F491727
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1211 | 467 | 1204 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100397993|Ga0070667_1003979932 |
| Length | 109 |
| Sequence | MEPIVTAIQAVPLKDYVYLSFILFSIGLAGALFRRNTIIILMCLELMFNSVNLLLAAFSAHHSDPSGQVFVFFIMLVAAAEVTVGLAILVMMKRNVDSVDINRLNRLKW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 4 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 5 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 6 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 117 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 133 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 138 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 139 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 140 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 141 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 142 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 143 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 144 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 145 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 146 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 147 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 172 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 261 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 262 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 263 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 264 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 265 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 266 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 267 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 268 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 269 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 270 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 271 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 272 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 273 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 274 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 275 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 276 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 277 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 278 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 280 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 281 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 282 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 283 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 284 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 285 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 286 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 287 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 288 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 289 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 290 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 291 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 292 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 293 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 297 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 298 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 299 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 302 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 309 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 310 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 313 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 314 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 317 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 318 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 320 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 321 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 322 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 323 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 324 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 325 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 326 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 327 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 328 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 329 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 330 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 331 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 332 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 333 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 334 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 335 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 336 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 343 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 344 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 345 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 346 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 347 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 348 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 349 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 350 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 351 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 352 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 353 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 354 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 355 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 356 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 357 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 358 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 359 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 360 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 361 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 362 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 363 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 364 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 365 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 366 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 367 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 368 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 369 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 394 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 395 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 396 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 397 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 398 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 399 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 425 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 426 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 427 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 431 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 435 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 437 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 440 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 453 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 454 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 455 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 456 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 458 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 459 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 460 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 461 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 462 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 463 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 464 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 467 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 0.74 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.53 |
| Nodule | 0.08 |
| Rhizoplane | 1.65 |
| Rhizosphere | 90.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1006058 | 3300001915 | Bacteria | 2465 |
| 2 | JGI24740J21852_10000237 | 3300001979 | Bacteria | 23259 |
| 3 | JGI24740J21852_10011357 | 3300001979 | Bacteria | 3393 |
| 4 | JGI24740J21852_10084797 | 3300001979 | Bacteria | 825 |
| 5 | JGI24737J22298_10211635 | 3300001990 | Bacteria | 572 |
| 6 | JGI24743J22301_10155886 | 3300001991 | Bacteria | 513 |
| 7 | JGI24750J21931_1053125 | 3300002070 | Bacteria | 636 |
| 8 | JGI25151J46595_10015776 | 3300003187 | Bacteria | 3317 |
| 9 | rootH2_10005458 | 3300003320 | Bacteria | 1145 |
| 10 | JGI26145J50221_1034951 | 3300003371 | Bacteria | 522 |
| 11 | Ga0065714_10278487 | 3300005288 | Bacteria | 727 |
| 12 | Ga0065712_10069820 | 3300005290 | Bacteria | 6657 |
| 13 | Ga0065715_10208296 | 3300005293 | Bacteria | 1326 |
| 14 | Ga0065707_10054676 | 3300005295 | Bacteria | 629 |
| 15 | Ga0065707_10069677 | 3300005295 | Bacteria | 543 |
| 16 | Ga0065707_10102239 | 3300005295 | Bacteria | 2818 |
| 17 | Ga0065707_10234435 | 3300005295 | Bacteria | 1177 |
| 18 | Ga0070658_11371670 | 3300005327 | Bacteria | 614 |
| 19 | Ga0070676_10106384 | 3300005328 | Bacteria | 1741 |
| 20 | Ga0070676_10405320 | 3300005328 | Bacteria | 950 |
| 21 | Ga0070676_10756693 | 3300005328 | Bacteria | 714 |
| 22 | Ga0070683_100136912 | 3300005329 | Bacteria | 2319 |
| 23 | Ga0070683_100273316 | 3300005329 | Bacteria | 1607 |
| 24 | Ga0070683_100349994 | 3300005329 | Bacteria | 1407 |
| 25 | Ga0070683_100456368 | 3300005329 | Bacteria | 1219 |
| 26 | Ga0070683_100919141 | 3300005329 | Bacteria | 839 |
| 27 | Ga0070683_100944054 | 3300005329 | Bacteria | 828 |
| 28 | Ga0070683_102417418 | 3300005329 | Bacteria | 503 |
| 29 | Ga0070690_100002812 | 3300005330 | Bacteria | 9390 |
| 30 | Ga0070670_100471116 | 3300005331 | Bacteria | 1114 |
| 31 | Ga0070670_100479182 | 3300005331 | Bacteria | 1105 |
| 32 | Ga0070670_101540248 | 3300005331 | Bacteria | 611 |
| 33 | Ga0070677_10737337 | 3300005333 | Bacteria | 558 |
| 34 | Ga0068869_100002841 | 3300005334 | Bacteria | 10497 |
| 35 | Ga0068869_100619687 | 3300005334 | Bacteria | 916 |
| 36 | Ga0068869_101473734 | 3300005334 | Bacteria | 604 |
| 37 | Ga0070666_11206043 | 3300005335 | Bacteria | 564 |
| 38 | Ga0070680_100010185 | 3300005336 | Bacteria | 7250 |
| 39 | Ga0070680_100012762 | 3300005336 | Bacteria | 6533 |
| 40 | Ga0070680_100081997 | 3300005336 | Bacteria | 2661 |
| 41 | Ga0070680_100083592 | 3300005336 | Bacteria | 2636 |
| 42 | Ga0070680_100120220 | 3300005336 | Bacteria | 2192 |
| 43 | Ga0070680_101417565 | 3300005336 | Bacteria | 601 |
| 44 | Ga0070682_100423380 | 3300005337 | Bacteria | 1012 |
| 45 | Ga0070682_100472054 | 3300005337 | Bacteria | 966 |
| 46 | Ga0070682_100746539 | 3300005337 | Bacteria | 790 |
| 47 | Ga0068868_100389275 | 3300005338 | Bacteria | 1201 |
| 48 | Ga0068868_100450414 | 3300005338 | Bacteria | 1119 |
| 49 | Ga0070660_100163303 | 3300005339 | Bacteria | 1796 |
| 50 | Ga0070660_100274175 | 3300005339 | Bacteria | 1379 |
| 51 | Ga0070660_100308013 | 3300005339 | Bacteria | 1299 |
| 52 | Ga0070660_100816918 | 3300005339 | Bacteria | 784 |
| 53 | Ga0070660_101133197 | 3300005339 | Bacteria | 662 |
| 54 | Ga0070689_100001094 | 3300005340 | Bacteria | 17018 |
| 55 | Ga0070689_100575973 | 3300005340 | Bacteria | 972 |
| 56 | Ga0070689_100762462 | 3300005340 | Bacteria | 849 |
| 57 | Ga0070691_10004253 | 3300005341 | Bacteria | 6508 |
| 58 | Ga0070691_10011711 | 3300005341 | Bacteria | 4012 |
| 59 | Ga0070691_10070928 | 3300005341 | Bacteria | 1691 |
| 60 | Ga0070691_10233691 | 3300005341 | Bacteria | 979 |
| 61 | Ga0070691_10293733 | 3300005341 | Bacteria | 885 |
| 62 | Ga0070691_10465498 | 3300005341 | Bacteria | 724 |
| 63 | Ga0070687_100216339 | 3300005343 | Bacteria | 1170 |
| 64 | Ga0070687_100266341 | 3300005343 | Bacteria | 1072 |
| 65 | Ga0070661_100195995 | 3300005344 | Bacteria | 1542 |
| 66 | Ga0070661_100246458 | 3300005344 | Bacteria | 1377 |
| 67 | Ga0070661_100259807 | 3300005344 | Bacteria | 1342 |
| 68 | Ga0070661_100286391 | 3300005344 | Bacteria | 1279 |
| 69 | Ga0070661_100815713 | 3300005344 | Bacteria | 766 |
| 70 | Ga0070661_101080655 | 3300005344 | Bacteria | 668 |
| 71 | Ga0070661_101871062 | 3300005344 | Bacteria | 510 |
| 72 | Ga0070692_10057240 | 3300005345 | Bacteria | 2044 |
| 73 | Ga0070692_10104041 | 3300005345 | Bacteria | 1560 |
| 74 | Ga0070692_10126257 | 3300005345 | Bacteria | 1433 |
| 75 | Ga0070692_10207647 | 3300005345 | Bacteria | 1151 |
| 76 | Ga0070692_10268720 | 3300005345 | Bacteria | 1028 |
| 77 | Ga0070692_10292766 | 3300005345 | Bacteria | 991 |
| 78 | Ga0070692_10817083 | 3300005345 | Bacteria | 638 |
| 79 | Ga0070668_100013940 | 3300005347 | Bacteria | 6011 |
| 80 | Ga0070669_100067122 | 3300005353 | Bacteria | 2645 |
| 81 | Ga0070675_100013649 | 3300005354 | Bacteria | 6390 |
| 82 | Ga0070675_100388095 | 3300005354 | Bacteria | 1244 |
| 83 | Ga0070675_100430036 | 3300005354 | Bacteria | 1182 |
| 84 | Ga0070675_100517223 | 3300005354 | Bacteria | 1077 |
| 85 | Ga0070675_101607120 | 3300005354 | Bacteria | 600 |
| 86 | Ga0070671_100253366 | 3300005355 | Bacteria | 1495 |
| 87 | Ga0070671_100389916 | 3300005355 | Bacteria | 1191 |
| 88 | Ga0070674_100242958 | 3300005356 | Bacteria | 1411 |
| 89 | Ga0070674_100872610 | 3300005356 | Bacteria | 782 |
| 90 | Ga0070674_101222385 | 3300005356 | Bacteria | 668 |
| 91 | Ga0070673_100077357 | 3300005364 | Bacteria | 2689 |
| 92 | Ga0070673_100243847 | 3300005364 | Bacteria | 1564 |
| 93 | Ga0070673_101360780 | 3300005364 | Bacteria | 667 |
| 94 | Ga0070688_100040619 | 3300005365 | Bacteria | 2852 |
| 95 | Ga0070688_100254433 | 3300005365 | Bacteria | 1252 |
| 96 | Ga0070688_101140230 | 3300005365 | Bacteria | 625 |
| 97 | Ga0070688_101159335 | 3300005365 | Bacteria | 620 |
| 98 | Ga0070659_100133905 | 3300005366 | Bacteria | 2015 |
| 99 | Ga0070659_100392854 | 3300005366 | Bacteria | 1170 |
| 100 | Ga0070659_100413522 | 3300005366 | Bacteria | 1140 |
| 101 | Ga0070659_100481130 | 3300005366 | Bacteria | 1056 |
| 102 | Ga0070659_100490138 | 3300005366 | Bacteria | 1047 |
| 103 | Ga0070667_100183217 | 3300005367 | Bacteria | 1853 |
| 104 | Ga0070667_100397993 | 3300005367 | Bacteria | 1253 |
| 105 | Ga0070667_100885685 | 3300005367 | Bacteria | 830 |
| 106 | Ga0070667_101841245 | 3300005367 | Bacteria | 570 |
| 107 | Ga0070703_10018767 | 3300005406 | Bacteria | 2003 |
| 108 | Ga0070703_10349306 | 3300005406 | Bacteria | 631 |
| 109 | Ga0070709_10086413 | 3300005434 | Bacteria | 2059 |
| 110 | Ga0070709_10362792 | 3300005434 | Bacteria | 1073 |
| 111 | Ga0070709_11538156 | 3300005434 | Bacteria | 541 |
| 112 | Ga0070714_100000372 | 3300005435 | Bacteria | 33436 |
| 113 | Ga0070710_11254403 | 3300005437 | Bacteria | 550 |
| 114 | Ga0070701_10060266 | 3300005438 | Bacteria | 1998 |
| 115 | Ga0070701_10127975 | 3300005438 | Bacteria | 1440 |
| 116 | Ga0070701_10489333 | 3300005438 | Bacteria | 797 |
| 117 | Ga0070711_100214462 | 3300005439 | Bacteria | 1493 |
| 118 | Ga0070705_100107192 | 3300005440 | Bacteria | 1777 |
| 119 | Ga0070700_100047238 | 3300005441 | Bacteria | 2664 |
| 120 | Ga0070700_101233972 | 3300005441 | Bacteria | 626 |
| 121 | Ga0070694_100144351 | 3300005444 | Bacteria | 1732 |
| 122 | Ga0070694_100209070 | 3300005444 | Bacteria | 1458 |
| 123 | Ga0070694_100430741 | 3300005444 | Bacteria | 1038 |
| 124 | Ga0070694_100546655 | 3300005444 | Bacteria | 927 |
| 125 | Ga0070708_100079144 | 3300005445 | Bacteria | 2973 |
| 126 | Ga0070663_100141159 | 3300005455 | Bacteria | 1839 |
| 127 | Ga0070663_100220903 | 3300005455 | Bacteria | 1487 |
| 128 | Ga0070663_100610469 | 3300005455 | Bacteria | 918 |
| 129 | Ga0070663_100862664 | 3300005455 | Bacteria | 780 |
| 130 | Ga0070663_101595517 | 3300005455 | Bacteria | 582 |
| 131 | Ga0070678_100010243 | 3300005456 | Bacteria | 5717 |
| 132 | Ga0070678_100134571 | 3300005456 | Bacteria | 1969 |
| 133 | Ga0070678_100798663 | 3300005456 | Bacteria | 857 |
| 134 | Ga0070678_100953179 | 3300005456 | Bacteria | 787 |
| 135 | Ga0070662_100019867 | 3300005457 | Bacteria | 4569 |
| 136 | Ga0070662_100394935 | 3300005457 | Bacteria | 1140 |
| 137 | Ga0070681_10000058 | 3300005458 | Bacteria | 79062 |
| 138 | Ga0070681_10004547 | 3300005458 | Bacteria | 13229 |
| 139 | Ga0070681_10008405 | 3300005458 | Bacteria | 10108 |
| 140 | Ga0070681_10015299 | 3300005458 | Bacteria | 7632 |
| 141 | Ga0070681_10017110 | 3300005458 | Bacteria | 7247 |
| 142 | Ga0070681_10370064 | 3300005458 | Bacteria | 1343 |
| 143 | Ga0070681_10595502 | 3300005458 | Bacteria | 1020 |
| 144 | Ga0070681_10700586 | 3300005458 | Bacteria | 928 |
| 145 | Ga0070681_10718045 | 3300005458 | Bacteria | 915 |
| 146 | Ga0070681_10941455 | 3300005458 | Bacteria | 783 |
| 147 | Ga0070681_11260446 | 3300005458 | Bacteria | 662 |
| 148 | Ga0068867_100095095 | 3300005459 | Bacteria | 2267 |
| 149 | Ga0068867_100452282 | 3300005459 | Bacteria | 1094 |
| 150 | Ga0070685_10104090 | 3300005466 | Bacteria | 1738 |
| 151 | Ga0070685_10738716 | 3300005466 | Bacteria | 721 |
| 152 | Ga0070706_100009220 | 3300005467 | Bacteria | 9192 |
| 153 | Ga0070706_100598445 | 3300005467 | Bacteria | 1025 |
| 154 | Ga0070698_100002102 | 3300005471 | Bacteria | 22110 |
| 155 | Ga0070698_100549186 | 3300005471 | Bacteria | 1095 |
| 156 | Ga0070698_102171070 | 3300005471 | Bacteria | 509 |
| 157 | Ga0070699_100072373 | 3300005518 | Bacteria | 2999 |
| 158 | Ga0070679_100001961 | 3300005530 | Bacteria | 18470 |
| 159 | Ga0070679_100004237 | 3300005530 | Bacteria | 13236 |
| 160 | Ga0070679_100015882 | 3300005530 | Bacteria | 7247 |
| 161 | Ga0070679_100064213 | 3300005530 | Bacteria | 3659 |
| 162 | Ga0070679_100118349 | 3300005530 | Bacteria | 2634 |
| 163 | Ga0070679_100225500 | 3300005530 | Bacteria | 1834 |
| 164 | Ga0070679_101284148 | 3300005530 | Bacteria | 678 |
| 165 | Ga0070679_101551627 | 3300005530 | Bacteria | 609 |
| 166 | Ga0070679_101724266 | 3300005530 | Bacteria | 574 |
| 167 | Ga0070679_101878527 | 3300005530 | Bacteria | 547 |
| 168 | Ga0070684_100001643 | 3300005535 | Bacteria | 16204 |
| 169 | Ga0070684_100156802 | 3300005535 | Bacteria | 2064 |
| 170 | Ga0070684_100328958 | 3300005535 | Bacteria | 1404 |
| 171 | Ga0070684_100558539 | 3300005535 | Bacteria | 1063 |
| 172 | Ga0070697_100224180 | 3300005536 | Bacteria | 1602 |
| 173 | Ga0068853_100187786 | 3300005539 | Bacteria | 1876 |
| 174 | Ga0068853_100272660 | 3300005539 | Bacteria | 1558 |
| 175 | Ga0068853_100799278 | 3300005539 | Bacteria | 903 |
| 176 | Ga0068853_101344939 | 3300005539 | Bacteria | 691 |
| 177 | Ga0068853_101545957 | 3300005539 | Bacteria | 643 |
| 178 | Ga0070672_100016355 | 3300005543 | Bacteria | 5310 |
| 179 | Ga0070686_101053025 | 3300005544 | Bacteria | 670 |
| 180 | Ga0070695_100534388 | 3300005545 | Bacteria | 912 |
| 181 | Ga0070695_100829185 | 3300005545 | Bacteria | 743 |
| 182 | Ga0070695_101025889 | 3300005545 | Bacteria | 672 |
| 183 | Ga0070696_100002369 | 3300005546 | Bacteria | 12458 |
| 184 | Ga0070696_100216133 | 3300005546 | Bacteria | 1436 |
| 185 | Ga0070696_101611169 | 3300005546 | Bacteria | 558 |
| 186 | Ga0070693_100005733 | 3300005547 | Bacteria | 5997 |
| 187 | Ga0070693_100210333 | 3300005547 | Bacteria | 1269 |
| 188 | Ga0070693_100316979 | 3300005547 | Bacteria | 1056 |
| 189 | Ga0070665_100041133 | 3300005548 | Bacteria | 4646 |
| 190 | Ga0070665_100082650 | 3300005548 | Bacteria | 3217 |
| 191 | Ga0070665_100092027 | 3300005548 | Bacteria | 3037 |
| 192 | Ga0070665_101127947 | 3300005548 | Bacteria | 795 |
| 193 | Ga0070704_100337583 | 3300005549 | Bacteria | 1268 |
| 194 | Ga0068855_100002743 | 3300005563 | Bacteria | 21682 |
| 195 | Ga0068855_100375704 | 3300005563 | Bacteria | 1561 |
| 196 | Ga0068855_100434091 | 3300005563 | Bacteria | 1435 |
| 197 | Ga0068855_101271904 | 3300005563 | Bacteria | 763 |
| 198 | Ga0068855_101333165 | 3300005563 | Bacteria | 742 |
| 199 | Ga0068855_101908594 | 3300005563 | Bacteria | 601 |
| 200 | Ga0070664_100004119 | 3300005564 | Bacteria | 11675 |
| 201 | Ga0070664_100095569 | 3300005564 | Bacteria | 2577 |
| 202 | Ga0070664_100637936 | 3300005564 | Bacteria | 989 |
| 203 | Ga0070664_101389890 | 3300005564 | Bacteria | 664 |
| 204 | Ga0070664_101529743 | 3300005564 | Bacteria | 632 |
| 205 | Ga0068857_100080822 | 3300005577 | Bacteria | 2902 |
| 206 | Ga0068857_100313758 | 3300005577 | Bacteria | 1447 |
| 207 | Ga0068857_100478674 | 3300005577 | Bacteria | 1166 |
| 208 | Ga0068857_100596321 | 3300005577 | Bacteria | 1044 |
| 209 | Ga0068857_101036320 | 3300005577 | Bacteria | 791 |
| 210 | Ga0068854_100090261 | 3300005578 | Bacteria | 2278 |
| 211 | Ga0068854_100147801 | 3300005578 | Bacteria | 1809 |
| 212 | Ga0068854_100392414 | 3300005578 | Bacteria | 1146 |
| 213 | Ga0068854_100747621 | 3300005578 | Bacteria | 848 |
| 214 | Ga0068854_102135244 | 3300005578 | Bacteria | 518 |
| 215 | Ga0068854_102188257 | 3300005578 | Bacteria | 511 |
| 216 | Ga0068856_100012478 | 3300005614 | Bacteria | 8226 |
| 217 | Ga0068856_100249036 | 3300005614 | Bacteria | 1792 |
| 218 | Ga0068856_101093939 | 3300005614 | Bacteria | 814 |
| 219 | Ga0068856_101559671 | 3300005614 | Bacteria | 674 |
| 220 | Ga0070702_100007955 | 3300005615 | Bacteria | 5108 |
| 221 | Ga0070702_100623626 | 3300005615 | Bacteria | 812 |
| 222 | Ga0068852_100212154 | 3300005616 | Bacteria | 1837 |
