ga0105243_100638115 190
215 3300009979 Ga0105032_100517 Ga0105032_1005173 190
216 3300012510 Ga0157316_1004643 Ga0157316_10046432 190
217 3300012512 Ga0157327_1000560 Ga0157327_10005602 190
218 3300012513 Ga0157326_1006833 Ga0157326_10068332 190
219 3300013100 Ga0157373_10142986 Ga0157373_101429862 190
220 3300013102 Ga0157371_10083622 Ga0157371_100836222 190
221 3300013102 Ga0157371_10707468 Ga0157371_107074682 190
222 3300013105 Ga0157369_10312189 Ga0157369_103121892 190
223 3300013297 Ga0157378_11019923 Ga0157378_110199232 190
224 3300013307 Ga0157372_10616942 Ga0157372_106169422 190
225 3300013307 Ga0157372_10903033 Ga0157372_109030332 190
226 3300013308 Ga0157375_10377773 Ga0157375_103777732 190
227 3300014326 Ga0157380_10515134 Ga0157380_105151342 190
228 3300015265 Ga0182005_1045440 Ga0182005_10454402 190
229 3300015689 Ga0183360_10001 Ga0183360_100012727 190
230 3300017792 Ga0163161_10348494 Ga0163161_103484942 190
231 3300020075 Ga0206349_1852705 Ga0206349_18527053 190
232 3300025245 Ga0207425_1000117 Ga0207425_100011741 190
233 3300025245 Ga0207425_1005550 Ga0207425_10055504 190
234 3300025258 Ga0209129_1000011 Ga0209129_1000011340 190
235 3300025263 Ga0209565_1000001 Ga0209565_10000011146 190
236 3300025273 Ga0209673_1000001 Ga0209673_10000011146 190
237 3300025273 Ga0209673_1002116 Ga0209673_100211624 190
238 3300025284 Ga0209130_1007816 Ga0209130_10078166 190
239 3300025291 Ga0209675_1000001 Ga0209675_10000011387 190
240 3300025291 Ga0209675_1006904 Ga0209675_10069046 190
241 3300025292 Ga0209676_1001608 Ga0209676_100160830 190
242 3300025292 Ga0209676_1004892 Ga0209676_10048923 190
243 3300025294 Ga0209025_1000002 Ga0209025_1000002458 190
244 3300025294 Ga0209025_1000006 Ga0209025_100000622 190
245 3300025295 Ga0209564_1000001 Ga0209564_10000011549 190
246 3300025295 Ga0209564_1007141 Ga0209564_100714110 190
247 3300025297 Ga0209758_1000003 Ga0209758_1000003465 190
248 3300025297 Ga0209758_1083243 Ga0209758_10832432 190
249 3300025298 Ga0209050_1001128 Ga0209050_100112839 190
250 3300025299 Ga0209256_1000002 Ga0209256_10000024 190
251 3300025299 Ga0209256_1003821 Ga0209256_10038214 190
252 3300025302 Ga0207426_1068355 Ga0207426_10683552 190
253 3300025303 Ga0209051_1028616 Ga0209051_10286162 190
254 3300025304 Ga0209257_1002665 Ga0209257_100266527 190
255 3300025304 Ga0209257_1006382 Ga0209257_100638216 190
256 3300025315 Ga0207697_10049742 Ga0207697_100497422 190
257 3300025321 Ga0207656_10367844 Ga0207656_103678441 190
258 3300025735 Ga0207713_1000294 Ga0207713_100029437 190
259 3300025907 Ga0207645_10107422 Ga0207645_101074223 190
260 3300025908 Ga0207643_10160910 Ga0207643_101609103 190
261 3300025909 Ga0207705_10060885 Ga0207705_100608853 190
262 3300025912 Ga0207707_10277754 Ga0207707_102777542 190
263 3300025919 Ga0207657_10006384 Ga0207657_100063844 190
264 3300025921 Ga0207652_10097888 Ga0207652_100978883 190
265 3300025923 Ga0207681_10248036 Ga0207681_102480362 190
266 3300025925 Ga0207650_10004000 Ga0207650_100040004 190
267 3300025925 Ga0207650_10023595 Ga0207650_100235953 190
268 3300025926 Ga0207659_10242293 Ga0207659_102422932 190
269 3300025929 Ga0207664_10775667 Ga0207664_107756672 190
270 3300025931 Ga0207644_10004894 Ga0207644_100048944 190
271 3300025935 Ga0207709_10044385 Ga0207709_100443852 190
272 3300025941 Ga0207711_10073580 Ga0207711_100735805 190
273 3300025942 Ga0207689_10856643 Ga0207689_108566432 190
274 3300025944 Ga0207661_10169487 Ga0207661_101694871 190
275 3300025949 Ga0207667_10419728 Ga0207667_104197282 190
276 3300025972 Ga0207668_10008750 Ga0207668_100087506 190
277 3300025972 Ga0207668_10013075 Ga0207668_100130756 190
278 3300025981 Ga0207640_10532998 Ga0207640_105329982 190
279 3300026023 Ga0207677_10446954 Ga0207677_104469542 190
280 3300026041 Ga0207639_11079581 Ga0207639_110795812 190
281 3300026088 Ga0207641_10104276 Ga0207641_101042763 190
282 3300026089 Ga0207648_10084850 Ga0207648_100848504 190
283 3300026095 Ga0207676_10059226 Ga0207676_100592265 190
284 3300026118 Ga0207675_100428514 Ga0207675_1004285142 190
285 3300026142 Ga0207698_10450120 Ga0207698_104501203 190
286 3300027252 Ga0209973_1001982 Ga0209973_10019821 190
287 3300027312 Ga0209371_1000294 Ga0209371_100029464 190
288 3300027360 Ga0209969_1000918 Ga0209969_10009185 190
289 3300027364 Ga0209967_1002362 Ga0209967_10023625 190
290 3300027364 Ga0209967_1009133 Ga0209967_10091332 190
291 3300027424 Ga0209984_1000306 Ga0209984_10003066 190
292 3300027462 Ga0210000_1004942 Ga0210000_10049423 190
293 3300027471 Ga0209995_1000770 Ga0209995_10007707 190
294 3300027543 Ga0209999_1002797 Ga0209999_10027972 190
295 3300027543 Ga0209999_1020896 Ga0209999_10208962 190
296 3300027552 Ga0209982_1000032 Ga0209982_10000326 190
297 3300027552 Ga0209982_1051017 Ga0209982_10510171 190
298 3300027614 Ga0209970_1038066 Ga0209970_10380661 190
299 3300027665 Ga0209983_1000295 Ga0209983_100029520 190
300 3300027682 Ga0209971_1000410 Ga0209971_100041021 190
301 3300027876 Ga0209974_10010367 Ga0209974_100103673 190
302 3300027876 Ga0209974_10074748 Ga0209974_100747482 190
303 3300028379 Ga0268266_10168036 Ga0268266_101680363 190
304 3300028380 Ga0268265_10162232 Ga0268265_101622323 190
305 3300030500 Ga0268256_1000258 Ga0268256_10002584 190
306 3300030732 Ga0316176_1213588 Ga0316176_12135882 190
307 3300030744 Ga0316181_1164435 Ga0316181_11644352 190
308 3300031456 Ga0307513_10521493 Ga0307513_105214932 190
309 3300031548 Ga0307408_100181171 Ga0307408_1001811712 190
310 3300031548 Ga0307408_101204677 Ga0307408_1012046771 190
311 3300031731 Ga0307405_10142144 Ga0307405_101421443 190
312 3300031824 Ga0307413_10037133 Ga0307413_100371333 190
313 3300031824 Ga0307413_10047867 Ga0307413_100478673 190
314 3300031824 Ga0307413_10279926 Ga0307413_102799262 190
315 3300031824 Ga0307413_10280806 Ga0307413_102808062 190
316 3300031852 Ga0307410_10028499 Ga0307410_100284992 190
317 3300031901 Ga0307406_10068752 Ga0307406_100687522 190
318 3300031903 Ga0307407_10034741 Ga0307407_100347413 190
319 3300031903 Ga0307407_10089439 Ga0307407_100894392 190
320 3300031911 Ga0307412_10042944 Ga0307412_100429445 190
321 3300031995 Ga0307409_100024348 Ga0307409_1000243486 190
322 3300032002 Ga0307416_100404694 Ga0307416_1004046943 190
323 3300032004 Ga0307414_10002120 Ga0307414_1000212020 190
324 3300032004 Ga0307414_10020644 Ga0307414_100206446 190
325 3300032004 Ga0307414_10046872 Ga0307414_100468723 190
326 3300032004 Ga0307414_10178231 Ga0307414_101782313 190
327 3300032004 Ga0307414_10258340 Ga0307414_102583403 190
328 3300032004 Ga0307414_10305106 Ga0307414_103051063 190
329 3300032005 Ga0307411_10015295 Ga0307411_1001529510 190
330 3300032005 Ga0307411_10390319 Ga0307411_103903192 190
331 3300032005 Ga0307411_10953077 Ga0307411_109530772 190
332 3300032126 Ga0307415_100292343 Ga0307415_1002923433 190
333 3300034816 Ga0373930_0069596 Ga0373930_0069596_110_715 190
334 3300037418 Ga0395900_0036642 Ga0395900_0036642_4110_4715 190
335 3300037418 Ga0395900_0765478 Ga0395900_0765478_183_788 190
336 3300037466 Ga0395898_0180698 Ga0395898_0180698_129_734 190
337 3300037471 Ga0395905_0293167 Ga0395905_0293167_745_1350 190
338 3300037471 Ga0395905_0298452 Ga0395905_0298452_723_1328 190
339 3300038705 Ga0237819_00026 Ga0237819_00026_48152_48763 190
340 3300041404 Ga0439436_0020558 Ga0439436_0020558_412_1020 190
341 3300041404 Ga0439436_0044395 Ga0439436_0044395_71_676 190
342 3300041404 Ga0439436_0110206 Ga0439436_0110206_69_674 190
343 3300041406 Ga0439439_0004561 Ga0439439_0004561_793_1398 190
344 3300041407 Ga0439447_013961 Ga0439447_013961_1079_1690 190
345 3300041413 Ga0439465_0005524 Ga0439465_0005524_2645_3253 190
346 3300041444 Ga0451790_10956 Ga0451790_10956_183_794 190
347 3300041452 Ga0451793_0190021 Ga0451793_0190021_130_738 190
348 3300041456 Ga0451795_0694995 Ga0451795_0694995_302_910 190
349 3300041461 Ga0451805_049393 Ga0451805_049393_443_1051 190
350 3300041463 Ga0451804_0524950 Ga0451804_0524950_223_831 190