| 223 | Ga0068852_100322544 | 3300005616 | Bacteria | 1500 |
| 224 | Ga0068852_100431312 | 3300005616 | Bacteria | 1302 |
| 225 | Ga0068852_100502481 | 3300005616 | Bacteria | 1207 |
| 226 | Ga0068852_100831271 | 3300005616 | Bacteria | 939 |
| 227 | Ga0068859_100003542 | 3300005617 | Bacteria | 15898 |
| 228 | Ga0068859_100065390 | 3300005617 | Bacteria | 3671 |
| 229 | Ga0068859_100161732 | 3300005617 | Bacteria | 2318 |
| 230 | Ga0068859_100296267 | 3300005617 | Bacteria | 1711 |
| 231 | Ga0068859_101621020 | 3300005617 | Bacteria | 715 |
| 232 | Ga0068859_102628498 | 3300005617 | Bacteria | 554 |
| 233 | Ga0068864_100002080 | 3300005618 | Bacteria | 16539 |
| 234 | Ga0068864_100480311 | 3300005618 | Bacteria | 1193 |
| 235 | Ga0068866_10424016 | 3300005718 | Bacteria | 864 |
| 236 | Ga0068861_100291376 | 3300005719 | Bacteria | 1410 |
| 237 | Ga0068861_102281560 | 3300005719 | Bacteria | 543 |
| 238 | Ga0068861_102681873 | 3300005719 | Bacteria | 503 |
| 239 | Ga0068851_10119168 | 3300005834 | Bacteria | 1417 |
| 240 | Ga0068851_10502967 | 3300005834 | Bacteria | 727 |
| 241 | Ga0068851_11023400 | 3300005834 | Bacteria | 522 |
| 242 | Ga0068870_10163763 | 3300005840 | Bacteria | 1321 |
| 243 | Ga0068863_100003431 | 3300005841 | Bacteria | 15619 |
| 244 | Ga0068863_101033480 | 3300005841 | Bacteria | 825 |
| 245 | Ga0068863_101845345 | 3300005841 | Unclassified | 614 |
| 246 | Ga0068863_102032468 | 3300005841 | Bacteria | 585 |
| 247 | Ga0068858_100150154 | 3300005842 | Bacteria | 2191 |
| 248 | Ga0068858_101384966 | 3300005842 | Bacteria | 693 |
| 249 | Ga0068860_100065835 | 3300005843 | Bacteria | 3441 |
| 250 | Ga0068860_100300092 | 3300005843 | Bacteria | 1573 |
| 251 | Ga0068860_100494327 | 3300005843 | Bacteria | 1221 |
| 252 | Ga0068860_101323069 | 3300005843 | Bacteria | 741 |
| 253 | Ga0068860_101627468 | 3300005843 | Bacteria | 668 |
| 254 | Ga0068860_102021474 | 3300005843 | Bacteria | 598 |
| 255 | Ga0068862_100168706 | 3300005844 | Bacteria | 1958 |
| 256 | Ga0068862_100613855 | 3300005844 | Bacteria | 1046 |
| 257 | Ga0068862_101083502 | 3300005844 | Bacteria | 796 |
| 258 | Ga0068862_101191206 | 3300005844 | Bacteria | 760 |
| 259 | Ga0081455_10000268 | 3300005937 | Bacteria | 68637 |
| 260 | Ga0081455_10054750 | 3300005937 | Bacteria | 3398 |
| 261 | Ga0081455_10204578 | 3300005937 | Bacteria | 1476 |
| 262 | Ga0081538_10084296 | 3300005981 | Bacteria | 1675 |
| 263 | Ga0081539_10013083 | 3300005985 | Bacteria | 6291 |
| 264 | Ga0081539_10042275 | 3300005985 | Bacteria | 2656 |
| 265 | Ga0070717_11034841 | 3300006028 | Bacteria | 748 |
| 266 | Ga0075365_10558830 | 3300006038 | Bacteria | 809 |
| 267 | Ga0075368_10050117 | 3300006042 | Bacteria | 1657 |
| 268 | Ga0075368_10055615 | 3300006042 | Bacteria | 1578 |
| 269 | Ga0075363_100236481 | 3300006048 | Bacteria | 1049 |
| 270 | Ga0075364_10543097 | 3300006051 | Bacteria | 794 |
| 271 | Ga0075364_10559743 | 3300006051 | Bacteria | 781 |
| 272 | Ga0070712_100081916 | 3300006175 | Bacteria | 2340 |
| 273 | Ga0070712_100583517 | 3300006175 | Bacteria | 945 |
| 274 | Ga0075362_10008923 | 3300006177 | Bacteria | 3855 |
| 275 | Ga0075362_10020897 | 3300006177 | Bacteria | 2739 |
| 276 | Ga0075362_10047714 | 3300006177 | Bacteria | 1908 |
| 277 | Ga0075362_10167732 | 3300006177 | Bacteria | 1059 |
| 278 | Ga0075362_10625954 | 3300006177 | Bacteria | 557 |
| 279 | Ga0075367_10041520 | 3300006178 | Bacteria | 2689 |
| 280 | Ga0075367_10168964 | 3300006178 | Bacteria | 1362 |
| 281 | Ga0075367_10238885 | 3300006178 | Bacteria | 1138 |
| 282 | Ga0075369_10008002 | 3300006186 | Bacteria | 4050 |
| 283 | Ga0075369_10030877 | 3300006186 | Bacteria | 2258 |
| 284 | Ga0075369_10272459 | 3300006186 | Bacteria | 788 |
| 285 | Ga0075366_10305473 | 3300006195 | Bacteria | 974 |
| 286 | Ga0075366_10414108 | 3300006195 | Bacteria | 830 |
| 287 | Ga0075366_11058337 | 3300006195 | Bacteria | 507 |
| 288 | Ga0097621_100118997 | 3300006237 | Bacteria | 2239 |
| 289 | Ga0097621_100733281 | 3300006237 | Bacteria | 912 |
| 290 | Ga0075370_10064170 | 3300006353 | Bacteria | 2094 |
| 291 | Ga0075370_10139524 | 3300006353 | Bacteria | 1417 |
| 292 | Ga0075370_10278040 | 3300006353 | Bacteria | 994 |
| 293 | Ga0068871_100109737 | 3300006358 | Bacteria | 2320 |
| 294 | Ga0068871_100874852 | 3300006358 | Bacteria | 832 |
| 295 | Ga0075428_100005214 | 3300006844 | Bacteria | 14448 |
| 296 | Ga0075428_100104078 | 3300006844 | Bacteria | 3095 |
| 297 | Ga0075428_100346444 | 3300006844 | Bacteria | 1595 |
| 298 | Ga0075428_100353694 | 3300006844 | Bacteria | 1576 |
| 299 | Ga0075428_100481381 | 3300006844 | Bacteria | 1328 |
| 300 | Ga0075428_101662488 | 3300006844 | Bacteria | 667 |
| 301 | Ga0075430_100006334 | 3300006846 | Bacteria | 9985 |
| 302 | Ga0075430_100225756 | 3300006846 | Bacteria | 1553 |
| 303 | Ga0075430_100282401 | 3300006846 | Bacteria | 1373 |
| 304 | Ga0075431_100055692 | 3300006847 | Bacteria | 4079 |
| 305 | Ga0075431_100163788 | 3300006847 | Bacteria | 2286 |
| 306 | Ga0075433_10004060 | 3300006852 | Bacteria | 11337 |
| 307 | Ga0075433_10488278 | 3300006852 | Bacteria | 1085 |
| 308 | Ga0075433_10593433 | 3300006852 | Bacteria | 973 |
| 309 | Ga0075433_11874624 | 3300006852 | Bacteria | 515 |
| 310 | Ga0075434_100006745 | 3300006871 | Bacteria | 10551 |
| 311 | Ga0075434_100753152 | 3300006871 | Bacteria | 991 |
| 312 | Ga0075429_100007100 | 3300006880 | Bacteria | 9723 |
| 313 | Ga0075429_100936264 | 3300006880 | Bacteria | 758 |
| 314 | Ga0075429_101336271 | 3300006880 | Bacteria | 625 |
| 315 | Ga0068865_100204877 | 3300006881 | Bacteria | 1534 |
| 316 | Ga0097620_100003542 | 3300006931 | Bacteria | 15898 |
| 317 | Ga0097620_100065389 | 3300006931 | Bacteria | 3671 |
| 318 | Ga0097620_100161733 | 3300006931 | Bacteria | 2318 |
| 319 | Ga0097620_100296272 | 3300006931 | Bacteria | 1711 |
| 320 | Ga0097620_101620990 | 3300006931 | Bacteria | 715 |
| 321 | Ga0097620_102628778 | 3300006931 | Bacteria | 554 |
| 322 | Ga0099794_10518170 | 3300007265 | Bacteria | 628 |
| 323 | Ga0099795_10025934 | 3300007788 | Bacteria | 1970 |
| 324 | Ga0105244_10151516 | 3300009036 | Bacteria | 1111 |
| 325 | Ga0105250_10000023 | 3300009092 | Bacteria | 219389 |
| 326 | Ga0105250_10180981 | 3300009092 | Bacteria | 884 |
| 327 | Ga0105240_10015264 | 3300009093 | Bacteria | 10452 |
| 328 | Ga0105240_10019139 | 3300009093 | Bacteria | 9155 |
| 329 | Ga0105240_10223820 | 3300009093 | Bacteria | 2190 |
| 330 | Ga0105240_10291794 | 3300009093 | Bacteria | 1869 |
| 331 | Ga0111539_10006091 | 3300009094 | Bacteria | 15568 |
| 332 | Ga0111539_10038677 | 3300009094 | Bacteria | 5757 |
| 333 | Ga0111539_10277704 | 3300009094 | Bacteria | 1949 |
| 334 | Ga0111539_10371852 | 3300009094 | Bacteria | 1664 |
| 335 | Ga0111539_10378882 | 3300009094 | Bacteria | 1647 |
| 336 | Ga0111539_10656833 | 3300009094 | Bacteria | 1221 |
| 337 | Ga0111539_11044874 | 3300009094 | Bacteria | 950 |
| 338 | Ga0111539_12290432 | 3300009094 | Bacteria | 627 |
| 339 | Ga0111539_13435686 | 3300009094 | Bacteria | 509 |
| 340 | Ga0105245_10993126 | 3300009098 | Bacteria | 883 |
| 341 | Ga0105245_11450088 | 3300009098 | Bacteria | 737 |
| 342 | Ga0105245_12238577 | 3300009098 | Bacteria | 600 |
| 343 | Ga0105247_11181634 | 3300009101 | Bacteria | 608 |
| 344 | Ga0114129_10012049 | 3300009147 | Bacteria | 12300 |
| 345 | Ga0114129_10589038 | 3300009147 | Bacteria | 1442 |
| 346 | Ga0105243_10578939 | 3300009148 | Bacteria | 1077 |
| 347 | Ga0105243_11057020 | 3300009148 | Bacteria | 818 |
| 348 | Ga0105241_12506530 | 3300009174 | Bacteria | 516 |
| 349 | Ga0105242_10159634 | 3300009176 | Bacteria | 1972 |
| 350 | Ga0105242_11423816 | 3300009176 | Unclassified | 721 |
| 351 | Ga0105242_11484397 | 3300009176 | Bacteria | 708 |
| 352 | Ga0105242_11888983 | 3300009176 | Bacteria | 637 |
| 353 | Ga0105248_10013091 | 3300009177 | Bacteria | 9133 |
| 354 | Ga0105248_11649917 | 3300009177 | Unclassified | 726 |
| 355 | Ga0105248_12071450 | 3300009177 | Bacteria | 647 |
| 356 | Ga0105237_10350907 | 3300009545 | Bacteria | 1480 |
| 357 | Ga0105237_11572704 | 3300009545 | Bacteria | 664 |
| 358 | Ga0105238_10082734 | 3300009551 | Bacteria | 3200 |
| 359 | Ga0105238_10405318 | 3300009551 | Bacteria | 1357 |
| 360 | Ga0105238_10644448 | 3300009551 | Bacteria | 1069 |
| 361 | Ga0105238_11703811 | 3300009551 | Bacteria | 661 |
| 362 | Ga0105249_10010911 | 3300009553 | Bacteria | 7986 |
| 363 | Ga0105249_10068998 | 3300009553 | Bacteria | 3262 |
| 364 | Ga0105249_10712431 | 3300009553 | Bacteria | 1064 |
| 365 | Ga0105249_10929115 | 3300009553 | Bacteria | 937 |
| 366 | Ga0105249_11460237 | 3300009553 | Bacteria | 756 |
| 367 | Ga0105032_101327 | 3300009979 | Bacteria | 2282 |
| 368 | Ga0105035_104908 | 3300009988 | Bacteria | 1072 |
| 369 | Ga0105035_105563 | 3300009988 | Bacteria | 1026 |
| 370 | Ga0105035_115012 | 3300009988 | Bacteria | 709 |
| 371 | Ga0099796_10059854 | 3300010159 | Bacteria | 1346 |
| 372 | Ga0099796_10152403 | 3300010159 | Bacteria | 911 |
| 373 | Ga0105239_10746592 | 3300010375 | Bacteria | 1120 |
| 374 | Ga0105239_11176614 | 3300010375 | Bacteria | 883 |
| 375 | Ga0105239_11525377 | 3300010375 | Bacteria | 772 |
| 376 | Ga0105246_11230406 | 3300011119 | Bacteria | 691 |
| 377 | Ga0157328_1012371 | 3300012478 | Bacteria | 619 |
| 378 | Ga0157325_1022663 | 3300012485 | Bacteria | 573 |
| 379 | Ga0157321_1016396 | 3300012487 | Bacteria | 636 |
| 380 | Ga0157322_1011930 | 3300012490 | Bacteria | 724 |
| 381 | Ga0157329_1047268 | 3300012491 | Bacteria | 501 |
| 382 | Ga0157335_1007582 | 3300012492 | Bacteria | 814 |
| 383 | Ga0157319_1028887 | 3300012497 | Bacteria | 588 |
| 384 | Ga0157314_1026926 | 3300012500 | Bacteria | 623 |
| 385 | Ga0157313_1008230 | 3300012503 | Bacteria | 834 |
| 386 | Ga0157339_1019563 | 3300012505 | Bacteria | 707 |
| 387 | Ga0157316_1001729 | 3300012510 | Bacteria | 1400 |
| 388 | Ga0157316_1020032 | 3300012510 | Bacteria | 723 |
| 389 | Ga0157373_10076846 | 3300013100 | Bacteria | 2356 |
| 390 | Ga0157373_10128973 | 3300013100 | Bacteria | 1778 |
| 391 | Ga0157373_10163294 | 3300013100 | Bacteria | 1567 |
| 392 | Ga0157373_10397466 | 3300013100 | Bacteria | 987 |
| 393 | Ga0157373_10586227 | 3300013100 | Bacteria | 811 |
| 394 | Ga0157371_10116033 | 3300013102 | Bacteria | 1902 |
| 395 | Ga0157371_10272431 | 3300013102 | Bacteria | 1222 |
| 396 | Ga0157371_10702630 | 3300013102 | Bacteria | 757 |
| 397 | Ga0157370_10232982 | 3300013104 | Bacteria | 1704 |
| 398 | Ga0157370_10263741 | 3300013104 | Bacteria | 1592 |
| 399 | Ga0157370_10283780 | 3300013104 | Bacteria | 1530 |
| 400 | Ga0157370_10384293 | 3300013104 | Bacteria | 1293 |
| 401 | Ga0157370_10492511 | 3300013104 | Bacteria | 1126 |
| 402 | Ga0157370_10501829 | 3300013104 | Bacteria | 1114 |
| 403 | Ga0157370_10898316 | 3300013104 | Bacteria | 804 |
| 404 | Ga0157370_11922971 | 3300013104 | Bacteria | 531 |
| 405 | Ga0157369_10032420 | 3300013105 | Bacteria | 5746 |
| 406 | Ga0157369_10535490 | 3300013105 | Bacteria | 1211 |
| 407 | Ga0157369_10560682 | 3300013105 | Bacteria | 1180 |
| 408 | Ga0157369_10815163 | 3300013105 | Bacteria | 959 |
| 409 | Ga0157369_11588552 | 3300013105 | Bacteria | 665 |
| 410 | Ga0157369_11712607 | 3300013105 | Bacteria | 639 |
| 411 | Ga0157374_10660366 | 3300013296 | Bacteria | 1057 |
| 412 | Ga0157374_11047909 | 3300013296 | Bacteria | 835 |
| 413 | Ga0157378_10202557 | 3300013297 | Bacteria | 1878 |
| 414 | Ga0157378_10254609 | 3300013297 | Bacteria | 1682 |
| 415 | Ga0157378_10357402 | 3300013297 | Bacteria | 1429 |
| 416 | Ga0157378_10466658 | 3300013297 | Bacteria | 1256 |
| 417 | Ga0163162_11035510 | 3300013306 | Bacteria | 929 |
| 418 | Ga0163162_12276857 | 3300013306 | Bacteria | 622 |
| 419 | Ga0157372_10125411 | 3300013307 | Bacteria | 2952 |
| 420 | Ga0157372_10228057 | 3300013307 | Bacteria | 2159 |
| 421 | Ga0157372_10338190 | 3300013307 | Bacteria | 1753 |
| 422 | Ga0157372_10924129 | 3300013307 | Bacteria | 1012 |
| 423 | Ga0157375_10358117 | 3300013308 | Bacteria | 1625 |
| 424 | Ga0157375_10962784 | 3300013308 | Bacteria | 995 |
| 425 | Ga0157375_11092958 | 3300013308 | Bacteria | 933 |
| 426 | Ga0157375_11581043 | 3300013308 | Bacteria | 775 |
| 427 | Ga0157375_11969545 | 3300013308 | Unclassified | 694 |
| 428 | Ga0157515_112177 | 3300013875 | Bacteria | 801 |
| 429 | Ga0163163_10030882 | 3300014325 | Bacteria | 5166 |
| 430 | Ga0163163_12318229 | 3300014325 | Bacteria | 596 |
| 431 | Ga0163163_12410127 | 3300014325 | Bacteria | 585 |
| 432 | Ga0157380_10088498 | 3300014326 | Bacteria | 2548 |
| 433 | Ga0157380_10351176 | 3300014326 | Bacteria | 1380 |
| 434 | Ga0157380_10475325 | 3300014326 | Bacteria | 1207 |
| 435 | Ga0157380_10872203 | 3300014326 | Bacteria | 924 |
| 436 | Ga0157380_12627350 | 3300014326 | Bacteria | 570 |
| 437 | Ga0182008_10128865 | 3300014497 | Bacteria | 1261 |
| 438 | Ga0157377_10018611 | 3300014745 | Bacteria | 3612 |
| 439 | Ga0157377_10898458 | 3300014745 | Bacteria | 662 |
| 440 | Ga0157377_10901973 | 3300014745 | Bacteria | 661 |
| 441 | Ga0157377_11503113 | 3300014745 | Bacteria | 535 |
| 442 | Ga0157379_10021307 | 3300014968 | Bacteria | 5736 |
| 443 | Ga0157379_10084854 | 3300014968 | Bacteria | 2838 |
| 444 | Ga0157379_11897178 | 3300014968 | Bacteria | 587 |
| 445 | Ga0157376_10261648 | 3300014969 | Bacteria | 1621 |
| 446 | Ga0157376_11748617 | 3300014969 | Bacteria | 657 |
| 447 | Ga0182007_10145999 | 3300015262 | Bacteria | 802 |
| 448 | Ga0163161_10692538 | 3300017792 | Bacteria | 848 |
| 449 | Ga0163161_11003190 | 3300017792 | Bacteria | 713 |
| 450 | Ga0206350_10919969 | 3300020080 | Bacteria | 846 |
| 451 | Ga0206354_10021222 | 3300020081 | Bacteria | 3279 |
| 452 | Ga0206353_10035558 | 3300020082 | Bacteria | 1735 |
| 453 | Ga0206353_11001100 | 3300020082 | Bacteria | 1043 |
| 454 | Ga0154015_1173312 | 3300020610 | Bacteria | 1366 |
| 455 | Ga0213872_10037234 | 3300021361 | Bacteria | 2221 |
| 456 | Ga0213871_10003275 | 3300021441 | Bacteria | 3102 |
| 457 | Ga0209676_1025789 | 3300025292 | Bacteria | 1879 |
| 458 | Ga0207426_1062561 | 3300025302 | Bacteria | 1065 |
| 459 | Ga0207656_10143901 | 3300025321 | Bacteria | 1125 |
| 460 | Ga0207696_1000098 | 3300025711 | Bacteria | 175181 |
| 461 | Ga0207642_10364956 | 3300025899 | Bacteria | 855 |
| 462 | Ga0207688_10052206 | 3300025901 | Bacteria | 2291 |
| 463 | Ga0207688_10214010 | 3300025901 | Bacteria | 1159 |
| 464 | Ga0207688_10604299 | 3300025901 | Bacteria | 691 |
| 465 | Ga0207680_11054491 | 3300025903 | Bacteria | 582 |
| 466 | Ga0207647_10016579 | 3300025904 | Bacteria | 5024 |
| 467 | Ga0207647_10309413 | 3300025904 | Bacteria | 899 |
| 468 | Ga0207699_10310358 | 3300025906 | Bacteria | 1104 |
| 469 | Ga0207699_10486394 | 3300025906 | Bacteria | 889 |
| 470 | Ga0207699_11130928 | 3300025906 | Bacteria | 580 |
| 471 | Ga0207645_10010902 | 3300025907 | Bacteria | 6224 |
| 472 | Ga0207645_10179437 | 3300025907 | Bacteria | 1389 |
| 473 | Ga0207643_10502761 | 3300025908 | Bacteria | 775 |
| 474 | Ga0207643_10638341 | 3300025908 | Bacteria | 687 |
| 475 | Ga0207705_10000083 | 3300025909 | Bacteria | 117366 |
| 476 | Ga0207705_10016964 | 3300025909 | Bacteria | 5215 |
| 477 | Ga0207705_10132869 | 3300025909 | Bacteria | 1853 |
| 478 | Ga0207705_10182418 | 3300025909 | Bacteria | 1584 |
| 479 | Ga0207705_10387986 | 3300025909 | Bacteria | 1079 |
| 480 | Ga0207705_10470595 | 3300025909 | Bacteria | 975 |
| 481 | Ga0207684_10057826 | 3300025910 | Bacteria | 3291 |
| 482 | Ga0207654_10100628 | 3300025911 | Bacteria | 1780 |
| 483 | Ga0207654_10138259 | 3300025911 | Bacteria | 1550 |
| 484 | Ga0207654_11016646 | 3300025911 | Bacteria | 603 |
| 485 | Ga0207707_10000069 | 3300025912 | Bacteria | 103460 |
| 486 | Ga0207707_10000292 | 3300025912 | Bacteria | 53455 |
| 487 | Ga0207707_10000912 | 3300025912 | Bacteria | 28803 |
| 488 | Ga0207707_10001098 | 3300025912 | Bacteria | 25804 |
| 489 | Ga0207707_10002049 | 3300025912 | Bacteria | 18304 |
| 490 | Ga0207707_10002853 | 3300025912 | Bacteria | 15432 |
| 491 | Ga0207707_10014746 | 3300025912 | Bacteria | 6811 |
| 492 | Ga0207707_10042268 | 3300025912 | Bacteria | 3978 |
| 493 | Ga0207707_10541983 | 3300025912 | Bacteria | 989 |
| 494 | Ga0207707_10665327 | 3300025912 | Bacteria | 877 |
| 495 | Ga0207695_10003936 | 3300025913 | Bacteria | 20547 |
| 496 | Ga0207695_10004599 | 3300025913 | Bacteria | 18742 |
| 497 | Ga0207695_10021124 | 3300025913 | Bacteria | 7436 |
| 498 | Ga0207695_10149525 | 3300025913 | Bacteria | 2276 |
| 499 | Ga0207695_10161639 | 3300025913 | Bacteria | 2171 |
| 500 | Ga0207695_10186630 | 3300025913 | Bacteria | 1992 |
| 501 | Ga0207695_10205245 | 3300025913 | Bacteria | 1884 |
| 502 | Ga0207695_10213921 | 3300025913 | Bacteria | 1837 |
| 503 | Ga0207671_10538157 | 3300025914 | Bacteria | 931 |
| 504 | Ga0207693_10107991 | 3300025915 | Bacteria | 2183 |
| 505 | Ga0207663_10266962 | 3300025916 | Bacteria | 1266 |
| 506 | Ga0207660_10000080 | 3300025917 | Bacteria | 50991 |
| 507 | Ga0207660_10011506 | 3300025917 | Bacteria | 5763 |
| 508 | Ga0207660_10021757 | 3300025917 | Bacteria | 4315 |
| 509 | Ga0207660_10037471 | 3300025917 | Bacteria | 3379 |
| 510 | Ga0207660_10082740 | 3300025917 | Bacteria | 2362 |
| 511 | Ga0207660_10138191 | 3300025917 | Bacteria | 1861 |
| 512 | Ga0207660_10324961 | 3300025917 | Bacteria | 1229 |
| 513 | Ga0207660_10936337 | 3300025917 | Bacteria | 707 |
| 514 | Ga0207662_10009092 | 3300025918 | Bacteria | 5459 |
| 515 | Ga0207662_10345307 | 3300025918 | Bacteria | 998 |
| 516 | Ga0207657_10025007 | 3300025919 | Bacteria | 5517 |
| 517 | Ga0207657_10164670 | 3300025919 | Bacteria | 1799 |
| 518 | Ga0207657_10199572 | 3300025919 | Bacteria | 1610 |
| 519 | Ga0207657_10405598 | 3300025919 | Bacteria | 1072 |
| 520 | Ga0207649_10001073 | 3300025920 | Bacteria | 16700 |
| 521 | Ga0207649_10016885 | 3300025920 | Bacteria | 4129 |
| 522 | Ga0207649_10181844 | 3300025920 | Bacteria | 1472 |
| 523 | Ga0207649_10190129 | 3300025920 | Bacteria | 1443 |
| 524 | Ga0207649_10356317 | 3300025920 | Bacteria | 1084 |
| 525 | Ga0207649_10451736 | 3300025920 | Bacteria | 970 |
| 526 | Ga0207649_10633114 | 3300025920 | Bacteria | 825 |
| 527 | Ga0207649_10737367 | 3300025920 | Bacteria | 766 |
| 528 | Ga0207652_10004216 | 3300025921 | Bacteria | 11735 |
| 529 | Ga0207652_10007199 | 3300025921 | Bacteria | 8976 |
| 530 | Ga0207652_10008762 | 3300025921 | Bacteria | 8143 |
| 531 | Ga0207652_10013121 | 3300025921 | Bacteria | 6708 |
| 532 | Ga0207652_10016538 | 3300025921 | Bacteria | 6024 |
| 533 | Ga0207652_10020260 | 3300025921 | Bacteria | 5476 |
| 534 | Ga0207652_10025790 | 3300025921 | Bacteria | 4891 |
| 535 | Ga0207652_10159426 | 3300025921 | Bacteria | 2022 |
| 536 | Ga0207652_10180483 | 3300025921 | Bacteria | 1897 |
| 537 | Ga0207652_11050044 | 3300025921 | Bacteria | 714 |
| 538 | Ga0207652_11226465 | 3300025921 | Bacteria | 652 |
| 539 | Ga0207646_10309751 | 3300025922 | Bacteria | 1427 |
| 540 | Ga0207681_10080433 | 3300025923 | Bacteria | 2298 |
| 541 | Ga0207681_10940439 | 3300025923 | Bacteria | 724 |
| 542 | Ga0207681_11379939 | 3300025923 | Bacteria | 591 |
| 543 | Ga0207694_10086136 | 3300025924 | Bacteria | 2473 |
| 544 | Ga0207694_10600309 | 3300025924 | Bacteria | 926 |
| 545 | Ga0207650_10603732 | 3300025925 | Bacteria | 923 |
| 546 | Ga0207650_10616025 | 3300025925 | Bacteria | 913 |
| 547 | Ga0207650_10683091 | 3300025925 | Bacteria | 867 |
| 548 | Ga0207650_11099075 | 3300025925 | Bacteria | 677 |
| 549 | Ga0207650_11670881 | 3300025925 | Bacteria | 540 |
| 550 | Ga0207659_10002602 | 3300025926 | Bacteria | 10744 |
| 551 | Ga0207659_10328582 | 3300025926 | Bacteria | 1263 |
| 552 | Ga0207659_10793614 | 3300025926 | Bacteria | 813 |
| 553 | Ga0207659_11239246 | 3300025926 | Bacteria | 641 |
| 554 | Ga0207659_11497289 | 3300025926 | Bacteria | 577 |
| 555 | Ga0207659_11666813 | 3300025926 | Bacteria | 543 |
| 556 | Ga0207687_10330585 | 3300025927 | Bacteria | 1236 |
| 557 | Ga0207687_11740111 | 3300025927 | Bacteria | 534 |
| 558 | Ga0207700_10016571 | 3300025928 | Bacteria | 4900 |
| 559 | Ga0207664_10005812 | 3300025929 | Bacteria | 8436 |
| 560 | Ga0207644_10285518 | 3300025931 | Bacteria | 1326 |
| 561 | Ga0207644_10475263 | 3300025931 | Bacteria | 1029 |
| 562 | Ga0207690_10029881 | 3300025932 | Bacteria | 3469 |
| 563 | Ga0207690_10065616 | 3300025932 | Bacteria | 2483 |
| 564 | Ga0207690_10177685 | 3300025932 | Bacteria | 1600 |
| 565 | Ga0207690_10380502 | 3300025932 | Bacteria | 1122 |
| 566 | Ga0207690_11659037 | 3300025932 | Bacteria | 534 |
| 567 | Ga0207706_10027898 | 3300025933 | Bacteria | 5047 |
| 568 | Ga0207706_11008701 | 3300025933 | Bacteria | 699 |
| 569 | Ga0207686_10059253 | 3300025934 | Bacteria | 2418 |
| 570 | Ga0207686_10813755 | 3300025934 | Bacteria | 750 |
| 571 | Ga0207709_10070905 | 3300025935 | Bacteria | 2211 |
| 572 | Ga0207709_10911312 | 3300025935 | Bacteria | 715 |
| 573 | Ga0207670_10000955 | 3300025936 | Bacteria | 15246 |
| 574 | Ga0207670_10566030 | 3300025936 | Bacteria | 930 |
| 575 | Ga0207669_11379555 | 3300025937 | Bacteria | 600 |
| 576 | Ga0207669_11424965 | 3300025937 | Bacteria | 590 |
| 577 | Ga0207704_10313012 | 3300025938 | Bacteria | 1208 |
| 578 | Ga0207704_11175201 | 3300025938 | Bacteria | 654 |
| 579 | Ga0207665_10577722 | 3300025939 | Bacteria | 876 |
| 580 | Ga0207691_10028519 | 3300025940 | Bacteria | 5227 |
| 581 | Ga0207691_10188956 | 3300025940 | Bacteria | 1797 |
| 582 | Ga0207691_10870512 | 3300025940 | Bacteria | 755 |
| 583 | Ga0207711_10009083 | 3300025941 | Bacteria | 8300 |
| 584 | Ga0207711_10411796 | 3300025941 | Bacteria | 1257 |
| 585 | Ga0207711_11101025 | 3300025941 | Unclassified | 735 |
| 586 | Ga0207689_10062065 | 3300025942 | Bacteria | 3073 |
| 587 | Ga0207689_10192564 | 3300025942 | Bacteria | 1682 |
| 588 | Ga0207689_10544740 | 3300025942 | Bacteria | 974 |
| 589 | Ga0207689_11436703 | 3300025942 | Bacteria | 577 |
| 590 | Ga0207661_10030536 | 3300025944 | Bacteria | 4152 |
| 591 | Ga0207661_10041689 | 3300025944 | Bacteria | 3614 |
| 592 | Ga0207661_10174835 | 3300025944 | Bacteria | 1871 |
| 593 | Ga0207661_10295663 | 3300025944 | Bacteria | 1450 |
| 594 | Ga0207661_10447882 | 3300025944 | Bacteria | 1176 |
| 595 | Ga0207679_10010978 | 3300025945 | Bacteria | 5844 |
| 596 | Ga0207679_10042253 | 3300025945 | Bacteria | 3275 |
| 597 | Ga0207679_10152680 | 3300025945 | Bacteria | 1882 |
| 598 | Ga0207679_10164764 | 3300025945 | Bacteria | 1819 |
| 599 | Ga0207679_10559186 | 3300025945 | Bacteria | 1027 |
| 600 | Ga0207679_10846136 | 3300025945 | Bacteria | 835 |
| 601 | Ga0207679_11588660 | 3300025945 | Bacteria | 599 |
| 602 | Ga0207667_10001111 | 3300025949 | Bacteria | 33935 |
| 603 | Ga0207667_10023375 | 3300025949 | Bacteria | 6806 |
| 604 | Ga0207667_10069264 | 3300025949 | Bacteria | 3672 |
| 605 | Ga0207667_10089651 | 3300025949 | Bacteria | 3178 |
| 606 | Ga0207667_10099195 | 3300025949 | Bacteria | 3005 |
| 607 | Ga0207667_11037087 | 3300025949 | Bacteria | 806 |
| 608 | Ga0207651_10054087 | 3300025960 | Bacteria | 2748 |
| 609 | Ga0207651_10202142 | 3300025960 | Bacteria | 1593 |
| 610 | Ga0207651_10821212 | 3300025960 | Bacteria | 825 |
| 611 | Ga0207651_11699774 | 3300025960 | Bacteria | 568 |
| 612 | Ga0207712_10371524 | 3300025961 | Bacteria | 1194 |
| 613 | Ga0207668_10002142 | 3300025972 | Bacteria | 11514 |
| 614 | Ga0207640_10001700 | 3300025981 | Bacteria | 11794 |
| 615 | Ga0207640_10003799 | 3300025981 | Bacteria | 8136 |
| 616 | Ga0207640_10199819 | 3300025981 | Bacteria | 1514 |
| 617 | Ga0207640_10563281 | 3300025981 | Bacteria | 959 |
| 618 | Ga0207640_10604769 | 3300025981 | Bacteria | 928 |
| 619 | Ga0207640_11238473 | 3300025981 | Bacteria | 664 |
| 620 | Ga0207658_10328117 | 3300025986 | Bacteria | 1327 |
| 621 | Ga0207677_10248711 | 3300026023 | Bacteria | 1443 |
| 622 | Ga0207677_10797751 | 3300026023 | Bacteria | 845 |
| 623 | Ga0207703_10056564 | 3300026035 | Bacteria | 3195 |
| 624 | Ga0207703_10933453 | 3300026035 | Bacteria | 831 |
| 625 | Ga0207703_11775666 | 3300026035 | Bacteria | 593 |
| 626 | Ga0207639_10002481 | 3300026041 | Bacteria | 12369 |
| 627 | Ga0207639_10584733 | 3300026041 | Bacteria | 1028 |
| 628 | Ga0207639_11516399 | 3300026041 | Bacteria | 629 |
| 629 | Ga0207678_10345183 | 3300026067 | Bacteria | 1283 |
| 630 | Ga0207678_10735832 | 3300026067 | Bacteria | 869 |
| 631 | Ga0207678_10765255 | 3300026067 | Bacteria | 852 |
| 632 | Ga0207678_11004132 | 3300026067 | Bacteria | 738 |
| 633 | Ga0207708_10048258 | 3300026075 | Bacteria | 3241 |
| 634 | Ga0207708_10506386 | 3300026075 | Bacteria | 1013 |
| 635 | Ga0207708_10886013 | 3300026075 | Bacteria | 772 |
| 636 | Ga0207702_10004145 | 3300026078 | Bacteria | 12990 |
| 637 | Ga0207702_10024167 | 3300026078 | Bacteria | 5041 |
| 638 | Ga0207702_10080281 | 3300026078 | Bacteria | 2829 |
| 639 | Ga0207702_10261634 | 3300026078 | Bacteria | 1629 |
| 640 | Ga0207702_10312752 | 3300026078 | Bacteria | 1494 |
| 641 | Ga0207641_10051766 | 3300026088 | Bacteria | 3477 |
| 642 | Ga0207641_11260911 | 3300026088 | Bacteria | 739 |
| 643 | Ga0207641_11343247 | 3300026088 | Bacteria | 716 |
| 644 | Ga0207641_12371002 | 3300026088 | Unclassified | 530 |
| 645 | Ga0207648_10060535 | 3300026089 | Bacteria | 3302 |
| 646 | Ga0207648_10111593 | 3300026089 | Bacteria | 2401 |
| 647 | Ga0207648_11813793 | 3300026089 | Bacteria | 572 |
| 648 | Ga0207648_12271143 | 3300026089 | Bacteria | 503 |
| 649 | Ga0207676_10002529 | 3300026095 | Bacteria | 13044 |
| 650 | Ga0207676_11819921 | 3300026095 | Bacteria | 608 |
| 651 | Ga0207674_10011504 | 3300026116 | Bacteria | 9939 |
| 652 | Ga0207674_10246743 | 3300026116 | Bacteria | 1733 |
| 653 | Ga0207674_10254630 | 3300026116 | Bacteria | 1702 |
| 654 | Ga0207674_10394180 | 3300026116 | Bacteria | 1338 |
| 655 | Ga0207674_10539147 | 3300026116 | Bacteria | 1127 |
| 656 | Ga0207674_10910208 | 3300026116 | Bacteria | 848 |
| 657 | Ga0207674_10950995 | 3300026116 | Bacteria | 828 |
| 658 | Ga0207675_100023624 | 3300026118 | Bacteria | 5719 |
| 659 | Ga0207675_100781314 | 3300026118 | Bacteria | 967 |
| 660 | Ga0207683_10031461 | 3300026121 | Bacteria | 4605 |
| 661 | Ga0207683_10130226 | 3300026121 | Bacteria | 2262 |
| 662 | Ga0207683_10676712 | 3300026121 | Bacteria | 956 |
| 663 | Ga0207683_11561305 | 3300026121 | Bacteria | 609 |
| 664 | Ga0207698_10000983 | 3300026142 | Bacteria | 16579 |
| 665 | Ga0207698_10024975 | 3300026142 | Bacteria | 4201 |
| 666 | Ga0207698_10046809 | 3300026142 | Bacteria | 3270 |
| 667 | Ga0207698_10065798 | 3300026142 | Bacteria | 2849 |
| 668 | Ga0207698_10074460 | 3300026142 | Bacteria | 2709 |
| 669 | Ga0207698_10785599 | 3300026142 | Bacteria | 953 |
| 670 | Ga0207698_10862961 | 3300026142 | Bacteria | 911 |
| 671 | Ga0209973_1028199 | 3300027252 | Bacteria | 780 |
| 672 | Ga0209969_1004771 | 3300027360 | Bacteria | 1896 |
| 673 | Ga0209967_1009251 | 3300027364 | Bacteria | 1365 |
| 674 | Ga0209981_1001337 | 3300027378 | Bacteria | 3118 |
| 675 | Ga0209981_1065415 | 3300027378 | Bacteria | 559 |
| 676 | Ga0209995_1030700 | 3300027471 | Bacteria | 899 |
| 677 | Ga0209995_1033043 | 3300027471 | Bacteria | 869 |
| 678 | Ga0209179_1033853 | 3300027512 | Bacteria | 1058 |
| 679 | Ga0209999_1000092 | 3300027543 | Bacteria | 10795 |
| 680 | Ga0209982_1002643 | 3300027552 | Bacteria | 2520 |
| 681 | Ga0209970_1025601 | 3300027614 | Bacteria | 1011 |
| 682 | Ga0210002_1011194 | 3300027617 | Bacteria | 1385 |
| 683 | Ga0209983_1000216 | 3300027665 | Bacteria | 11518 |
| 684 | Ga0209588_1131804 | 3300027671 | Bacteria | 797 |
| 685 | Ga0209971_1000244 | 3300027682 | Bacteria | 15445 |
| 686 | Ga0209971_1047827 | 3300027682 | Bacteria | 1032 |
| 687 | Ga0209998_10163167 | 3300027717 | Bacteria | 576 |
| 688 | Ga0209813_10200175 | 3300027866 | Bacteria | 739 |
| 689 | Ga0209974_10003853 | 3300027876 | Bacteria | 5375 |
| 690 | Ga0207428_10015261 | 3300027907 | Bacteria | 6649 |
| 691 | Ga0207428_10025945 | 3300027907 | Bacteria | 4896 |
| 692 | Ga0207428_10066622 | 3300027907 | Bacteria | 2837 |
| 693 | Ga0207428_10106399 | 3300027907 | Bacteria | 2163 |
| 694 | Ga0207428_10429416 | 3300027907 | Bacteria | 965 |
| 695 | Ga0268266_10014847 | 3300028379 | Bacteria | 6690 |
| 696 | Ga0268266_10036486 | 3300028379 | Bacteria | 4184 |
| 697 | Ga0268266_10114151 | 3300028379 | Bacteria | 2396 |
| 698 | Ga0268266_10117808 | 3300028379 | Bacteria | 2360 |
| 699 | Ga0268266_10231290 | 3300028379 | Bacteria | 1703 |
| 700 | Ga0268266_12157187 | 3300028379 | Bacteria | 529 |
| 701 | Ga0268265_10004900 | 3300028380 | Bacteria | 9212 |
| 702 | Ga0268265_10042806 | 3300028380 | Bacteria | 3362 |
| 703 | Ga0268265_10081454 | 3300028380 | Bacteria | 2556 |
| 704 | Ga0268265_10204269 | 3300028380 | Bacteria | 1716 |
| 705 | Ga0268265_10975401 | 3300028380 | Bacteria | 836 |
| 706 | Ga0268264_10014907 | 3300028381 | Bacteria | 6385 |
| 707 | Ga0268264_10466261 | 3300028381 | Bacteria | 1226 |
| 708 | Ga0268264_11125356 | 3300028381 | Bacteria | 794 |
| 709 | Ga0265334_10000009 | 3300028573 | Bacteria | 194312 |
| 710 | Ga0265334_10016689 | 3300028573 | Bacteria | 3036 |
| 711 | Ga0265334_10019278 | 3300028573 | Bacteria | 2808 |
| 712 | Ga0265338_10030752 | 3300028800 | Bacteria | 5279 |
| 713 | Ga0265338_10061743 | 3300028800 | Bacteria | 3283 |
| 714 | Ga0265338_10849248 | 3300028800 | Bacteria | 624 |
| 715 | Ga0265324_10309304 | 3300029957 | Bacteria | 538 |
| 716 | Ga0316177_1078971 | 3300030731 | Bacteria | 1698 |
| 717 | Ga0316176_1126462 | 3300030732 | Bacteria | 1714 |
| 718 | Ga0314311_1072280 | 3300030733 | Bacteria | 2532 |
| 719 | Ga0316178_1037950 | 3300030735 | Bacteria | 1847 |
| 720 | Ga0265332_10040268 | 3300031238 | Bacteria | 2023 |
| 721 | Ga0265325_10146906 | 3300031241 | Bacteria | 1118 |
| 722 | Ga0265340_10194160 | 3300031247 | Bacteria | 915 |
| 723 | Ga0265327_10089220 | 3300031251 | Bacteria | 1506 |
| 724 | Ga0265316_10268047 | 3300031344 | Bacteria | 1250 |
| 725 | Ga0307408_100104606 | 3300031548 | Bacteria | 2163 |
| 726 | Ga0307408_100132187 | 3300031548 | Bacteria | 1948 |
| 727 | Ga0307408_100219023 | 3300031548 | Bacteria | 1552 |
| 728 | Ga0307408_100226482 | 3300031548 | Bacteria | 1528 |
| 729 | Ga0307408_102445464 | 3300031548 | Bacteria | 507 |
| 730 | Ga0265313_10000628 | 3300031595 | Bacteria | 36547 |
| 731 | Ga0307508_10893633 | 3300031616 | Bacteria | 514 |
| 732 | Ga0316575_10012371 | 3300031665 | Bacteria | 3174 |
| 733 | Ga0316575_10054891 | 3300031665 | Bacteria | 1586 |
| 734 | Ga0316575_10191231 | 3300031665 | Bacteria | 851 |
| 735 | Ga0316579_10001255 | 3300031691 | Bacteria | 9121 |
| 736 | Ga0316579_10321743 | 3300031691 | Bacteria | 748 |
| 737 | Ga0316579_10344646 | 3300031691 | Bacteria | 720 |
| 738 | Ga0316579_10479688 | 3300031691 | Bacteria | 602 |
| 739 | Ga0316579_10637711 | 3300031691 | Bacteria | 516 |
| 740 | Ga0265314_10009334 | 3300031711 | Bacteria | 8301 |
| 741 | Ga0265342_10426261 | 3300031712 | Bacteria | 683 |
| 742 | Ga0316576_10002711 | 3300031727 | Bacteria | 10129 |
| 743 | Ga0316576_10004680 | 3300031727 | Bacteria | 8250 |
| 744 | Ga0316576_10005793 | 3300031727 | Bacteria | 7613 |
| 745 | Ga0316576_10006718 | 3300031727 | Bacteria | 7189 |
| 746 | Ga0316576_10010662 | 3300031727 | Bacteria | 5985 |
| 747 | Ga0316576_10045306 | 3300031727 | Bacteria | 3180 |
| 748 | Ga0316576_10182926 | 3300031727 | Bacteria | 1581 |
| 749 | Ga0316576_10273020 | 3300031727 | Bacteria | 1267 |
| 750 | Ga0316576_10638126 | 3300031727 | Bacteria | 775 |
| 751 | Ga0316576_10676212 | 3300031727 | Bacteria | 749 |
| 752 | Ga0316578_10000469 | 3300031728 | Bacteria | 13481 |
| 753 | Ga0316578_10028616 | 3300031728 | Bacteria | 3157 |
| 754 | Ga0316578_10130955 | 3300031728 | Bacteria | 1509 |
| 755 | Ga0316578_10316434 | 3300031728 | Bacteria | 932 |
| 756 | Ga0307405_10031842 | 3300031731 | Bacteria | 3109 |
| 757 | Ga0307405_10537175 | 3300031731 | Bacteria | 944 |
| 758 | Ga0307405_10734265 | 3300031731 | Bacteria | 821 |
| 759 | Ga0316577_10001512 | 3300031733 | Bacteria | 11029 |
| 760 | Ga0316577_10003045 | 3300031733 | Bacteria | 8413 |
| 761 | Ga0316577_10050851 | 3300031733 | Bacteria | 2313 |
| 762 | Ga0316577_10074888 | 3300031733 | Bacteria | 1890 |
| 763 | Ga0316577_10122706 | 3300031733 | Bacteria | 1460 |
| 764 | Ga0316577_10681857 | 3300031733 | Bacteria | 584 |
| 765 | Ga0307413_10068873 | 3300031824 | Bacteria | 2218 |
| 766 | Ga0307413_10153351 | 3300031824 | Bacteria | 1608 |
| 767 | Ga0307413_10270337 | 3300031824 | Bacteria | 1272 |
| 768 | Ga0307413_10600199 | 3300031824 | Bacteria | 901 |
| 769 | Ga0307413_10673757 | 3300031824 | Bacteria | 856 |
| 770 | Ga0307413_11031278 | 3300031824 | Bacteria | 707 |
| 771 | Ga0307413_11101118 | 3300031824 | Bacteria | 686 |
| 772 | Ga0307413_11303718 | 3300031824 | Bacteria | 635 |
| 773 | Ga0307413_11729384 | 3300031824 | Bacteria | 558 |
| 774 | Ga0307410_10049850 | 3300031852 | Bacteria | 2812 |
| 775 | Ga0307410_10441579 | 3300031852 | Bacteria | 1060 |
| 776 | Ga0307406_10740795 | 3300031901 | Bacteria | 824 |
| 777 | Ga0307406_10786424 | 3300031901 | Bacteria | 802 |
| 778 | Ga0307406_12134608 | 3300031901 | Bacteria | 502 |
| 779 | Ga0307407_10415974 | 3300031903 | Bacteria | 968 |
| 780 | Ga0307407_10472106 | 3300031903 | Bacteria | 914 |
| 781 | Ga0307407_10892395 | 3300031903 | Bacteria | 682 |
| 782 | Ga0307412_10113674 | 3300031911 | Bacteria | 1937 |
| 783 | Ga0307412_10319141 | 3300031911 | Bacteria | 1235 |
| 784 | Ga0307412_10640871 | 3300031911 | Bacteria | 905 |
| 785 | Ga0307412_11118825 | 3300031911 | Bacteria | 702 |
| 786 | Ga0307412_12314694 | 3300031911 | Bacteria | 501 |
| 787 | Ga0307409_100260956 | 3300031995 | Bacteria | 1590 |
| 788 | Ga0307409_100426573 | 3300031995 | Bacteria | 1273 |
| 789 | Ga0307409_100486245 | 3300031995 | Bacteria | 1199 |
| 790 | Ga0307416_100098925 | 3300032002 | Bacteria | 2531 |
| 791 | Ga0307416_100154839 | 3300032002 | Bacteria | 2108 |
| 792 | Ga0307416_100170274 | 3300032002 | Bacteria | 2026 |
| 793 | Ga0307416_100439317 | 3300032002 | Bacteria | 1354 |
| 794 | Ga0307416_101965261 | 3300032002 | Bacteria | 688 |
| 795 | Ga0307416_102365520 | 3300032002 | Bacteria | 631 |
| 796 | Ga0307414_10190887 | 3300032004 | Bacteria | 1657 |
| 797 | Ga0307414_10397133 | 3300032004 | Bacteria | 1196 |
| 798 | Ga0307414_10941640 | 3300032004 | Bacteria | 793 |
| 799 | Ga0307414_11687408 | 3300032004 | Bacteria | 591 |
| 800 | Ga0307411_10095506 | 3300032005 | Bacteria | 2087 |
| 801 | Ga0307411_10366906 | 3300032005 | Bacteria | 1179 |
| 802 | Ga0307411_10638037 | 3300032005 | Bacteria | 920 |
| 803 | Ga0307411_10939846 | 3300032005 | Bacteria | 770 |
| 804 | Ga0307415_100005213 | 3300032126 | Bacteria | 6870 |
| 805 | Ga0307415_100448318 | 3300032126 | Bacteria | 1115 |
| 806 | Ga0307415_100635529 | 3300032126 | Bacteria | 955 |
| 807 | Ga0307415_100968319 | 3300032126 | Bacteria | 789 |
| 808 | Ga0307415_101398084 | 3300032126 | Bacteria | 666 |
| 809 | Ga0307415_102402672 | 3300032126 | Bacteria | 518 |
| 810 | Ga0316583_10004293 | 3300032133 | Bacteria | 5082 |
| 811 | Ga0316583_10032173 | 3300032133 | Bacteria | 1865 |
| 812 | Ga0316583_10059532 | 3300032133 | Bacteria | 1340 |
| 813 | Ga0316585_10000686 | 3300032137 | Bacteria | 8446 |
| 814 | Ga0316585_10106233 | 3300032137 | Bacteria | 922 |
| 815 | Ga0316580_10000381 | 3300032139 | Bacteria | 9989 |
| 816 | Ga0316580_10005234 | 3300032139 | Bacteria | 3779 |
| 817 | Ga0316580_10059784 | 3300032139 | Bacteria | 1170 |
| 818 | Ga0316580_10217561 | 3300032139 | Bacteria | 589 |
| 819 | Ga0316593_10000769 | 3300032168 | Bacteria | 6356 |
| 820 | Ga0316593_10350026 | 3300032168 | Bacteria | 565 |
| 821 | Ga0316586_1022360 | 3300033527 | Bacteria | 1050 |
| 822 | Ga0316596_1000111 | 3300033541 | Bacteria | 10492 |
| 823 | Ga0373950_0129735 | 3300034818 | Bacteria | 564 |
| 824 | Ga0373938_0234578 | 3300034957 | Bacteria | 520 |
| 825 | Ga0373929_0023849 | 3300035085 | Bacteria | 1260 |
| 826 | Ga0373949_0083144 | 3300035090 | Bacteria | 856 |
| 827 | Ga0373951_0134154 | 3300035091 | Bacteria | 683 |
| 828 | Ga0373939_0389905 | 3300035114 | Bacteria | 575 |
| 829 | Ga0373941_0204504 | 3300035115 | Bacteria | 752 |
| 830 | Ga0373945_0077177 | 3300035116 | Bacteria | 1271 |
| 831 | Ga0373954_0383164 | 3300035118 | Bacteria | 695 |
| 832 | Ga0373954_0636757 | 3300035118 | Bacteria | 529 |
| 833 | Ga0373956_0232577 | 3300035119 | Bacteria | 876 |
| 834 | Ga0373946_0316423 | 3300035171 | Bacteria | 775 |
| 835 | Ga0373946_0596934 | 3300035171 | Bacteria | 572 |
| 836 | Ga0373942_0265705 | 3300035207 | Bacteria | 587 |
| 837 | Ga0373962_0158564 | 3300035242 | Bacteria | 745 |
| 838 | Ga0316574_0000505 | 3300035398 | Bacteria | 15853 |
| 839 | Ga0316574_0002851 | 3300035398 | Bacteria | 8777 |
| 840 | Ga0316574_0005191 | 3300035398 | Bacteria | 6930 |
| 841 | Ga0316574_0009989 | 3300035398 | Bacteria | 5340 |
| 842 | Ga0316574_0023955 | 3300035398 | Bacteria | 3649 |
| 843 | Ga0316574_0032827 | 3300035398 | Bacteria | 3157 |
| 844 | Ga0316574_0056770 | 3300035398 | Bacteria | 2450 |
| 845 | Ga0316574_0088612 | 3300035398 | Bacteria | 1971 |
| 846 | Ga0316574_0173345 | 3300035398 | Bacteria | 1388 |
| 847 | Ga0316574_0270473 | 3300035398 | Bacteria | 1084 |
| 848 | Ga0316574_0307403 | 3300035398 | Bacteria | 1008 |
| 849 | Ga0316574_0350827 | 3300035398 | Bacteria | 933 |
| 850 | Ga0316574_0435023 | 3300035398 | Bacteria | 823 |
| 851 | Ga0373931_0058100 | 3300035691 | Bacteria | 2077 |
| 852 | Ga0373931_0961773 | 3300035691 | Bacteria | 576 |
| 853 | Ga0373935_0167268 | 3300035692 | Bacteria | 1502 |
| 854 | Ga0373935_0731206 | 3300035692 | Bacteria | 729 |
| 855 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 856 | Ga0373933_0336330 | 3300035724 | Bacteria | 980 |
| 857 | Ga0373933_1172007 | 3300035724 | Bacteria | 506 |
| 858 | Ga0373947_0109656 | 3300035725 | Bacteria | 1743 |
| 859 | Ga0373947_0497026 | 3300035725 | Bacteria | 829 |
| 860 | Ga0373937_0376784 | 3300036401 | Bacteria | 1346 |
| 861 | Ga0373937_1404323 | 3300036401 | Bacteria | 646 |
| 862 | Ga0316582_0001472 | 3300036647 | Bacteria | 10369 |
| 863 | Ga0316582_0024839 | 3300036647 | Bacteria | 3591 |
| 864 | Ga0316582_1094741 | 3300036647 | Bacteria | 543 |
| 865 | Ga0316584_0004416 | 3300036712 | Bacteria | 9310 |
| 866 | Ga0316584_0005187 | 3300036712 | Bacteria | 8712 |
| 867 | Ga0316584_0223352 | 3300036712 | Bacteria | 1383 |
| 868 | Ga0316584_0270727 | 3300036712 | Bacteria | 1236 |
| 869 | Ga0316584_0415858 | 3300036712 | Bacteria | 956 |
| 870 | Ga0316584_0991486 | 3300036712 | Bacteria | 561 |
| 871 | Ga0373925_0050662 | 3300037068 | Bacteria | 3098 |
| 872 | Ga0373925_0206781 | 3300037068 | Bacteria | 1563 |
| 873 | Ga0395899_0003047 | 3300037312 | Bacteria | 13379 |
| 874 | Ga0395899_0040867 | 3300037312 | Bacteria | 3467 |
| 875 | Ga0395899_0084866 | 3300037312 | Bacteria | 2301 |
| 876 | Ga0395899_0235618 | 3300037312 | Bacteria | 1262 |
| 877 | Ga0395900_0002026 | 3300037418 | Bacteria | 22791 |
| 878 | Ga0395900_0002792 | 3300037418 | Bacteria | 19093 |
| 879 | Ga0395900_0036061 | 3300037418 | Bacteria | 5096 |
| 880 | Ga0395900_0039505 | 3300037418 | Bacteria | 4862 |
| 881 | Ga0395900_0100964 | 3300037418 | Bacteria | 2963 |
| 882 | Ga0395900_0162599 | 3300037418 | Bacteria | 2276 |
| 883 | Ga0395900_0197353 | 3300037418 | Bacteria | 2038 |
| 884 | Ga0395900_0240748 | 3300037418 | Bacteria | 1815 |
| 885 | Ga0395900_0836808 | 3300037418 | Bacteria | 846 |
| 886 | Ga0395898_0009118 | 3300037466 | Bacteria | 10449 |
| 887 | Ga0395898_0025582 | 3300037466 | Bacteria | 5945 |
| 888 | Ga0395898_0034635 | 3300037466 | Bacteria | 5029 |
| 889 | Ga0395898_0487202 | 3300037466 | Bacteria | 1173 |
| 890 | Ga0395898_1294729 | 3300037466 | Bacteria | 658 |
| 891 | Ga0395898_1781138 | 3300037466 | Bacteria | 537 |
| 892 | Ga0395905_1005578 | 3300037471 | Bacteria | 737 |
| 893 | Ga0395905_1195406 | 3300037471 | Bacteria | 664 |
| 894 | Ga0395901_0003592 | 3300038443 | Bacteria | 15640 |
| 895 | Ga0395901_0009897 | 3300038443 | Bacteria | 9665 |
| 896 | Ga0395901_0012227 | 3300038443 | Bacteria | 8711 |
| 897 | Ga0395901_0024914 | 3300038443 | Bacteria | 6142 |
| 898 | Ga0395901_0063211 | 3300038443 | Bacteria | 3852 |
| 899 | Ga0395901_0743314 | 3300038443 | Bacteria | 975 |
| 900 | Ga0400490_07618 | 3300038726 | Bacteria | 12059 |
| 901 | Ga0400486_18067 | 3300038742 | Bacteria | 1959 |
| 902 | Ga0400483_036792 | 3300039062 | Bacteria | 4834 |
| 903 | Ga0400483_038990 | 3300039062 | Bacteria | 1289 |
| 904 | Ga0400483_180247 | 3300039062 | Bacteria | 5981 |
| 905 | Ga0400483_181669 | 3300039062 | Bacteria | 2055 |
| 906 | Ga0400489_53512 | 3300039093 | Bacteria | 1216 |
| 907 | Ga0400487_66249 | 3300039110 | Bacteria | 1256 |
| 908 | Ga0436365_0012766 | 3300039437 | Bacteria | 2011 |
| 909 | Ga0436360_0253706 | 3300039438 | Bacteria | 14356 |
| 910 | Ga0436360_0457170 | 3300039438 | Bacteria | 592 |
| 911 | Ga0436361_0629730 | 3300039447 | Bacteria | 1530 |
| 912 | Ga0436361_1086284 | 3300039447 | Bacteria | 4680 |
| 913 | Ga0436363_0607560 | 3300039450 | Bacteria | 1313 |
| 914 | Ga0436362_0195822 | 3300039453 | Bacteria | 1506 |
| 915 | Ga0439439_0007650 | 3300041406 | Bacteria | 2532 |
| 916 | Ga0439439_0102742 | 3300041406 | Bacteria | 788 |
| 917 | Ga0439465_0385051 | 3300041413 | Bacteria | 532 |
| 918 | Ga0451791_1427860 | 3300041451 | Bacteria | 1278 |
| 919 | Ga0451793_1589387 | 3300041452 | Bacteria | 691 |
| 920 | Ga0451797_1211170 | 3300041453 | Bacteria | 718 |
| 921 | Ga0451797_1365695 | 3300041453 | Bacteria | 1089 |
| 922 | Ga0451795_1294879 | 3300041456 | Bacteria | 711 |
| 923 | Ga0451800_0097612 | 3300041459 | Bacteria | 565 |
| 924 | Ga0451807_0346592 | 3300041486 | Bacteria | 2174 |
| 925 | Ga0451807_0622679 | 3300041486 | Bacteria | 907 |
| 926 | Ga0451837_0436478 | 3300041494 | Bacteria | 833 |
| 927 | Ga0451837_1077267 | 3300041494 | Bacteria | 865 |
| 928 | Ga0451841_0576354 | 3300041498 | Bacteria | 667 |
| 929 | Ga0451845_0691868 | 3300041501 | Bacteria | 1049 |
| 930 | Ga0451849_0458457 | 3300041505 | Bacteria | 998 |
| 931 | Ga0451853_0558631 | 3300041512 | Bacteria | 776 |
| 932 | Ga0439437_062255 | 3300042000 | Bacteria | 508 |
| 933 | Ga0439441_001948 | 3300042001 | Bacteria | 2833 |
| 934 | Ga0439443_013863 | 3300042003 | Bacteria | 1209 |