351 3300041509 Ga0451843_0242471 Ga0451843_0242471_164_775 190
352 3300041509 Ga0451843_0922492 Ga0451843_0922492_133_744 190
353 3300041997 Ga0439431_0008628 Ga0439431_0008628_1327_1935 190
354 3300042004 Ga0439445_0011454 Ga0439445_0011454_1432_2037 190
355 3300042007 Ga0439449_0011871 Ga0439449_0011871_1714_2319 190
356 3300042007 Ga0439449_0039601 Ga0439449_0039601_739_1347 190
357 3300042007 Ga0439449_0050566 Ga0439449_0050566_63_671 190
358 3300042007 Ga0439449_0052843 Ga0439449_0052843_557_1168 190
359 3300042010 Ga0439452_041628 Ga0439452_041628_377_985 190
360 3300042128 Ga0450897_006886 Ga0450897_006886_309_920 190
361 3300042156 Ga0439446_0036071 Ga0439446_0036071_278_886 190
362 3300042435 Ga0439434_0194142 Ga0439434_0194142_35_640 190
363 3300042993 Ga0439440_0015463 Ga0439440_0015463_249_857 190
364 3300046525 Ga0495663_0004473 Ga0495663_0004473_753_1361 190
365 3300046525 Ga0495663_0102121 Ga0495663_0102121_214_819 190
366 3300046539 Ga0495621_0001470 Ga0495621_0001470_4076_4681 190
367 3300046615 Ga0495656_0006174 Ga0495656_0006174_3521_4129 190
368 3300046615 Ga0495656_0140966 Ga0495656_0140966_418_1023 190
369 3300046616 Ga0495668_0033171 Ga0495668_0033171_1770_2375 190
370 3300046691 Ga0495670_0101413 Ga0495670_0101413_449_1060 190
371 3300047318 Ga0495636_0052343 Ga0495636_0052343_733_1344 190
372 3300047445 Ga0495677_0149460 Ga0495677_0149460_147_752 190
373 3300048903 Ga0496100_0732691 Ga0496100_0732691_37_645 190
374 3300048904 Ga0496101_0090873 Ga0496101_0090873_1634_2239 190
375 3300048905 Ga0496102_0109999 Ga0496102_0109999_1439_2044 190
376 3300048906 Ga0496103_0145760 Ga0496103_0145760_493_1098 190
377 3300048909 Ga0496106_0003988 Ga0496106_0003988_1399_2004 190
378 3300048910 Ga0496107_0011190 Ga0496107_0011190_4274_4879 190
379 3300048911 Ga0496108_0001932 Ga0496108_0001932_1511_2116 190
380 3300048912 Ga0496109_0085316 Ga0496109_0085316_1493_2098 190
381 3300048913 Ga0496110_0011371 Ga0496110_0011371_5128_5733 190
382 3300048914 Ga0496111_0003793 Ga0496111_0003793_1384_1989 190
383 3300048915 Ga0496112_0240221 Ga0496112_0240221_756_1361 190
384 3300048917 Ga0496114_0025860 Ga0496114_0025860_323_928 190
385 3300048920 Ga0496117_0028524 Ga0496117_0028524_2119_2730 190
386 3300048921 Ga0496118_0099530 Ga0496118_0099530_1286_1897 190
387 3300048922 Ga0496119_0267452 Ga0496119_0267452_207_818 190
388 3300048923 Ga0496120_0024106 Ga0496120_0024106_1592_2203 190
389 3300048924 Ga0496121_0005001 Ga0496121_0005001_15316_15927 190
390 3300048925 Ga0496122_0079528 Ga0496122_0079528_212_820 190
391 3300048925 Ga0496122_0097842 Ga0496122_0097842_892_1500 190
392 3300048926 Ga0496123_0022702 Ga0496123_0022702_632_1240 190
393 3300048926 Ga0496123_0031047 Ga0496123_0031047_1601_2212 190
394 3300048926 Ga0496123_0146817 Ga0496123_0146817_488_1096 190
395 3300048927 Ga0496124_0000018 Ga0496124_0000018_440814_441422 190
396 3300048927 Ga0496124_0107957 Ga0496124_0107957_1461_2069 190
397 3300049128 Ga0501308_000035 Ga0501308_000035_1663_2271 190
398 3300049129 Ga0501309_003449 Ga0501309_003449_224_829 190
399 3300049130 Ga0501310_000986 Ga0501310_000986_921_1526 190
400 3300049162 Ga0501307_000579 Ga0501307_000579_238_846 190
401 3300049162 Ga0501307_006548 Ga0501307_006548_132_737 190
402 3300049527 Ga0501311_003051 Ga0501311_003051_624_1229 190
403 3300049528 Ga0501312_002244 Ga0501312_002244_116_724 190
404 3300049528 Ga0501312_002447 Ga0501312_002447_1010_1615 190
405 3300049528 Ga0501312_007104 Ga0501312_007104_169_774 190
406 3300049531 Ga0501315_004415 Ga0501315_004415_609_1214 190
407 3300049533 Ga0501317_001762 Ga0501317_001762_340_945 190
408 3300049533 Ga0501317_006218 Ga0501317_006218_76_684 190
409 3300049534 Ga0501318_000528 Ga0501318_000528_921_1526 190
410 3300049535 Ga0501319_000070 Ga0501319_000070_142_750 190
411 3300049537 Ga0501321_005366 Ga0501321_005366_104_709 190
412 3300049539 Ga0501323_000068 Ga0501323_000068_4187_4792 190
413 3300049539 Ga0501323_000101 Ga0501323_000101_3954_4562 190
414 3300049540 Ga0501324_014225 Ga0501324_014225_27_635 190
415 3300049568 Ga0501031_0025141 Ga0501031_0025141_2901_3509 190
416 3300049568 Ga0501031_0101188 Ga0501031_0101188_1033_1635 190
417 3300049570 Ga0501033_0075593 Ga0501033_0075593_352_960 190
418 3300049570 Ga0501033_0123272 Ga0501033_0123272_1168_1770 190
419 3300049571 Ga0501034_0099165 Ga0501034_0099165_1871_2479 190
420 3300049571 Ga0501034_0120372 Ga0501034_0120372_995_1603 190
421 3300049572 Ga0501036_0066357 Ga0501036_0066357_786_1394 190
422 3300049574 Ga0501038_0002396 Ga0501038_0002396_1622_2230 190
423 3300049574 Ga0501038_0026720 Ga0501038_0026720_1418_2020 190
424 3300049575 Ga0501039_0013271 Ga0501039_0013271_3322_3930 190
425 3300049579 Ga0501043_0030616 Ga0501043_0030616_2134_2745 190
426 3300049581 Ga0501047_0221275 Ga0501047_0221275_499_1107 190
427 3300049586 Ga0501070_0198353 Ga0501070_0198353_968_1570 190
428 3300049587 Ga0501071_0037161 Ga0501071_0037161_237_845 190
429 3300049589 Ga0501073_0068309 Ga0501073_0068309_830_1432 190
430 3300049672 Ga0501239_002487 Ga0501239_002487_687_1295 190
431 3300049674 Ga0501242_009218 Ga0501242_009218_472_1077 190
432 3300049677 Ga0501247_029292 Ga0501247_029292_64_669 190
433 3300049679 Ga0501249_021629 Ga0501249_021629_514_1122 190
434 3300049682 Ga0501252_008250 Ga0501252_008250_76_684 190
435 3300049742 Ga0501080_0018310 Ga0501080_0018310_4935_5543 190
436 3300049822 Ga0501035_0039431 Ga0501035_0039431_1148_1756 190
437 3300049823 Ga0501044_0003730 Ga0501044_0003730_117_725 190
438 3300049823 Ga0501044_0154075 Ga0501044_0154075_954_1556 190
439 3300053161 Ga0500634_0003199 Ga0500634_0003199_4963_5574 190
440 3300059510 Ga0587090_008934 Ga0587090_008934_138_746 190
441 3300005331 Ga0070670_100385915 Ga0070670_1003859153 191
442 3300005539 Ga0068853_100116876 Ga0068853_1001168762 191
443 3300012477 Ga0157336_1001516 Ga0157336_10015162 191
444 3300026121 Ga0207683_10335929 Ga0207683_103359293 191
445 3300048929 Ga0496126_0655193 Ga0496126_0655193_88_693 191
446 3300005543 Ga0070672_100451180 Ga0070672_1004511802 192
447 3300005547 Ga0070693_100016180 Ga0070693_1000161804 192
448 3300025909 Ga0207705_10512893 Ga0207705_105128931 192
449 3300025940 Ga0207691_10441264 Ga0207691_104412642 192
450 3300053120 Ga0500597_115201 Ga0500597_115201_138_749 192
451 iso_pu_bacteria 2537561836 2538834131 196
452 iso_pu_bacteria 2547132130 2547502383 196
453 iso_pu_bacteria 2571042365 2572256415 196
454 iso_pu_bacteria 2576861471 2578459523 196
455 iso_pu_bacteria 2593339238 2595448046 196
456 iso_pu_bacteria 2593339239 2595451342 196
457 iso_pu_bacteria 2643221559 2643816128 196
458 iso_pu_bacteria 2643221562 2643829525 196
459 iso_pu_bacteria 2643221573 2643877934 196
460 iso_pu_bacteria 2643221577 2643895220 196
461 iso_pu_bacteria 2643221581 2643915222 196
462 iso_pu_bacteria 2643221586 2643938156 196
463 iso_pu_bacteria 2643221593 2643975361 196
464 iso_pu_bacteria 2643221612 2644077728 196
465 iso_pu_bacteria 2643221685 2644477379 196
466 iso_pu_bacteria 2643221695 2644530917 196
467 iso_pu_bacteria 2643221720 2644659244 196
468 iso_pu_bacteria 2643221727 2644695979 196
469 iso_pu_bacteria 2643221728 2644698582 196
470 iso_pu_bacteria 2687453130 2687584040 196
471 iso_pu_bacteria 2718218334 2721028623 196
472 iso_pu_bacteria 2734482264 2735835786 196
473 iso_pu_bacteria 2738543009 2739227009 196
474 iso_pu_bacteria 2739367700 2739732123 196
475 iso_pu_bacteria 2747842428 2747950328 196
476 iso_pu_bacteria 2747842501 2748018122 196
477 iso_pu_bacteria 2765235840 2765577783 196
478 iso_pu_bacteria 2816332141 2816515846 196
479 iso_pu_bacteria 2818991440 2819566530 196
480 iso_pu_bacteria 2818991457 2819660642 196
481 iso_pu_bacteria 2842391507 2842394170 196
482 iso_pu_bacteria 2842757796 2842759739 196
483 iso_pu_bacteria 2842780639 2842781649 196
484 iso_pu_bacteria 2842914999 2842915002 196
485 iso_pu_bacteria 2842918807 2842922236 196
486 iso_pu_bacteria 2852649853 2852653100 196