| 935 | Ga0439445_0118935 | 3300042004 | Bacteria | 758 |
| 936 | Ga0439448_0149770 | 3300042005 | Bacteria | 809 |
| 937 | Ga0439449_0013715 | 3300042007 | Bacteria | 3050 |
| 938 | Ga0439456_137969 | 3300042013 | Bacteria | 565 |
| 939 | Ga0439457_075826 | 3300042014 | Bacteria | 770 |
| 940 | Ga0450896_002550 | 3300042133 | Bacteria | 2362 |
| 941 | Ga0439446_0007690 | 3300042156 | Bacteria | 2841 |
| 942 | Ga0439446_0012350 | 3300042156 | Bacteria | 2332 |
| 943 | Ga0439435_0000245 | 3300042436 | Bacteria | 7822 |
| 944 | Ga0439444_0000819 | 3300042437 | Bacteria | 3750 |
| 945 | Ga0439459_0049242 | 3300042438 | Bacteria | 920 |
| 946 | Ga0439459_0079456 | 3300042438 | Bacteria | 772 |
| 947 | Ga0439459_0124276 | 3300042438 | Bacteria | 654 |
| 948 | Ga0439464_0060669 | 3300042439 | Bacteria | 1107 |
| 949 | Ga0439464_0179268 | 3300042439 | Bacteria | 670 |
| 950 | Ga0439464_0321557 | 3300042439 | Bacteria | 508 |
| 951 | Ga0439460_0038163 | 3300042461 | Bacteria | 1400 |
| 952 | Ga0450893_0040196 | 3300042532 | Bacteria | 855 |
| 953 | Ga0451577_0608168 | 3300042876 | Bacteria | 992 |
| 954 | Ga0439440_0078827 | 3300042993 | Bacteria | 868 |
| 955 | Ga0453683_0000032 | 3300044673 | Bacteria | 241702 |
| 956 | Ga0453683_0009223 | 3300044673 | Bacteria | 6590 |
| 957 | Ga0453683_0017770 | 3300044673 | Bacteria | 4574 |
| 958 | Ga0453683_0020317 | 3300044673 | Bacteria | 4245 |
| 959 | Ga0453683_0066690 | 3300044673 | Bacteria | 2249 |
| 960 | Ga0453683_0136124 | 3300044673 | Bacteria | 1549 |
| 961 | Ga0453683_0148416 | 3300044673 | Bacteria | 1481 |
| 962 | Ga0453683_0308039 | 3300044673 | Bacteria | 1014 |
| 963 | Ga0453684_0001733 | 3300044712 | Bacteria | 58391 |
| 964 | Ga0453684_0085624 | 3300044712 | Bacteria | 3914 |
| 965 | Ga0453684_0146325 | 3300044712 | Bacteria | 2814 |
| 966 | Ga0453684_0253350 | 3300044712 | Bacteria | 2020 |
| 967 | Ga0453684_0292369 | 3300044712 | Unclassified | 1855 |
| 968 | Ga0453684_0422354 | 3300044712 | Bacteria | 1489 |
| 969 | Ga0453684_0700262 | 3300044712 | Bacteria | 1101 |
| 970 | Ga0451576_0004794 | 3300045051 | Bacteria | 17336 |
| 971 | Ga0451576_0008374 | 3300045051 | Bacteria | 12143 |
| 972 | Ga0451576_0061299 | 3300045051 | Bacteria | 3923 |
| 973 | Ga0451576_0097813 | 3300045051 | Bacteria | 3052 |
| 974 | Ga0451576_0152648 | 3300045051 | Bacteria | 2409 |
| 975 | Ga0451576_0265047 | 3300045051 | Bacteria | 1796 |
| 976 | Ga0451576_0638834 | 3300045051 | Bacteria | 1118 |
| 977 | Ga0451576_0954320 | 3300045051 | Bacteria | 899 |
| 978 | Ga0451576_1551875 | 3300045051 | Unclassified | 687 |
| 979 | Ga0466967_0289914 | 3300045976 | Bacteria | 1572 |
| 980 | Ga0466967_1302879 | 3300045976 | Bacteria | 723 |
| 981 | Ga0495651_1001983 | 3300046462 | Bacteria | 507 |
| 982 | Ga0495664_0443934 | 3300046477 | Bacteria | 777 |
| 983 | Ga0495584_0688684 | 3300046491 | Bacteria | 521 |
| 984 | Ga0495583_0182942 | 3300046506 | Bacteria | 857 |
| 985 | Ga0495628_1029490 | 3300046516 | Bacteria | 565 |
| 986 | Ga0495630_1077588 | 3300046517 | Bacteria | 609 |
| 987 | Ga0495630_1162612 | 3300046517 | Bacteria | 584 |
| 988 | Ga0495652_0536179 | 3300046529 | Bacteria | 807 |
| 989 | Ga0495621_0409546 | 3300046539 | Bacteria | 576 |
| 990 | Ga0495622_0381757 | 3300046557 | Bacteria | 608 |
| 991 | Ga0495667_0918921 | 3300046559 | Bacteria | 536 |
| 992 | Ga0495625_0484352 | 3300046660 | Bacteria | 759 |
| 993 | Ga0495625_0768660 | 3300046660 | Bacteria | 563 |
| 994 | Ga0495599_0836478 | 3300046678 | Bacteria | 524 |
| 995 | Ga0495647_0058416 | 3300046681 | Bacteria | 1516 |
| 996 | Ga0495669_0225438 | 3300046684 | Bacteria | 899 |
| 997 | Ga0495604_0627271 | 3300047317 | Bacteria | 687 |
| 998 | Ga0495604_0869084 | 3300047317 | Bacteria | 565 |
| 999 | Ga0495674_0849802 | 3300047319 | Bacteria | 707 |
| 1000 | Ga0495672_0108070 | 3300047320 | Bacteria | 1497 |
| 1001 | Ga0495672_0310688 | 3300047320 | Bacteria | 743 |
| 1002 | Ga0495680_0761927 | 3300047322 | Bacteria | 635 |
| 1003 | Ga0496100_0421868 | 3300048903 | Bacteria | 1019 |
| 1004 | Ga0496102_0425706 | 3300048905 | Bacteria | 1247 |
| 1005 | Ga0496105_1358588 | 3300048908 | Bacteria | 516 |
| 1006 | Ga0496106_0609077 | 3300048909 | Bacteria | 874 |
| 1007 | Ga0496108_0762198 | 3300048911 | Bacteria | 837 |
| 1008 | Ga0496109_0702894 | 3300048912 | Bacteria | 948 |
| 1009 | Ga0496109_1387016 | 3300048912 | Bacteria | 638 |
| 1010 | Ga0496110_0132646 | 3300048913 | Bacteria | 2250 |
| 1011 | Ga0496111_0982424 | 3300048914 | Bacteria | 605 |
| 1012 | Ga0496112_0064201 | 3300048915 | Bacteria | 3623 |
| 1013 | Ga0496112_1005348 | 3300048915 | Bacteria | 754 |
| 1014 | Ga0496113_0212463 | 3300048916 | Bacteria | 1540 |
| 1015 | Ga0496125_0147615 | 3300048928 | Bacteria | 1622 |
| 1016 | Ga0496126_0060378 | 3300048929 | Bacteria | 3410 |
| 1017 | Ga0495682_0189225 | 3300049460 | Bacteria | 731 |
| 1018 | Ga0495682_0375173 | 3300049460 | Bacteria | 501 |
| 1019 | Ga0501031_0002792 | 3300049568 | Bacteria | 11140 |
| 1020 | Ga0501031_0163074 | 3300049568 | Bacteria | 1457 |
| 1021 | Ga0501032_0216506 | 3300049569 | Bacteria | 1247 |
| 1022 | Ga0501032_0253784 | 3300049569 | Bacteria | 1141 |
| 1023 | Ga0501033_0000085 | 3300049570 | Bacteria | 88350 |
| 1024 | Ga0501033_0090458 | 3300049570 | Bacteria | 2239 |
| 1025 | Ga0501033_0478985 | 3300049570 | Bacteria | 862 |
| 1026 | Ga0501034_0001212 | 3300049571 | Bacteria | 35390 |
| 1027 | Ga0501034_0034188 | 3300049571 | Bacteria | 5154 |
| 1028 | Ga0501034_0049580 | 3300049571 | Bacteria | 4236 |
| 1029 | Ga0501034_0817949 | 3300049571 | Bacteria | 823 |
| 1030 | Ga0501036_0188338 | 3300049572 | Bacteria | 1736 |
| 1031 | Ga0501036_0324031 | 3300049572 | Bacteria | 1287 |
| 1032 | Ga0501036_0928300 | 3300049572 | Bacteria | 714 |
| 1033 | Ga0501036_1672578 | 3300049572 | Bacteria | 513 |
| 1034 | Ga0501037_0015737 | 3300049573 | Bacteria | 5566 |
| 1035 | Ga0501037_0156366 | 3300049573 | Bacteria | 1627 |
| 1036 | Ga0501037_0269954 | 3300049573 | Bacteria | 1187 |
| 1037 | Ga0501038_0012467 | 3300049574 | Bacteria | 7767 |
| 1038 | Ga0501038_0017727 | 3300049574 | Bacteria | 6435 |
| 1039 | Ga0501038_0266568 | 3300049574 | Bacteria | 1352 |
| 1040 | Ga0501038_0490525 | 3300049574 | Bacteria | 940 |
| 1041 | Ga0501038_0612491 | 3300049574 | Bacteria | 823 |
| 1042 | Ga0501038_0880794 | 3300049574 | Bacteria | 662 |
| 1043 | Ga0501039_0011528 | 3300049575 | Bacteria | 6728 |
| 1044 | Ga0501039_1367532 | 3300049575 | Bacteria | 545 |
| 1045 | Ga0501041_0271626 | 3300049577 | Bacteria | 1066 |
| 1046 | Ga0501041_0332201 | 3300049577 | Bacteria | 959 |
| 1047 | Ga0501041_0532795 | 3300049577 | Bacteria | 748 |
| 1048 | Ga0501041_0743536 | 3300049577 | Bacteria | 628 |
| 1049 | Ga0501041_0971019 | 3300049577 | Bacteria | 546 |
| 1050 | Ga0501041_1018570 | 3300049577 | Bacteria | 533 |
| 1051 | Ga0501042_1341633 | 3300049578 | Bacteria | 522 |
| 1052 | Ga0501043_0013251 | 3300049579 | Bacteria | 6446 |
| 1053 | Ga0501043_0171257 | 3300049579 | Bacteria | 1694 |
| 1054 | Ga0501043_0188436 | 3300049579 | Bacteria | 1605 |
| 1055 | Ga0501046_0342532 | 3300049580 | Bacteria | 1086 |
| 1056 | Ga0501047_0072634 | 3300049581 | Bacteria | 3312 |
| 1057 | Ga0501047_0097067 | 3300049581 | Bacteria | 2825 |
| 1058 | Ga0501047_0177182 | 3300049581 | Bacteria | 1999 |
| 1059 | Ga0501048_0248023 | 3300049582 | Bacteria | 1264 |
| 1060 | Ga0501068_0033874 | 3300049584 | Bacteria | 3044 |
| 1061 | Ga0501068_0265977 | 3300049584 | Bacteria | 1094 |
| 1062 | Ga0501069_0078745 | 3300049585 | Bacteria | 1854 |
| 1063 | Ga0501069_0118933 | 3300049585 | Bacteria | 1508 |
| 1064 | Ga0501069_0202168 | 3300049585 | Bacteria | 1151 |
| 1065 | Ga0501069_0400882 | 3300049585 | Bacteria | 812 |
| 1066 | Ga0501070_0000205 | 3300049586 | Bacteria | 55714 |
| 1067 | Ga0501070_0010339 | 3300049586 | Bacteria | 7887 |
| 1068 | Ga0501070_0047310 | 3300049586 | Bacteria | 3575 |
| 1069 | Ga0501070_0047315 | 3300049586 | Bacteria | 3575 |
| 1070 | Ga0501070_0072567 | 3300049586 | Bacteria | 2849 |
| 1071 | Ga0501070_0079771 | 3300049586 | Bacteria | 2708 |
| 1072 | Ga0501070_0092877 | 3300049586 | Bacteria | 2497 |
| 1073 | Ga0501070_0284218 | 3300049586 | Bacteria | 1349 |
| 1074 | Ga0501070_0322926 | 3300049586 | Bacteria | 1255 |
| 1075 | Ga0501070_0614077 | 3300049586 | Bacteria | 866 |
| 1076 | Ga0501070_1005204 | 3300049586 | Bacteria | 647 |
| 1077 | Ga0501071_0094000 | 3300049587 | Bacteria | 2205 |
| 1078 | Ga0501071_0398382 | 3300049587 | Bacteria | 1051 |
| 1079 | Ga0501071_0736066 | 3300049587 | Bacteria | 760 |
| 1080 | Ga0501072_0328267 | 3300049588 | Bacteria | 1216 |
| 1081 | Ga0501072_0443767 | 3300049588 | Bacteria | 1028 |
| 1082 | Ga0501072_0520425 | 3300049588 | Bacteria | 940 |
| 1083 | Ga0501072_0737821 | 3300049588 | Bacteria | 773 |
| 1084 | Ga0501072_1105164 | 3300049588 | Bacteria | 617 |
| 1085 | Ga0501073_0012256 | 3300049589 | Bacteria | 6256 |
| 1086 | Ga0501073_0247457 | 3300049589 | Bacteria | 1231 |
| 1087 | Ga0501073_0474504 | 3300049589 | Bacteria | 865 |
| 1088 | Ga0501073_0760608 | 3300049589 | Bacteria | 668 |
| 1089 | Ga0501074_0008681 | 3300049590 | Bacteria | 7361 |
| 1090 | Ga0501074_0034570 | 3300049590 | Bacteria | 3663 |
| 1091 | Ga0501074_0538840 | 3300049590 | Bacteria | 826 |
| 1092 | Ga0501075_0027238 | 3300049591 | Bacteria | 4211 |
| 1093 | Ga0501075_0053690 | 3300049591 | Bacteria | 3031 |
| 1094 | Ga0501075_0242458 | 3300049591 | Bacteria | 1374 |
| 1095 | Ga0501075_0596398 | 3300049591 | Bacteria | 843 |
| 1096 | Ga0501076_0025159 | 3300049592 | Bacteria | 4605 |
| 1097 | Ga0501076_0813723 | 3300049592 | Bacteria | 771 |
| 1098 | Ga0501076_0996662 | 3300049592 | Bacteria | 690 |
| 1099 | Ga0501077_0158129 | 3300049593 | Bacteria | 1439 |
| 1100 | Ga0501077_0330153 | 3300049593 | Bacteria | 972 |
| 1101 | Ga0501211_015065 | 3300049658 | Bacteria | 778 |
| 1102 | Ga0501239_030106 | 3300049672 | Bacteria | 709 |
| 1103 | Ga0501249_160610 | 3300049679 | Bacteria | 571 |
| 1104 | Ga0501079_0026434 | 3300049741 | Bacteria | 4450 |
| 1105 | Ga0501079_0292252 | 3300049741 | Bacteria | 1274 |
| 1106 | Ga0501079_0651321 | 3300049741 | Bacteria | 829 |
| 1107 | Ga0501079_1075017 | 3300049741 | Bacteria | 634 |
| 1108 | Ga0501080_0012268 | 3300049742 | Bacteria | 7849 |
| 1109 | Ga0501080_0025763 | 3300049742 | Bacteria | 5462 |
| 1110 | Ga0501080_0092523 | 3300049742 | Bacteria | 2808 |
| 1111 | Ga0501080_0202291 | 3300049742 | Bacteria | 1823 |
| 1112 | Ga0501080_0869247 | 3300049742 | Bacteria | 787 |
| 1113 | Ga0501080_1466511 | 3300049742 | Bacteria | 581 |
| 1114 | Ga0501081_0028494 | 3300049743 | Bacteria | 3769 |
| 1115 | Ga0501081_0054930 | 3300049743 | Bacteria | 2752 |
| 1116 | Ga0501263_023819 | 3300049760 | Bacteria | 836 |
| 1117 | Ga0501035_0027119 | 3300049822 | Bacteria | 5237 |
| 1118 | Ga0501035_0078930 | 3300049822 | Bacteria | 2907 |
| 1119 | Ga0501035_0094461 | 3300049822 | Bacteria | 2629 |
| 1120 | Ga0501035_0206765 | 3300049822 | Bacteria | 1681 |
| 1121 | Ga0501035_0226715 | 3300049822 | Bacteria | 1594 |
| 1122 | Ga0501035_0258125 | 3300049822 | Bacteria | 1478 |
| 1123 | Ga0501044_0025207 | 3300049823 | Bacteria | 6305 |
| 1124 | Ga0501044_0101649 | 3300049823 | Bacteria | 2892 |
| 1125 | Ga0501044_0419094 | 3300049823 | Bacteria | 1249 |
| 1126 | Ga0501045_0000020 | 3300049824 | Bacteria | 68659 |
| 1127 | Ga0501045_0180250 | 3300049824 | Bacteria | 1574 |
| 1128 | Ga0501226_017026 | 3300049853 | Bacteria | 800 |
| 1129 | nmdc:mga03683_1042_c1 | 3300050489 | Bacteria | 6227 |
| 1130 | nmdc:mga03683_115128_c1 | 3300050489 | Bacteria | 1192 |
| 1131 | nmdc:mga03683_154203_c1 | 3300050489 | Bacteria | 1038 |
| 1132 | nmdc:mga03683_342106_c1 | 3300050489 | Bacteria | 707 |
| 1133 | nmdc:mga03683_49692_c1 | 3300050489 | Bacteria | 1747 |
| 1134 | nmdc:mga03683_98643_c1 | 3300050489 | Bacteria | 1282 |
| 1135 | nmdc:mga00v17_420774_c1 | 3300050491 | Bacteria | 868 |
| 1136 | nmdc:mga0yw44_159268_c1 | 3300050492 | Bacteria | 1477 |
| 1137 | nmdc:mga0yw44_179062_c1 | 3300050492 | Bacteria | 1395 |
| 1138 | nmdc:mga0yw44_225849_c1 | 3300050492 | Bacteria | 1242 |
| 1139 | nmdc:mga0yw44_609616_c1 | 3300050492 | Bacteria | 742 |
| 1140 | nmdc:mga0yw44_645585_c1 | 3300050492 | Bacteria | 719 |
| 1141 | nmdc:mga0k408_140414_c1 | 3300050493 | Bacteria | 1119 |
| 1142 | nmdc:mga0k408_302813_c1 | 3300050493 | Bacteria | 954 |
| 1143 | nmdc:mga06z11_104251_c1 | 3300050494 | Bacteria | 1561 |
| 1144 | nmdc:mga06z11_180098_c1 | 3300050494 | Bacteria | 1218 |
| 1145 | nmdc:mga06z11_251464_c1 | 3300050494 | Bacteria | 1041 |
| 1146 | nmdc:mga06z11_390740_c1 | 3300050494 | Bacteria | 837 |
| 1147 | nmdc:mga06z11_589833_c1 | 3300050494 | Bacteria | 676 |
| 1148 | nmdc:mga04h51_79426_c1 | 3300050495 | Bacteria | 1161 |
| 1149 | nmdc:mga07m45_56264_c2 | 3300050496 | Bacteria | 1853 |
| 1150 | nmdc:mga07m45_846538_c1 | 3300050496 | Bacteria | 524 |
| 1151 | nmdc:mga07m45_9131_c1 | 3300050496 | Bacteria | 4158 |
| 1152 | nmdc:mga05p37_2119605_c1 | 3300050507 | Bacteria | 526 |
| 1153 | nmdc:mga05p37_57894_c1 | 3300050507 | Bacteria | 4773 |
| 1154 | nmdc:mga05p37_642932_c1 | 3300050507 | Bacteria | 1189 |
| 1155 | nmdc:mga09592_1126591_c1 | 3300050508 | Bacteria | 651 |
| 1156 | nmdc:mga09592_117461_c1 | 3300050508 | Bacteria | 2283 |
| 1157 | nmdc:mga09592_1625_c1 | 3300050508 | Bacteria | 18092 |
| 1158 | nmdc:mga09592_828035_c1 | 3300050508 | Bacteria | 781 |
| 1159 | nmdc:mga0qj67_101746_c1 | 3300050509 | Bacteria | 2317 |
| 1160 | nmdc:mga0qj67_291240_c1 | 3300050509 | Bacteria | 1323 |
| 1161 | nmdc:mga0qj67_403095_c1 | 3300050509 | Bacteria | 1104 |
| 1162 | nmdc:mga06r32_1247364_c1 | 3300050510 | Bacteria | 689 |
| 1163 | nmdc:mga06r32_146441_c1 | 3300050510 | Bacteria | 2339 |
| 1164 | nmdc:mga06r32_354889_c1 | 3300050510 | Bacteria | 1451 |
| 1165 | nmdc:mga06r32_7529_c1 | 3300050510 | Bacteria | 9791 |
| 1166 | nmdc:mga08y16_281982_c1 | 3300050511 | Bacteria | 1714 |
| 1167 | nmdc:mga08y16_303578_c1 | 3300050511 | Bacteria | 1645 |
| 1168 | nmdc:mga08y16_346922_c1 | 3300050511 | Bacteria | 1526 |
| 1169 | nmdc:mga08y16_46278_c1 | 3300050511 | Bacteria | 4555 |
| 1170 | nmdc:mga08y16_511137_c1 | 3300050511 | Bacteria | 1219 |
| 1171 | nmdc:mga08y16_7763_c1 | 3300050511 | Bacteria | 11240 |
| 1172 | nmdc:mga0n895_659860_c1 | 3300050512 | Bacteria | 1044 |
| 1173 | nmdc:mga0n895_67879_c1 | 3300050512 | Bacteria | 3532 |
| 1174 | nmdc:mga0a205_13260_c1 | 3300050515 | Bacteria | 7664 |
| 1175 | nmdc:mga0a205_578032_c1 | 3300050515 | Bacteria | 977 |
| 1176 | nmdc:mga0a205_636955_c1 | 3300050515 | Bacteria | 918 |
| 1177 | nmdc:mga0sz30_102_c1 | 3300050516 | Bacteria | 31707 |
| 1178 | nmdc:mga0sz30_2362_c3 | 3300050516 | Bacteria | 4744 |
| 1179 | nmdc:mga0sz30_71838_c1 | 3300050516 | Bacteria | 1490 |
| 1180 | Ga0495601_0061880 | 3300053077 | Bacteria | 2377 |
| 1181 | Ga0495619_0139532 | 3300053085 | Bacteria | 1669 |
| 1182 | Ga0495619_0140851 | 3300053085 | Bacteria | 1661 |
| 1183 | Ga0500651_0000291 | 3300053093 | Bacteria | 29128 |
| 1184 | Ga0500651_0292341 | 3300053093 | Bacteria | 937 |
| 1185 | Ga0500641_0001583 | 3300053096 | Bacteria | 8107 |
| 1186 | Ga0500617_174776 | 3300053124 | Bacteria | 820 |
| 1187 | Ga0500642_0476713 | 3300053130 | Bacteria | 531 |
| 1188 | Ga0500642_0498325 | 3300053130 | Bacteria | 515 |
| 1189 | Ga0500658_0059449 | 3300053134 | Bacteria | 1586 |
| 1190 | Ga0500616_0005860 | 3300053153 | Bacteria | 8227 |
| 1191 | Ga0500620_316208 | 3300053155 | Bacteria | 502 |
| 1192 | Ga0500637_0202398 | 3300053178 | Bacteria | 1130 |
| 1193 | Ga0500645_056333 | 3300053730 | Bacteria | 1141 |
| 1194 | Ga0500609_020995 | 3300053731 | Bacteria | 891 |
| 1195 | Ga0500552_000219 | 3300053733 | Bacteria | 5169 |
| 1196 | Ga0500596_068619 | 3300053735 | Bacteria | 603 |
| 1197 | Ga0501084_0022989 | 3300054114 | Bacteria | 5204 |
| 1198 | Ga0501084_1337863 | 3300054114 | Bacteria | 600 |
| 1199 | Ga0501082_0074716 | 3300060353 | Bacteria | 2919 |
| 1200 | Ga0501082_0665126 | 3300060353 | Bacteria | 912 |
| 1201 | Ga0501082_0781625 | 3300060353 | Bacteria | 835 |
| 1202 | Ga0501082_0826763 | 3300060353 | Bacteria | 810 |
| 1203 | Ga0530510_0025314 | 3300061734 | Bacteria | 4242 |
| 1204 | Ga0530510_0662755 | 3300061734 | Bacteria | 795 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0004794 | Ga0451576_0004794_9773_10102 | 80 |
| 2 | 3300049586 | Ga0501070_0072567 | Ga0501070_0072567_2551_2820 | 89 |
| 3 | 3300026142 | Ga0207698_10024975 | Ga0207698_100249752 | 91 |
| 4 | 3300035114 | Ga0373939_0389905 | Ga0373939_0389905_280_558 | 92 |
| 5 | 3300001979 | JGI24740J21852_10084797 | JGI24740J21852_100847972 | 93 |
| 6 | 3300035171 | Ga0373946_0316423 | Ga0373946_0316423_10_291 | 93 |
| 7 | 3300044712 | Ga0453684_0292369 | Ga0453684_0292369_727_1056 | 93 |
| 8 | 3300048908 | Ga0496105_1358588 | Ga0496105_1358588_20_301 | 93 |
| 9 | 3300049585 | Ga0501069_0118933 | Ga0501069_0118933_17_298 | 93 |
| 10 | 3300029957 | Ga0265324_10309304 | Ga0265324_103093041 | 95 |
| 11 | 3300031344 | Ga0265316_10268047 | Ga0265316_102680472 | 95 |
| 12 | 3300031711 | Ga0265314_10009334 | Ga0265314_100093342 | 95 |
| 13 | 3300042876 | Ga0451577_0608168 | Ga0451577_0608168_199_528 | 96 |
| 14 | 3300044712 | Ga0453684_0085624 | Ga0453684_0085624_242_571 | 96 |
| 15 | 3300044712 | Ga0453684_0253350 | Ga0453684_0253350_1660_1989 | 96 |
| 16 | iso_pu_bacteria | 2524614729 | 2525556895 | 97 |
| 17 | iso_pu_bacteria | 2627854209 | 2630648491 | 97 |
| 18 | iso_pu_bacteria | 2816332141 | 2816519088 | 97 |
| 19 | iso_pu_bacteria | 2842391507 | 2842394831 | 97 |
| 20 | iso_pu_bacteria | 2961064222 | 2961065991 | 97 |
| 21 | 3300028800 | Ga0265338_10061743 | Ga0265338_100617433 | 99 |
| 22 | 3300031824 | Ga0307413_11729384 | Ga0307413_117293841 | 100 |
| 23 | 3300031901 | Ga0307406_10786424 | Ga0307406_107864242 | 100 |
| 24 | 3300031911 | Ga0307412_10319141 | Ga0307412_103191413 | 100 |
| 25 | 3300032004 | Ga0307414_10190887 | Ga0307414_101908872 | 100 |
| 26 | 3300032004 | Ga0307414_10397133 | Ga0307414_103971332 | 100 |
| 27 | 3300002070 | JGI24750J21931_1053125 | JGI24750J21931_10531251 | 101 |
| 28 | 3300003187 | JGI25151J46595_10015776 | JGI25151J46595_100157765 | 101 |
| 29 | 3300003320 | rootH2_10005458 | rootH2_100054582 | 101 |
| 30 | 3300003371 | JGI26145J50221_1034951 | JGI26145J50221_10349512 | 101 |
| 31 | 3300005288 | Ga0065714_10278487 | Ga0065714_102784872 | 101 |
| 32 | 3300005290 | Ga0065712_10069820 | Ga0065712_100698203 | 101 |
| 33 | 3300005293 | Ga0065715_10208296 | Ga0065715_102082963 | 101 |
| 34 | 3300005295 | Ga0065707_10069677 | Ga0065707_100696772 | 101 |
| 35 | 3300005295 | Ga0065707_10102239 | Ga0065707_101022392 | 101 |
| 36 | 3300005295 | Ga0065707_10234435 | Ga0065707_102344352 | 101 |
| 37 | 3300005327 | Ga0070658_11371670 | Ga0070658_113716701 | 101 |
| 38 | 3300005328 | Ga0070676_10106384 | Ga0070676_101063843 | 101 |
| 39 | 3300005329 | Ga0070683_100349994 | Ga0070683_1003499942 | 101 |
| 40 | 3300005329 | Ga0070683_100456368 | Ga0070683_1004563682 | 101 |
| 41 | 3300005329 | Ga0070683_100944054 | Ga0070683_1009440542 | 101 |
| 42 | 3300005330 | Ga0070690_100002812 | Ga0070690_1000028125 | 101 |
| 43 | 3300005331 | Ga0070670_100471116 | Ga0070670_1004711162 | 101 |
| 44 | 3300005331 | Ga0070670_100479182 | Ga0070670_1004791822 | 101 |
| 45 | 3300005331 | Ga0070670_101540248 | Ga0070670_1015402482 | 101 |
| 46 | 3300005333 | Ga0070677_10737337 | Ga0070677_107373372 | 101 |
| 47 | 3300005334 | Ga0068869_100002841 | Ga0068869_10000284113 | 101 |
| 48 | 3300005334 | Ga0068869_100619687 | Ga0068869_1006196872 | 101 |
| 49 | 3300005337 | Ga0070682_100472054 | Ga0070682_1004720542 | 101 |
| 50 | 3300005338 | Ga0068868_100450414 | Ga0068868_1004504142 | 101 |
| 51 | 3300005339 | Ga0070660_100308013 | Ga0070660_1003080132 | 101 |
| 52 | 3300005340 | Ga0070689_100001094 | Ga0070689_1000010946 | 101 |
| 53 | 3300005340 | Ga0070689_100762462 | Ga0070689_1007624621 | 101 |
| 54 | 3300005343 | Ga0070687_100216339 | Ga0070687_1002163392 | 101 |
| 55 | 3300005344 | Ga0070661_100259807 | Ga0070661_1002598072 | 101 |
| 56 | 3300005344 | Ga0070661_100815713 | Ga0070661_1008157132 | 101 |
| 57 | 3300005344 | Ga0070661_101080655 | Ga0070661_1010806551 | 101 |
| 58 | 3300005344 | Ga0070661_101871062 | Ga0070661_1018710622 | 101 |
| 59 | 3300005345 | Ga0070692_10126257 | Ga0070692_101262572 | 101 |
| 60 | 3300005345 | Ga0070692_10817083 | Ga0070692_108170832 | 101 |
| 61 | 3300005347 | Ga0070668_100013940 | Ga0070668_1000139405 | 101 |
| 62 | 3300005353 | Ga0070669_100067122 | Ga0070669_1000671223 | 101 |
| 63 | 3300005354 | Ga0070675_100013649 | Ga0070675_1000136495 | 101 |
| 64 | 3300005354 | Ga0070675_100430036 | Ga0070675_1004300362 | 101 |
| 65 | 3300005354 | Ga0070675_100517223 | Ga0070675_1005172232 | 101 |
| 66 | 3300005354 | Ga0070675_101607120 | Ga0070675_1016071201 | 101 |
| 67 | 3300005355 | Ga0070671_100253366 | Ga0070671_1002533661 | 101 |
| 68 | 3300005355 | Ga0070671_100389916 | Ga0070671_1003899162 | 101 |
| 69 | 3300005356 | Ga0070674_100242958 | Ga0070674_1002429582 | 101 |
| 70 | 3300005356 | Ga0070674_100872610 | Ga0070674_1008726102 | 101 |
| 71 | 3300005356 | Ga0070674_101222385 | Ga0070674_1012223852 | 101 |
| 72 | 3300005364 | Ga0070673_100077357 | Ga0070673_1000773574 | 101 |
| 73 | 3300005364 | Ga0070673_101360780 | Ga0070673_1013607802 | 101 |
| 74 | 3300005365 | Ga0070688_100040619 | Ga0070688_1000406194 | 101 |
| 75 | 3300005366 | Ga0070659_100133905 | Ga0070659_1001339052 | 101 |
| 76 | 3300005366 | Ga0070659_100392854 | Ga0070659_1003928542 | 101 |
| 77 | 3300005367 | Ga0070667_100183217 | Ga0070667_1001832174 | 101 |
| 78 | 3300005367 | Ga0070667_100397993 | Ga0070667_1003979932 | 101 |
| 79 | 3300005367 | Ga0070667_101841245 | Ga0070667_1018412452 | 101 |
| 80 | 3300005434 | Ga0070709_10086413 | Ga0070709_100864132 | 101 |
| 81 | 3300005434 | Ga0070709_10362792 | Ga0070709_103627922 | 101 |
| 82 | 3300005434 | Ga0070709_11538156 | Ga0070709_115381562 | 101 |
| 83 | 3300005435 | Ga0070714_100000372 | Ga0070714_10000037233 | 101 |
| 84 | 3300005438 | Ga0070701_10060266 | Ga0070701_100602662 | 101 |
| 85 | 3300005439 | Ga0070711_100214462 | Ga0070711_1002144623 | 101 |
| 86 | 3300005440 | Ga0070705_100107192 | Ga0070705_1001071923 | 101 |
| 87 | 3300005441 | Ga0070700_101233972 | Ga0070700_1012339721 | 101 |
| 88 | 3300005444 | Ga0070694_100144351 | Ga0070694_1001443512 | 101 |
| 89 | 3300005444 | Ga0070694_100430741 | Ga0070694_1004307412 | 101 |
| 90 | 3300005456 | Ga0070678_100134571 | Ga0070678_1001345712 | 101 |
| 91 | 3300005456 | Ga0070678_100798663 | Ga0070678_1007986631 | 101 |
| 92 | 3300005456 | Ga0070678_100953179 | Ga0070678_1009531792 | 101 |
| 93 | 3300005457 | Ga0070662_100394935 | Ga0070662_1003949352 | 101 |
| 94 | 3300005458 | Ga0070681_10000058 | Ga0070681_1000005811 | 101 |
| 95 | 3300005458 | Ga0070681_10700586 | Ga0070681_107005862 | 101 |
| 96 | 3300005458 | Ga0070681_11260446 | Ga0070681_112604461 | 101 |
| 97 | 3300005459 | Ga0068867_100095095 | Ga0068867_1000950952 | 101 |
| 98 | 3300005466 | Ga0070685_10104090 | Ga0070685_101040904 | 101 |
| 99 | 3300005471 | Ga0070698_102171070 | Ga0070698_1021710701 | 101 |
| 100 | 3300005530 | Ga0070679_100118349 | Ga0070679_1001183494 | 101 |
| 101 | 3300005530 | Ga0070679_101284148 | Ga0070679_1012841481 | 101 |
| 102 | 3300005530 | Ga0070679_101724266 | Ga0070679_1017242661 | 101 |
| 103 | 3300005535 | Ga0070684_100001643 | Ga0070684_10000164313 | 101 |
| 104 | 3300005539 | Ga0068853_100799278 | Ga0068853_1007992782 | 101 |
| 105 | 3300005539 | Ga0068853_101545957 | Ga0068853_1015459572 | 101 |
| 106 | 3300005543 | Ga0070672_100016355 | Ga0070672_1000163554 | 101 |
| 107 | 3300005545 | Ga0070695_100829185 | Ga0070695_1008291852 | 101 |
| 108 | 3300005545 | Ga0070695_101025889 | Ga0070695_1010258892 | 101 |
| 109 | 3300005547 | Ga0070693_100210333 | Ga0070693_1002103332 | 101 |
| 110 | 3300005548 | Ga0070665_100041133 | Ga0070665_1000411333 | 101 |
| 111 | 3300005563 | Ga0068855_101271904 | Ga0068855_1012719042 | 101 |
| 112 | 3300005563 | Ga0068855_101333165 | Ga0068855_1013331652 | 101 |
| 113 | 3300005564 | Ga0070664_100004119 | Ga0070664_10000411913 | 101 |
| 114 | 3300005564 | Ga0070664_101389890 | Ga0070664_1013898902 | 101 |
| 115 | 3300005577 | Ga0068857_100313758 | Ga0068857_1003137583 | 101 |
| 116 | 3300005577 | Ga0068857_100596321 | Ga0068857_1005963212 | 101 |
| 117 | 3300005578 | Ga0068854_100147801 | Ga0068854_1001478012 | 101 |
| 118 | 3300005614 | Ga0068856_101559671 | Ga0068856_1015596712 | 101 |
| 119 | 3300005615 | Ga0070702_100007955 | Ga0070702_1000079555 | 101 |
| 120 | 3300005616 | Ga0068852_100431312 | Ga0068852_1004313123 | 101 |
| 121 | 3300005617 | Ga0068859_100003542 | Ga0068859_1000035427 | 101 |
| 122 | 3300005617 | Ga0068859_100161732 | Ga0068859_1001617323 | 101 |
| 123 | 3300005617 | Ga0068859_102628498 | Ga0068859_1026284981 | 101 |
| 124 | 3300005618 | Ga0068864_100002080 | Ga0068864_10000208012 | 101 |
| 125 | 3300005719 | Ga0068861_102281560 | Ga0068861_1022815602 | 101 |
| 126 | 3300005834 | Ga0068851_10502967 | Ga0068851_105029672 | 101 |
| 127 | 3300005840 | Ga0068870_10163763 | Ga0068870_101637632 | 101 |
| 128 | 3300005841 | Ga0068863_100003431 | Ga0068863_10000343117 | 101 |
| 129 | 3300005841 | Ga0068863_101845345 | Ga0068863_1018453451 | 101 |
| 130 | 3300005842 | Ga0068858_100150154 | Ga0068858_1001501544 | 101 |
| 131 | 3300005843 | Ga0068860_100065835 | Ga0068860_1000658352 | 101 |
| 132 | 3300005843 | Ga0068860_101323069 | Ga0068860_1013230692 | 101 |
| 133 | 3300005843 | Ga0068860_101627468 | Ga0068860_1016274682 | 101 |
| 134 | 3300005844 | Ga0068862_101191206 | Ga0068862_1011912062 | 101 |
| 135 | 3300005937 | Ga0081455_10054750 | Ga0081455_100547502 | 101 |
| 136 | 3300005985 | Ga0081539_10042275 | Ga0081539_100422752 | 101 |
| 137 | 3300006028 | Ga0070717_11034841 | Ga0070717_110348412 | 101 |
| 138 | 3300006175 | Ga0070712_100081916 | Ga0070712_1000819164 | 101 |
| 139 | 3300006237 | Ga0097621_100118997 | Ga0097621_1001189972 | 101 |
| 140 | 3300006358 | Ga0068871_100109737 | Ga0068871_1001097372 | 101 |
| 141 | 3300006844 | Ga0075428_100005214 | Ga0075428_10000521418 | 101 |
| 142 | 3300006844 | Ga0075428_100104078 | Ga0075428_1001040784 | 101 |
| 143 | 3300006844 | Ga0075428_100353694 | Ga0075428_1003536943 | 101 |
| 144 | 3300006844 | Ga0075428_101662488 | Ga0075428_1016624882 | 101 |
| 145 | 3300006846 | Ga0075430_100006334 | Ga0075430_10000633410 | 101 |
| 146 | 3300006846 | Ga0075430_100225756 | Ga0075430_1002257563 | 101 |
| 147 | 3300006847 | Ga0075431_100055692 | Ga0075431_1000556922 | 101 |
| 148 | 3300006847 | Ga0075431_100163788 | Ga0075431_1001637882 | 101 |
| 149 | 3300006852 | Ga0075433_10004060 | Ga0075433_100040604 | 101 |
| 150 | 3300006852 | Ga0075433_10593433 | Ga0075433_105934332 | 101 |
| 151 | 3300006852 | Ga0075433_11874624 | Ga0075433_118746241 | 101 |
| 152 | 3300006871 | Ga0075434_100006745 | Ga0075434_10000674511 | 101 |
| 153 | 3300006880 | Ga0075429_100007100 | Ga0075429_1000071007 | 101 |
| 154 | 3300006880 | Ga0075429_100936264 | Ga0075429_1009362642 | 101 |
| 155 | 3300006881 | Ga0068865_100204877 | Ga0068865_1002048772 | 101 |
| 156 | 3300006931 | Ga0097620_100003542 | Ga0097620_1000035427 | 101 |
| 157 | 3300006931 | Ga0097620_100161733 | Ga0097620_1001617333 | 101 |
| 158 | 3300006931 | Ga0097620_102628778 | Ga0097620_1026287782 | 101 |
| 159 | 3300009036 | Ga0105244_10151516 | Ga0105244_101515162 | 101 |
| 160 | 3300009092 | Ga0105250_10000023 | Ga0105250_1000002371 | 101 |
| 161 | 3300009092 | Ga0105250_10180981 | Ga0105250_101809812 | 101 |
| 162 | 3300009093 | Ga0105240_10015264 | Ga0105240_100152642 | 101 |
| 163 | 3300009094 | Ga0111539_10006091 | Ga0111539_1000609113 | 101 |
| 164 | 3300009094 | Ga0111539_10038677 | Ga0111539_100386774 | 101 |
| 165 | 3300009094 | Ga0111539_10656833 | Ga0111539_106568332 | 101 |
| 166 | 3300009094 | Ga0111539_11044874 | Ga0111539_110448742 | 101 |
| 167 | 3300009098 | Ga0105245_11450088 | Ga0105245_114500882 | 101 |
| 168 | 3300009098 | Ga0105245_12238577 | Ga0105245_122385772 | 101 |
| 169 | 3300009147 | Ga0114129_10012049 | Ga0114129_100120497 | 101 |
| 170 | 3300009147 | Ga0114129_10589038 | Ga0114129_105890383 | 101 |
| 171 | 3300009148 | Ga0105243_11057020 | Ga0105243_110570202 | 101 |
| 172 | 3300009174 | Ga0105241_12506530 | Ga0105241_125065302 | 101 |
| 173 | 3300009176 | Ga0105242_10159634 | Ga0105242_101596342 | 101 |
| 174 | 3300009176 | Ga0105242_11423816 | Ga0105242_114238162 | 101 |
| 175 | 3300009176 | Ga0105242_11484397 | Ga0105242_114843972 | 101 |
| 176 | 3300009177 | Ga0105248_10013091 | Ga0105248_100130914 | 101 |
| 177 | 3300009177 | Ga0105248_11649917 | Ga0105248_116499171 | 101 |
| 178 | 3300009177 | Ga0105248_12071450 | Ga0105248_120714502 | 101 |
| 179 | 3300009551 | Ga0105238_11703811 | Ga0105238_117038112 | 101 |
| 180 | 3300009553 | Ga0105249_10010911 | Ga0105249_100109114 | 101 |
| 181 | 3300009553 | Ga0105249_10068998 | Ga0105249_100689985 | 101 |
| 182 | 3300009553 | Ga0105249_10712431 | Ga0105249_107124311 | 101 |
| 183 | 3300009979 | Ga0105032_101327 | Ga0105032_1013272 | 101 |
| 184 | 3300009988 | Ga0105035_105563 | Ga0105035_1055632 | 101 |
| 185 | 3300010159 | Ga0099796_10059854 | Ga0099796_100598542 | 101 |
| 186 | 3300010375 | Ga0105239_11176614 | Ga0105239_111766142 | 101 |
| 187 | 3300012478 | Ga0157328_1012371 | Ga0157328_10123712 | 101 |
| 188 | 3300012485 | Ga0157325_1022663 | Ga0157325_10226631 | 101 |
| 189 | 3300012487 | Ga0157321_1016396 | Ga0157321_10163962 | 101 |
| 190 | 3300012490 | Ga0157322_1011930 | Ga0157322_10119302 | 101 |
| 191 | 3300012491 | Ga0157329_1047268 | Ga0157329_10472682 | 101 |
| 192 | 3300012492 | Ga0157335_1007582 | Ga0157335_10075822 | 101 |
| 193 | 3300012497 | Ga0157319_1028887 | Ga0157319_10288872 | 101 |
| 194 | 3300012500 | Ga0157314_1026926 | Ga0157314_10269262 | 101 |
| 195 | 3300012503 | Ga0157313_1008230 | Ga0157313_10082302 | 101 |
| 196 | 3300012505 | Ga0157339_1019563 | Ga0157339_10195632 | 101 |
| 197 | 3300012510 | Ga0157316_1001729 | Ga0157316_10017292 | 101 |
| 198 | 3300013100 | Ga0157373_10076846 | Ga0157373_100768464 | 101 |
| 199 | 3300013102 | Ga0157371_10116033 | Ga0157371_101160332 | 101 |
| 200 | 3300013102 | Ga0157371_10702630 | Ga0157371_107026302 | 101 |
| 201 | 3300013104 | Ga0157370_10492511 | Ga0157370_104925112 | 101 |
| 202 | 3300013105 | Ga0157369_10032420 | Ga0157369_100324202 | 101 |
| 203 | 3300013297 | Ga0157378_10202557 | Ga0157378_102025573 | 101 |
| 204 | 3300013297 | Ga0157378_10254609 | Ga0157378_102546092 | 101 |
| 205 | 3300013297 | Ga0157378_10357402 | Ga0157378_103574021 | 101 |
| 206 | 3300013297 | Ga0157378_10466658 | Ga0157378_104666582 | 101 |
| 207 | 3300013306 | Ga0163162_11035510 | Ga0163162_110355102 | 101 |
| 208 | 3300013308 | Ga0157375_10358117 | Ga0157375_103581172 | 101 |
| 209 | 3300013308 | Ga0157375_11581043 | Ga0157375_115810432 | 101 |
| 210 | 3300013308 | Ga0157375_11969545 | Ga0157375_119695452 | 101 |
| 211 | 3300014325 | Ga0163163_10030882 | Ga0163163_100308822 | 101 |
| 212 | 3300014325 | Ga0163163_12318229 | Ga0163163_123182292 | 101 |
| 213 | 3300014326 | Ga0157380_10088498 | Ga0157380_100884984 | 101 |
| 214 | 3300014326 | Ga0157380_10351176 | Ga0157380_103511763 | 101 |
| 215 | 3300014326 | Ga0157380_10475325 | Ga0157380_104753252 | 101 |
| 216 | 3300014326 | Ga0157380_10872203 | Ga0157380_108722032 | 101 |
| 217 | 3300014745 | Ga0157377_10018611 | Ga0157377_100186112 | 101 |
| 218 | 3300014745 | Ga0157377_11503113 | Ga0157377_115031132 | 101 |
| 219 | 3300014968 | Ga0157379_10021307 | Ga0157379_100213072 | 101 |
| 220 | 3300014968 | Ga0157379_10084854 | Ga0157379_100848542 | 101 |
| 221 | 3300014969 | Ga0157376_11748617 | Ga0157376_117486172 | 101 |
| 222 | 3300017792 | Ga0163161_11003190 | Ga0163161_110031901 | 101 |
| 223 | 3300021361 | Ga0213872_10037234 | Ga0213872_100372342 | 101 |
| 224 | 3300021441 | Ga0213871_10003275 | Ga0213871_100032753 | 101 |
| 225 | 3300025292 | Ga0209676_1025789 | Ga0209676_10257892 | 101 |
| 226 | 3300025302 | Ga0207426_1062561 | Ga0207426_10625613 | 101 |
| 227 | 3300025711 | Ga0207696_1000098 | Ga0207696_100009842 | 101 |
| 228 | 3300025899 | Ga0207642_10364956 | Ga0207642_103649562 | 101 |
| 229 | 3300025901 | Ga0207688_10052206 | Ga0207688_100522062 | 101 |
| 230 | 3300025901 | Ga0207688_10604299 | Ga0207688_106042992 | 101 |
| 231 | 3300025906 | Ga0207699_10310358 | Ga0207699_103103582 | 101 |
| 232 | 3300025906 | Ga0207699_11130928 | Ga0207699_111309282 | 101 |
| 233 | 3300025907 | Ga0207645_10010902 | Ga0207645_100109023 | 101 |
| 234 | 3300025908 | Ga0207643_10502761 | Ga0207643_105027612 | 101 |
| 235 | 3300025909 | Ga0207705_10387986 | Ga0207705_103879862 | 101 |
| 236 | 3300025911 | Ga0207654_11016646 | Ga0207654_110166462 | 101 |
| 237 | 3300025912 | Ga0207707_10000912 | Ga0207707_1000091215 | 101 |
| 238 | 3300025912 | Ga0207707_10541983 | Ga0207707_105419832 | 101 |
| 239 | 3300025913 | Ga0207695_10161639 | Ga0207695_101616392 | 101 |
| 240 | 3300025915 | Ga0207693_10107991 | Ga0207693_101079912 | 101 |
| 241 | 3300025916 | Ga0207663_10266962 | Ga0207663_102669622 | 101 |
| 242 | 3300025918 | Ga0207662_10009092 | Ga0207662_100090922 | 101 |
| 243 | 3300025919 | Ga0207657_10025007 | Ga0207657_100250075 | 101 |
| 244 | 3300025920 | Ga0207649_10016885 | Ga0207649_100168852 | 101 |
| 245 | 3300025920 | Ga0207649_10451736 | Ga0207649_104517362 | 101 |
| 246 | 3300025920 | Ga0207649_10737367 | Ga0207649_107373672 | 101 |
| 247 | 3300025921 | Ga0207652_10180483 | Ga0207652_101804832 | 101 |
| 248 | 3300025923 | Ga0207681_10080433 | Ga0207681_100804333 | 101 |
| 249 | 3300025923 | Ga0207681_10940439 | Ga0207681_109404392 | 101 |
| 250 | 3300025924 | Ga0207694_10600309 | Ga0207694_106003092 | 101 |
| 251 | 3300025925 | Ga0207650_10603732 | Ga0207650_106037322 | 101 |
| 252 | 3300025925 | Ga0207650_10683091 | Ga0207650_106830912 | 101 |
| 253 | 3300025926 | Ga0207659_10002602 | Ga0207659_100026023 | 101 |
| 254 | 3300025926 | Ga0207659_11239246 | Ga0207659_112392462 | 101 |
| 255 | 3300025926 | Ga0207659_11497289 | Ga0207659_114972892 | 101 |
| 256 | 3300025926 | Ga0207659_11666813 | Ga0207659_116668132 | 101 |
| 257 | 3300025927 | Ga0207687_10330585 | Ga0207687_103305852 | 101 |
| 258 | 3300025927 | Ga0207687_11740111 | Ga0207687_117401112 | 101 |
| 259 | 3300025928 | Ga0207700_10016571 | Ga0207700_100165713 | 101 |
| 260 | 3300025929 | Ga0207664_10005812 | Ga0207664_100058122 | 101 |
| 261 | 3300025931 | Ga0207644_10285518 | Ga0207644_102855183 | 101 |
| 262 | 3300025931 | Ga0207644_10475263 | Ga0207644_104752632 | 101 |
| 263 | 3300025932 | Ga0207690_10065616 | Ga0207690_100656162 | 101 |
| 264 | 3300025934 | Ga0207686_10059253 | Ga0207686_100592531 | 101 |
| 265 | 3300025935 | Ga0207709_10070905 | Ga0207709_100709052 | 101 |
| 266 | 3300025935 | Ga0207709_10911312 | Ga0207709_109113121 | 101 |
| 267 | 3300025936 | Ga0207670_10000955 | Ga0207670_100009558 | 101 |
| 268 | 3300025936 | Ga0207670_10566030 | Ga0207670_105660302 | 101 |
| 269 | 3300025938 | Ga0207704_10313012 | Ga0207704_103130122 | 101 |
| 270 | 3300025939 | Ga0207665_10577722 | Ga0207665_105777222 | 101 |
| 271 | 3300025940 | Ga0207691_10028519 | Ga0207691_100285194 | 101 |
| 272 | 3300025940 | Ga0207691_10188956 | Ga0207691_101889562 | 101 |
| 273 | 3300025941 | Ga0207711_10009083 | Ga0207711_100090835 | 101 |
| 274 | 3300025941 | Ga0207711_11101025 | Ga0207711_111010251 | 101 |
| 275 | 3300025942 | Ga0207689_10062065 | Ga0207689_100620652 | 101 |
| 276 | 3300025942 | Ga0207689_10192564 | Ga0207689_101925643 | 101 |
| 277 | 3300025942 | Ga0207689_10544740 | Ga0207689_105447402 | 101 |
| 278 | 3300025944 | Ga0207661_10447882 | Ga0207661_104478822 | 101 |
| 279 | 3300025945 | Ga0207679_10152680 | Ga0207679_101526803 | 101 |
| 280 | 3300025945 | Ga0207679_10164764 | Ga0207679_101647642 | 101 |
| 281 | 3300025945 | Ga0207679_10846136 | Ga0207679_108461362 | 101 |
| 282 | 3300025960 | Ga0207651_10054087 | Ga0207651_100540874 | 101 |
| 283 | 3300025960 | Ga0207651_11699774 | Ga0207651_116997742 | 101 |
| 284 | 3300025972 | Ga0207668_10002142 | Ga0207668_100021425 | 101 |
| 285 | 3300025981 | Ga0207640_10563281 | Ga0207640_105632812 | 101 |
| 286 | 3300026023 | Ga0207677_10248711 | Ga0207677_102487112 | 101 |
| 287 | 3300026035 | Ga0207703_10056564 | Ga0207703_100565642 | 101 |
| 288 | 3300026035 | Ga0207703_11775666 | Ga0207703_117756662 | 101 |
| 289 | 3300026075 | Ga0207708_10506386 | Ga0207708_105063861 | 101 |
| 290 | 3300026088 | Ga0207641_10051766 | Ga0207641_100517663 | 101 |
| 291 | 3300026088 | Ga0207641_12371002 | Ga0207641_123710021 | 101 |
| 292 | 3300026089 | Ga0207648_10111593 | Ga0207648_101115932 | 101 |
| 293 | 3300026089 | Ga0207648_11813793 | Ga0207648_118137932 | 101 |
| 294 | 3300026089 | Ga0207648_12271143 | Ga0207648_122711431 | 101 |
| 295 | 3300026095 | Ga0207676_10002529 | Ga0207676_1000252915 | 101 |
| 296 | 3300026116 | Ga0207674_10254630 | Ga0207674_102546302 | 101 |
| 297 | 3300026116 | Ga0207674_10910208 | Ga0207674_109102082 | 101 |
| 298 | 3300026116 | Ga0207674_10950995 | Ga0207674_109509952 | 101 |
| 299 | 3300026121 | Ga0207683_10130226 | Ga0207683_101302262 | 101 |
| 300 | 3300026121 | Ga0207683_10676712 | Ga0207683_106767122 | 101 |
| 301 | 3300026121 | Ga0207683_11561305 | Ga0207683_115613052 | 101 |
| 302 | 3300026142 | Ga0207698_10785599 | Ga0207698_107855992 | 101 |
| 303 | 3300026142 | Ga0207698_10862961 | Ga0207698_108629612 | 101 |
| 304 | 3300027252 | Ga0209973_1028199 | Ga0209973_10281992 | 101 |
| 305 | 3300027360 | Ga0209969_1004771 | Ga0209969_10047713 | 101 |
| 306 | 3300027364 | Ga0209967_1009251 | Ga0209967_10092512 | 101 |
| 307 | 3300027378 | Ga0209981_1001337 | Ga0209981_10013374 | 101 |
| 308 | 3300027378 | Ga0209981_1065415 | Ga0209981_10654153 | 101 |
| 309 | 3300027471 | Ga0209995_1030700 | Ga0209995_10307002 | 101 |
| 310 | 3300027471 | Ga0209995_1033043 | Ga0209995_10330432 | 101 |
| 311 | 3300027543 | Ga0209999_1000092 | Ga0209999_10000927 | 101 |
| 312 | 3300027552 | Ga0209982_1002643 | Ga0209982_10026432 | 101 |
| 313 | 3300027614 | Ga0209970_1025601 | Ga0209970_10256012 | 101 |
| 314 | 3300027617 | Ga0210002_1011194 | Ga0210002_10111942 | 101 |
| 315 | 3300027665 | Ga0209983_1000216 | Ga0209983_10002165 | 101 |
| 316 | 3300027682 | Ga0209971_1000244 | Ga0209971_10002445 | 101 |
| 317 | 3300027682 | Ga0209971_1047827 | Ga0209971_10478272 | 101 |
| 318 | 3300027876 | Ga0209974_10003853 | Ga0209974_100038535 | 101 |
| 319 | 3300027907 | Ga0207428_10015261 | Ga0207428_100152612 | 101 |
| 320 | 3300027907 | Ga0207428_10025945 | Ga0207428_100259455 | 101 |
| 321 | 3300027907 | Ga0207428_10066622 | Ga0207428_100666223 | 101 |
| 322 | 3300027907 | Ga0207428_10429416 | Ga0207428_104294162 | 101 |
| 323 | 3300028379 | Ga0268266_10014847 | Ga0268266_100148474 | 101 |
| 324 | 3300028379 | Ga0268266_12157187 | Ga0268266_121571872 | 101 |
| 325 | 3300028380 | Ga0268265_10004900 | Ga0268265_100049003 | 101 |
| 326 | 3300028380 | Ga0268265_10042806 | Ga0268265_100428062 | 101 |
| 327 | 3300028380 | Ga0268265_10975401 | Ga0268265_109754012 | 101 |
| 328 | 3300028381 | Ga0268264_10014907 | Ga0268264_100149072 | 101 |
| 329 | 3300028381 | Ga0268264_11125356 | Ga0268264_111253562 | 101 |
| 330 | 3300028573 | Ga0265334_10000009 | Ga0265334_10000009129 | 101 |
| 331 | 3300028573 | Ga0265334_10016689 | Ga0265334_100166893 | 101 |
| 332 | 3300028800 | Ga0265338_10030752 | Ga0265338_100307524 | 101 |
| 333 | 3300028800 | Ga0265338_10849248 | Ga0265338_108492482 | 101 |
| 334 | 3300030731 | Ga0316177_1078971 | Ga0316177_10789713 | 101 |
| 335 | 3300030732 | Ga0316176_1126462 | Ga0316176_11264622 | 101 |
| 336 | 3300030733 | Ga0314311_1072280 | Ga0314311_10722802 | 101 |
| 337 | 3300030735 | Ga0316178_1037950 | Ga0316178_10379503 | 101 |
| 338 | 3300031251 | Ga0265327_10089220 | Ga0265327_100892202 | 101 |
| 339 | 3300031548 | Ga0307408_100104606 | Ga0307408_1001046064 | 101 |
| 340 | 3300031548 | Ga0307408_100132187 | Ga0307408_1001321874 | 101 |
| 341 | 3300031548 | Ga0307408_100226482 | Ga0307408_1002264822 | 101 |
| 342 | 3300031595 | Ga0265313_10000628 | Ga0265313_1000062828 | 101 |
| 343 | 3300031616 | Ga0307508_10893633 | Ga0307508_108936331 | 101 |
| 344 | 3300031665 | Ga0316575_10012371 | Ga0316575_100123714 | 101 |
| 345 | 3300031665 | Ga0316575_10054891 | Ga0316575_100548913 | 101 |
| 346 | 3300031665 | Ga0316575_10191231 | Ga0316575_101912312 | 101 |
| 347 | 3300031691 | Ga0316579_10001255 | Ga0316579_100012556 | 101 |
| 348 | 3300031691 | Ga0316579_10321743 | Ga0316579_103217432 | 101 |
| 349 | 3300031691 | Ga0316579_10344646 | Ga0316579_103446462 | 101 |
| 350 | 3300031691 | Ga0316579_10479688 | Ga0316579_104796882 | 101 |
| 351 | 3300031691 | Ga0316579_10637711 | Ga0316579_106377111 | 101 |
| 352 | 3300031727 | Ga0316576_10002711 | Ga0316576_100027116 | 101 |
| 353 | 3300031727 | Ga0316576_10004680 | Ga0316576_100046807 | 101 |
| 354 | 3300031727 | Ga0316576_10005793 | Ga0316576_100057937 | 101 |
| 355 | 3300031727 | Ga0316576_10006718 | Ga0316576_100067182 | 101 |
| 356 | 3300031727 | Ga0316576_10010662 | Ga0316576_100106624 | 101 |
| 357 | 3300031727 | Ga0316576_10045306 | Ga0316576_100453061 | 101 |
| 358 | 3300031727 | Ga0316576_10182926 | Ga0316576_101829262 | 101 |
| 359 | 3300031727 | Ga0316576_10273020 | Ga0316576_102730201 | 101 |
| 360 | 3300031727 | Ga0316576_10638126 | Ga0316576_106381262 | 101 |
| 361 | 3300031727 | Ga0316576_10676212 | Ga0316576_106762121 | 101 |
| 362 | 3300031728 | Ga0316578_10000469 | Ga0316578_100004694 | 101 |
| 363 | 3300031728 | Ga0316578_10028616 | Ga0316578_100286164 | 101 |
| 364 | 3300031728 | Ga0316578_10130955 | Ga0316578_101309551 | 101 |
| 365 | 3300031728 | Ga0316578_10316434 | Ga0316578_103164342 | 101 |
| 366 | 3300031731 | Ga0307405_10031842 | Ga0307405_100318424 | 101 |
| 367 | 3300031731 | Ga0307405_10734265 | Ga0307405_107342652 | 101 |
| 368 | 3300031733 | Ga0316577_10001512 | Ga0316577_100015129 | 101 |
| 369 | 3300031733 | Ga0316577_10003045 | Ga0316577_100030454 | 101 |
| 370 | 3300031733 | Ga0316577_10050851 | Ga0316577_100508512 | 101 |
| 371 | 3300031733 | Ga0316577_10074888 | Ga0316577_100748882 | 101 |
| 372 | 3300031733 | Ga0316577_10122706 | Ga0316577_101227062 | 101 |