487 iso_pu_bacteria 2852684882 2852688818 196
488 iso_pu_bacteria 2857442823 2857445084 196
489 iso_pu_bacteria 2874220319 2874220388 196
490 iso_pu_bacteria 2884338543 2884339564 196
491 iso_pu_bacteria 2884411467 2884413729 196
492 iso_pu_bacteria 2894414249 2894414495 196
493 iso_pu_bacteria 2895395659 2895397475 196
494 iso_pu_bacteria 2904463128 2904467186 196
495 iso_pu_bacteria 2919085039 2919086799 196
496 iso_pu_bacteria 2919089067 2919091658 196
497 iso_pu_bacteria 2919130084 2919130087 196
498 iso_pu_bacteria 2919134579 2919134935 196
499 iso_pu_bacteria 2919404418 2919404421 196
500 iso_pu_bacteria 2919513703 2919515163 196
501 iso_pu_bacteria 2919675420 2919678180 196
502 iso_pu_bacteria 2923516293 2923519228 196
503 iso_pu_bacteria 2928496128 2928498478 196
504 iso_pu_bacteria 2928963466 2928964821 196
505 iso_pu_bacteria 2929195423 2929198918 196
506 iso_pu_bacteria 2931380184 2931381955 196
507 iso_pu_bacteria 2937610967 2937611279 196
508 iso_pu_bacteria 2939589442 2939591859 196
509 iso_pu_bacteria 2939611941 2939612732 196
510 iso_pu_bacteria 2939622612 2939625885 196
511 iso_pu_bacteria 2939626828 2939631014 196
512 iso_pu_bacteria 2941471342 2941473850 196
513 iso_pu_bacteria 2941475908 2941477278 196
514 iso_pu_bacteria 2953994433 2953997353 196
515 iso_pu_bacteria 2961047084 2961047153 196
516 iso_pu_bacteria 2961064222 2961068523 196
517 iso_pu_bacteria 2974307012 2974309976 196
518 iso_pu_bacteria 2977247770 2977250711 196
519 iso_pu_bacteria 2984514374 2984514804 196
520 iso_pu_bacteria 2987605356 2987605648 196
521 iso_pu_bacteria 2995948881 2995950364 196
522 iso_pu_bacteria 8002869464 8002871445 196
523 iso_pu_bacteria 8003014200 8003015002 196
524 iso_pu_bacteria 8021622325 8021626350 196
525 iso_pu_bacteria 8021626552 8021629643 196
526 iso_pu_bacteria 8021648035 8021649684 196
527 3300002077 JGI24744J21845_10002487 JGI24744J21845_100024872 198
528 3300005335 Ga0070666_10028752 Ga0070666_100287522 198
529 3300005834 Ga0068851_10059998 Ga0068851_100599983 198
530 3300006358 Ga0068871_100342936 Ga0068871_1003429362 198
531 3300009098 Ga0105245_11928201 Ga0105245_119282011 198
532 3300013296 Ga0157374_10190512 Ga0157374_101905123 198
533 3300013306 Ga0163162_10046484 Ga0163162_100464846 198
534 3300014325 Ga0163163_10165866 Ga0163163_101658663 198
535 3300025903 Ga0207680_10002673 Ga0207680_100026731 198
536 3300025928 Ga0207700_10741499 Ga0207700_107414992 198
537 3300031616 Ga0307508_10105773 Ga0307508_101057734 198
538 3300048906 Ga0496103_0296905 Ga0496103_0296905_37_636 198
539 3300048918 Ga0496115_0002549 Ga0496115_0002549_1209_1808 198
540 3300048929 Ga0496126_0000033 Ga0496126_0000033_31638_32237 198
541 3300049568 Ga0501031_0096163 Ga0501031_0096163_1118_1717 198
542 3300049569 Ga0501032_0045411 Ga0501032_0045411_1512_2111 198
543 3300049571 Ga0501034_0056333 Ga0501034_0056333_2193_2792 198
544 3300049571 Ga0501034_0066470 Ga0501034_0066470_1853_2452 198
545 3300049571 Ga0501034_0377238 Ga0501034_0377238_640_1239 198
546 3300049575 Ga0501039_0811864 Ga0501039_0811864_51_650 198
547 3300049579 Ga0501043_0111378 Ga0501043_0111378_807_1406 198
548 3300049580 Ga0501046_0067782 Ga0501046_0067782_927_1526 198
549 3300049580 Ga0501046_0470696 Ga0501046_0470696_146_745 198
550 3300049581 Ga0501047_0000250 Ga0501047_0000250_1146_1745 198
551 3300049581 Ga0501047_0045199 Ga0501047_0045199_2157_2756 198
552 3300049581 Ga0501047_0100864 Ga0501047_0100864_835_1434 198
553 3300049583 Ga0501067_0019365 Ga0501067_0019365_1168_1767 198
554 3300049585 Ga0501069_0095297 Ga0501069_0095297_765_1364 198
555 3300049586 Ga0501070_0042967 Ga0501070_0042967_1996_2595 198
556 3300049586 Ga0501070_0086782 Ga0501070_0086782_656_1255 198
557 3300049586 Ga0501070_0153676 Ga0501070_0153676_224_823 198
558 3300049586 Ga0501070_0162900 Ga0501070_0162900_76_675 198
559 3300049588 Ga0501072_0021878 Ga0501072_0021878_3195_3794 198
560 3300049589 Ga0501073_0000196 Ga0501073_0000196_38267_38866 198
561 3300049589 Ga0501073_0210261 Ga0501073_0210261_569_1168 198
562 3300049590 Ga0501074_0031616 Ga0501074_0031616_1067_1666 198
563 3300049590 Ga0501074_0034673 Ga0501074_0034673_64_663 198
564 3300049590 Ga0501074_0154724 Ga0501074_0154724_695_1294 198
565 3300049742 Ga0501080_0005488 Ga0501080_0005488_1168_1767 198
566 3300049742 Ga0501080_0075188 Ga0501080_0075188_665_1264 198
567 3300049742 Ga0501080_0107130 Ga0501080_0107130_944_1543 198
568 3300049742 Ga0501080_0290833 Ga0501080_0290833_231_830 198
569 3300049744 Ga0501083_0021386 Ga0501083_0021386_1167_1766 198
570 3300049823 Ga0501044_0031982 Ga0501044_0031982_615_1214 198
571 3300054114 Ga0501084_0245529 Ga0501084_0245529_22_621 198
572 3300009094 Ga0111539_10329500 Ga0111539_103295002 199
573 3300025936 Ga0207670_10342728 Ga0207670_103427282 199
574 3300030745 Ga0316182_1088536 Ga0316182_10885361 199
575 3300031730 Ga0307516_10007119 Ga0307516_100071199 199
576 3300041999 Ga0439433_0083311 Ga0439433_0083311_12_614 199
577 3300042876 Ga0451577_0065354 Ga0451577_0065354_127_729 199
578 3300042876 Ga0451577_0182922 Ga0451577_0182922_832_1434 199
579 3300044712 Ga0453684_0000136 Ga0453684_0000136_321626_322228 199
580 3300045051 Ga0451576_0000025 Ga0451576_0000025_105663_106265 199
581 3300049162 Ga0501307_005239 Ga0501307_005239_716_1318 199
582 3300001904 JGI24736J21556_1004671 JGI24736J21556_10046713 200
583 3300001979 JGI24740J21852_10006264 JGI24740J21852_100062644 200
584 3300001989 JGI24739J22299_10000118 JGI24739J22299_100001182 200
585 3300001989 JGI24739J22299_10027486 JGI24739J22299_100274862 200
586 3300001990 JGI24737J22298_10010174 JGI24737J22298_100101746 200
587 3300001990 JGI24737J22298_10010685 JGI24737J22298_100106855 200
588 3300001990 JGI24737J22298_10037402 JGI24737J22298_100374022 200
589 3300002067 JGI24735J21928_10009574 JGI24735J21928_100095742 200
590 3300002067 JGI24735J21928_10011190 JGI24735J21928_100111902 200
591 3300002705 JGI25156J39149_1002085 JGI25156J39149_100208512 200
592 3300002705 JGI25156J39149_1002290 JGI25156J39149_10022904 200
593 3300002705 JGI25156J39149_1003296 JGI25156J39149_10032965 200
594 3300002705 JGI25156J39149_1007054 JGI25156J39149_10070543 200
595 3300002737 JGI25162J39368_1003847 JGI25162J39368_10038474 200
596 3300002737 JGI25162J39368_1003864 JGI25162J39368_10038645 200
597 3300002737 JGI25162J39368_1003895 JGI25162J39368_10038953 200
598 3300002737 JGI25162J39368_1008978 JGI25162J39368_10089783 200
599 3300002738 JGI25154J39366_1006144 JGI25154J39366_10061442 200
600 3300002741 JGI25157J39369_1001153 JGI25157J39369_10011534 200
601 3300002741 JGI25157J39369_1001750 JGI25157J39369_100175012 200
602 3300002741 JGI25157J39369_1001921 JGI25157J39369_10019213 200
603 3300002741 JGI25157J39369_1002043 JGI25157J39369_100204310 200
604 3300002741 JGI25157J39369_1002044 JGI25157J39369_10020444 200
605 3300002771 JGI25163J39215_1001413 JGI25163J39215_10014135 200
606 3300002772 JGI25164J39214_1000312 JGI25164J39214_100031236 200
607 3300002772 JGI25164J39214_1000781 JGI25164J39214_10007814 200
608 3300003214 JGI25165J46597_1000586 JGI25165J46597_100058636 200
609 3300003214 JGI25165J46597_1001532 JGI25165J46597_100153220 200
610 3300003215 JGI25153J46596_10022417 JGI25153J46596_100224173 200
611 3300003305 Ga0006770J48903_1007534 Ga0006770J48903_10075343 200
612 3300003320 rootH2_10028076 rootH2_100280765 200
613 3300003354 JGI25160J50197_1034172 JGI25160J50197_10341721 200
614 3300003479 Ga0006556J51387_1018520 Ga0006556J51387_10185203 200
615 3300003479 Ga0006556J51387_1028196 Ga0006556J51387_10281964 200
616 3300003558 Ga0006558J51389_1018313 Ga0006558J51389_10183133 200
617 3300003565 Ga0006560J51390_1017170 Ga0006560J51390_10171703 200
618 3300003565 Ga0006560J51390_1021707 Ga0006560J51390_10217074 200
619 3300003567 Ga0006554J51385_1017088 Ga0006554J51385_10170883 200
620 3300003567 Ga0006554J51385_1020490 Ga0006554J51385_10204904 200