| 373 | 3300031733 | Ga0316577_10681857 | Ga0316577_106818571 | 101 |
| 374 | 3300031824 | Ga0307413_10068873 | Ga0307413_100688733 | 101 |
| 375 | 3300031824 | Ga0307413_10153351 | Ga0307413_101533513 | 101 |
| 376 | 3300031824 | Ga0307413_10270337 | Ga0307413_102703372 | 101 |
| 377 | 3300031824 | Ga0307413_10600199 | Ga0307413_106001992 | 101 |
| 378 | 3300031824 | Ga0307413_10673757 | Ga0307413_106737572 | 101 |
| 379 | 3300031824 | Ga0307413_11101118 | Ga0307413_111011181 | 101 |
| 380 | 3300031824 | Ga0307413_11303718 | Ga0307413_113037181 | 101 |
| 381 | 3300031852 | Ga0307410_10049850 | Ga0307410_100498504 | 101 |
| 382 | 3300031852 | Ga0307410_10441579 | Ga0307410_104415792 | 101 |
| 383 | 3300031901 | Ga0307406_10740795 | Ga0307406_107407952 | 101 |
| 384 | 3300031901 | Ga0307406_12134608 | Ga0307406_121346081 | 101 |
| 385 | 3300031903 | Ga0307407_10415974 | Ga0307407_104159742 | 101 |
| 386 | 3300031903 | Ga0307407_10472106 | Ga0307407_104721061 | 101 |
| 387 | 3300031903 | Ga0307407_10892395 | Ga0307407_108923952 | 101 |
| 388 | 3300031911 | Ga0307412_10113674 | Ga0307412_101136742 | 101 |
| 389 | 3300031911 | Ga0307412_10640871 | Ga0307412_106408712 | 101 |
| 390 | 3300031911 | Ga0307412_12314694 | Ga0307412_123146942 | 101 |
| 391 | 3300031995 | Ga0307409_100260956 | Ga0307409_1002609562 | 101 |
| 392 | 3300031995 | Ga0307409_100426573 | Ga0307409_1004265732 | 101 |
| 393 | 3300031995 | Ga0307409_100486245 | Ga0307409_1004862452 | 101 |
| 394 | 3300032002 | Ga0307416_100098925 | Ga0307416_1000989254 | 101 |
| 395 | 3300032002 | Ga0307416_100154839 | Ga0307416_1001548393 | 101 |
| 396 | 3300032002 | Ga0307416_100170274 | Ga0307416_1001702741 | 101 |
| 397 | 3300032002 | Ga0307416_100439317 | Ga0307416_1004393173 | 101 |
| 398 | 3300032002 | Ga0307416_101965261 | Ga0307416_1019652612 | 101 |
| 399 | 3300032002 | Ga0307416_102365520 | Ga0307416_1023655202 | 101 |
| 400 | 3300032004 | Ga0307414_10941640 | Ga0307414_109416402 | 101 |
| 401 | 3300032004 | Ga0307414_11687408 | Ga0307414_116874081 | 101 |
| 402 | 3300032005 | Ga0307411_10095506 | Ga0307411_100955063 | 101 |
| 403 | 3300032005 | Ga0307411_10366906 | Ga0307411_103669062 | 101 |
| 404 | 3300032005 | Ga0307411_10638037 | Ga0307411_106380372 | 101 |
| 405 | 3300032005 | Ga0307411_10939846 | Ga0307411_109398462 | 101 |
| 406 | 3300032126 | Ga0307415_100005213 | Ga0307415_1000052137 | 101 |
| 407 | 3300032126 | Ga0307415_100448318 | Ga0307415_1004483181 | 101 |
| 408 | 3300032126 | Ga0307415_100635529 | Ga0307415_1006355292 | 101 |
| 409 | 3300032126 | Ga0307415_100968319 | Ga0307415_1009683192 | 101 |
| 410 | 3300032126 | Ga0307415_102402672 | Ga0307415_1024026722 | 101 |
| 411 | 3300032133 | Ga0316583_10004293 | Ga0316583_100042935 | 101 |
| 412 | 3300032133 | Ga0316583_10032173 | Ga0316583_100321731 | 101 |
| 413 | 3300032133 | Ga0316583_10059532 | Ga0316583_100595322 | 101 |
| 414 | 3300032137 | Ga0316585_10000686 | Ga0316585_100006863 | 101 |
| 415 | 3300032137 | Ga0316585_10106233 | Ga0316585_101062332 | 101 |
| 416 | 3300032139 | Ga0316580_10000381 | Ga0316580_100003814 | 101 |
| 417 | 3300032139 | Ga0316580_10005234 | Ga0316580_100052342 | 101 |
| 418 | 3300032139 | Ga0316580_10059784 | Ga0316580_100597842 | 101 |
| 419 | 3300032139 | Ga0316580_10217561 | Ga0316580_102175612 | 101 |
| 420 | 3300032168 | Ga0316593_10000769 | Ga0316593_100007692 | 101 |
| 421 | 3300032168 | Ga0316593_10350026 | Ga0316593_103500262 | 101 |
| 422 | 3300033527 | Ga0316586_1022360 | Ga0316586_10223602 | 101 |
| 423 | 3300033541 | Ga0316596_1000111 | Ga0316596_100011112 | 101 |
| 424 | 3300034818 | Ga0373950_0129735 | Ga0373950_0129735_244_549 | 101 |
| 425 | 3300035090 | Ga0373949_0083144 | Ga0373949_0083144_524_829 | 101 |
| 426 | 3300035091 | Ga0373951_0134154 | Ga0373951_0134154_163_468 | 101 |
| 427 | 3300035115 | Ga0373941_0204504 | Ga0373941_0204504_272_577 | 101 |
| 428 | 3300035118 | Ga0373954_0383164 | Ga0373954_0383164_167_472 | 101 |
| 429 | 3300035119 | Ga0373956_0232577 | Ga0373956_0232577_333_638 | 101 |
| 430 | 3300035171 | Ga0373946_0596934 | Ga0373946_0596934_96_401 | 101 |
| 431 | 3300035242 | Ga0373962_0158564 | Ga0373962_0158564_266_571 | 101 |
| 432 | 3300035398 | Ga0316574_0000505 | Ga0316574_0000505_4913_5218 | 101 |
| 433 | 3300035398 | Ga0316574_0002851 | Ga0316574_0002851_7143_7448 | 101 |
| 434 | 3300035398 | Ga0316574_0005191 | Ga0316574_0005191_4961_5266 | 101 |
| 435 | 3300035398 | Ga0316574_0009989 | Ga0316574_0009989_377_682 | 101 |
| 436 | 3300035398 | Ga0316574_0023955 | Ga0316574_0023955_3206_3511 | 101 |
| 437 | 3300035398 | Ga0316574_0032827 | Ga0316574_0032827_775_1080 | 101 |
| 438 | 3300035398 | Ga0316574_0056770 | Ga0316574_0056770_1153_1458 | 101 |
| 439 | 3300035398 | Ga0316574_0088612 | Ga0316574_0088612_1097_1402 | 101 |
| 440 | 3300035398 | Ga0316574_0173345 | Ga0316574_0173345_843_1148 | 101 |
| 441 | 3300035398 | Ga0316574_0270473 | Ga0316574_0270473_319_624 | 101 |
| 442 | 3300035398 | Ga0316574_0307403 | Ga0316574_0307403_29_334 | 101 |
| 443 | 3300035398 | Ga0316574_0350827 | Ga0316574_0350827_544_849 | 101 |
| 444 | 3300035398 | Ga0316574_0435023 | Ga0316574_0435023_353_658 | 101 |
| 445 | 3300035692 | Ga0373935_0731206 | Ga0373935_0731206_179_484 | 101 |
| 446 | 3300035695 | Ga0373927_0000003 | Ga0373927_0000003_343921_344226 | 101 |
| 447 | 3300035724 | Ga0373933_0336330 | Ga0373933_0336330_336_641 | 101 |
| 448 | 3300035725 | Ga0373947_0497026 | Ga0373947_0497026_56_361 | 101 |
| 449 | 3300036647 | Ga0316582_0001472 | Ga0316582_0001472_6054_6359 | 101 |
| 450 | 3300036647 | Ga0316582_0024839 | Ga0316582_0024839_1902_2207 | 101 |
| 451 | 3300036647 | Ga0316582_1094741 | Ga0316582_1094741_11_316 | 101 |
| 452 | 3300036712 | Ga0316584_0004416 | Ga0316584_0004416_5959_6264 | 101 |
| 453 | 3300036712 | Ga0316584_0005187 | Ga0316584_0005187_6432_6737 | 101 |
| 454 | 3300036712 | Ga0316584_0223352 | Ga0316584_0223352_725_1030 | 101 |
| 455 | 3300036712 | Ga0316584_0270727 | Ga0316584_0270727_28_333 | 101 |
| 456 | 3300036712 | Ga0316584_0415858 | Ga0316584_0415858_317_622 | 101 |
| 457 | 3300036712 | Ga0316584_0991486 | Ga0316584_0991486_133_438 | 101 |
| 458 | 3300037068 | Ga0373925_0050662 | Ga0373925_0050662_1620_1925 | 101 |
| 459 | 3300037418 | Ga0395900_0197353 | Ga0395900_0197353_141_464 | 101 |
| 460 | 3300037466 | Ga0395898_0487202 | Ga0395898_0487202_89_412 | 101 |
| 461 | 3300037466 | Ga0395898_1781138 | Ga0395898_1781138_109_432 | 101 |
| 462 | 3300037471 | Ga0395905_1195406 | Ga0395905_1195406_208_531 | 101 |
| 463 | 3300038443 | Ga0395901_0743314 | Ga0395901_0743314_634_939 | 101 |
| 464 | 3300038726 | Ga0400490_07618 | Ga0400490_07618_9056_9361 | 101 |
| 465 | 3300038742 | Ga0400486_18067 | Ga0400486_18067_756_1061 | 101 |
| 466 | 3300039062 | Ga0400483_036792 | Ga0400483_036792_4180_4485 | 101 |
| 467 | 3300039062 | Ga0400483_038990 | Ga0400483_038990_544_849 | 101 |
| 468 | 3300039062 | Ga0400483_180247 | Ga0400483_180247_2772_3077 | 101 |
| 469 | 3300039062 | Ga0400483_181669 | Ga0400483_181669_37_342 | 101 |
| 470 | 3300039093 | Ga0400489_53512 | Ga0400489_53512_473_778 | 101 |
| 471 | 3300039110 | Ga0400487_66249 | Ga0400487_66249_381_686 | 101 |
| 472 | 3300039438 | Ga0436360_0253706 | Ga0436360_0253706_9799_10104 | 101 |
| 473 | 3300039447 | Ga0436361_1086284 | Ga0436361_1086284_1802_2107 | 101 |
| 474 | 3300039450 | Ga0436363_0607560 | Ga0436363_0607560_626_931 | 101 |
| 475 | 3300039453 | Ga0436362_0195822 | Ga0436362_0195822_1124_1429 | 101 |
| 476 | 3300041406 | Ga0439439_0007650 | Ga0439439_0007650_1165_1470 | 101 |
| 477 | 3300041406 | Ga0439439_0102742 | Ga0439439_0102742_90_395 | 101 |
| 478 | 3300041451 | Ga0451791_1427860 | Ga0451791_1427860_418_723 | 101 |
| 479 | 3300041453 | Ga0451797_1211170 | Ga0451797_1211170_329_634 | 101 |
| 480 | 3300041453 | Ga0451797_1365695 | Ga0451797_1365695_523_828 | 101 |
| 481 | 3300041456 | Ga0451795_1294879 | Ga0451795_1294879_88_393 | 101 |
| 482 | 3300041459 | Ga0451800_0097612 | Ga0451800_0097612_123_428 | 101 |
| 483 | 3300041486 | Ga0451807_0346592 | Ga0451807_0346592_828_1133 | 101 |
| 484 | 3300041494 | Ga0451837_0436478 | Ga0451837_0436478_496_819 | 101 |
| 485 | 3300041494 | Ga0451837_1077267 | Ga0451837_1077267_216_521 | 101 |
| 486 | 3300041498 | Ga0451841_0576354 | Ga0451841_0576354_59_373 | 101 |
| 487 | 3300041501 | Ga0451845_0691868 | Ga0451845_0691868_188_493 | 101 |
| 488 | 3300041505 | Ga0451849_0458457 | Ga0451849_0458457_387_692 | 101 |
| 489 | 3300041512 | Ga0451853_0558631 | Ga0451853_0558631_255_560 | 101 |
| 490 | 3300042003 | Ga0439443_013863 | Ga0439443_013863_113_418 | 101 |
| 491 | 3300042007 | Ga0439449_0013715 | Ga0439449_0013715_2366_2689 | 101 |
| 492 | 3300042014 | Ga0439457_075826 | Ga0439457_075826_90_395 | 101 |
| 493 | 3300042133 | Ga0450896_002550 | Ga0450896_002550_1410_1715 | 101 |
| 494 | 3300042156 | Ga0439446_0007690 | Ga0439446_0007690_1608_1913 | 101 |
| 495 | 3300042156 | Ga0439446_0012350 | Ga0439446_0012350_928_1233 | 101 |
| 496 | 3300042436 | Ga0439435_0000245 | Ga0439435_0000245_7025_7330 | 101 |
| 497 | 3300042437 | Ga0439444_0000819 | Ga0439444_0000819_2170_2475 | 101 |
| 498 | 3300042438 | Ga0439459_0124276 | Ga0439459_0124276_213_518 | 101 |
| 499 | 3300042439 | Ga0439464_0060669 | Ga0439464_0060669_502_807 | 101 |
| 500 | 3300042439 | Ga0439464_0179268 | Ga0439464_0179268_322_627 | 101 |
| 501 | 3300042439 | Ga0439464_0321557 | Ga0439464_0321557_33_338 | 101 |
| 502 | 3300042461 | Ga0439460_0038163 | Ga0439460_0038163_1053_1358 | 101 |
| 503 | 3300042532 | Ga0450893_0040196 | Ga0450893_0040196_379_684 | 101 |
| 504 | 3300042993 | Ga0439440_0078827 | Ga0439440_0078827_92_397 | 101 |
| 505 | 3300044673 | Ga0453683_0000032 | Ga0453683_0000032_6449_6778 | 101 |
| 506 | 3300044673 | Ga0453683_0009223 | Ga0453683_0009223_4260_4589 | 101 |
| 507 | 3300044673 | Ga0453683_0017770 | Ga0453683_0017770_2304_2633 | 101 |
| 508 | 3300044673 | Ga0453683_0020317 | Ga0453683_0020317_523_852 | 101 |
| 509 | 3300044673 | Ga0453683_0066690 | Ga0453683_0066690_611_919 | 101 |
| 510 | 3300044673 | Ga0453683_0136124 | Ga0453683_0136124_815_1120 | 101 |
| 511 | 3300044673 | Ga0453683_0148416 | Ga0453683_0148416_34_363 | 101 |
| 512 | 3300044673 | Ga0453683_0308039 | Ga0453683_0308039_11_340 | 101 |
| 513 | 3300044712 | Ga0453684_0001733 | Ga0453684_0001733_27182_27511 | 101 |
| 514 | 3300044712 | Ga0453684_0146325 | Ga0453684_0146325_2425_2733 | 101 |
| 515 | 3300044712 | Ga0453684_0422354 | Ga0453684_0422354_92_421 | 101 |
| 516 | 3300044712 | Ga0453684_0700262 | Ga0453684_0700262_543_872 | 101 |
| 517 | 3300045051 | Ga0451576_0008374 | Ga0451576_0008374_10176_10505 | 101 |
| 518 | 3300045051 | Ga0451576_0061299 | Ga0451576_0061299_2343_2672 | 101 |
| 519 | 3300045051 | Ga0451576_0097813 | Ga0451576_0097813_2541_2849 | 101 |
| 520 | 3300045051 | Ga0451576_0152648 | Ga0451576_0152648_1820_2149 | 101 |
| 521 | 3300045051 | Ga0451576_0265047 | Ga0451576_0265047_1173_1502 | 101 |
| 522 | 3300045051 | Ga0451576_0638834 | Ga0451576_0638834_576_881 | 101 |
| 523 | 3300045051 | Ga0451576_0954320 | Ga0451576_0954320_233_538 | 101 |
| 524 | 3300045051 | Ga0451576_1551875 | Ga0451576_1551875_254_583 | 101 |
| 525 | 3300046477 | Ga0495664_0443934 | Ga0495664_0443934_313_618 | 101 |
| 526 | 3300046491 | Ga0495584_0688684 | Ga0495584_0688684_183_488 | 101 |
| 527 | 3300046506 | Ga0495583_0182942 | Ga0495583_0182942_149_454 | 101 |
| 528 | 3300046516 | Ga0495628_1029490 | Ga0495628_1029490_87_392 | 101 |
| 529 | 3300046517 | Ga0495630_1077588 | Ga0495630_1077588_236_541 | 101 |
| 530 | 3300046517 | Ga0495630_1162612 | Ga0495630_1162612_112_417 | 101 |
| 531 | 3300046529 | Ga0495652_0536179 | Ga0495652_0536179_203_508 | 101 |
| 532 | 3300046539 | Ga0495621_0409546 | Ga0495621_0409546_96_401 | 101 |
| 533 | 3300046557 | Ga0495622_0381757 | Ga0495622_0381757_163_468 | 101 |
| 534 | 3300046559 | Ga0495667_0918921 | Ga0495667_0918921_197_502 | 101 |
| 535 | 3300046660 | Ga0495625_0484352 | Ga0495625_0484352_353_658 | 101 |
| 536 | 3300046660 | Ga0495625_0768660 | Ga0495625_0768660_246_551 | 101 |
| 537 | 3300046678 | Ga0495599_0836478 | Ga0495599_0836478_126_431 | 101 |
| 538 | 3300046681 | Ga0495647_0058416 | Ga0495647_0058416_1088_1393 | 101 |
| 539 | 3300046684 | Ga0495669_0225438 | Ga0495669_0225438_267_572 | 101 |
| 540 | 3300047317 | Ga0495604_0627271 | Ga0495604_0627271_16_321 | 101 |
| 541 | 3300047317 | Ga0495604_0869084 | Ga0495604_0869084_114_419 | 101 |
| 542 | 3300047319 | Ga0495674_0849802 | Ga0495674_0849802_338_643 | 101 |
| 543 | 3300047320 | Ga0495672_0108070 | Ga0495672_0108070_760_1065 | 101 |
| 544 | 3300047320 | Ga0495672_0310688 | Ga0495672_0310688_218_523 | 101 |
| 545 | 3300047322 | Ga0495680_0761927 | Ga0495680_0761927_179_484 | 101 |
| 546 | 3300048903 | Ga0496100_0421868 | Ga0496100_0421868_392_697 | 101 |
| 547 | 3300048905 | Ga0496102_0425706 | Ga0496102_0425706_409_738 | 101 |
| 548 | 3300048909 | Ga0496106_0609077 | Ga0496106_0609077_141_446 | 101 |
| 549 | 3300048911 | Ga0496108_0762198 | Ga0496108_0762198_83_403 | 101 |
| 550 | 3300048912 | Ga0496109_0702894 | Ga0496109_0702894_446_766 | 101 |
| 551 | 3300048912 | Ga0496109_1387016 | Ga0496109_1387016_91_402 | 101 |
| 552 | 3300048913 | Ga0496110_0132646 | Ga0496110_0132646_865_1170 | 101 |
| 553 | 3300048914 | Ga0496111_0982424 | Ga0496111_0982424_50_355 | 101 |
| 554 | 3300048915 | Ga0496112_0064201 | Ga0496112_0064201_2485_2790 | 101 |
| 555 | 3300048916 | Ga0496113_0212463 | Ga0496113_0212463_1056_1361 | 101 |
| 556 | 3300049460 | Ga0495682_0189225 | Ga0495682_0189225_126_431 | 101 |
| 557 | 3300049460 | Ga0495682_0375173 | Ga0495682_0375173_179_484 | 101 |
| 558 | 3300049568 | Ga0501031_0002792 | Ga0501031_0002792_3693_4022 | 101 |
| 559 | 3300049568 | Ga0501031_0163074 | Ga0501031_0163074_930_1256 | 101 |
| 560 | 3300049569 | Ga0501032_0216506 | Ga0501032_0216506_497_826 | 101 |
| 561 | 3300049569 | Ga0501032_0253784 | Ga0501032_0253784_409_735 | 101 |
| 562 | 3300049570 | Ga0501033_0000085 | Ga0501033_0000085_6473_6802 | 101 |
| 563 | 3300049570 | Ga0501033_0090458 | Ga0501033_0090458_1663_1989 | 101 |
| 564 | 3300049570 | Ga0501033_0478985 | Ga0501033_0478985_291_596 | 101 |
| 565 | 3300049571 | Ga0501034_0001212 | Ga0501034_0001212_13901_14206 | 101 |
| 566 | 3300049571 | Ga0501034_0034188 | Ga0501034_0034188_389_721 | 101 |
| 567 | 3300049571 | Ga0501034_0049580 | Ga0501034_0049580_536_865 | 101 |
| 568 | 3300049571 | Ga0501034_0817949 | Ga0501034_0817949_479_805 | 101 |
| 569 | 3300049572 | Ga0501036_0188338 | Ga0501036_0188338_1319_1648 | 101 |
| 570 | 3300049572 | Ga0501036_0324031 | Ga0501036_0324031_802_1128 | 101 |
| 571 | 3300049572 | Ga0501036_1672578 | Ga0501036_1672578_163_495 | 101 |
| 572 | 3300049573 | Ga0501037_0015737 | Ga0501037_0015737_4919_5248 | 101 |
| 573 | 3300049573 | Ga0501037_0269954 | Ga0501037_0269954_435_761 | 101 |
| 574 | 3300049574 | Ga0501038_0012467 | Ga0501038_0012467_3856_4188 | 101 |
| 575 | 3300049574 | Ga0501038_0017727 | Ga0501038_0017727_5262_5591 | 101 |
| 576 | 3300049574 | Ga0501038_0266568 | Ga0501038_0266568_325_630 | 101 |
| 577 | 3300049574 | Ga0501038_0490525 | Ga0501038_0490525_233_559 | 101 |
| 578 | 3300049574 | Ga0501038_0880794 | Ga0501038_0880794_91_396 | 101 |
| 579 | 3300049575 | Ga0501039_0011528 | Ga0501039_0011528_5115_5444 | 101 |
| 580 | 3300049575 | Ga0501039_1367532 | Ga0501039_1367532_105_410 | 101 |
| 581 | 3300049577 | Ga0501041_0271626 | Ga0501041_0271626_735_1040 | 101 |
| 582 | 3300049577 | Ga0501041_0332201 | Ga0501041_0332201_148_453 | 101 |
| 583 | 3300049577 | Ga0501041_0743536 | Ga0501041_0743536_40_345 | 101 |
| 584 | 3300049577 | Ga0501041_1018570 | Ga0501041_1018570_22_327 | 101 |
| 585 | 3300049578 | Ga0501042_1341633 | Ga0501042_1341633_91_396 | 101 |
| 586 | 3300049579 | Ga0501043_0013251 | Ga0501043_0013251_975_1304 | 101 |
| 587 | 3300049580 | Ga0501046_0342532 | Ga0501046_0342532_393_698 | 101 |
| 588 | 3300049581 | Ga0501047_0072634 | Ga0501047_0072634_1805_2134 | 101 |
| 589 | 3300049582 | Ga0501048_0248023 | Ga0501048_0248023_907_1212 | 101 |
| 590 | 3300049584 | Ga0501068_0033874 | Ga0501068_0033874_765_1070 | 101 |
| 591 | 3300049584 | Ga0501068_0265977 | Ga0501068_0265977_748_1053 | 101 |
| 592 | 3300049585 | Ga0501069_0400882 | Ga0501069_0400882_10_315 | 101 |
| 593 | 3300049586 | Ga0501070_0322926 | Ga0501070_0322926_409_735 | 101 |
| 594 | 3300049586 | Ga0501070_0614077 | Ga0501070_0614077_460_789 | 101 |
| 595 | 3300049587 | Ga0501071_0094000 | Ga0501071_0094000_1047_1352 | 101 |
| 596 | 3300049587 | Ga0501071_0398382 | Ga0501071_0398382_280_585 | 101 |
| 597 | 3300049587 | Ga0501071_0736066 | Ga0501071_0736066_426_731 | 101 |
| 598 | 3300049588 | Ga0501072_0443767 | Ga0501072_0443767_373_678 | 101 |
| 599 | 3300049588 | Ga0501072_0520425 | Ga0501072_0520425_29_334 | 101 |
| 600 | 3300049588 | Ga0501072_0737821 | Ga0501072_0737821_134_439 | 101 |
| 601 | 3300049589 | Ga0501073_0247457 | Ga0501073_0247457_393_698 | 101 |
| 602 | 3300049589 | Ga0501073_0474504 | Ga0501073_0474504_397_702 | 101 |
| 603 | 3300049589 | Ga0501073_0760608 | Ga0501073_0760608_237_563 | 101 |
| 604 | 3300049591 | Ga0501075_0027238 | Ga0501075_0027238_3314_3619 | 101 |
| 605 | 3300049591 | Ga0501075_0053690 | Ga0501075_0053690_1773_2078 | 101 |
| 606 | 3300049591 | Ga0501075_0242458 | Ga0501075_0242458_237_542 | 101 |
| 607 | 3300049592 | Ga0501076_0025159 | Ga0501076_0025159_1845_2150 | 101 |
| 608 | 3300049592 | Ga0501076_0813723 | Ga0501076_0813723_124_429 | 101 |
| 609 | 3300049593 | Ga0501077_0158129 | Ga0501077_0158129_584_889 | 101 |
| 610 | 3300049658 | Ga0501211_015065 | Ga0501211_015065_346_651 | 101 |
| 611 | 3300049672 | Ga0501239_030106 | Ga0501239_030106_219_524 | 101 |
| 612 | 3300049679 | Ga0501249_160610 | Ga0501249_160610_52_357 | 101 |
| 613 | 3300049741 | Ga0501079_0026434 | Ga0501079_0026434_3995_4300 | 101 |
| 614 | 3300049741 | Ga0501079_0292252 | Ga0501079_0292252_615_920 | 101 |
| 615 | 3300049741 | Ga0501079_1075017 | Ga0501079_1075017_250_555 | 101 |
| 616 | 3300049742 | Ga0501080_0202291 | Ga0501080_0202291_1137_1442 | 101 |
| 617 | 3300049742 | Ga0501080_0869247 | Ga0501080_0869247_10_336 | 101 |
| 618 | 3300049742 | Ga0501080_1466511 | Ga0501080_1466511_101_406 | 101 |
| 619 | 3300049743 | Ga0501081_0028494 | Ga0501081_0028494_1038_1343 | 101 |
| 620 | 3300049743 | Ga0501081_0054930 | Ga0501081_0054930_814_1119 | 101 |
| 621 | 3300049760 | Ga0501263_023819 | Ga0501263_023819_434_760 | 101 |
| 622 | 3300049822 | Ga0501035_0078930 | Ga0501035_0078930_160_489 | 101 |
| 623 | 3300049822 | Ga0501035_0206765 | Ga0501035_0206765_989_1315 | 101 |
| 624 | 3300049822 | Ga0501035_0226715 | Ga0501035_0226715_597_902 | 101 |
| 625 | 3300049823 | Ga0501044_0025207 | Ga0501044_0025207_1164_1493 | 101 |
| 626 | 3300049824 | Ga0501045_0000020 | Ga0501045_0000020_59246_59575 | 101 |
| 627 | 3300049824 | Ga0501045_0180250 | Ga0501045_0180250_776_1081 | 101 |
| 628 | 3300049853 | Ga0501226_017026 | Ga0501226_017026_277_582 | 101 |
| 629 | 3300050507 | nmdc:mga05p37_2119605_c1 | nmdc:mga05p37_2119605_c1_87_392 | 101 |
| 630 | 3300050507 | nmdc:mga05p37_57894_c1 | nmdc:mga05p37_57894_c1_91_396 | 101 |
| 631 | 3300050507 | nmdc:mga05p37_642932_c1 | nmdc:mga05p37_642932_c1_377_682 | 101 |
| 632 | 3300050508 | nmdc:mga09592_1126591_c1 | nmdc:mga09592_1126591_c1_317_622 | 101 |
| 633 | 3300050508 | nmdc:mga09592_117461_c1 | nmdc:mga09592_117461_c1_206_511 | 101 |
| 634 | 3300050508 | nmdc:mga09592_1625_c1 | nmdc:mga09592_1625_c1_14112_14417 | 101 |
| 635 | 3300050509 | nmdc:mga0qj67_101746_c1 | nmdc:mga0qj67_101746_c1_328_633 | 101 |
| 636 | 3300050509 | nmdc:mga0qj67_403095_c1 | nmdc:mga0qj67_403095_c1_37_342 | 101 |
| 637 | 3300050510 | nmdc:mga06r32_1247364_c1 | nmdc:mga06r32_1247364_c1_12_317 | 101 |
| 638 | 3300050510 | nmdc:mga06r32_146441_c1 | nmdc:mga06r32_146441_c1_1272_1577 | 101 |
| 639 | 3300050510 | nmdc:mga06r32_354889_c1 | nmdc:mga06r32_354889_c1_1085_1390 | 101 |
| 640 | 3300050510 | nmdc:mga06r32_7529_c1 | nmdc:mga06r32_7529_c1_1513_1818 | 101 |
| 641 | 3300050511 | nmdc:mga08y16_303578_c1 | nmdc:mga08y16_303578_c1_740_1045 | 101 |
| 642 | 3300050511 | nmdc:mga08y16_346922_c1 | nmdc:mga08y16_346922_c1_1084_1389 | 101 |
| 643 | 3300050511 | nmdc:mga08y16_46278_c1 | nmdc:mga08y16_46278_c1_1488_1793 | 101 |
| 644 | 3300050511 | nmdc:mga08y16_7763_c1 | nmdc:mga08y16_7763_c1_8646_8951 | 101 |
| 645 | 3300050512 | nmdc:mga0n895_67879_c1 | nmdc:mga0n895_67879_c1_912_1217 | 101 |
| 646 | 3300050515 | nmdc:mga0a205_13260_c1 | nmdc:mga0a205_13260_c1_5425_5730 | 101 |
| 647 | 3300050515 | nmdc:mga0a205_578032_c1 | nmdc:mga0a205_578032_c1_177_482 | 101 |
| 648 | 3300053077 | Ga0495601_0061880 | Ga0495601_0061880_1113_1418 | 101 |
| 649 | 3300053085 | Ga0495619_0139532 | Ga0495619_0139532_679_984 | 101 |
| 650 | 3300053093 | Ga0500651_0000291 | Ga0500651_0000291_960_1265 | 101 |
| 651 | 3300053124 | Ga0500617_174776 | Ga0500617_174776_202_507 | 101 |
| 652 | 3300053178 | Ga0500637_0202398 | Ga0500637_0202398_750_1055 | 101 |
| 653 | 3300054114 | Ga0501084_0022989 | Ga0501084_0022989_2001_2306 | 101 |
| 654 | 3300054114 | Ga0501084_1337863 | Ga0501084_1337863_282_587 | 101 |