621 3300003578 Ga0006562J51391_1006869 Ga0006562J51391_100686916 200
622 3300003578 Ga0006562J51391_1018587 Ga0006562J51391_10185873 200
623 3300003751 Ga0055538_1000680 Ga0055538_100068021 200
624 3300003752 Ga0055539_1000456 Ga0055539_10004564 200
625 3300003756 Ga0055533_1000432 Ga0055533_100043226 200
626 3300003756 Ga0055533_1002319 Ga0055533_10023193 200
627 3300003759 Ga0055525_1000111 Ga0055525_100011137 200
628 3300003760 Ga0055527_1001178 Ga0055527_10011783 200
629 3300003760 Ga0055527_1001334 Ga0055527_10013343 200
630 3300003760 Ga0055527_1004708 Ga0055527_10047083 200
631 3300003761 Ga0055535_1002650 Ga0055535_100265010 200
632 3300003761 Ga0055535_1002929 Ga0055535_10029298 200
633 3300003761 Ga0055535_1004862 Ga0055535_10048625 200
634 3300003761 Ga0055535_1006090 Ga0055535_10060905 200
635 3300003761 Ga0055535_1006166 Ga0055535_10061661 200
636 3300003762 Ga0055542_1002512 Ga0055542_10025123 200
637 3300003762 Ga0055542_1003780 Ga0055542_10037804 200
638 3300003762 Ga0055542_1003848 Ga0055542_10038485 200
639 3300003762 Ga0055542_1003932 Ga0055542_10039328 200
640 3300003762 Ga0055542_1004903 Ga0055542_10049032 200
641 3300003762 Ga0055542_1006542 Ga0055542_10065421 200
642 3300003763 Ga0055529_1001670 Ga0055529_100167010 200
643 3300003763 Ga0055529_1002584 Ga0055529_10025843 200
644 3300003763 Ga0055529_1002611 Ga0055529_10026113 200
645 3300003763 Ga0055529_1003204 Ga0055529_10032043 200
646 3300004801 Ga0058860_10137024 Ga0058860_101370245 200
647 3300005262 Ga0065165_1000598 Ga0065165_100059859 200
648 3300005262 Ga0065165_1033037 Ga0065165_10330372 200
649 3300005331 Ga0070670_100045008 Ga0070670_1000450087 200
650 3300005331 Ga0070670_100407778 Ga0070670_1004077783 200
651 3300005334 Ga0068869_100043109 Ga0068869_1000431094 200
652 3300005335 Ga0070666_10000012 Ga0070666_100000124 200
653 3300005336 Ga0070680_100214844 Ga0070680_1002148441 200
654 3300005336 Ga0070680_100219981 Ga0070680_1002199813 200
655 3300005336 Ga0070680_100420032 Ga0070680_1004200323 200
656 3300005337 Ga0070682_100046558 Ga0070682_1000465582 200
657 3300005337 Ga0070682_100141710 Ga0070682_1001417102 200
658 3300005337 Ga0070682_100235089 Ga0070682_1002350891 200
659 3300005338 Ga0068868_100282839 Ga0068868_1002828392 200
660 3300005339 Ga0070660_100745227 Ga0070660_1007452272 200
661 3300005340 Ga0070689_100041431 Ga0070689_1000414316 200
662 3300005341 Ga0070691_10463307 Ga0070691_104633071 200
663 3300005344 Ga0070661_100015281 Ga0070661_1000152818 200
664 3300005344 Ga0070661_101015440 Ga0070661_1010154401 200
665 3300005345 Ga0070692_10054766 Ga0070692_100547662 200
666 3300005347 Ga0070668_100225982 Ga0070668_1002259822 200
667 3300005364 Ga0070673_100109100 Ga0070673_1001091003 200
668 3300005364 Ga0070673_100170446 Ga0070673_1001704463 200
669 3300005366 Ga0070659_100219319 Ga0070659_1002193192 200
670 3300005366 Ga0070659_100393823 Ga0070659_1003938232 200
671 3300005366 Ga0070659_100794965 Ga0070659_1007949652 200
672 3300005367 Ga0070667_100075141 Ga0070667_1000751412 200
673 3300005435 Ga0070714_100086583 Ga0070714_1000865835 200
674 3300005435 Ga0070714_100162027 Ga0070714_1001620271 200
675 3300005435 Ga0070714_100254633 Ga0070714_1002546332 200
676 3300005435 Ga0070714_100743036 Ga0070714_1007430361 200
677 3300005436 Ga0070713_100008401 Ga0070713_1000084014 200
678 3300005437 Ga0070710_10040859 Ga0070710_100408594 200
679 3300005437 Ga0070710_10099927 Ga0070710_100999273 200
680 3300005444 Ga0070694_100380270 Ga0070694_1003802702 200
681 3300005455 Ga0070663_100053898 Ga0070663_1000538985 200
682 3300005455 Ga0070663_100059429 Ga0070663_1000594291 200
683 3300005455 Ga0070663_100088895 Ga0070663_1000888953 200
684 3300005455 Ga0070663_100112513 Ga0070663_1001125131 200
685 3300005455 Ga0070663_100112649 Ga0070663_1001126492 200
686 3300005455 Ga0070663_100150300 Ga0070663_1001503002 200
687 3300005455 Ga0070663_100772457 Ga0070663_1007724571 200
688 3300005458 Ga0070681_10075723 Ga0070681_100757236 200
689 3300005458 Ga0070681_10121502 Ga0070681_101215022 200
690 3300005458 Ga0070681_10128522 Ga0070681_101285222 200
691 3300005458 Ga0070681_10828609 Ga0070681_108286092 200
692 3300005466 Ga0070685_10002255 Ga0070685_100022552 200
693 3300005535 Ga0070684_101113278 Ga0070684_1011132781 200
694 3300005539 Ga0068853_100191675 Ga0068853_1001916752 200
695 3300005539 Ga0068853_100317536 Ga0068853_1003175363 200
696 3300005539 Ga0068853_100340462 Ga0068853_1003404621 200
697 3300005539 Ga0068853_100387241 Ga0068853_1003872412 200
698 3300005543 Ga0070672_100228215 Ga0070672_1002282153 200
699 3300005546 Ga0070696_100010164 Ga0070696_10001016413 200
700 3300005546 Ga0070696_100128219 Ga0070696_1001282192 200
701 3300005546 Ga0070696_100612860 Ga0070696_1006128602 200
702 3300005547 Ga0070693_100025657 Ga0070693_1000256576 200
703 3300005547 Ga0070693_100028679 Ga0070693_1000286796 200
704 3300005547 Ga0070693_100296685 Ga0070693_1002966852 200
705 3300005548 Ga0070665_100000175 Ga0070665_100000175111 200
706 3300005548 Ga0070665_100105834 Ga0070665_1001058344 200
707 3300005548 Ga0070665_100564696 Ga0070665_1005646962 200
708 3300005549 Ga0070704_100439193 Ga0070704_1004391931 200
709 3300005563 Ga0068855_100149075 Ga0068855_1001490752 200
710 3300005563 Ga0068855_100231949 Ga0068855_1002319493 200
711 3300005563 Ga0068855_100886189 Ga0068855_1008861891 200
712 3300005563 Ga0068855_101018046 Ga0068855_1010180461 200
713 3300005577 Ga0068857_100000998 Ga0068857_10000099833 200
714 3300005577 Ga0068857_100087151 Ga0068857_1000871513 200
715 3300005577 Ga0068857_100132398 Ga0068857_1001323983 200
716 3300005577 Ga0068857_100210127 Ga0068857_1002101272 200
717 3300005577 Ga0068857_100262434 Ga0068857_1002624343 200
718 3300005577 Ga0068857_100347807 Ga0068857_1003478072 200
719 3300005577 Ga0068857_100480645 Ga0068857_1004806452 200
720 3300005578 Ga0068854_100054495 Ga0068854_1000544952 200
721 3300005578 Ga0068854_100278013 Ga0068854_1002780133 200
722 3300005578 Ga0068854_100482745 Ga0068854_1004827452 200
723 3300005578 Ga0068854_100536279 Ga0068854_1005362791 200
724 3300005578 Ga0068854_100536280 Ga0068854_1005362801 200
725 3300005578 Ga0068854_100559185 Ga0068854_1005591851 200
726 3300005614 Ga0068856_100004797 Ga0068856_1000047974 200
727 3300005614 Ga0068856_100076451 Ga0068856_1000764515 200
728 3300005614 Ga0068856_100184419 Ga0068856_1001844193 200
729 3300005616 Ga0068852_100058397 Ga0068852_1000583972 200
730 3300005616 Ga0068852_100248113 Ga0068852_1002481132 200
731 3300005617 Ga0068859_100122263 Ga0068859_1001222634 200
732 3300005617 Ga0068859_100275251 Ga0068859_1002752512 200
733 3300005617 Ga0068859_101205008 Ga0068859_1012050082 200
734 3300005834 Ga0068851_10014017 Ga0068851_100140176 200
735 3300005834 Ga0068851_10044959 Ga0068851_100449592 200
736 3300005841 Ga0068863_100100973 Ga0068863_1001009733 200
737 3300005842 Ga0068858_100048710 Ga0068858_1000487106 200
738 3300005842 Ga0068858_100075141 Ga0068858_1000751414 200
739 3300005842 Ga0068858_100285650 Ga0068858_1002856502 200
740 3300005843 Ga0068860_100054090 Ga0068860_1000540902 200
741 3300005843 Ga0068860_100079152 Ga0068860_1000791526 200
742 3300005843 Ga0068860_100369392 Ga0068860_1003693922 200
743 3300005844 Ga0068862_100164162 Ga0068862_1001641624 200
744 3300005937 Ga0081455_10053310 Ga0081455_100533103 200
745 3300005983 Ga0081540_1000720 Ga0081540_100072011 200
746 3300006163 Ga0070715_10144003 Ga0070715_101440031 200
747 3300006173 Ga0070716_100692208 Ga0070716_1006922081 200
748 3300006175 Ga0070712_100527301 Ga0070712_1005273012 200
749 3300006237 Ga0097621_100956787 Ga0097621_1009567871 200
750 3300006358 Ga0068871_100100892 Ga0068871_1001008923 200
751 3300006358 Ga0068871_100119042 Ga0068871_1001190423 200
752 3300006881 Ga0068865_100029937 Ga0068865_1000299376 200
753 3300006881 Ga0068865_100071838 Ga0068865_1000718382 200
754 3300006931 Ga0097620_100122253 Ga0097620_1001222534 200
755 3300006931 Ga0097620_100275240 Ga0097620_1002752402 200
756 3300006931 Ga0097620_100506219 Ga0097620_1005062192 200
757 3300006931 Ga0097620_101205147 Ga0097620_1012051472 200
758 3300009093 Ga0105240_10257037 Ga0105240_102570373 200
759 3300009093 Ga0105240_10699632 Ga0105240_106996322 200
760 3300009093 Ga0105240_10699669 Ga0105240_106996692 200
761 3300009101 Ga0105247_10014280 Ga0105247_100142803 200
762 3300009174 Ga0105241_11148800 Ga0105241_111488001 200
763 3300009545 Ga0105237_10050085 Ga0105237_100500854 200
764 3300009545 Ga0105237_10051347 Ga0105237_100513474 200
765 3300009545 Ga0105237_10073900 Ga0105237_100739004 200
766 3300009551 Ga0105238_10067600 Ga0105238_100676003 200
767 3300009551 Ga0105238_10145294 Ga0105238_101452944 200
768 3300009551 Ga0105238_10264938 Ga0105238_102649383 200
769 3300009551 Ga0105238_10361347 Ga0105238_103613473 200
770 3300009551 Ga0105238_10756217 Ga0105238_107562172 200
771 3300010375 Ga0105239_10006660 Ga0105239_100066604 200
772 3300010375 Ga0105239_10090407 Ga0105239_100904074 200
773 3300010375 Ga0105239_10139444 Ga0105239_101394443 200
774 3300010375 Ga0105239_10141288 Ga0105239_101412884 200
775 3300010375 Ga0105239_10572982 Ga0105239_105729822 200
776 3300011119 Ga0105246_10200918 Ga0105246_102009183 200
777 3300012500 Ga0157314_1000456 Ga0157314_10004564 200
778 3300013100 Ga0157373_10096936 Ga0157373_100969362 200
779 3300013102 Ga0157371_10045126 Ga0157371_100451264 200
780 3300013102 Ga0157371_10063110 Ga0157371_100631104 200
781 3300013102 Ga0157371_10432117 Ga0157371_104321172 200
782 3300013104 Ga0157370_10062752 Ga0157370_100627526 200
783 3300013104 Ga0157370_10069149 Ga0157370_100691494 200
784 3300013104 Ga0157370_10104910 Ga0157370_101049104 200
785 3300013104 Ga0157370_10119558 Ga0157370_101195582 200
786 3300013104 Ga0157370_10125529 Ga0157370_101255292 200
787 3300013104 Ga0157370_10285025 Ga0157370_102850253 200
788 3300013105 Ga0157369_10004613 Ga0157369_100046133 200
789 3300013105 Ga0157369_10036937 Ga0157369_100369374 200
790 3300013105 Ga0157369_10097097 Ga0157369_100970976 200
791 3300013105 Ga0157369_10107916 Ga0157369_101079163 200
792 3300013105 Ga0157369_11175580 Ga0157369_111755802 200
793 3300013296 Ga0157374_10395321 Ga0157374_103953212 200
794 3300013297 Ga0157378_10023199 Ga0157378_1002319912 200
795 3300013306 Ga0163162_10070045 Ga0163162_100700454 200
796 3300013307 Ga0157372_10094273 Ga0157372_100942734 200
797 3300013307 Ga0157372_10157288 Ga0157372_101572884 200
798 3300013307 Ga0157372_10181931 Ga0157372_101819312 200
799 3300013307 Ga0157372_10241293 Ga0157372_102412932 200
800 3300013307 Ga0157372_10560165 Ga0157372_105601653 200
801 3300013307 Ga0157372_10802551 Ga0157372_108025512 200
802 3300014325 Ga0163163_10509119 Ga0163163_105091192 200
803 3300014497 Ga0182008_10077601 Ga0182008_100776012 200
804 3300015265 Ga0182005_1012026 Ga0182005_10120262 200
805 3300015685 Ga0183369_1007 Ga0183369_1007153 200
806 3300015687 Ga0183368_1002 Ga0183368_1002395 200
807 3300020069 Ga0197907_10947378 Ga0197907_109473784 200
808 3300020070 Ga0206356_10171056 Ga0206356_101710564 200
809 3300020070 Ga0206356_10221074 Ga0206356_102210741 200
810 3300020070 Ga0206356_10657042 Ga0206356_106570422 200
811 3300020075 Ga0206349_1346577 Ga0206349_13465771 200
812 3300020076 Ga0206355_1315307 Ga0206355_13153073 200
813 3300020076 Ga0206355_1347985 Ga0206355_13479854 200
814 3300020076 Ga0206355_1642390 Ga0206355_16423901 200
815 3300020076 Ga0206355_1657004 Ga0206355_16570043 200
816 3300020077 Ga0206351_10229607 Ga0206351_102296073 200
817 3300020077 Ga0206351_10721784 Ga0206351_107217845 200
818 3300020078 Ga0206352_10790062 Ga0206352_107900623 200
819 3300020078 Ga0206352_11356790 Ga0206352_113567903 200
820 3300020080 Ga0206350_10322002 Ga0206350_103220023 200
821 3300020610 Ga0154015_1195220 Ga0154015_11952201 200
822 3300022467 Ga0224712_10003939 Ga0224712_100039396 200
823 3300022467 Ga0224712_10013385 Ga0224712_100133853 200
824 3300025206 Ga0209435_101200 Ga0209435_1012002 200
825 3300025206 Ga0209435_106506 Ga0209435_1065061 200
826 3300025224 Ga0209784_100167 Ga0209784_10016761 200
827 3300025225 Ga0209566_103884 Ga0209566_1038843 200
828 3300025226 Ga0209674_100043 Ga0209674_100043363 200
829 3300025226 Ga0209674_100381 Ga0209674_10038133 200
830 3300025226 Ga0209674_102055 Ga0209674_1020553 200
831 3300025226 Ga0209674_102881 Ga0209674_1028814 200
832 3300025228 Ga0209672_100004 Ga0209672_1000041296 200
833 3300025228 Ga0209672_100029 Ga0209672_1000294 200
834 3300025228 Ga0209672_101110 Ga0209672_10111020 200
835 3300025228 Ga0209672_102109 Ga0209672_1021096 200
836 3300025228 Ga0209672_104042 Ga0209672_1040425 200
837 3300025230 Ga0209563_100103 Ga0209563_10010337 200
838 3300025231 Ga0207427_100144 Ga0207427_1001444 200
839 3300025231 Ga0207427_100209 Ga0207427_1002094 200
840 3300025231 Ga0207427_100327 Ga0207427_1003274 200
841 3300025231 Ga0207427_104741 Ga0207427_1047412 200
842 3300025231 Ga0207427_118277 Ga0207427_1182771 200
843 3300025233 Ga0209437_100020 Ga0209437_100020622 200
844 3300025233 Ga0209437_100193 Ga0209437_100193107 200
845 3300025233 Ga0209437_100256 Ga0209437_10025685 200
846 3300025233 Ga0209437_100465 Ga0209437_10046536 200
847 3300025233 Ga0209437_103094 Ga0209437_1030943 200
848 3300025242 Ga0209258_100003 Ga0209258_1000031296 200
849 3300025242 Ga0209258_100053 Ga0209258_100053326 200
850 3300025242 Ga0209258_100149 Ga0209258_100149158 200
851 3300025242 Ga0209258_100329 Ga0209258_1003294 200
852 3300025242 Ga0209258_103384 Ga0209258_1033843 200
853 3300025246 Ga0209646_1000796 Ga0209646_100079615 200
854 3300025246 Ga0209646_1002116 Ga0209646_100211611 200
855 3300025246 Ga0209646_1006538 Ga0209646_10065382 200
856 3300025250 Ga0209026_1000060 Ga0209026_10000604 200
857 3300025250 Ga0209026_1000274 Ga0209026_100027449 200
858 3300025250 Ga0209026_1000293 Ga0209026_100029361 200
859 3300025250 Ga0209026_1000516 Ga0209026_10005164 200
860 3300025250 Ga0209026_1001271 Ga0209026_10012714 200
861 3300025250 Ga0209026_1006743 Ga0209026_10067433 200
862 3300025250 Ga0209026_1022088 Ga0209026_10220881 200
863 3300025253 Ga0209677_107876 Ga0209677_1078764 200
864 3300025253 Ga0209677_121643 Ga0209677_1216431 200
865 3300025254 Ga0209148_1000002 Ga0209148_10000021282 200
866 3300025254 Ga0209148_1000009 Ga0209148_10000094 200
867 3300025254 Ga0209148_1000010 Ga0209148_10000101165 200
868 3300025254 Ga0209148_1000025 Ga0209148_1000025600 200
869 3300025254 Ga0209148_1000039 Ga0209148_10000393 200
870 3300025254 Ga0209148_1000143 Ga0209148_1000143158 200
871 3300025256 Ga0209759_1000658 Ga0209759_100065836 200
872 3300025256 Ga0209759_1001919 Ga0209759_10019194 200
873 3300025256 Ga0209759_1002020 Ga0209759_10020204 200
874 3300025256 Ga0209759_1007439 Ga0209759_10074396 200
875 3300025256 Ga0209759_1010126 Ga0209759_10101264 200
876 3300025256 Ga0209759_1016259 Ga0209759_10162592 200
877 3300025258 Ga0209129_1000835 Ga0209129_100083513 200
878 3300025258 Ga0209129_1002898 Ga0209129_10028989 200
879 3300025261 Ga0209233_1000009 Ga0209233_10000094 200
880 3300025261 Ga0209233_1000020 Ga0209233_10000204 200
881 3300025261 Ga0209233_1000151 Ga0209233_1000151168 200
882 3300025261 Ga0209233_1000920 Ga0209233_100092024 200
883 3300025261 Ga0209233_1012013 Ga0209233_10120132 200
884 3300025272 Ga0209455_1000004 Ga0209455_10000041296 200
885 3300025272 Ga0209455_1000034 Ga0209455_10000344 200
886 3300025272 Ga0209455_1000060 Ga0209455_10000604 200
887 3300025272 Ga0209455_1000086 Ga0209455_10000864 200
888 3300025272 Ga0209455_1000095 Ga0209455_100009570 200
889 3300025297 Ga0209758_1005974 Ga0209758_100597416 200
890 3300025297 Ga0209758_1015882 Ga0209758_10158827 200
891 3300025299 Ga0209256_1002932 Ga0209256_10029325 200
892 3300025302 Ga0207426_1003657 Ga0207426_10036575 200
893 3300025898 Ga0207692_10016367 Ga0207692_100163674 200
894 3300025898 Ga0207692_10056387 Ga0207692_100563873 200
895 3300025903 Ga0207680_10000013 Ga0207680_100000134 200
896 3300025904 Ga0207647_10011795 Ga0207647_1001179511 200
897 3300025904 Ga0207647_10032989 Ga0207647_100329892 200
898 3300025904 Ga0207647_10047348 Ga0207647_100473483 200
899 3300025904 Ga0207647_10062600 Ga0207647_100626003 200
900 3300025904 Ga0207647_10094179 Ga0207647_100941792 200
901 3300025904 Ga0207647_10096744 Ga0207647_100967443 200
902 3300025907 Ga0207645_10015566 Ga0207645_100155669 200
903 3300025909 Ga0207705_10031780 Ga0207705_100317805 200
904 3300025912 Ga0207707_10007311 Ga0207707_1000731116 200
905 3300025912 Ga0207707_10046392 Ga0207707_100463924 200
906 3300025912 Ga0207707_10108295 Ga0207707_101082953 200
907 3300025913 Ga0207695_10008130 Ga0207695_100081309 200
908 3300025913 Ga0207695_10016662 Ga0207695_1001666216 200
909 3300025913 Ga0207695_10030817 Ga0207695_100308171 200
910 3300025913 Ga0207695_10148552 Ga0207695_101485521 200
911 3300025913 Ga0207695_10581056 Ga0207695_105810562 200
912 3300025914 Ga0207671_10000021 Ga0207671_100000214 200
913 3300025914 Ga0207671_10028839 Ga0207671_100288394 200
914 3300025914 Ga0207671_10054495 Ga0207671_100544953 200
915 3300025915 Ga0207693_10196988 Ga0207693_101969883 200
916 3300025916 Ga0207663_10652633 Ga0207663_106526332 200
917 3300025917 Ga0207660_10067512 Ga0207660_100675123 200
918 3300025917 Ga0207660_10533695 Ga0207660_105336952 200
919 3300025919 Ga0207657_10174148 Ga0207657_101741481 200
920 3300025919 Ga0207657_10174180 Ga0207657_101741803 200
921 3300025920 Ga0207649_10065071 Ga0207649_100650711 200
922 3300025920 Ga0207649_10147830 Ga0207649_101478302 200
923 3300025920 Ga0207649_10533300 Ga0207649_105333001 200
924 3300025921 Ga0207652_10055937 Ga0207652_100559376 200
925 3300025921 Ga0207652_10557595 Ga0207652_105575952 200
926 3300025923 Ga0207681_10417210 Ga0207681_104172102 200
927 3300025924 Ga0207694_10088183 Ga0207694_100881833 200
928 3300025924 Ga0207694_10093128 Ga0207694_100931283 200
929 3300025924 Ga0207694_10152495 Ga0207694_101524953 200
930 3300025924 Ga0207694_10190862 Ga0207694_101908622 200
931 3300025924 Ga0207694_10333983 Ga0207694_103339832 200
932 3300025925 Ga0207650_10288516 Ga0207650_102885162 200
933 3300025929 Ga0207664_10001884 Ga0207664_100018844 200
934 3300025929 Ga0207664_10728135 Ga0207664_107281352 200
935 3300025931 Ga0207644_10090873 Ga0207644_100908733 200
936 3300025932 Ga0207690_10000291 Ga0207690_1000029128 200
937 3300025932 Ga0207690_10207151 Ga0207690_102071512 200
938 3300025932 Ga0207690_10543009 Ga0207690_105430092 200
939 3300025932 Ga0207690_10694490 Ga0207690_106944901 200
940 3300025933 Ga0207706_10100114 Ga0207706_101001144 200
941 3300025933 Ga0207706_10638697 Ga0207706_106386972 200
942 3300025936 Ga0207670_10123040 Ga0207670_101230403 200
943 3300025937 Ga0207669_10885421 Ga0207669_108854211 200
944 3300025938 Ga0207704_10017680 Ga0207704_100176807 200
945 3300025938 Ga0207704_10088244 Ga0207704_100882443 200
946 3300025939 Ga0207665_10101234 Ga0207665_101012344 200
947 3300025940 Ga0207691_10036108 Ga0207691_1003610810 200
948 3300025942 Ga0207689_10034156 Ga0207689_100341566 200
949 3300025942 Ga0207689_10136777 Ga0207689_101367774 200
950 3300025944 Ga0207661_10594956 Ga0207661_105949562 200
951 3300025945 Ga0207679_10174503 Ga0207679_101745033 200
952 3300025949 Ga0207667_10034827 Ga0207667_100348278 200
953 3300025949 Ga0207667_10053962 Ga0207667_100539624 200
954 3300025949 Ga0207667_10095216 Ga0207667_100952163 200
955 3300025949 Ga0207667_10128195 Ga0207667_101281953 200
956 3300025949 Ga0207667_10128231 Ga0207667_101282313 200
957 3300025949 Ga0207667_10428679 Ga0207667_104286792 200
958 3300025949 Ga0207667_11510937 Ga0207667_115109371 200
959 3300025960 Ga0207651_10066649 Ga0207651_100666493 200
960 3300025972 Ga0207668_10091449 Ga0207668_100914493 200
961 3300025972 Ga0207668_10422846 Ga0207668_104228462 200
962 3300025981 Ga0207640_10003058 Ga0207640_100030584 200
963 3300025981 Ga0207640_10054936 Ga0207640_100549363 200
964 3300025981 Ga0207640_10075585 Ga0207640_100755851 200
965 3300025981 Ga0207640_10196461 Ga0207640_101964612 200
966 3300025981 Ga0207640_10894600 Ga0207640_108946002 200
967 3300025986 Ga0207658_10033742 Ga0207658_100337423 200
968 3300025986 Ga0207658_10269171 Ga0207658_102691712 200
969 3300025986 Ga0207658_10308229 Ga0207658_103082292 200
970 3300025986 Ga0207658_10353974 Ga0207658_103539742 200
971 3300026023 Ga0207677_10264744 Ga0207677_102647443 200
972 3300026035 Ga0207703_10108063 Ga0207703_101080633 200
973 3300026035 Ga0207703_10127293 Ga0207703_101272933 200
974 3300026041 Ga0207639_10077238 Ga0207639_100772383 200
975 3300026041 Ga0207639_10249512 Ga0207639_102495123 200
976 3300026067 Ga0207678_10016758 Ga0207678_100167583 200
977 3300026067 Ga0207678_10049236 Ga0207678_100492365 200
978 3300026067 Ga0207678_10054333 Ga0207678_100543337 200
979 3300026067 Ga0207678_10572241 Ga0207678_105722412 200
980 3300026078 Ga0207702_10000517 Ga0207702_1000051730 200
981 3300026078 Ga0207702_10000852 Ga0207702_1000085219 200
982 3300026078 Ga0207702_10091382 Ga0207702_100913824 200
983 3300026088 Ga0207641_10009230 Ga0207641_1000923017 200
984 3300026095 Ga0207676_10162686 Ga0207676_101626863 200
985 3300026095 Ga0207676_10731242 Ga0207676_107312422 200
986 3300026116 Ga0207674_10024573 Ga0207674_100245734 200
987 3300026116 Ga0207674_10111246 Ga0207674_101112464 200
988 3300026116 Ga0207674_10142271 Ga0207674_101422713 200
989 3300026116 Ga0207674_10235613 Ga0207674_102356132 200
990 3300026116 Ga0207674_10353015 Ga0207674_103530152 200
991 3300026116 Ga0207674_10357035 Ga0207674_103570353 200
992 3300026142 Ga0207698_10071585 Ga0207698_100715855 200
993 3300026142 Ga0207698_10145533 Ga0207698_101455333 200
994 3300028379 Ga0268266_10000001 Ga0268266_100000013284 200
995 3300028379 Ga0268266_10100303 Ga0268266_101003032 200
996 3300028379 Ga0268266_10210115 Ga0268266_102101152 200
997 3300028380 Ga0268265_10115242 Ga0268265_101152423 200
998 3300028381 Ga0268264_10023204 Ga0268264_100232043 200
999 3300030763 Ga0265763_1007233 Ga0265763_10072332 200
1000 3300030863 Ga0265766_1000306 Ga0265766_10003062 200
1001 3300030888 Ga0265769_100430 Ga0265769_1004302 200
1002 3300030889 Ga0265761_100106 Ga0265761_1001065 200
1003 3300031011 Ga0265774_100076 Ga0265774_1000763 200
1004 3300031507 Ga0307509_10199035 Ga0307509_101990353 200
1005 3300031665 Ga0316575_10015025 Ga0316575_100150254 200
1006 3300031901 Ga0307406_10093487 Ga0307406_100934873 200
1007 3300031911 Ga0307412_10028293 Ga0307412_100282936 200
1008 3300032002 Ga0307416_100079046 Ga0307416_1000790463 200
1009 3300035691 Ga0373931_0421997 Ga0373931_0421997_153_758 200
1010 3300036458 Ga0310112_000276 Ga0310112_000276_2087_2689 200
1011 3300037312 Ga0395899_0001959 Ga0395899_0001959_14592_15194 200
1012 3300037312 Ga0395899_0012521 Ga0395899_0012521_1494_2096 200
1013 3300037312 Ga0395899_0022053 Ga0395899_0022053_3878_4480 200
1014 3300037312 Ga0395899_0423649 Ga0395899_0423649_181_783 200
1015 3300037418 Ga0395900_0000012 Ga0395900_0000012_43430_44032 200
1016 3300037418 Ga0395900_0080209 Ga0395900_0080209_1188_1790 200
1017 3300037418 Ga0395900_0089318 Ga0395900_0089318_1188_1790 200
1018 3300037418 Ga0395900_0934356 Ga0395900_0934356_72_674 200
1019 3300037466 Ga0395898_0000558 Ga0395898_0000558_1713_2315 200
1020 3300037466 Ga0395898_0000600 Ga0395898_0000600_1520_2122 200
1021 3300037466 Ga0395898_0006608 Ga0395898_0006608_11664_12266 200
1022 3300037466 Ga0395898_0258265 Ga0395898_0258265_966_1568 200
1023 3300037466 Ga0395898_0745825 Ga0395898_0745825_81_683 200
1024 3300037466 Ga0395898_0796265 Ga0395898_0796265_192_794 200
1025 3300038443 Ga0395901_0002939 Ga0395901_0002939_1654_2256 200
1026 3300038443 Ga0395901_0011584 Ga0395901_0011584_1555_2157 200
1027 3300038443 Ga0395901_0075079 Ga0395901_0075079_593_1195 200
1028 3300038443 Ga0395901_0866142 Ga0395901_0866142_192_794 200
1029 3300041442 Ga0451788_24495 Ga0451788_24495_84_686 200