| 655 | 3300060353 | Ga0501082_0074716 | Ga0501082_0074716_2267_2572 | 101 |
| 656 | 3300060353 | Ga0501082_0665126 | Ga0501082_0665126_480_785 | 101 |
| 657 | 3300060353 | Ga0501082_0781625 | Ga0501082_0781625_96_401 | 101 |
| 658 | 3300060353 | Ga0501082_0826763 | Ga0501082_0826763_220_525 | 101 |
| 659 | 3300061734 | Ga0530510_0025314 | Ga0530510_0025314_1013_1318 | 101 |
| 660 | iso_pu_bacteria | 2894414249 | 2894415878 | 101 |
| 661 | iso_pu_bacteria | 8003014200 | 8003014559 | 101 |
| 662 | 3300001915 | JGI24741J21665_1006058 | JGI24741J21665_10060582 | 102 |
| 663 | 3300001979 | JGI24740J21852_10000237 | JGI24740J21852_1000023724 | 102 |
| 664 | 3300001979 | JGI24740J21852_10011357 | JGI24740J21852_100113573 | 102 |
| 665 | 3300001990 | JGI24737J22298_10211635 | JGI24737J22298_102116352 | 102 |
| 666 | 3300001991 | JGI24743J22301_10155886 | JGI24743J22301_101558861 | 102 |
| 667 | 3300005295 | Ga0065707_10054676 | Ga0065707_100546761 | 102 |
| 668 | 3300005328 | Ga0070676_10405320 | Ga0070676_104053202 | 102 |
| 669 | 3300005328 | Ga0070676_10756693 | Ga0070676_107566932 | 102 |
| 670 | 3300005329 | Ga0070683_100136912 | Ga0070683_1001369123 | 102 |
| 671 | 3300005329 | Ga0070683_100273316 | Ga0070683_1002733162 | 102 |
| 672 | 3300005329 | Ga0070683_100919141 | Ga0070683_1009191411 | 102 |
| 673 | 3300005329 | Ga0070683_102417418 | Ga0070683_1024174182 | 102 |
| 674 | 3300005334 | Ga0068869_101473734 | Ga0068869_1014737341 | 102 |
| 675 | 3300005335 | Ga0070666_11206043 | Ga0070666_112060432 | 102 |
| 676 | 3300005336 | Ga0070680_100010185 | Ga0070680_1000101852 | 102 |
| 677 | 3300005336 | Ga0070680_100012762 | Ga0070680_1000127625 | 102 |
| 678 | 3300005336 | Ga0070680_100081997 | Ga0070680_1000819972 | 102 |
| 679 | 3300005336 | Ga0070680_100083592 | Ga0070680_1000835922 | 102 |
| 680 | 3300005336 | Ga0070680_100120220 | Ga0070680_1001202202 | 102 |
| 681 | 3300005336 | Ga0070680_101417565 | Ga0070680_1014175652 | 102 |
| 682 | 3300005337 | Ga0070682_100423380 | Ga0070682_1004233802 | 102 |
| 683 | 3300005337 | Ga0070682_100746539 | Ga0070682_1007465392 | 102 |
| 684 | 3300005338 | Ga0068868_100389275 | Ga0068868_1003892753 | 102 |
| 685 | 3300005339 | Ga0070660_100163303 | Ga0070660_1001633032 | 102 |
| 686 | 3300005339 | Ga0070660_100274175 | Ga0070660_1002741751 | 102 |
| 687 | 3300005339 | Ga0070660_100816918 | Ga0070660_1008169182 | 102 |
| 688 | 3300005339 | Ga0070660_101133197 | Ga0070660_1011331972 | 102 |
| 689 | 3300005340 | Ga0070689_100575973 | Ga0070689_1005759732 | 102 |
| 690 | 3300005341 | Ga0070691_10004253 | Ga0070691_100042534 | 102 |
| 691 | 3300005341 | Ga0070691_10011711 | Ga0070691_100117113 | 102 |
| 692 | 3300005341 | Ga0070691_10070928 | Ga0070691_100709281 | 102 |
| 693 | 3300005341 | Ga0070691_10233691 | Ga0070691_102336912 | 102 |
| 694 | 3300005341 | Ga0070691_10293733 | Ga0070691_102937332 | 102 |
| 695 | 3300005341 | Ga0070691_10465498 | Ga0070691_104654982 | 102 |
| 696 | 3300005343 | Ga0070687_100266341 | Ga0070687_1002663412 | 102 |
| 697 | 3300005344 | Ga0070661_100195995 | Ga0070661_1001959952 | 102 |
| 698 | 3300005344 | Ga0070661_100246458 | Ga0070661_1002464582 | 102 |
| 699 | 3300005344 | Ga0070661_100286391 | Ga0070661_1002863912 | 102 |
| 700 | 3300005345 | Ga0070692_10057240 | Ga0070692_100572402 | 102 |
| 701 | 3300005345 | Ga0070692_10104041 | Ga0070692_101040412 | 102 |
| 702 | 3300005345 | Ga0070692_10207647 | Ga0070692_102076472 | 102 |
| 703 | 3300005345 | Ga0070692_10268720 | Ga0070692_102687202 | 102 |
| 704 | 3300005345 | Ga0070692_10292766 | Ga0070692_102927662 | 102 |
| 705 | 3300005354 | Ga0070675_100388095 | Ga0070675_1003880952 | 102 |
| 706 | 3300005364 | Ga0070673_100243847 | Ga0070673_1002438473 | 102 |
| 707 | 3300005365 | Ga0070688_100254433 | Ga0070688_1002544332 | 102 |
| 708 | 3300005365 | Ga0070688_101140230 | Ga0070688_1011402302 | 102 |
| 709 | 3300005365 | Ga0070688_101159335 | Ga0070688_1011593352 | 102 |
| 710 | 3300005366 | Ga0070659_100413522 | Ga0070659_1004135222 | 102 |
| 711 | 3300005366 | Ga0070659_100481130 | Ga0070659_1004811302 | 102 |
| 712 | 3300005366 | Ga0070659_100490138 | Ga0070659_1004901382 | 102 |
| 713 | 3300005367 | Ga0070667_100885685 | Ga0070667_1008856852 | 102 |
| 714 | 3300005406 | Ga0070703_10018767 | Ga0070703_100187672 | 102 |
| 715 | 3300005406 | Ga0070703_10349306 | Ga0070703_103493062 | 102 |
| 716 | 3300005437 | Ga0070710_11254403 | Ga0070710_112544031 | 102 |
| 717 | 3300005438 | Ga0070701_10127975 | Ga0070701_101279752 | 102 |
| 718 | 3300005438 | Ga0070701_10489333 | Ga0070701_104893332 | 102 |
| 719 | 3300005441 | Ga0070700_100047238 | Ga0070700_1000472382 | 102 |
| 720 | 3300005444 | Ga0070694_100209070 | Ga0070694_1002090702 | 102 |
| 721 | 3300005444 | Ga0070694_100546655 | Ga0070694_1005466552 | 102 |
| 722 | 3300005445 | Ga0070708_100079144 | Ga0070708_1000791442 | 102 |
| 723 | 3300005455 | Ga0070663_100141159 | Ga0070663_1001411592 | 102 |
| 724 | 3300005455 | Ga0070663_100220903 | Ga0070663_1002209032 | 102 |
| 725 | 3300005455 | Ga0070663_100610469 | Ga0070663_1006104692 | 102 |
| 726 | 3300005455 | Ga0070663_100862664 | Ga0070663_1008626642 | 102 |
| 727 | 3300005455 | Ga0070663_101595517 | Ga0070663_1015955171 | 102 |
| 728 | 3300005456 | Ga0070678_100010243 | Ga0070678_1000102433 | 102 |
| 729 | 3300005457 | Ga0070662_100019867 | Ga0070662_1000198673 | 102 |
| 730 | 3300005458 | Ga0070681_10004547 | Ga0070681_1000454710 | 102 |
| 731 | 3300005458 | Ga0070681_10008405 | Ga0070681_100084052 | 102 |
| 732 | 3300005458 | Ga0070681_10015299 | Ga0070681_100152997 | 102 |
| 733 | 3300005458 | Ga0070681_10017110 | Ga0070681_100171104 | 102 |
| 734 | 3300005458 | Ga0070681_10370064 | Ga0070681_103700642 | 102 |
| 735 | 3300005458 | Ga0070681_10595502 | Ga0070681_105955022 | 102 |
| 736 | 3300005458 | Ga0070681_10718045 | Ga0070681_107180451 | 102 |
| 737 | 3300005458 | Ga0070681_10941455 | Ga0070681_109414552 | 102 |
| 738 | 3300005459 | Ga0068867_100452282 | Ga0068867_1004522822 | 102 |
| 739 | 3300005466 | Ga0070685_10738716 | Ga0070685_107387162 | 102 |
| 740 | 3300005467 | Ga0070706_100009220 | Ga0070706_10000922010 | 102 |
| 741 | 3300005467 | Ga0070706_100598445 | Ga0070706_1005984451 | 102 |
| 742 | 3300005471 | Ga0070698_100002102 | Ga0070698_10000210222 | 102 |
| 743 | 3300005471 | Ga0070698_100549186 | Ga0070698_1005491862 | 102 |
| 744 | 3300005518 | Ga0070699_100072373 | Ga0070699_1000723732 | 102 |
| 745 | 3300005530 | Ga0070679_100001961 | Ga0070679_1000019613 | 102 |
| 746 | 3300005530 | Ga0070679_100004237 | Ga0070679_1000042375 | 102 |
| 747 | 3300005530 | Ga0070679_100015882 | Ga0070679_1000158824 | 102 |
| 748 | 3300005530 | Ga0070679_100064213 | Ga0070679_1000642134 | 102 |
| 749 | 3300005530 | Ga0070679_100225500 | Ga0070679_1002255002 | 102 |
| 750 | 3300005530 | Ga0070679_101551627 | Ga0070679_1015516271 | 102 |
| 751 | 3300005530 | Ga0070679_101878527 | Ga0070679_1018785271 | 102 |
| 752 | 3300005535 | Ga0070684_100156802 | Ga0070684_1001568022 | 102 |
| 753 | 3300005535 | Ga0070684_100328958 | Ga0070684_1003289582 | 102 |
| 754 | 3300005535 | Ga0070684_100558539 | Ga0070684_1005585392 | 102 |
| 755 | 3300005536 | Ga0070697_100224180 | Ga0070697_1002241802 | 102 |
| 756 | 3300005539 | Ga0068853_100187786 | Ga0068853_1001877862 | 102 |
| 757 | 3300005539 | Ga0068853_100272660 | Ga0068853_1002726603 | 102 |
| 758 | 3300005539 | Ga0068853_101344939 | Ga0068853_1013449392 | 102 |
| 759 | 3300005544 | Ga0070686_101053025 | Ga0070686_1010530252 | 102 |
| 760 | 3300005545 | Ga0070695_100534388 | Ga0070695_1005343882 | 102 |
| 761 | 3300005546 | Ga0070696_100002369 | Ga0070696_10000236911 | 102 |
| 762 | 3300005546 | Ga0070696_100216133 | Ga0070696_1002161332 | 102 |
| 763 | 3300005546 | Ga0070696_101611169 | Ga0070696_1016111692 | 102 |
| 764 | 3300005547 | Ga0070693_100005733 | Ga0070693_1000057335 | 102 |
| 765 | 3300005547 | Ga0070693_100316979 | Ga0070693_1003169792 | 102 |
| 766 | 3300005548 | Ga0070665_100082650 | Ga0070665_1000826503 | 102 |
| 767 | 3300005548 | Ga0070665_100092027 | Ga0070665_1000920273 | 102 |
| 768 | 3300005548 | Ga0070665_101127947 | Ga0070665_1011279472 | 102 |
| 769 | 3300005549 | Ga0070704_100337583 | Ga0070704_1003375831 | 102 |
| 770 | 3300005563 | Ga0068855_100002743 | Ga0068855_10000274318 | 102 |
| 771 | 3300005563 | Ga0068855_100375704 | Ga0068855_1003757042 | 102 |
| 772 | 3300005563 | Ga0068855_100434091 | Ga0068855_1004340912 | 102 |
| 773 | 3300005563 | Ga0068855_101908594 | Ga0068855_1019085942 | 102 |
| 774 | 3300005564 | Ga0070664_100095569 | Ga0070664_1000955692 | 102 |
| 775 | 3300005564 | Ga0070664_100637936 | Ga0070664_1006379362 | 102 |
| 776 | 3300005564 | Ga0070664_101529743 | Ga0070664_1015297432 | 102 |
| 777 | 3300005577 | Ga0068857_100080822 | Ga0068857_1000808224 | 102 |
| 778 | 3300005577 | Ga0068857_100478674 | Ga0068857_1004786742 | 102 |
| 779 | 3300005577 | Ga0068857_101036320 | Ga0068857_1010363202 | 102 |
| 780 | 3300005578 | Ga0068854_100090261 | Ga0068854_1000902612 | 102 |
| 781 | 3300005578 | Ga0068854_100392414 | Ga0068854_1003924142 | 102 |
| 782 | 3300005578 | Ga0068854_100747621 | Ga0068854_1007476212 | 102 |
| 783 | 3300005578 | Ga0068854_102135244 | Ga0068854_1021352441 | 102 |
| 784 | 3300005578 | Ga0068854_102188257 | Ga0068854_1021882572 | 102 |
| 785 | 3300005614 | Ga0068856_100012478 | Ga0068856_1000124782 | 102 |
| 786 | 3300005614 | Ga0068856_100249036 | Ga0068856_1002490362 | 102 |
| 787 | 3300005614 | Ga0068856_101093939 | Ga0068856_1010939392 | 102 |
| 788 | 3300005615 | Ga0070702_100623626 | Ga0070702_1006236261 | 102 |
| 789 | 3300005616 | Ga0068852_100212154 | Ga0068852_1002121543 | 102 |
| 790 | 3300005616 | Ga0068852_100322544 | Ga0068852_1003225442 | 102 |
| 791 | 3300005616 | Ga0068852_100502481 | Ga0068852_1005024812 | 102 |
| 792 | 3300005616 | Ga0068852_100831271 | Ga0068852_1008312712 | 102 |
| 793 | 3300005617 | Ga0068859_100065390 | Ga0068859_1000653903 | 102 |
| 794 | 3300005617 | Ga0068859_100296267 | Ga0068859_1002962672 | 102 |
| 795 | 3300005617 | Ga0068859_101621020 | Ga0068859_1016210202 | 102 |
| 796 | 3300005618 | Ga0068864_100480311 | Ga0068864_1004803112 | 102 |
| 797 | 3300005718 | Ga0068866_10424016 | Ga0068866_104240162 | 102 |
| 798 | 3300005719 | Ga0068861_100291376 | Ga0068861_1002913762 | 102 |
| 799 | 3300005719 | Ga0068861_102681873 | Ga0068861_1026818732 | 102 |
| 800 | 3300005834 | Ga0068851_10119168 | Ga0068851_101191682 | 102 |
| 801 | 3300005834 | Ga0068851_11023400 | Ga0068851_110234002 | 102 |
| 802 | 3300005841 | Ga0068863_101033480 | Ga0068863_1010334802 | 102 |
| 803 | 3300005841 | Ga0068863_102032468 | Ga0068863_1020324682 | 102 |
| 804 | 3300005842 | Ga0068858_101384966 | Ga0068858_1013849662 | 102 |
| 805 | 3300005843 | Ga0068860_100300092 | Ga0068860_1003000922 | 102 |
| 806 | 3300005843 | Ga0068860_100494327 | Ga0068860_1004943272 | 102 |
| 807 | 3300005843 | Ga0068860_102021474 | Ga0068860_1020214742 | 102 |
| 808 | 3300005844 | Ga0068862_100168706 | Ga0068862_1001687064 | 102 |
| 809 | 3300005844 | Ga0068862_100613855 | Ga0068862_1006138552 | 102 |
| 810 | 3300005844 | Ga0068862_101083502 | Ga0068862_1010835022 | 102 |
| 811 | 3300005937 | Ga0081455_10000268 | Ga0081455_100002683 | 102 |
| 812 | 3300005937 | Ga0081455_10204578 | Ga0081455_102045782 | 102 |
| 813 | 3300005981 | Ga0081538_10084296 | Ga0081538_100842961 | 102 |
| 814 | 3300005985 | Ga0081539_10013083 | Ga0081539_100130836 | 102 |
| 815 | 3300006038 | Ga0075365_10558830 | Ga0075365_105588302 | 102 |
| 816 | 3300006042 | Ga0075368_10050117 | Ga0075368_100501171 | 102 |
| 817 | 3300006042 | Ga0075368_10055615 | Ga0075368_100556152 | 102 |
| 818 | 3300006048 | Ga0075363_100236481 | Ga0075363_1002364812 | 102 |
| 819 | 3300006051 | Ga0075364_10543097 | Ga0075364_105430971 | 102 |
| 820 | 3300006051 | Ga0075364_10559743 | Ga0075364_105597432 | 102 |
| 821 | 3300006175 | Ga0070712_100583517 | Ga0070712_1005835171 | 102 |
| 822 | 3300006177 | Ga0075362_10008923 | Ga0075362_100089233 | 102 |
| 823 | 3300006177 | Ga0075362_10020897 | Ga0075362_100208972 | 102 |
| 824 | 3300006177 | Ga0075362_10047714 | Ga0075362_100477142 | 102 |
| 825 | 3300006177 | Ga0075362_10167732 | Ga0075362_101677321 | 102 |
| 826 | 3300006177 | Ga0075362_10625954 | Ga0075362_106259542 | 102 |
| 827 | 3300006178 | Ga0075367_10041520 | Ga0075367_100415203 | 102 |
| 828 | 3300006178 | Ga0075367_10168964 | Ga0075367_101689642 | 102 |
| 829 | 3300006178 | Ga0075367_10238885 | Ga0075367_102388852 | 102 |
| 830 | 3300006186 | Ga0075369_10008002 | Ga0075369_100080023 | 102 |
| 831 | 3300006186 | Ga0075369_10030877 | Ga0075369_100308772 | 102 |
| 832 | 3300006186 | Ga0075369_10272459 | Ga0075369_102724592 | 102 |
| 833 | 3300006195 | Ga0075366_10305473 | Ga0075366_103054732 | 102 |
| 834 | 3300006195 | Ga0075366_10414108 | Ga0075366_104141082 | 102 |
| 835 | 3300006195 | Ga0075366_11058337 | Ga0075366_110583372 | 102 |
| 836 | 3300006237 | Ga0097621_100733281 | Ga0097621_1007332812 | 102 |
| 837 | 3300006353 | Ga0075370_10064170 | Ga0075370_100641704 | 102 |
| 838 | 3300006353 | Ga0075370_10139524 | Ga0075370_101395243 | 102 |
| 839 | 3300006353 | Ga0075370_10278040 | Ga0075370_102780402 | 102 |
| 840 | 3300006358 | Ga0068871_100874852 | Ga0068871_1008748522 | 102 |
| 841 | 3300006844 | Ga0075428_100346444 | Ga0075428_1003464442 | 102 |
| 842 | 3300006844 | Ga0075428_100481381 | Ga0075428_1004813812 | 102 |
| 843 | 3300006846 | Ga0075430_100282401 | Ga0075430_1002824012 | 102 |
| 844 | 3300006852 | Ga0075433_10488278 | Ga0075433_104882782 | 102 |
| 845 | 3300006871 | Ga0075434_100753152 | Ga0075434_1007531522 | 102 |
| 846 | 3300006880 | Ga0075429_101336271 | Ga0075429_1013362712 | 102 |
| 847 | 3300006931 | Ga0097620_100065389 | Ga0097620_1000653893 | 102 |
| 848 | 3300006931 | Ga0097620_100296272 | Ga0097620_1002962722 | 102 |
| 849 | 3300006931 | Ga0097620_101620990 | Ga0097620_1016209902 | 102 |
| 850 | 3300007265 | Ga0099794_10518170 | Ga0099794_105181702 | 102 |
| 851 | 3300007788 | Ga0099795_10025934 | Ga0099795_100259342 | 102 |
| 852 | 3300009093 | Ga0105240_10019139 | Ga0105240_100191394 | 102 |
| 853 | 3300009093 | Ga0105240_10223820 | Ga0105240_102238204 | 102 |
| 854 | 3300009093 | Ga0105240_10291794 | Ga0105240_102917942 | 102 |
| 855 | 3300009094 | Ga0111539_10277704 | Ga0111539_102777042 | 102 |
| 856 | 3300009094 | Ga0111539_10371852 | Ga0111539_103718521 | 102 |
| 857 | 3300009094 | Ga0111539_10378882 | Ga0111539_103788822 | 102 |
| 858 | 3300009094 | Ga0111539_12290432 | Ga0111539_122904322 | 102 |
| 859 | 3300009094 | Ga0111539_13435686 | Ga0111539_134356862 | 102 |
| 860 | 3300009098 | Ga0105245_10993126 | Ga0105245_109931261 | 102 |
| 861 | 3300009101 | Ga0105247_11181634 | Ga0105247_111816342 | 102 |
| 862 | 3300009148 | Ga0105243_10578939 | Ga0105243_105789392 | 102 |
| 863 | 3300009176 | Ga0105242_11888983 | Ga0105242_118889831 | 102 |
| 864 | 3300009545 | Ga0105237_10350907 | Ga0105237_103509072 | 102 |
| 865 | 3300009545 | Ga0105237_11572704 | Ga0105237_115727042 | 102 |
| 866 | 3300009551 | Ga0105238_10082734 | Ga0105238_100827345 | 102 |
| 867 | 3300009551 | Ga0105238_10405318 | Ga0105238_104053182 | 102 |
| 868 | 3300009551 | Ga0105238_10644448 | Ga0105238_106444482 | 102 |
| 869 | 3300009553 | Ga0105249_10929115 | Ga0105249_109291152 | 102 |
| 870 | 3300009553 | Ga0105249_11460237 | Ga0105249_114602372 | 102 |
| 871 | 3300009988 | Ga0105035_104908 | Ga0105035_1049082 | 102 |
| 872 | 3300009988 | Ga0105035_115012 | Ga0105035_1150121 | 102 |
| 873 | 3300010159 | Ga0099796_10152403 | Ga0099796_101524032 | 102 |
| 874 | 3300010375 | Ga0105239_10746592 | Ga0105239_107465922 | 102 |
| 875 | 3300010375 | Ga0105239_11525377 | Ga0105239_115253772 | 102 |
| 876 | 3300011119 | Ga0105246_11230406 | Ga0105246_112304061 | 102 |
| 877 | 3300012510 | Ga0157316_1020032 | Ga0157316_10200322 | 102 |
| 878 | 3300013100 | Ga0157373_10128973 | Ga0157373_101289734 | 102 |
| 879 | 3300013100 | Ga0157373_10163294 | Ga0157373_101632943 | 102 |
| 880 | 3300013100 | Ga0157373_10397466 | Ga0157373_103974662 | 102 |
| 881 | 3300013100 | Ga0157373_10586227 | Ga0157373_105862271 | 102 |
| 882 | 3300013102 | Ga0157371_10272431 | Ga0157371_102724312 | 102 |
| 883 | 3300013104 | Ga0157370_10232982 | Ga0157370_102329822 | 102 |
| 884 | 3300013104 | Ga0157370_10263741 | Ga0157370_102637412 | 102 |
| 885 | 3300013104 | Ga0157370_10283780 | Ga0157370_102837802 | 102 |
| 886 | 3300013104 | Ga0157370_10384293 | Ga0157370_103842932 | 102 |
| 887 | 3300013104 | Ga0157370_10501829 | Ga0157370_105018292 | 102 |
| 888 | 3300013104 | Ga0157370_10898316 | Ga0157370_108983162 | 102 |
| 889 | 3300013104 | Ga0157370_11922971 | Ga0157370_119229711 | 102 |
| 890 | 3300013105 | Ga0157369_10535490 | Ga0157369_105354902 | 102 |
| 891 | 3300013105 | Ga0157369_10560682 | Ga0157369_105606822 | 102 |
| 892 | 3300013105 | Ga0157369_10815163 | Ga0157369_108151632 | 102 |
| 893 | 3300013105 | Ga0157369_11588552 | Ga0157369_115885522 | 102 |
| 894 | 3300013105 | Ga0157369_11712607 | Ga0157369_117126072 | 102 |
| 895 | 3300013296 | Ga0157374_10660366 | Ga0157374_106603662 | 102 |
| 896 | 3300013296 | Ga0157374_11047909 | Ga0157374_110479092 | 102 |
| 897 | 3300013306 | Ga0163162_12276857 | Ga0163162_122768572 | 102 |
| 898 | 3300013307 | Ga0157372_10125411 | Ga0157372_101254112 | 102 |
| 899 | 3300013307 | Ga0157372_10228057 | Ga0157372_102280572 | 102 |
| 900 | 3300013307 | Ga0157372_10338190 | Ga0157372_103381902 | 102 |
| 901 | 3300013307 | Ga0157372_10924129 | Ga0157372_109241292 | 102 |
| 902 | 3300013308 | Ga0157375_10962784 | Ga0157375_109627842 | 102 |
| 903 | 3300013308 | Ga0157375_11092958 | Ga0157375_110929582 | 102 |
| 904 | 3300013875 | Ga0157515_112177 | Ga0157515_1121772 | 102 |
| 905 | 3300014325 | Ga0163163_12410127 | Ga0163163_124101271 | 102 |
| 906 | 3300014326 | Ga0157380_12627350 | Ga0157380_126273501 | 102 |
| 907 | 3300014497 | Ga0182008_10128865 | Ga0182008_101288652 | 102 |
| 908 | 3300014745 | Ga0157377_10898458 | Ga0157377_108984582 | 102 |
| 909 | 3300014745 | Ga0157377_10901973 | Ga0157377_109019732 | 102 |
| 910 | 3300014968 | Ga0157379_11897178 | Ga0157379_118971782 | 102 |
| 911 | 3300014969 | Ga0157376_10261648 | Ga0157376_102616483 | 102 |
| 912 | 3300015262 | Ga0182007_10145999 | Ga0182007_101459991 | 102 |
| 913 | 3300017792 | Ga0163161_10692538 | Ga0163161_106925382 | 102 |
| 914 | 3300020080 | Ga0206350_10919969 | Ga0206350_109199692 | 102 |
| 915 | 3300020081 | Ga0206354_10021222 | Ga0206354_100212224 | 102 |
| 916 | 3300020082 | Ga0206353_10035558 | Ga0206353_100355582 | 102 |
| 917 | 3300020082 | Ga0206353_11001100 | Ga0206353_110011002 | 102 |
| 918 | 3300020610 | Ga0154015_1173312 | Ga0154015_11733122 | 102 |
| 919 | 3300025321 | Ga0207656_10143901 | Ga0207656_101439011 | 102 |
| 920 | 3300025901 | Ga0207688_10214010 | Ga0207688_102140102 | 102 |
| 921 | 3300025903 | Ga0207680_11054491 | Ga0207680_110544912 | 102 |
| 922 | 3300025904 | Ga0207647_10016579 | Ga0207647_100165795 | 102 |
| 923 | 3300025904 | Ga0207647_10309413 | Ga0207647_103094132 | 102 |
| 924 | 3300025906 | Ga0207699_10486394 | Ga0207699_104863942 | 102 |
| 925 | 3300025907 | Ga0207645_10179437 | Ga0207645_101794372 | 102 |
| 926 | 3300025908 | Ga0207643_10638341 | Ga0207643_106383411 | 102 |
| 927 | 3300025909 | Ga0207705_10000083 | Ga0207705_1000008329 | 102 |
| 928 | 3300025909 | Ga0207705_10016964 | Ga0207705_100169645 | 102 |
| 929 | 3300025909 | Ga0207705_10132869 | Ga0207705_101328692 | 102 |
| 930 | 3300025909 | Ga0207705_10182418 | Ga0207705_101824182 | 102 |
| 931 | 3300025909 | Ga0207705_10470595 | Ga0207705_104705951 | 102 |
| 932 | 3300025910 | Ga0207684_10057826 | Ga0207684_100578264 | 102 |
| 933 | 3300025911 | Ga0207654_10100628 | Ga0207654_101006283 | 102 |
| 934 | 3300025911 | Ga0207654_10138259 | Ga0207654_101382592 | 102 |
| 935 | 3300025912 | Ga0207707_10000069 | Ga0207707_100000692 | 102 |
| 936 | 3300025912 | Ga0207707_10000292 | Ga0207707_1000029249 | 102 |
| 937 | 3300025912 | Ga0207707_10001098 | Ga0207707_1000109810 | 102 |
| 938 | 3300025912 | Ga0207707_10002049 | Ga0207707_100020497 | 102 |
| 939 | 3300025912 | Ga0207707_10002853 | Ga0207707_100028539 | 102 |
| 940 | 3300025912 | Ga0207707_10014746 | Ga0207707_100147464 | 102 |
| 941 | 3300025912 | Ga0207707_10042268 | Ga0207707_100422682 | 102 |
| 942 | 3300025912 | Ga0207707_10665327 | Ga0207707_106653272 | 102 |
| 943 | 3300025913 | Ga0207695_10003936 | Ga0207695_1000393612 | 102 |
| 944 | 3300025913 | Ga0207695_10004599 | Ga0207695_100045996 | 102 |
| 945 | 3300025913 | Ga0207695_10021124 | Ga0207695_100211247 | 102 |
| 946 | 3300025913 | Ga0207695_10149525 | Ga0207695_101495252 | 102 |
| 947 | 3300025913 | Ga0207695_10186630 | Ga0207695_101866302 | 102 |
| 948 | 3300025913 | Ga0207695_10205245 | Ga0207695_102052452 | 102 |
| 949 | 3300025913 | Ga0207695_10213921 | Ga0207695_102139213 | 102 |
| 950 | 3300025914 | Ga0207671_10538157 | Ga0207671_105381572 | 102 |
| 951 | 3300025917 | Ga0207660_10000080 | Ga0207660_100000804 | 102 |
| 952 | 3300025917 | Ga0207660_10011506 | Ga0207660_100115063 | 102 |
| 953 | 3300025917 | Ga0207660_10021757 | Ga0207660_100217572 | 102 |