1030 3300041452 Ga0451793_0393032 Ga0451793_0393032_1480_2082 200
1031 3300041459 Ga0451800_0893000 Ga0451800_0893000_527_1129 200
1032 3300041459 Ga0451800_1044717 Ga0451800_1044717_32_640 200
1033 3300041461 Ga0451805_028824 Ga0451805_028824_532_1137 200
1034 3300041509 Ga0451843_1758148 Ga0451843_1758148_36_641 200
1035 3300041512 Ga0451853_2750802 Ga0451853_2750802_263_865 200
1036 3300042000 Ga0439437_001431 Ga0439437_001431_705_1307 200
1037 3300042184 Ga0450908_002110 Ga0450908_002110_688_1290 200
1038 3300042435 Ga0439434_0071617 Ga0439434_0071617_82_687 200
1039 3300044656 Ga0466969_0008348 Ga0466969_0008348_1568_2170 200
1040 3300044656 Ga0466969_0008941 Ga0466969_0008941_3306_3908 200
1041 3300044656 Ga0466969_0086989 Ga0466969_0086989_850_1452 200
1042 3300044658 Ga0466972_0024571 Ga0466972_0024571_844_1446 200
1043 3300044661 Ga0466975_0199194 Ga0466975_0199194_567_1169 200
1044 3300044672 Ga0466982_0000005 Ga0466982_0000005_99584_100186 200
1045 3300044672 Ga0466982_0000210 Ga0466982_0000210_12933_13535 200
1046 3300044683 Ga0466965_0003853 Ga0466965_0003853_5061_5663 200
1047 3300044684 Ga0466966_0002549 Ga0466966_0002549_1504_2106 200
1048 3300044684 Ga0466966_0069760 Ga0466966_0069760_182_784 200
1049 3300044693 Ga0466961_0010336 Ga0466961_0010336_3445_4047 200
1050 3300044693 Ga0466961_0015293 Ga0466961_0015293_1006_1608 200
1051 3300044693 Ga0466961_0079218 Ga0466961_0079218_648_1250 200
1052 3300044693 Ga0466961_0085616 Ga0466961_0085616_385_987 200
1053 3300044693 Ga0466961_0265280 Ga0466961_0265280_240_842 200
1054 3300044694 Ga0466963_0052819 Ga0466963_0052819_1207_1809 200
1055 3300044694 Ga0466963_0151824 Ga0466963_0151824_683_1285 200
1056 3300044694 Ga0466963_0588989 Ga0466963_0588989_118_720 200
1057 3300044706 Ga0466964_0018986 Ga0466964_0018986_613_1215 200
1058 3300044706 Ga0466964_0142737 Ga0466964_0142737_102_704 200
1059 3300044706 Ga0466964_0322127 Ga0466964_0322127_162_764 200
1060 3300044719 Ga0466971_0000338 Ga0466971_0000338_9318_9920 200
1061 3300044719 Ga0466971_0006109 Ga0466971_0006109_1508_2110 200
1062 3300044719 Ga0466971_0033841 Ga0466971_0033841_890_1492 200
1063 3300044735 Ga0466968_0000409 Ga0466968_0000409_13377_13979 200
1064 3300044735 Ga0466968_0048557 Ga0466968_0048557_365_967 200
1065 3300044765 Ga0466970_0001896 Ga0466970_0001896_1478_2080 200
1066 3300044765 Ga0466970_0215617 Ga0466970_0215617_255_857 200
1067 3300044842 Ga0466957_0019946 Ga0466957_0019946_184_786 200
1068 3300044842 Ga0466957_0075171 Ga0466957_0075171_1382_1984 200
1069 3300044901 Ga0466960_0002345 Ga0466960_0002345_1503_2105 200
1070 3300045049 Ga0466959_0033759 Ga0466959_0033759_1529_2131 200
1071 3300045049 Ga0466959_0043319 Ga0466959_0043319_535_1137 200
1072 3300045049 Ga0466959_0072597 Ga0466959_0072597_385_987 200
1073 3300045836 Ga0466958_0005279 Ga0466958_0005279_1503_2105 200
1074 3300045836 Ga0466958_0045436 Ga0466958_0045436_1976_2578 200
1075 3300045836 Ga0466958_0054129 Ga0466958_0054129_1033_1635 200
1076 3300045836 Ga0466958_0067609 Ga0466958_0067609_1294_1896 200
1077 3300045836 Ga0466958_0080493 Ga0466958_0080493_1169_1771 200
1078 3300045976 Ga0466967_0075901 Ga0466967_0075901_79_681 200
1079 3300046452 Ga0495617_005550 Ga0495617_005550_3075_3677 200
1080 3300046460 Ga0495638_0000007 Ga0495638_0000007_599566_600168 200
1081 3300046460 Ga0495638_0029717 Ga0495638_0029717_1177_1779 200
1082 3300046460 Ga0495638_0055083 Ga0495638_0055083_1821_2423 200
1083 3300046471 Ga0495650_0000202 Ga0495650_0000202_12476_13078 200
1084 3300046501 Ga0495607_0007223 Ga0495607_0007223_4379_4981 200
1085 3300046501 Ga0495607_0026377 Ga0495607_0026377_2233_2835 200
1086 3300046501 Ga0495607_0100086 Ga0495607_0100086_908_1510 200
1087 3300046507 Ga0495606_0001329 Ga0495606_0001329_31401_32003 200
1088 3300046513 Ga0495616_0007049 Ga0495616_0007049_1714_2316 200
1089 3300046519 Ga0495632_0005327 Ga0495632_0005327_1595_2197 200
1090 3300046520 Ga0495637_0009169 Ga0495637_0009169_1936_2538 200
1091 3300046538 Ga0495609_0001578 Ga0495609_0001578_12634_13236 200
1092 3300046648 Ga0495611_0000029 Ga0495611_0000029_100774_101376 200
1093 3300046660 Ga0495625_0001724 Ga0495625_0001724_14512_15114 200
1094 3300046660 Ga0495625_0016676 Ga0495625_0016676_2031_2633 200
1095 3300046674 Ga0495588_0151180 Ga0495588_0151180_149_751 200
1096 3300046691 Ga0495670_0262669 Ga0495670_0262669_275_877 200
1097 3300046692 Ga0495671_0005114 Ga0495671_0005114_1838_2440 200
1098 3300046694 Ga0495649_0000383 Ga0495649_0000383_1947_2549 200
1099 3300046794 Ga0495589_0000144 Ga0495589_0000144_22162_22764 200
1100 3300046810 Ga0495660_0003242 Ga0495660_0003242_7799_8401 200
1101 3300047320 Ga0495672_0018426 Ga0495672_0018426_640_1245 200
1102 3300047321 Ga0495676_0620206 Ga0495676_0620206_13_615 200
1103 3300047446 Ga0495679_000001 Ga0495679_000001_1605222_1605824 200
1104 3300047472 Ga0495686_0002623 Ga0495686_0002623_1557_2159 200
1105 3300048903 Ga0496100_0006795 Ga0496100_0006795_4092_4694 200
1106 3300048904 Ga0496101_0009854 Ga0496101_0009854_655_1257 200
1107 3300048904 Ga0496101_0243688 Ga0496101_0243688_161_763 200
1108 3300048907 Ga0496104_0045988 Ga0496104_0045988_3399_4001 200
1109 3300048907 Ga0496104_0159892 Ga0496104_0159892_660_1262 200
1110 3300048908 Ga0496105_0041905 Ga0496105_0041905_1413_2015 200
1111 3300048910 Ga0496107_0034298 Ga0496107_0034298_283_885 200
1112 3300048911 Ga0496108_0143885 Ga0496108_0143885_517_1119 200
1113 3300048912 Ga0496109_0571328 Ga0496109_0571328_101_703 200
1114 3300048916 Ga0496113_0471490 Ga0496113_0471490_13_615 200
1115 3300048917 Ga0496114_0055393 Ga0496114_0055393_1353_1955 200
1116 3300048918 Ga0496115_0002269 Ga0496115_0002269_11596_12198 200
1117 3300048918 Ga0496115_0137021 Ga0496115_0137021_1128_1730 200
1118 3300048918 Ga0496115_0323400 Ga0496115_0323400_125_727 200
1119 3300048919 Ga0496116_0085191 Ga0496116_0085191_422_1024 200
1120 3300048919 Ga0496116_0129825 Ga0496116_0129825_776_1378 200
1121 3300048920 Ga0496117_0063248 Ga0496117_0063248_1039_1641 200
1122 3300048920 Ga0496117_0360569 Ga0496117_0360569_53_655 200
1123 3300048921 Ga0496118_0024725 Ga0496118_0024725_4437_5039 200
1124 3300048921 Ga0496118_0028854 Ga0496118_0028854_3122_3724 200
1125 3300048921 Ga0496118_0041939 Ga0496118_0041939_1210_1812 200
1126 3300048921 Ga0496118_0092393 Ga0496118_0092393_291_893 200
1127 3300048921 Ga0496118_0155303 Ga0496118_0155303_657_1259 200
1128 3300048922 Ga0496119_0016519 Ga0496119_0016519_1880_2482 200
1129 3300048924 Ga0496121_0000290 Ga0496121_0000290_9980_10582 200
1130 3300048924 Ga0496121_0016314 Ga0496121_0016314_2713_3315 200
1131 3300048924 Ga0496121_0053526 Ga0496121_0053526_1445_2047 200
1132 3300048924 Ga0496121_0056865 Ga0496121_0056865_1703_2305 200
1133 3300048925 Ga0496122_0176593 Ga0496122_0176593_62_664 200
1134 3300048926 Ga0496123_0033327 Ga0496123_0033327_2156_2758 200
1135 3300048926 Ga0496123_0070780 Ga0496123_0070780_637_1239 200
1136 3300048926 Ga0496123_0094978 Ga0496123_0094978_930_1532 200
1137 3300048926 Ga0496123_0259638 Ga0496123_0259638_22_624 200
1138 3300048927 Ga0496124_0000472 Ga0496124_0000472_1694_2296 200
1139 3300048928 Ga0496125_0000379 Ga0496125_0000379_81022_81624 200
1140 3300048928 Ga0496125_0024621 Ga0496125_0024621_3546_4148 200
1141 3300048928 Ga0496125_0042644 Ga0496125_0042644_494_1096 200
1142 3300048929 Ga0496126_0028743 Ga0496126_0028743_2184_2786 200
1143 3300048929 Ga0496126_0119779 Ga0496126_0119779_354_956 200
1144 3300049459 Ga0495678_004567 Ga0495678_004567_2355_2957 200
1145 3300049459 Ga0495678_016742 Ga0495678_016742_1659_2261 200
1146 3300049460 Ga0495682_0073233 Ga0495682_0073233_496_1098 200
1147 3300049568 Ga0501031_0047206 Ga0501031_0047206_2057_2659 200
1148 3300049568 Ga0501031_0063611 Ga0501031_0063611_915_1517 200
1149 3300049569 Ga0501032_0020602 Ga0501032_0020602_2575_3177 200
1150 3300049569 Ga0501032_0025237 Ga0501032_0025237_1975_2577 200
1151 3300049570 Ga0501033_0000337 Ga0501033_0000337_1415_2017 200
1152 3300049570 Ga0501033_0060996 Ga0501033_0060996_98_715 200
1153 3300049571 Ga0501034_0008263 Ga0501034_0008263_8892_9494 200
1154 3300049571 Ga0501034_0025504 Ga0501034_0025504_1414_2016 200
1155 3300049572 Ga0501036_0030355 Ga0501036_0030355_3816_4418 200
1156 3300049572 Ga0501036_0037846 Ga0501036_0037846_2104_2706 200
1157 3300049572 Ga0501036_0665537 Ga0501036_0665537_59_661 200
1158 3300049573 Ga0501037_0019227 Ga0501037_0019227_710_1312 200
1159 3300049573 Ga0501037_0127086 Ga0501037_0127086_322_924 200
1160 3300049573 Ga0501037_0204211 Ga0501037_0204211_549_1151 200
1161 3300049574 Ga0501038_0013134 Ga0501038_0013134_2183_2785 200
1162 3300049574 Ga0501038_0055414 Ga0501038_0055414_1391_1993 200
1163 3300049574 Ga0501038_0283895 Ga0501038_0283895_424_1026 200
1164 3300049574 Ga0501038_0326070 Ga0501038_0326070_575_1177 200
1165 3300049575 Ga0501039_0036074 Ga0501039_0036074_1477_2079 200
1166 3300049575 Ga0501039_0128008 Ga0501039_0128008_548_1150 200
1167 3300049576 Ga0501040_0187968 Ga0501040_0187968_641_1243 200
1168 3300049578 Ga0501042_0056670 Ga0501042_0056670_548_1150 200
1169 3300049578 Ga0501042_0160846 Ga0501042_0160846_834_1436 200
1170 3300049579 Ga0501043_0016278 Ga0501043_0016278_1478_2095 200
1171 3300049579 Ga0501043_0113617 Ga0501043_0113617_1415_2017 200
1172 3300049579 Ga0501043_0141105 Ga0501043_0141105_990_1592 200
1173 3300049579 Ga0501043_0147266 Ga0501043_0147266_437_1039 200
1174 3300049579 Ga0501043_0269409 Ga0501043_0269409_670_1272 200
1175 3300049580 Ga0501046_0025093 Ga0501046_0025093_2794_3396 200
1176 3300049580 Ga0501046_0034206 Ga0501046_0034206_1720_2322 200
1177 3300049580 Ga0501046_0100330 Ga0501046_0100330_1358_1960 200
1178 3300049580 Ga0501046_0113833 Ga0501046_0113833_1215_1817 200
1179 3300049581 Ga0501047_0103968 Ga0501047_0103968_750_1352 200
1180 3300049581 Ga0501047_0136357 Ga0501047_0136357_1131_1733 200
1181 3300049581 Ga0501047_0383280 Ga0501047_0383280_277_879 200
1182 3300049581 Ga0501047_0629767 Ga0501047_0629767_125_727 200
1183 3300049582 Ga0501048_0021518 Ga0501048_0021518_2756_3358 200
1184 3300049582 Ga0501048_0029557 Ga0501048_0029557_2342_2944 200
1185 3300049582 Ga0501048_0132280 Ga0501048_0132280_316_918 200
1186 3300049583 Ga0501067_0015294 Ga0501067_0015294_2502_3104 200
1187 3300049585 Ga0501069_0036066 Ga0501069_0036066_149_751 200
1188 3300049586 Ga0501070_0022172 Ga0501070_0022172_905_1513 200
1189 3300049586 Ga0501070_0033585 Ga0501070_0033585_2557_3159 200
1190 3300049586 Ga0501070_0038865 Ga0501070_0038865_1568_2170 200
1191 3300049586 Ga0501070_0130993 Ga0501070_0130993_1230_1832 200
1192 3300049587 Ga0501071_0088182 Ga0501071_0088182_290_892 200
1193 3300049587 Ga0501071_0441656 Ga0501071_0441656_290_892 200
1194 3300049589 Ga0501073_0029914 Ga0501073_0029914_1033_1635 200
1195 3300049589 Ga0501073_0078475 Ga0501073_0078475_1359_1961 200
1196 3300049590 Ga0501074_0074903 Ga0501074_0074903_277_879 200
1197 3300049590 Ga0501074_0148950 Ga0501074_0148950_322_924 200
1198 3300049590 Ga0501074_0685815 Ga0501074_0685815_95_697 200
1199 3300049591 Ga0501075_0321697 Ga0501075_0321697_432_1034 200
1200 3300049742 Ga0501080_0016130 Ga0501080_0016130_4902_5510 200
1201 3300049742 Ga0501080_0045089 Ga0501080_0045089_2114_2716 200
1202 3300049742 Ga0501080_0049719 Ga0501080_0049719_1326_1928 200
1203 3300049743 Ga0501081_0073960 Ga0501081_0073960_819_1421 200
1204 3300049744 Ga0501083_0057300 Ga0501083_0057300_1101_1703 200
1205 3300049744 Ga0501083_0240929 Ga0501083_0240929_85_687 200
1206 3300049822 Ga0501035_0021041 Ga0501035_0021041_3630_4232 200
1207 3300049822 Ga0501035_0043368 Ga0501035_0043368_2344_2946 200
1208 3300049822 Ga0501035_0213194 Ga0501035_0213194_620_1222 200
1209 3300049822 Ga0501035_0627844 Ga0501035_0627844_154_756 200
1210 3300049822 Ga0501035_0828346 Ga0501035_0828346_77_694 200
1211 3300049823 Ga0501044_0053687 Ga0501044_0053687_2018_2620 200
1212 3300049823 Ga0501044_0128002 Ga0501044_0128002_1392_1994 200
1213 3300049823 Ga0501044_0312859 Ga0501044_0312859_290_892 200
1214 3300049823 Ga0501044_0453222 Ga0501044_0453222_537_1139 200
1215 3300049823 Ga0501044_0583195 Ga0501044_0583195_265_867 200
1216 3300049824 Ga0501045_0042206 Ga0501045_0042206_2561_3163 200
1217 3300053087 Ga0500643_000120 Ga0500643_000120_41341_41943 200
1218 3300053093 Ga0500651_0000131 Ga0500651_0000131_24903_25505 200
1219 3300053103 Ga0500555_001368 Ga0500555_001368_5005_5607 200
1220 3300053139 Ga0500568_0019513 Ga0500568_0019513_1161_1763 200
1221 3300059478 Ga0587093_001690 Ga0587093_001690_1214_1816 200
1222 3300059492 Ga0587073_0001891 Ga0587073_0001891_1235_1837 200
1223 3300059492 Ga0587073_0022645 Ga0587073_0022645_173_775 200
1224 3300059503 Ga0587080_001372 Ga0587080_001372_717_1319 200
1225 3300059503 Ga0587080_003084 Ga0587080_003084_527_1129 200
1226 3300059504 Ga0587082_000933 Ga0587082_000933_877_1479 200
1227 3300059505 Ga0587083_0050429 Ga0587083_0050429_184_786 200
1228 3300059508 Ga0587088_000941 Ga0587088_000941_889_1491 200
1229 3300059508 Ga0587088_001539 Ga0587088_001539_541_1143 200
1230 3300059510 Ga0587090_000930 Ga0587090_000930_1372_1974 200
1231 3300059511 Ga0587091_013769 Ga0587091_013769_58_660 200
1232 3300059513 Ga0587094_012935 Ga0587094_012935_177_779 200
1233 3300059605 Ga0587106_000089 Ga0587106_000089_1479_2081 200
1234 3300059622 Ga0587099_000319 Ga0587099_000319_1265_1867 200
1235 3300059623 Ga0587101_004567 Ga0587101_004567_123_725 200
1236 3300059625 Ga0587113_000588 Ga0587113_000588_1209_1811 200
1237 3300059630 Ga0587128_002799 Ga0587128_002799_23_625 200
1238 3300059640 Ga0587067_000398 Ga0587067_000398_1836_2438 200
1239 3300059643 Ga0587072_001885 Ga0587072_001885_823_1425 200
1240 3300059644 Ga0587075_002127 Ga0587075_002127_201_803 200
1241 3300059646 Ga0587078_000692 Ga0587078_000692_795_1397 200
1242 3300059646 Ga0587078_001522 Ga0587078_001522_949_1551 200
1243 3300059647 Ga0587079_003247 Ga0587079_003247_174_776 200
1244 3300059659 Ga0587120_001142 Ga0587120_001142_254_856 200
1245 3300060344 Ga0587071_002066 Ga0587071_002066_1210_1812 200
1246 3300060344 Ga0587071_018773 Ga0587071_018773_514_1116 200
1247 3300060353 Ga0501082_0017750 Ga0501082_0017750_1182_1784 200
1248 3300060353 Ga0501082_0146414 Ga0501082_0146414_81_683 200
1249 3300061719 Ga0466962_0007521 Ga0466962_0007521_2053_2655 200
1250 3300061719 Ga0466962_0021946 Ga0466962_0021946_1130_1732 200
1251 3300061719 Ga0466962_0039986 Ga0466962_0039986_1005_1607 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

203

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9418 1 200
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9357 1 200
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9322 1 200
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9262 1 200
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9183 7 200
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7824 8 200 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7793 1 200 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7762 1 200 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.758 8 198 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7513 10 199 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A536U9H5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9813 94 200 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A845JRC5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9726 99 199 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A536U9H5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9723 94 200 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-X0W5J0-F1-model_v4 50S ribosomal protein L4 0.9678 106 198 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-C8N6G3-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9677 99 200 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.82 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map