| 954 | 3300025917 | Ga0207660_10037471 | Ga0207660_100374712 | 102 |
| 955 | 3300025917 | Ga0207660_10082740 | Ga0207660_100827402 | 102 |
| 956 | 3300025917 | Ga0207660_10138191 | Ga0207660_101381912 | 102 |
| 957 | 3300025917 | Ga0207660_10324961 | Ga0207660_103249612 | 102 |
| 958 | 3300025917 | Ga0207660_10936337 | Ga0207660_109363372 | 102 |
| 959 | 3300025918 | Ga0207662_10345307 | Ga0207662_103453072 | 102 |
| 960 | 3300025919 | Ga0207657_10164670 | Ga0207657_101646702 | 102 |
| 961 | 3300025919 | Ga0207657_10199572 | Ga0207657_101995723 | 102 |
| 962 | 3300025919 | Ga0207657_10405598 | Ga0207657_104055982 | 102 |
| 963 | 3300025920 | Ga0207649_10001073 | Ga0207649_100010734 | 102 |
| 964 | 3300025920 | Ga0207649_10181844 | Ga0207649_101818443 | 102 |
| 965 | 3300025920 | Ga0207649_10190129 | Ga0207649_101901292 | 102 |
| 966 | 3300025920 | Ga0207649_10356317 | Ga0207649_103563172 | 102 |
| 967 | 3300025920 | Ga0207649_10633114 | Ga0207649_106331142 | 102 |
| 968 | 3300025921 | Ga0207652_10004216 | Ga0207652_100042164 | 102 |
| 969 | 3300025921 | Ga0207652_10007199 | Ga0207652_100071996 | 102 |
| 970 | 3300025921 | Ga0207652_10008762 | Ga0207652_100087625 | 102 |
| 971 | 3300025921 | Ga0207652_10013121 | Ga0207652_100131213 | 102 |
| 972 | 3300025921 | Ga0207652_10016538 | Ga0207652_100165382 | 102 |
| 973 | 3300025921 | Ga0207652_10020260 | Ga0207652_100202605 | 102 |
| 974 | 3300025921 | Ga0207652_10025790 | Ga0207652_100257905 | 102 |
| 975 | 3300025921 | Ga0207652_10159426 | Ga0207652_101594262 | 102 |
| 976 | 3300025921 | Ga0207652_11050044 | Ga0207652_110500442 | 102 |
| 977 | 3300025921 | Ga0207652_11226465 | Ga0207652_112264652 | 102 |
| 978 | 3300025922 | Ga0207646_10309751 | Ga0207646_103097512 | 102 |
| 979 | 3300025923 | Ga0207681_11379939 | Ga0207681_113799392 | 102 |
| 980 | 3300025924 | Ga0207694_10086136 | Ga0207694_100861362 | 102 |
| 981 | 3300025925 | Ga0207650_10616025 | Ga0207650_106160252 | 102 |
| 982 | 3300025925 | Ga0207650_11099075 | Ga0207650_110990752 | 102 |
| 983 | 3300025925 | Ga0207650_11670881 | Ga0207650_116708811 | 102 |
| 984 | 3300025926 | Ga0207659_10328582 | Ga0207659_103285822 | 102 |
| 985 | 3300025926 | Ga0207659_10793614 | Ga0207659_107936142 | 102 |
| 986 | 3300025932 | Ga0207690_10029881 | Ga0207690_100298814 | 102 |
| 987 | 3300025932 | Ga0207690_10177685 | Ga0207690_101776853 | 102 |
| 988 | 3300025932 | Ga0207690_10380502 | Ga0207690_103805022 | 102 |
| 989 | 3300025932 | Ga0207690_11659037 | Ga0207690_116590372 | 102 |
| 990 | 3300025933 | Ga0207706_10027898 | Ga0207706_100278983 | 102 |
| 991 | 3300025933 | Ga0207706_11008701 | Ga0207706_110087012 | 102 |
| 992 | 3300025934 | Ga0207686_10813755 | Ga0207686_108137552 | 102 |
| 993 | 3300025937 | Ga0207669_11379555 | Ga0207669_113795551 | 102 |
| 994 | 3300025937 | Ga0207669_11424965 | Ga0207669_114249652 | 102 |
| 995 | 3300025938 | Ga0207704_11175201 | Ga0207704_111752011 | 102 |
| 996 | 3300025940 | Ga0207691_10870512 | Ga0207691_108705122 | 102 |
| 997 | 3300025941 | Ga0207711_10411796 | Ga0207711_104117961 | 102 |
| 998 | 3300025942 | Ga0207689_11436703 | Ga0207689_114367031 | 102 |
| 999 | 3300025944 | Ga0207661_10030536 | Ga0207661_100305365 | 102 |
| 1000 | 3300025944 | Ga0207661_10041689 | Ga0207661_100416895 | 102 |
| 1001 | 3300025944 | Ga0207661_10174835 | Ga0207661_101748352 | 102 |
| 1002 | 3300025944 | Ga0207661_10295663 | Ga0207661_102956633 | 102 |
| 1003 | 3300025945 | Ga0207679_10010978 | Ga0207679_100109785 | 102 |
| 1004 | 3300025945 | Ga0207679_10042253 | Ga0207679_100422532 | 102 |
| 1005 | 3300025945 | Ga0207679_10559186 | Ga0207679_105591862 | 102 |
| 1006 | 3300025945 | Ga0207679_11588660 | Ga0207679_115886601 | 102 |
| 1007 | 3300025949 | Ga0207667_10001111 | Ga0207667_1000111121 | 102 |
| 1008 | 3300025949 | Ga0207667_10023375 | Ga0207667_100233754 | 102 |
| 1009 | 3300025949 | Ga0207667_10069264 | Ga0207667_100692645 | 102 |
| 1010 | 3300025949 | Ga0207667_10089651 | Ga0207667_100896514 | 102 |
| 1011 | 3300025949 | Ga0207667_10099195 | Ga0207667_100991952 | 102 |
| 1012 | 3300025949 | Ga0207667_11037087 | Ga0207667_110370871 | 102 |
| 1013 | 3300025960 | Ga0207651_10202142 | Ga0207651_102021423 | 102 |
| 1014 | 3300025960 | Ga0207651_10821212 | Ga0207651_108212122 | 102 |
| 1015 | 3300025961 | Ga0207712_10371524 | Ga0207712_103715242 | 102 |
| 1016 | 3300025981 | Ga0207640_10001700 | Ga0207640_1000170012 | 102 |
| 1017 | 3300025981 | Ga0207640_10003799 | Ga0207640_100037994 | 102 |
| 1018 | 3300025981 | Ga0207640_10199819 | Ga0207640_101998192 | 102 |
| 1019 | 3300025981 | Ga0207640_10604769 | Ga0207640_106047692 | 102 |
| 1020 | 3300025981 | Ga0207640_11238473 | Ga0207640_112384732 | 102 |
| 1021 | 3300025986 | Ga0207658_10328117 | Ga0207658_103281172 | 102 |
| 1022 | 3300026023 | Ga0207677_10797751 | Ga0207677_107977511 | 102 |
| 1023 | 3300026035 | Ga0207703_10933453 | Ga0207703_109334532 | 102 |
| 1024 | 3300026041 | Ga0207639_10002481 | Ga0207639_1000248114 | 102 |
| 1025 | 3300026041 | Ga0207639_10584733 | Ga0207639_105847332 | 102 |
| 1026 | 3300026041 | Ga0207639_11516399 | Ga0207639_115163992 | 102 |
| 1027 | 3300026067 | Ga0207678_10345183 | Ga0207678_103451832 | 102 |
| 1028 | 3300026067 | Ga0207678_10735832 | Ga0207678_107358322 | 102 |
| 1029 | 3300026067 | Ga0207678_10765255 | Ga0207678_107652552 | 102 |
| 1030 | 3300026067 | Ga0207678_11004132 | Ga0207678_110041321 | 102 |
| 1031 | 3300026075 | Ga0207708_10048258 | Ga0207708_100482582 | 102 |
| 1032 | 3300026075 | Ga0207708_10886013 | Ga0207708_108860132 | 102 |
| 1033 | 3300026078 | Ga0207702_10004145 | Ga0207702_100041457 | 102 |
| 1034 | 3300026078 | Ga0207702_10024167 | Ga0207702_100241674 | 102 |
| 1035 | 3300026078 | Ga0207702_10080281 | Ga0207702_100802812 | 102 |
| 1036 | 3300026078 | Ga0207702_10261634 | Ga0207702_102616343 | 102 |
| 1037 | 3300026078 | Ga0207702_10312752 | Ga0207702_103127522 | 102 |
| 1038 | 3300026088 | Ga0207641_11260911 | Ga0207641_112609112 | 102 |
| 1039 | 3300026088 | Ga0207641_11343247 | Ga0207641_113432472 | 102 |
| 1040 | 3300026089 | Ga0207648_10060535 | Ga0207648_100605352 | 102 |
| 1041 | 3300026095 | Ga0207676_11819921 | Ga0207676_118199212 | 102 |
| 1042 | 3300026116 | Ga0207674_10011504 | Ga0207674_100115041 | 102 |
| 1043 | 3300026116 | Ga0207674_10246743 | Ga0207674_102467433 | 102 |
| 1044 | 3300026116 | Ga0207674_10394180 | Ga0207674_103941802 | 102 |
| 1045 | 3300026116 | Ga0207674_10539147 | Ga0207674_105391472 | 102 |
| 1046 | 3300026118 | Ga0207675_100023624 | Ga0207675_1000236244 | 102 |
| 1047 | 3300026118 | Ga0207675_100781314 | Ga0207675_1007813142 | 102 |
| 1048 | 3300026121 | Ga0207683_10031461 | Ga0207683_100314613 | 102 |
| 1049 | 3300026142 | Ga0207698_10000983 | Ga0207698_1000098314 | 102 |
| 1050 | 3300026142 | Ga0207698_10046809 | Ga0207698_100468094 | 102 |
| 1051 | 3300026142 | Ga0207698_10065798 | Ga0207698_100657982 | 102 |
| 1052 | 3300026142 | Ga0207698_10074460 | Ga0207698_100744604 | 102 |
| 1053 | 3300027512 | Ga0209179_1033853 | Ga0209179_10338532 | 102 |
| 1054 | 3300027671 | Ga0209588_1131804 | Ga0209588_11318042 | 102 |
| 1055 | 3300027717 | Ga0209998_10163167 | Ga0209998_101631672 | 102 |
| 1056 | 3300027866 | Ga0209813_10200175 | Ga0209813_102001752 | 102 |
| 1057 | 3300027907 | Ga0207428_10106399 | Ga0207428_101063992 | 102 |
| 1058 | 3300028379 | Ga0268266_10036486 | Ga0268266_100364863 | 102 |
| 1059 | 3300028379 | Ga0268266_10114151 | Ga0268266_101141512 | 102 |
| 1060 | 3300028379 | Ga0268266_10117808 | Ga0268266_101178083 | 102 |
| 1061 | 3300028379 | Ga0268266_10231290 | Ga0268266_102312902 | 102 |
| 1062 | 3300028380 | Ga0268265_10081454 | Ga0268265_100814542 | 102 |
| 1063 | 3300028380 | Ga0268265_10204269 | Ga0268265_102042693 | 102 |
| 1064 | 3300028381 | Ga0268264_10466261 | Ga0268264_104662612 | 102 |
| 1065 | 3300028573 | Ga0265334_10019278 | Ga0265334_100192784 | 102 |
| 1066 | 3300031238 | Ga0265332_10040268 | Ga0265332_100402684 | 102 |
| 1067 | 3300031241 | Ga0265325_10146906 | Ga0265325_101469061 | 102 |
| 1068 | 3300031247 | Ga0265340_10194160 | Ga0265340_101941602 | 102 |
| 1069 | 3300031548 | Ga0307408_100219023 | Ga0307408_1002190231 | 102 |
| 1070 | 3300031548 | Ga0307408_102445464 | Ga0307408_1024454642 | 102 |
| 1071 | 3300031712 | Ga0265342_10426261 | Ga0265342_104262612 | 102 |
| 1072 | 3300031731 | Ga0307405_10537175 | Ga0307405_105371752 | 102 |
| 1073 | 3300031824 | Ga0307413_11031278 | Ga0307413_110312782 | 102 |
| 1074 | 3300031911 | Ga0307412_11118825 | Ga0307412_111188252 | 102 |
| 1075 | 3300032126 | Ga0307415_101398084 | Ga0307415_1013980842 | 102 |
| 1076 | 3300034957 | Ga0373938_0234578 | Ga0373938_0234578_65_373 | 102 |
| 1077 | 3300035085 | Ga0373929_0023849 | Ga0373929_0023849_229_537 | 102 |
| 1078 | 3300035116 | Ga0373945_0077177 | Ga0373945_0077177_746_1054 | 102 |
| 1079 | 3300035118 | Ga0373954_0636757 | Ga0373954_0636757_73_384 | 102 |
| 1080 | 3300035207 | Ga0373942_0265705 | Ga0373942_0265705_184_492 | 102 |
| 1081 | 3300035691 | Ga0373931_0058100 | Ga0373931_0058100_609_917 | 102 |
| 1082 | 3300035691 | Ga0373931_0961773 | Ga0373931_0961773_71_379 | 102 |
| 1083 | 3300035692 | Ga0373935_0167268 | Ga0373935_0167268_746_1054 | 102 |
| 1084 | 3300035724 | Ga0373933_1172007 | Ga0373933_1172007_118_426 | 102 |
| 1085 | 3300035725 | Ga0373947_0109656 | Ga0373947_0109656_547_855 | 102 |
| 1086 | 3300036401 | Ga0373937_0376784 | Ga0373937_0376784_552_860 | 102 |
| 1087 | 3300036401 | Ga0373937_1404323 | Ga0373937_1404323_305_616 | 102 |
| 1088 | 3300037068 | Ga0373925_0206781 | Ga0373925_0206781_1122_1430 | 102 |
| 1089 | 3300037312 | Ga0395899_0003047 | Ga0395899_0003047_9807_10115 | 102 |
| 1090 | 3300037312 | Ga0395899_0040867 | Ga0395899_0040867_502_810 | 102 |
| 1091 | 3300037312 | Ga0395899_0084866 | Ga0395899_0084866_1304_1612 | 102 |
| 1092 | 3300037312 | Ga0395899_0235618 | Ga0395899_0235618_825_1133 | 102 |
| 1093 | 3300037418 | Ga0395900_0002026 | Ga0395900_0002026_13784_14092 | 102 |
| 1094 | 3300037418 | Ga0395900_0002792 | Ga0395900_0002792_488_796 | 102 |
| 1095 | 3300037418 | Ga0395900_0036061 | Ga0395900_0036061_32_340 | 102 |
| 1096 | 3300037418 | Ga0395900_0039505 | Ga0395900_0039505_488_796 | 102 |
| 1097 | 3300037418 | Ga0395900_0100964 | Ga0395900_0100964_1628_1936 | 102 |
| 1098 | 3300037418 | Ga0395900_0162599 | Ga0395900_0162599_99_407 | 102 |
| 1099 | 3300037418 | Ga0395900_0240748 | Ga0395900_0240748_329_637 | 102 |
| 1100 | 3300037418 | Ga0395900_0836808 | Ga0395900_0836808_507_815 | 102 |
| 1101 | 3300037466 | Ga0395898_0009118 | Ga0395898_0009118_7125_7433 | 102 |
| 1102 | 3300037466 | Ga0395898_0025582 | Ga0395898_0025582_3768_4076 | 102 |
| 1103 | 3300037466 | Ga0395898_0034635 | Ga0395898_0034635_3264_3572 | 102 |
| 1104 | 3300037466 | Ga0395898_1294729 | Ga0395898_1294729_147_455 | 102 |
| 1105 | 3300037471 | Ga0395905_1005578 | Ga0395905_1005578_55_363 | 102 |
| 1106 | 3300038443 | Ga0395901_0003592 | Ga0395901_0003592_2750_3058 | 102 |
| 1107 | 3300038443 | Ga0395901_0009897 | Ga0395901_0009897_6512_6820 | 102 |
| 1108 | 3300038443 | Ga0395901_0012227 | Ga0395901_0012227_4151_4459 | 102 |
| 1109 | 3300038443 | Ga0395901_0024914 | Ga0395901_0024914_5096_5404 | 102 |
| 1110 | 3300038443 | Ga0395901_0063211 | Ga0395901_0063211_2522_2830 | 102 |
| 1111 | 3300039437 | Ga0436365_0012766 | Ga0436365_0012766_147_458 | 102 |
| 1112 | 3300039438 | Ga0436360_0457170 | Ga0436360_0457170_49_357 | 102 |
| 1113 | 3300039447 | Ga0436361_0629730 | Ga0436361_0629730_829_1137 | 102 |
| 1114 | 3300041413 | Ga0439465_0385051 | Ga0439465_0385051_55_363 | 102 |
| 1115 | 3300041452 | Ga0451793_1589387 | Ga0451793_1589387_344_652 | 102 |
| 1116 | 3300041486 | Ga0451807_0622679 | Ga0451807_0622679_492_800 | 102 |
| 1117 | 3300042000 | Ga0439437_062255 | Ga0439437_062255_11_319 | 102 |
| 1118 | 3300042001 | Ga0439441_001948 | Ga0439441_001948_1437_1745 | 102 |
| 1119 | 3300042004 | Ga0439445_0118935 | Ga0439445_0118935_357_665 | 102 |
| 1120 | 3300042005 | Ga0439448_0149770 | Ga0439448_0149770_49_357 | 102 |
| 1121 | 3300042013 | Ga0439456_137969 | Ga0439456_137969_150_458 | 102 |
| 1122 | 3300042438 | Ga0439459_0049242 | Ga0439459_0049242_130_438 | 102 |
| 1123 | 3300042438 | Ga0439459_0079456 | Ga0439459_0079456_149_457 | 102 |
| 1124 | 3300045976 | Ga0466967_0289914 | Ga0466967_0289914_547_885 | 102 |
| 1125 | 3300045976 | Ga0466967_1302879 | Ga0466967_1302879_65_373 | 102 |
| 1126 | 3300046462 | Ga0495651_1001983 | Ga0495651_1001983_188_496 | 102 |
| 1127 | 3300048915 | Ga0496112_1005348 | Ga0496112_1005348_139_447 | 102 |
| 1128 | 3300048928 | Ga0496125_0147615 | Ga0496125_0147615_493_828 | 102 |
| 1129 | 3300048929 | Ga0496126_0060378 | Ga0496126_0060378_2488_2796 | 102 |
| 1130 | 3300049572 | Ga0501036_0928300 | Ga0501036_0928300_25_333 | 102 |
| 1131 | 3300049573 | Ga0501037_0156366 | Ga0501037_0156366_979_1287 | 102 |
| 1132 | 3300049574 | Ga0501038_0612491 | Ga0501038_0612491_160_468 | 102 |
| 1133 | 3300049577 | Ga0501041_0532795 | Ga0501041_0532795_148_456 | 102 |
| 1134 | 3300049577 | Ga0501041_0971019 | Ga0501041_0971019_62_370 | 102 |
| 1135 | 3300049579 | Ga0501043_0171257 | Ga0501043_0171257_1273_1581 | 102 |
| 1136 | 3300049579 | Ga0501043_0188436 | Ga0501043_0188436_856_1164 | 102 |
| 1137 | 3300049581 | Ga0501047_0097067 | Ga0501047_0097067_951_1259 | 102 |
| 1138 | 3300049581 | Ga0501047_0177182 | Ga0501047_0177182_818_1126 | 102 |
| 1139 | 3300049585 | Ga0501069_0078745 | Ga0501069_0078745_1012_1320 | 102 |
| 1140 | 3300049585 | Ga0501069_0202168 | Ga0501069_0202168_352_660 | 102 |
| 1141 | 3300049586 | Ga0501070_0000205 | Ga0501070_0000205_54436_54744 | 102 |
| 1142 | 3300049586 | Ga0501070_0010339 | Ga0501070_0010339_6981_7289 | 102 |
| 1143 | 3300049586 | Ga0501070_0047310 | Ga0501070_0047310_2609_2917 | 102 |
| 1144 | 3300049586 | Ga0501070_0047315 | Ga0501070_0047315_1162_1470 | 102 |
| 1145 | 3300049586 | Ga0501070_0079771 | Ga0501070_0079771_379_687 | 102 |
| 1146 | 3300049586 | Ga0501070_0092877 | Ga0501070_0092877_1133_1441 | 102 |
| 1147 | 3300049586 | Ga0501070_0284218 | Ga0501070_0284218_167_475 | 102 |
| 1148 | 3300049586 | Ga0501070_1005204 | Ga0501070_1005204_261_569 | 102 |
| 1149 | 3300049588 | Ga0501072_0328267 | Ga0501072_0328267_533_841 | 102 |
| 1150 | 3300049588 | Ga0501072_1105164 | Ga0501072_1105164_221_529 | 102 |
| 1151 | 3300049589 | Ga0501073_0012256 | Ga0501073_0012256_5748_6056 | 102 |
| 1152 | 3300049590 | Ga0501074_0008681 | Ga0501074_0008681_211_519 | 102 |
| 1153 | 3300049590 | Ga0501074_0034570 | Ga0501074_0034570_842_1150 | 102 |
| 1154 | 3300049590 | Ga0501074_0538840 | Ga0501074_0538840_233_541 | 102 |
| 1155 | 3300049591 | Ga0501075_0596398 | Ga0501075_0596398_359_667 | 102 |
| 1156 | 3300049592 | Ga0501076_0996662 | Ga0501076_0996662_297_605 | 102 |
| 1157 | 3300049593 | Ga0501077_0330153 | Ga0501077_0330153_491_799 | 102 |
| 1158 | 3300049741 | Ga0501079_0651321 | Ga0501079_0651321_362_670 | 102 |
| 1159 | 3300049742 | Ga0501080_0012268 | Ga0501080_0012268_2673_2981 | 102 |
| 1160 | 3300049742 | Ga0501080_0025763 | Ga0501080_0025763_5126_5434 | 102 |
| 1161 | 3300049742 | Ga0501080_0092523 | Ga0501080_0092523_897_1205 | 102 |
| 1162 | 3300049822 | Ga0501035_0027119 | Ga0501035_0027119_172_480 | 102 |
| 1163 | 3300049822 | Ga0501035_0094461 | Ga0501035_0094461_1748_2056 | 102 |
| 1164 | 3300049822 | Ga0501035_0258125 | Ga0501035_0258125_557_865 | 102 |
| 1165 | 3300049823 | Ga0501044_0101649 | Ga0501044_0101649_1806_2114 | 102 |
| 1166 | 3300049823 | Ga0501044_0419094 | Ga0501044_0419094_877_1185 | 102 |
| 1167 | 3300050489 | nmdc:mga03683_1042_c1 | nmdc:mga03683_1042_c1_5149_5457 | 102 |
| 1168 | 3300050489 | nmdc:mga03683_115128_c1 | nmdc:mga03683_115128_c1_716_1024 | 102 |
| 1169 | 3300050489 | nmdc:mga03683_154203_c1 | nmdc:mga03683_154203_c1_458_766 | 102 |
| 1170 | 3300050489 | nmdc:mga03683_342106_c1 | nmdc:mga03683_342106_c1_346_654 | 102 |
| 1171 | 3300050489 | nmdc:mga03683_49692_c1 | nmdc:mga03683_49692_c1_666_974 | 102 |
| 1172 | 3300050489 | nmdc:mga03683_98643_c1 | nmdc:mga03683_98643_c1_839_1147 | 102 |
| 1173 | 3300050491 | nmdc:mga00v17_420774_c1 | nmdc:mga00v17_420774_c1_175_483 | 102 |
| 1174 | 3300050492 | nmdc:mga0yw44_159268_c1 | nmdc:mga0yw44_159268_c1_931_1239 | 102 |
| 1175 | 3300050492 | nmdc:mga0yw44_179062_c1 | nmdc:mga0yw44_179062_c1_36_344 | 102 |
| 1176 | 3300050492 | nmdc:mga0yw44_225849_c1 | nmdc:mga0yw44_225849_c1_722_1030 | 102 |
| 1177 | 3300050492 | nmdc:mga0yw44_609616_c1 | nmdc:mga0yw44_609616_c1_172_480 | 102 |
| 1178 | 3300050492 | nmdc:mga0yw44_645585_c1 | nmdc:mga0yw44_645585_c1_222_530 | 102 |
| 1179 | 3300050493 | nmdc:mga0k408_140414_c1 | nmdc:mga0k408_140414_c1_189_497 | 102 |
| 1180 | 3300050493 | nmdc:mga0k408_302813_c1 | nmdc:mga0k408_302813_c1_322_630 | 102 |
| 1181 | 3300050494 | nmdc:mga06z11_104251_c1 | nmdc:mga06z11_104251_c1_527_835 | 102 |
| 1182 | 3300050494 | nmdc:mga06z11_180098_c1 | nmdc:mga06z11_180098_c1_604_912 | 102 |
| 1183 | 3300050494 | nmdc:mga06z11_251464_c1 | nmdc:mga06z11_251464_c1_661_969 | 102 |
| 1184 | 3300050494 | nmdc:mga06z11_390740_c1 | nmdc:mga06z11_390740_c1_30_338 | 102 |
| 1185 | 3300050494 | nmdc:mga06z11_589833_c1 | nmdc:mga06z11_589833_c1_286_594 | 102 |
| 1186 | 3300050495 | nmdc:mga04h51_79426_c1 | nmdc:mga04h51_79426_c1_261_569 | 102 |
| 1187 | 3300050496 | nmdc:mga07m45_56264_c2 | nmdc:mga07m45_56264_c2_870_1178 | 102 |
| 1188 | 3300050496 | nmdc:mga07m45_846538_c1 | nmdc:mga07m45_846538_c1_13_321 | 102 |
| 1189 | 3300050496 | nmdc:mga07m45_9131_c1 | nmdc:mga07m45_9131_c1_2573_2881 | 102 |
| 1190 | 3300050508 | nmdc:mga09592_828035_c1 | nmdc:mga09592_828035_c1_308_616 | 102 |
| 1191 | 3300050509 | nmdc:mga0qj67_291240_c1 | nmdc:mga0qj67_291240_c1_122_430 | 102 |
| 1192 | 3300050511 | nmdc:mga08y16_281982_c1 | nmdc:mga08y16_281982_c1_425_733 | 102 |
| 1193 | 3300050511 | nmdc:mga08y16_511137_c1 | nmdc:mga08y16_511137_c1_696_1004 | 102 |
| 1194 | 3300050512 | nmdc:mga0n895_659860_c1 | nmdc:mga0n895_659860_c1_15_323 | 102 |
| 1195 | 3300050515 | nmdc:mga0a205_636955_c1 | nmdc:mga0a205_636955_c1_35_343 | 102 |
| 1196 | 3300050516 | nmdc:mga0sz30_102_c1 | nmdc:mga0sz30_102_c1_691_999 | 102 |
| 1197 | 3300050516 | nmdc:mga0sz30_2362_c3 | nmdc:mga0sz30_2362_c3_1459_1767 | 102 |
| 1198 | 3300050516 | nmdc:mga0sz30_71838_c1 | nmdc:mga0sz30_71838_c1_312_620 | 102 |
| 1199 | 3300053085 | Ga0495619_0140851 | Ga0495619_0140851_849_1160 | 102 |
| 1200 | 3300053093 | Ga0500651_0292341 | Ga0500651_0292341_173_481 | 102 |
| 1201 | 3300053096 | Ga0500641_0001583 | Ga0500641_0001583_883_1191 | 102 |
| 1202 | 3300053130 | Ga0500642_0476713 | Ga0500642_0476713_201_509 | 102 |
| 1203 | 3300053130 | Ga0500642_0498325 | Ga0500642_0498325_16_324 | 102 |
| 1204 | 3300053134 | Ga0500658_0059449 | Ga0500658_0059449_915_1223 | 102 |
| 1205 | 3300053153 | Ga0500616_0005860 | Ga0500616_0005860_2072_2380 | 102 |
| 1206 | 3300053155 | Ga0500620_316208 | Ga0500620_316208_149_460 | 102 |
| 1207 | 3300053730 | Ga0500645_056333 | Ga0500645_056333_332_643 | 102 |
| 1208 | 3300053731 | Ga0500609_020995 | Ga0500609_020995_437_745 | 102 |
| 1209 | 3300053733 | Ga0500552_000219 | Ga0500552_000219_700_1008 | 102 |
| 1210 | 3300053735 | Ga0500596_068619 | Ga0500596_068619_116_424 | 102 |
| 1211 | 3300061734 | Ga0530510_0662755 | Ga0530510_0662755_157_465 | 102 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zmh-assembly1.cif.gz_L | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm | 0.8881 | 11 | 93 |
| 6x89-assembly1.cif.gz_4L | vigna radiata mitochondrial complex i* | 0.8697 | 5 | 87 |
| 7a24-assembly1.cif.gz_K | assembly intermediate of the plant mitochondrial complex i | 0.8691 | 4 | 87 |
| 8bef-assembly1.cif.gz_K | cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) | 0.8671 | 5 | 99 |
| 8e73-assembly1.cif.gz_4L | vigna radiata supercomplex i+iii2 (full bridge) | 0.8641 | 5 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A3B6U9Q8_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9059 | 8 | 95 | 1.10.287.3510 |
| af_A0A2P2CLH7_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8887 | 8 | 99 | 1.10.287.3510 |
| af_Q6R9N1_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8849 | 8 | 97 | 1.10.287.3510 |
| af_A0A2P2CLH7_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8472 | 8 | 99 | 1.10.287.3510 |
| af_P18934_2_96_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8464 | 4 | 98 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A368F7W0-F1-model_v4 | NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) | 0.9601 | 10 | 89 |
GO:0003954
GO:0008137 GO:0015990 GO:0016020 GO:0042773 |
| AF-A0A367IZW3-F1-model_v4 | NADH dehydrogenase subunit 4 | 0.9487 | 5 | 93 |
GO:0003954
GO:0008137 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-Q9ZY26-F1-model_v4 | NADH dehydrogenase subunit 4L (EC 1.6.5.3) | 0.9459 | 9 | 90 |
GO:0005739
GO:0016020 GO:0016491 |
| AF-Q2A1G0-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.9302 | 5 | 97 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A0R0FEW8-F1-model_v4 | NADH dehydrogenase subunit 4L | 0.9182 | 14 | 94 |
GO:0016651
GO:0030964 GO:0042773 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar