F491727

General Info

Members Datasets Scaffolds Average Seq Length
1211 467 1204 102

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100397993|Ga0070667_1003979932
Length 109
Sequence MEPIVTAIQAVPLKDYVYLSFILFSIGLAGALFRRNTIIILMCLELMFNSVNLLLAAFSAHHSDPSGQVFVFFIMLVAAAEVTVGLAILVMMKRNVDSVDINRLNRLKW

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
4 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
5 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
6 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
117 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
133 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
138 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
139 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
140 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
141 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
142 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
143 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
144 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
145 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
146 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
147 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
258 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
259 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
260 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
261 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
262 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
263 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
264 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
265 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
266 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
267 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
268 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
269 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
270 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
271 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
272 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
273 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
274 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
275 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
276 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
277 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
279 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
280 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
281 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
282 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
283 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
284 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
285 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
288 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
289 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
290 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
291 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
292 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
293 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
297 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
298 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
299 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
300 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
301 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
302 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
303 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
306 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
307 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
308 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
309 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
310 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
311 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
317 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
318 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
319 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
320 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
321 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
322 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
325 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
326 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
327 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
328 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
329 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
330 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
331 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
332 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
333 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
334 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
335 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
336 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
337 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
338 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
339 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
340 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
341 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
342 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
343 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
344 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
345 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
346 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
347 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
348 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
349 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
350 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
351 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
352 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
353 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
354 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
355 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
356 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
357 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
358 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
359 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
360 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
361 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
362 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
363 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
364 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
365 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
366 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
367 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
368 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
371 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
372 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
373 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
376 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
377 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
378 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
379 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
386 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
387 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
392 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
393 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
394 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
395 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
399 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
400 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
415 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
416 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
417 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
418 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
419 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
424 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
425 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
426 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
435 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
453 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
454 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
455 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
456 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
457 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
458 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
459 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
460 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
461 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
462 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
463 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
464 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
465 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
466 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
467 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.74
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.53
Nodule 0.08
Rhizoplane 1.65
Rhizosphere 90.92
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1006058 3300001915 Bacteria 2465
2 JGI24740J21852_10000237 3300001979 Bacteria 23259
3 JGI24740J21852_10011357 3300001979 Bacteria 3393
4 JGI24740J21852_10084797 3300001979 Bacteria 825
5 JGI24737J22298_10211635 3300001990 Bacteria 572
6 JGI24743J22301_10155886 3300001991 Bacteria 513
7 JGI24750J21931_1053125 3300002070 Bacteria 636
8 JGI25151J46595_10015776 3300003187 Bacteria 3317
9 rootH2_10005458 3300003320 Bacteria 1145
10 JGI26145J50221_1034951 3300003371 Bacteria 522
11 Ga0065714_10278487 3300005288 Bacteria 727
12 Ga0065712_10069820 3300005290 Bacteria 6657
13 Ga0065715_10208296 3300005293 Bacteria 1326
14 Ga0065707_10054676 3300005295 Bacteria 629
15 Ga0065707_10069677 3300005295 Bacteria 543
16 Ga0065707_10102239 3300005295 Bacteria 2818
17 Ga0065707_10234435 3300005295 Bacteria 1177
18 Ga0070658_11371670 3300005327 Bacteria 614
19 Ga0070676_10106384 3300005328 Bacteria 1741
20 Ga0070676_10405320 3300005328 Bacteria 950
21 Ga0070676_10756693 3300005328 Bacteria 714
22 Ga0070683_100136912 3300005329 Bacteria 2319
23 Ga0070683_100273316 3300005329 Bacteria 1607
24 Ga0070683_100349994 3300005329 Bacteria 1407
25 Ga0070683_100456368 3300005329 Bacteria 1219
26 Ga0070683_100919141 3300005329 Bacteria 839
27 Ga0070683_100944054 3300005329 Bacteria 828
28 Ga0070683_102417418 3300005329 Bacteria 503
29 Ga0070690_100002812 3300005330 Bacteria 9390
30 Ga0070670_100471116 3300005331 Bacteria 1114
31 Ga0070670_100479182 3300005331 Bacteria 1105
32 Ga0070670_101540248 3300005331 Bacteria 611
33 Ga0070677_10737337 3300005333 Bacteria 558
34 Ga0068869_100002841 3300005334 Bacteria 10497
35 Ga0068869_100619687 3300005334 Bacteria 916
36 Ga0068869_101473734 3300005334 Bacteria 604
37 Ga0070666_11206043 3300005335 Bacteria 564
38 Ga0070680_100010185 3300005336 Bacteria 7250
39 Ga0070680_100012762 3300005336 Bacteria 6533
40 Ga0070680_100081997 3300005336 Bacteria 2661
41 Ga0070680_100083592 3300005336 Bacteria 2636
42 Ga0070680_100120220 3300005336 Bacteria 2192
43 Ga0070680_101417565 3300005336 Bacteria 601
44 Ga0070682_100423380 3300005337 Bacteria 1012
45 Ga0070682_100472054 3300005337 Bacteria 966
46 Ga0070682_100746539 3300005337 Bacteria 790
47 Ga0068868_100389275 3300005338 Bacteria 1201
48 Ga0068868_100450414 3300005338 Bacteria 1119
49 Ga0070660_100163303 3300005339 Bacteria 1796
50 Ga0070660_100274175 3300005339 Bacteria 1379
51 Ga0070660_100308013 3300005339 Bacteria 1299
52 Ga0070660_100816918 3300005339 Bacteria 784
53 Ga0070660_101133197 3300005339 Bacteria 662
54 Ga0070689_100001094 3300005340 Bacteria 17018
55 Ga0070689_100575973 3300005340 Bacteria 972
56 Ga0070689_100762462 3300005340 Bacteria 849
57 Ga0070691_10004253 3300005341 Bacteria 6508
58 Ga0070691_10011711 3300005341 Bacteria 4012
59 Ga0070691_10070928 3300005341 Bacteria 1691
60 Ga0070691_10233691 3300005341 Bacteria 979
61 Ga0070691_10293733 3300005341 Bacteria 885
62 Ga0070691_10465498 3300005341 Bacteria 724
63 Ga0070687_100216339 3300005343 Bacteria 1170
64 Ga0070687_100266341 3300005343 Bacteria 1072
65 Ga0070661_100195995 3300005344 Bacteria 1542
66 Ga0070661_100246458 3300005344 Bacteria 1377
67 Ga0070661_100259807 3300005344 Bacteria 1342
68 Ga0070661_100286391 3300005344 Bacteria 1279
69 Ga0070661_100815713 3300005344 Bacteria 766
70 Ga0070661_101080655 3300005344 Bacteria 668
71 Ga0070661_101871062 3300005344 Bacteria 510
72 Ga0070692_10057240 3300005345 Bacteria 2044
73 Ga0070692_10104041 3300005345 Bacteria 1560
74 Ga0070692_10126257 3300005345 Bacteria 1433
75 Ga0070692_10207647 3300005345 Bacteria 1151
76 Ga0070692_10268720 3300005345 Bacteria 1028
77 Ga0070692_10292766 3300005345 Bacteria 991
78 Ga0070692_10817083 3300005345 Bacteria 638
79 Ga0070668_100013940 3300005347 Bacteria 6011
80 Ga0070669_100067122 3300005353 Bacteria 2645
81 Ga0070675_100013649 3300005354 Bacteria 6390
82 Ga0070675_100388095 3300005354 Bacteria 1244
83 Ga0070675_100430036 3300005354 Bacteria 1182
84 Ga0070675_100517223 3300005354 Bacteria 1077
85 Ga0070675_101607120 3300005354 Bacteria 600
86 Ga0070671_100253366 3300005355 Bacteria 1495
87 Ga0070671_100389916 3300005355 Bacteria 1191
88 Ga0070674_100242958 3300005356 Bacteria 1411
89 Ga0070674_100872610 3300005356 Bacteria 782
90 Ga0070674_101222385 3300005356 Bacteria 668
91 Ga0070673_100077357 3300005364 Bacteria 2689
92 Ga0070673_100243847 3300005364 Bacteria 1564
93 Ga0070673_101360780 3300005364 Bacteria 667
94 Ga0070688_100040619 3300005365 Bacteria 2852
95 Ga0070688_100254433 3300005365 Bacteria 1252
96 Ga0070688_101140230 3300005365 Bacteria 625
97 Ga0070688_101159335 3300005365 Bacteria 620
98 Ga0070659_100133905 3300005366 Bacteria 2015
99 Ga0070659_100392854 3300005366 Bacteria 1170
100 Ga0070659_100413522 3300005366 Bacteria 1140
101 Ga0070659_100481130 3300005366 Bacteria 1056
102 Ga0070659_100490138 3300005366 Bacteria 1047
103 Ga0070667_100183217 3300005367 Bacteria 1853
104 Ga0070667_100397993 3300005367 Bacteria 1253
105 Ga0070667_100885685 3300005367 Bacteria 830
106 Ga0070667_101841245 3300005367 Bacteria 570
107 Ga0070703_10018767 3300005406 Bacteria 2003
108 Ga0070703_10349306 3300005406 Bacteria 631
109 Ga0070709_10086413 3300005434 Bacteria 2059
110 Ga0070709_10362792 3300005434 Bacteria 1073
111 Ga0070709_11538156 3300005434 Bacteria 541
112 Ga0070714_100000372 3300005435 Bacteria 33436
113 Ga0070710_11254403 3300005437 Bacteria 550
114 Ga0070701_10060266 3300005438 Bacteria 1998
115 Ga0070701_10127975 3300005438 Bacteria 1440
116 Ga0070701_10489333 3300005438 Bacteria 797
117 Ga0070711_100214462 3300005439 Bacteria 1493
118 Ga0070705_100107192 3300005440 Bacteria 1777
119 Ga0070700_100047238 3300005441 Bacteria 2664
120 Ga0070700_101233972 3300005441 Bacteria 626
121 Ga0070694_100144351 3300005444 Bacteria 1732
122 Ga0070694_100209070 3300005444 Bacteria 1458
123 Ga0070694_100430741 3300005444 Bacteria 1038
124 Ga0070694_100546655 3300005444 Bacteria 927
125 Ga0070708_100079144 3300005445 Bacteria 2973
126 Ga0070663_100141159 3300005455 Bacteria 1839
127 Ga0070663_100220903 3300005455 Bacteria 1487
128 Ga0070663_100610469 3300005455 Bacteria 918
129 Ga0070663_100862664 3300005455 Bacteria 780
130 Ga0070663_101595517 3300005455 Bacteria 582
131 Ga0070678_100010243 3300005456 Bacteria 5717
132 Ga0070678_100134571 3300005456 Bacteria 1969
133 Ga0070678_100798663 3300005456 Bacteria 857
134 Ga0070678_100953179 3300005456 Bacteria 787
135 Ga0070662_100019867 3300005457 Bacteria 4569
136 Ga0070662_100394935 3300005457 Bacteria 1140
137 Ga0070681_10000058 3300005458 Bacteria 79062
138 Ga0070681_10004547 3300005458 Bacteria 13229
139 Ga0070681_10008405 3300005458 Bacteria 10108
140 Ga0070681_10015299 3300005458 Bacteria 7632
141 Ga0070681_10017110 3300005458 Bacteria 7247
142 Ga0070681_10370064 3300005458 Bacteria 1343
143 Ga0070681_10595502 3300005458 Bacteria 1020
144 Ga0070681_10700586 3300005458 Bacteria 928
145 Ga0070681_10718045 3300005458 Bacteria 915
146 Ga0070681_10941455 3300005458 Bacteria 783
147 Ga0070681_11260446 3300005458 Bacteria 662
148 Ga0068867_100095095 3300005459 Bacteria 2267
149 Ga0068867_100452282 3300005459 Bacteria 1094
150 Ga0070685_10104090 3300005466 Bacteria 1738
151 Ga0070685_10738716 3300005466 Bacteria 721
152 Ga0070706_100009220 3300005467 Bacteria 9192
153 Ga0070706_100598445 3300005467 Bacteria 1025
154 Ga0070698_100002102 3300005471 Bacteria 22110
155 Ga0070698_100549186 3300005471 Bacteria 1095
156 Ga0070698_102171070 3300005471 Bacteria 509
157 Ga0070699_100072373 3300005518 Bacteria 2999
158 Ga0070679_100001961 3300005530 Bacteria 18470
159 Ga0070679_100004237 3300005530 Bacteria 13236
160 Ga0070679_100015882 3300005530 Bacteria 7247
161 Ga0070679_100064213 3300005530 Bacteria 3659
162 Ga0070679_100118349 3300005530 Bacteria 2634
163 Ga0070679_100225500 3300005530 Bacteria 1834
164 Ga0070679_101284148 3300005530 Bacteria 678
165 Ga0070679_101551627 3300005530 Bacteria 609
166 Ga0070679_101724266 3300005530 Bacteria 574
167 Ga0070679_101878527 3300005530 Bacteria 547
168 Ga0070684_100001643 3300005535 Bacteria 16204
169 Ga0070684_100156802 3300005535 Bacteria 2064
170 Ga0070684_100328958 3300005535 Bacteria 1404
171 Ga0070684_100558539 3300005535 Bacteria 1063
172 Ga0070697_100224180 3300005536 Bacteria 1602
173 Ga0068853_100187786 3300005539 Bacteria 1876
174 Ga0068853_100272660 3300005539 Bacteria 1558
175 Ga0068853_100799278 3300005539 Bacteria 903
176 Ga0068853_101344939 3300005539 Bacteria 691
177 Ga0068853_101545957 3300005539 Bacteria 643
178 Ga0070672_100016355 3300005543 Bacteria 5310
179 Ga0070686_101053025 3300005544 Bacteria 670
180 Ga0070695_100534388 3300005545 Bacteria 912
181 Ga0070695_100829185 3300005545 Bacteria 743
182 Ga0070695_101025889 3300005545 Bacteria 672
183 Ga0070696_100002369 3300005546 Bacteria 12458
184 Ga0070696_100216133 3300005546 Bacteria 1436
185 Ga0070696_101611169 3300005546 Bacteria 558
186 Ga0070693_100005733 3300005547 Bacteria 5997
187 Ga0070693_100210333 3300005547 Bacteria 1269
188 Ga0070693_100316979 3300005547 Bacteria 1056
189 Ga0070665_100041133 3300005548 Bacteria 4646
190 Ga0070665_100082650 3300005548 Bacteria 3217
191 Ga0070665_100092027 3300005548 Bacteria 3037
192 Ga0070665_101127947 3300005548 Bacteria 795
193 Ga0070704_100337583 3300005549 Bacteria 1268
194 Ga0068855_100002743 3300005563 Bacteria 21682
195 Ga0068855_100375704 3300005563 Bacteria 1561
196 Ga0068855_100434091 3300005563 Bacteria 1435
197 Ga0068855_101271904 3300005563 Bacteria 763
198 Ga0068855_101333165 3300005563 Bacteria 742
199 Ga0068855_101908594 3300005563 Bacteria 601
200 Ga0070664_100004119 3300005564 Bacteria 11675
201 Ga0070664_100095569 3300005564 Bacteria 2577
202 Ga0070664_100637936 3300005564 Bacteria 989
203 Ga0070664_101389890 3300005564 Bacteria 664
204 Ga0070664_101529743 3300005564 Bacteria 632
205 Ga0068857_100080822 3300005577 Bacteria 2902
206 Ga0068857_100313758 3300005577 Bacteria 1447
207 Ga0068857_100478674 3300005577 Bacteria 1166
208 Ga0068857_100596321 3300005577 Bacteria 1044
209 Ga0068857_101036320 3300005577 Bacteria 791
210 Ga0068854_100090261 3300005578 Bacteria 2278
211 Ga0068854_100147801 3300005578 Bacteria 1809
212 Ga0068854_100392414 3300005578 Bacteria 1146
213 Ga0068854_100747621 3300005578 Bacteria 848
214 Ga0068854_102135244 3300005578 Bacteria 518
215 Ga0068854_102188257 3300005578 Bacteria 511
216 Ga0068856_100012478 3300005614 Bacteria 8226
217 Ga0068856_100249036 3300005614 Bacteria 1792
218 Ga0068856_101093939 3300005614 Bacteria 814
219 Ga0068856_101559671 3300005614 Bacteria 674
220 Ga0070702_100007955 3300005615 Bacteria 5108
221 Ga0070702_100623626 3300005615 Bacteria 812
222 Ga0068852_100212154 3300005616 Bacteria 1837
223 Ga0068852_100322544 3300005616 Bacteria 1500
224 Ga0068852_100431312 3300005616 Bacteria 1302
225 Ga0068852_100502481 3300005616 Bacteria 1207
226 Ga0068852_100831271 3300005616 Bacteria 939
227 Ga0068859_100003542 3300005617 Bacteria 15898
228 Ga0068859_100065390 3300005617 Bacteria 3671
229 Ga0068859_100161732 3300005617 Bacteria 2318
230 Ga0068859_100296267 3300005617 Bacteria 1711
231 Ga0068859_101621020 3300005617 Bacteria 715
232 Ga0068859_102628498 3300005617 Bacteria 554
233 Ga0068864_100002080 3300005618 Bacteria 16539
234 Ga0068864_100480311 3300005618 Bacteria 1193
235 Ga0068866_10424016 3300005718 Bacteria 864
236 Ga0068861_100291376 3300005719 Bacteria 1410
237 Ga0068861_102281560 3300005719 Bacteria 543
238 Ga0068861_102681873 3300005719 Bacteria 503
239 Ga0068851_10119168 3300005834 Bacteria 1417
240 Ga0068851_10502967 3300005834 Bacteria 727
241 Ga0068851_11023400 3300005834 Bacteria 522
242 Ga0068870_10163763 3300005840 Bacteria 1321
243 Ga0068863_100003431 3300005841 Bacteria 15619
244 Ga0068863_101033480 3300005841 Bacteria 825
245 Ga0068863_101845345 3300005841 Unclassified 614
246 Ga0068863_102032468 3300005841 Bacteria 585
247 Ga0068858_100150154 3300005842 Bacteria 2191
248 Ga0068858_101384966 3300005842 Bacteria 693
249 Ga0068860_100065835 3300005843 Bacteria 3441
250 Ga0068860_100300092 3300005843 Bacteria 1573
251 Ga0068860_100494327 3300005843 Bacteria 1221
252 Ga0068860_101323069 3300005843 Bacteria 741
253 Ga0068860_101627468 3300005843 Bacteria 668
254 Ga0068860_102021474 3300005843 Bacteria 598
255 Ga0068862_100168706 3300005844 Bacteria 1958
256 Ga0068862_100613855 3300005844 Bacteria 1046
257 Ga0068862_101083502 3300005844 Bacteria 796
258 Ga0068862_101191206 3300005844 Bacteria 760
259 Ga0081455_10000268 3300005937 Bacteria 68637
260 Ga0081455_10054750 3300005937 Bacteria 3398
261 Ga0081455_10204578 3300005937 Bacteria 1476
262 Ga0081538_10084296 3300005981 Bacteria 1675
263 Ga0081539_10013083 3300005985 Bacteria 6291
264 Ga0081539_10042275 3300005985 Bacteria 2656
265 Ga0070717_11034841 3300006028 Bacteria 748
266 Ga0075365_10558830 3300006038 Bacteria 809
267 Ga0075368_10050117 3300006042 Bacteria 1657
268 Ga0075368_10055615 3300006042 Bacteria 1578
269 Ga0075363_100236481 3300006048 Bacteria 1049
270 Ga0075364_10543097 3300006051 Bacteria 794
271 Ga0075364_10559743 3300006051 Bacteria 781
272 Ga0070712_100081916 3300006175 Bacteria 2340
273 Ga0070712_100583517 3300006175 Bacteria 945
274 Ga0075362_10008923 3300006177 Bacteria 3855
275 Ga0075362_10020897 3300006177 Bacteria 2739
276 Ga0075362_10047714 3300006177 Bacteria 1908
277 Ga0075362_10167732 3300006177 Bacteria 1059
278 Ga0075362_10625954 3300006177 Bacteria 557
279 Ga0075367_10041520 3300006178 Bacteria 2689
280 Ga0075367_10168964 3300006178 Bacteria 1362
281 Ga0075367_10238885 3300006178 Bacteria 1138
282 Ga0075369_10008002 3300006186 Bacteria 4050
283 Ga0075369_10030877 3300006186 Bacteria 2258
284 Ga0075369_10272459 3300006186 Bacteria 788
285 Ga0075366_10305473 3300006195 Bacteria 974
286 Ga0075366_10414108 3300006195 Bacteria 830
287 Ga0075366_11058337 3300006195 Bacteria 507
288 Ga0097621_100118997 3300006237 Bacteria 2239
289 Ga0097621_100733281 3300006237 Bacteria 912
290 Ga0075370_10064170 3300006353 Bacteria 2094
291 Ga0075370_10139524 3300006353 Bacteria 1417
292 Ga0075370_10278040 3300006353 Bacteria 994
293 Ga0068871_100109737 3300006358 Bacteria 2320
294 Ga0068871_100874852 3300006358 Bacteria 832
295 Ga0075428_100005214 3300006844 Bacteria 14448
296 Ga0075428_100104078 3300006844 Bacteria 3095
297 Ga0075428_100346444 3300006844 Bacteria 1595
298 Ga0075428_100353694 3300006844 Bacteria 1576
299 Ga0075428_100481381 3300006844 Bacteria 1328
300 Ga0075428_101662488 3300006844 Bacteria 667
301 Ga0075430_100006334 3300006846 Bacteria 9985
302 Ga0075430_100225756 3300006846 Bacteria 1553
303 Ga0075430_100282401 3300006846 Bacteria 1373
304 Ga0075431_100055692 3300006847 Bacteria 4079
305 Ga0075431_100163788 3300006847 Bacteria 2286
306 Ga0075433_10004060 3300006852 Bacteria 11337
307 Ga0075433_10488278 3300006852 Bacteria 1085
308 Ga0075433_10593433 3300006852 Bacteria 973
309 Ga0075433_11874624 3300006852 Bacteria 515
310 Ga0075434_100006745 3300006871 Bacteria 10551
311 Ga0075434_100753152 3300006871 Bacteria 991
312 Ga0075429_100007100 3300006880 Bacteria 9723
313 Ga0075429_100936264 3300006880 Bacteria 758
314 Ga0075429_101336271 3300006880 Bacteria 625
315 Ga0068865_100204877 3300006881 Bacteria 1534
316 Ga0097620_100003542 3300006931 Bacteria 15898
317 Ga0097620_100065389 3300006931 Bacteria 3671
318 Ga0097620_100161733 3300006931 Bacteria 2318
319 Ga0097620_100296272 3300006931 Bacteria 1711
320 Ga0097620_101620990 3300006931 Bacteria 715
321 Ga0097620_102628778 3300006931 Bacteria 554
322 Ga0099794_10518170 3300007265 Bacteria 628
323 Ga0099795_10025934 3300007788 Bacteria 1970
324 Ga0105244_10151516 3300009036 Bacteria 1111
325 Ga0105250_10000023 3300009092 Bacteria 219389
326 Ga0105250_10180981 3300009092 Bacteria 884
327 Ga0105240_10015264 3300009093 Bacteria 10452
328 Ga0105240_10019139 3300009093 Bacteria 9155
329 Ga0105240_10223820 3300009093 Bacteria 2190
330 Ga0105240_10291794 3300009093 Bacteria 1869
331 Ga0111539_10006091 3300009094 Bacteria 15568
332 Ga0111539_10038677 3300009094 Bacteria 5757
333 Ga0111539_10277704 3300009094 Bacteria 1949
334 Ga0111539_10371852 3300009094 Bacteria 1664
335 Ga0111539_10378882 3300009094 Bacteria 1647
336 Ga0111539_10656833 3300009094 Bacteria 1221
337 Ga0111539_11044874 3300009094 Bacteria 950
338 Ga0111539_12290432 3300009094 Bacteria 627
339 Ga0111539_13435686 3300009094 Bacteria 509
340 Ga0105245_10993126 3300009098 Bacteria 883
341 Ga0105245_11450088 3300009098 Bacteria 737
342 Ga0105245_12238577 3300009098 Bacteria 600
343 Ga0105247_11181634 3300009101 Bacteria 608
344 Ga0114129_10012049 3300009147 Bacteria 12300
345 Ga0114129_10589038 3300009147 Bacteria 1442
346 Ga0105243_10578939 3300009148 Bacteria 1077
347 Ga0105243_11057020 3300009148 Bacteria 818
348 Ga0105241_12506530 3300009174 Bacteria 516
349 Ga0105242_10159634 3300009176 Bacteria 1972
350 Ga0105242_11423816 3300009176 Unclassified 721
351 Ga0105242_11484397 3300009176 Bacteria 708
352 Ga0105242_11888983 3300009176 Bacteria 637
353 Ga0105248_10013091 3300009177 Bacteria 9133
354 Ga0105248_11649917 3300009177 Unclassified 726
355 Ga0105248_12071450 3300009177 Bacteria 647
356 Ga0105237_10350907 3300009545 Bacteria 1480
357 Ga0105237_11572704 3300009545 Bacteria 664
358 Ga0105238_10082734 3300009551 Bacteria 3200
359 Ga0105238_10405318 3300009551 Bacteria 1357
360 Ga0105238_10644448 3300009551 Bacteria 1069
361 Ga0105238_11703811 3300009551 Bacteria 661
362 Ga0105249_10010911 3300009553 Bacteria 7986
363 Ga0105249_10068998 3300009553 Bacteria 3262
364 Ga0105249_10712431 3300009553 Bacteria 1064
365 Ga0105249_10929115 3300009553 Bacteria 937
366 Ga0105249_11460237 3300009553 Bacteria 756
367 Ga0105032_101327 3300009979 Bacteria 2282
368 Ga0105035_104908 3300009988 Bacteria 1072
369 Ga0105035_105563 3300009988 Bacteria 1026
370 Ga0105035_115012 3300009988 Bacteria 709
371 Ga0099796_10059854 3300010159 Bacteria 1346
372 Ga0099796_10152403 3300010159 Bacteria 911
373 Ga0105239_10746592 3300010375 Bacteria 1120
374 Ga0105239_11176614 3300010375 Bacteria 883
375 Ga0105239_11525377 3300010375 Bacteria 772
376 Ga0105246_11230406 3300011119 Bacteria 691
377 Ga0157328_1012371 3300012478 Bacteria 619
378 Ga0157325_1022663 3300012485 Bacteria 573
379 Ga0157321_1016396 3300012487 Bacteria 636
380 Ga0157322_1011930 3300012490 Bacteria 724
381 Ga0157329_1047268 3300012491 Bacteria 501
382 Ga0157335_1007582 3300012492 Bacteria 814
383 Ga0157319_1028887 3300012497 Bacteria 588
384 Ga0157314_1026926 3300012500 Bacteria 623
385 Ga0157313_1008230 3300012503 Bacteria 834
386 Ga0157339_1019563 3300012505 Bacteria 707
387 Ga0157316_1001729 3300012510 Bacteria 1400
388 Ga0157316_1020032 3300012510 Bacteria 723
389 Ga0157373_10076846 3300013100 Bacteria 2356
390 Ga0157373_10128973 3300013100 Bacteria 1778
391 Ga0157373_10163294 3300013100 Bacteria 1567
392 Ga0157373_10397466 3300013100 Bacteria 987
393 Ga0157373_10586227 3300013100 Bacteria 811
394 Ga0157371_10116033 3300013102 Bacteria 1902
395 Ga0157371_10272431 3300013102 Bacteria 1222
396 Ga0157371_10702630 3300013102 Bacteria 757
397 Ga0157370_10232982 3300013104 Bacteria 1704
398 Ga0157370_10263741 3300013104 Bacteria 1592
399 Ga0157370_10283780 3300013104 Bacteria 1530
400 Ga0157370_10384293 3300013104 Bacteria 1293
401 Ga0157370_10492511 3300013104 Bacteria 1126
402 Ga0157370_10501829 3300013104 Bacteria 1114
403 Ga0157370_10898316 3300013104 Bacteria 804
404 Ga0157370_11922971 3300013104 Bacteria 531
405 Ga0157369_10032420 3300013105 Bacteria 5746
406 Ga0157369_10535490 3300013105 Bacteria 1211
407 Ga0157369_10560682 3300013105 Bacteria 1180
408 Ga0157369_10815163 3300013105 Bacteria 959
409 Ga0157369_11588552 3300013105 Bacteria 665
410 Ga0157369_11712607 3300013105 Bacteria 639
411 Ga0157374_10660366 3300013296 Bacteria 1057
412 Ga0157374_11047909 3300013296 Bacteria 835
413 Ga0157378_10202557 3300013297 Bacteria 1878
414 Ga0157378_10254609 3300013297 Bacteria 1682
415 Ga0157378_10357402 3300013297 Bacteria 1429
416 Ga0157378_10466658 3300013297 Bacteria 1256
417 Ga0163162_11035510 3300013306 Bacteria 929
418 Ga0163162_12276857 3300013306 Bacteria 622
419 Ga0157372_10125411 3300013307 Bacteria 2952
420 Ga0157372_10228057 3300013307 Bacteria 2159
421 Ga0157372_10338190 3300013307 Bacteria 1753
422 Ga0157372_10924129 3300013307 Bacteria 1012
423 Ga0157375_10358117 3300013308 Bacteria 1625
424 Ga0157375_10962784 3300013308 Bacteria 995
425 Ga0157375_11092958 3300013308 Bacteria 933
426 Ga0157375_11581043 3300013308 Bacteria 775
427 Ga0157375_11969545 3300013308 Unclassified 694
428 Ga0157515_112177 3300013875 Bacteria 801
429 Ga0163163_10030882 3300014325 Bacteria 5166
430 Ga0163163_12318229 3300014325 Bacteria 596
431 Ga0163163_12410127 3300014325 Bacteria 585
432 Ga0157380_10088498 3300014326 Bacteria 2548
433 Ga0157380_10351176 3300014326 Bacteria 1380
434 Ga0157380_10475325 3300014326 Bacteria 1207
435 Ga0157380_10872203 3300014326 Bacteria 924
436 Ga0157380_12627350 3300014326 Bacteria 570
437 Ga0182008_10128865 3300014497 Bacteria 1261
438 Ga0157377_10018611 3300014745 Bacteria 3612
439 Ga0157377_10898458 3300014745 Bacteria 662
440 Ga0157377_10901973 3300014745 Bacteria 661
441 Ga0157377_11503113 3300014745 Bacteria 535
442 Ga0157379_10021307 3300014968 Bacteria 5736
443 Ga0157379_10084854 3300014968 Bacteria 2838
444 Ga0157379_11897178 3300014968 Bacteria 587
445 Ga0157376_10261648 3300014969 Bacteria 1621
446 Ga0157376_11748617 3300014969 Bacteria 657
447 Ga0182007_10145999 3300015262 Bacteria 802
448 Ga0163161_10692538 3300017792 Bacteria 848
449 Ga0163161_11003190 3300017792 Bacteria 713
450 Ga0206350_10919969 3300020080 Bacteria 846
451 Ga0206354_10021222 3300020081 Bacteria 3279
452 Ga0206353_10035558 3300020082 Bacteria 1735
453 Ga0206353_11001100 3300020082 Bacteria 1043
454 Ga0154015_1173312 3300020610 Bacteria 1366
455 Ga0213872_10037234 3300021361 Bacteria 2221
456 Ga0213871_10003275 3300021441 Bacteria 3102
457 Ga0209676_1025789 3300025292 Bacteria 1879
458 Ga0207426_1062561 3300025302 Bacteria 1065
459 Ga0207656_10143901 3300025321 Bacteria 1125
460 Ga0207696_1000098 3300025711 Bacteria 175181
461 Ga0207642_10364956 3300025899 Bacteria 855
462 Ga0207688_10052206 3300025901 Bacteria 2291
463 Ga0207688_10214010 3300025901 Bacteria 1159
464 Ga0207688_10604299 3300025901 Bacteria 691
465 Ga0207680_11054491 3300025903 Bacteria 582
466 Ga0207647_10016579 3300025904 Bacteria 5024
467 Ga0207647_10309413 3300025904 Bacteria 899
468 Ga0207699_10310358 3300025906 Bacteria 1104
469 Ga0207699_10486394 3300025906 Bacteria 889
470 Ga0207699_11130928 3300025906 Bacteria 580
471 Ga0207645_10010902 3300025907 Bacteria 6224
472 Ga0207645_10179437 3300025907 Bacteria 1389
473 Ga0207643_10502761 3300025908 Bacteria 775
474 Ga0207643_10638341 3300025908 Bacteria 687
475 Ga0207705_10000083 3300025909 Bacteria 117366
476 Ga0207705_10016964 3300025909 Bacteria 5215
477 Ga0207705_10132869 3300025909 Bacteria 1853
478 Ga0207705_10182418 3300025909 Bacteria 1584
479 Ga0207705_10387986 3300025909 Bacteria 1079
480 Ga0207705_10470595 3300025909 Bacteria 975
481 Ga0207684_10057826 3300025910 Bacteria 3291
482 Ga0207654_10100628 3300025911 Bacteria 1780
483 Ga0207654_10138259 3300025911 Bacteria 1550
484 Ga0207654_11016646 3300025911 Bacteria 603
485 Ga0207707_10000069 3300025912 Bacteria 103460
486 Ga0207707_10000292 3300025912 Bacteria 53455
487 Ga0207707_10000912 3300025912 Bacteria 28803
488 Ga0207707_10001098 3300025912 Bacteria 25804
489 Ga0207707_10002049 3300025912 Bacteria 18304
490 Ga0207707_10002853 3300025912 Bacteria 15432
491 Ga0207707_10014746 3300025912 Bacteria 6811
492 Ga0207707_10042268 3300025912 Bacteria 3978
493 Ga0207707_10541983 3300025912 Bacteria 989
494 Ga0207707_10665327 3300025912 Bacteria 877
495 Ga0207695_10003936 3300025913 Bacteria 20547
496 Ga0207695_10004599 3300025913 Bacteria 18742
497 Ga0207695_10021124 3300025913 Bacteria 7436
498 Ga0207695_10149525 3300025913 Bacteria 2276
499 Ga0207695_10161639 3300025913 Bacteria 2171
500 Ga0207695_10186630 3300025913 Bacteria 1992
501 Ga0207695_10205245 3300025913 Bacteria 1884
502 Ga0207695_10213921 3300025913 Bacteria 1837
503 Ga0207671_10538157 3300025914 Bacteria 931
504 Ga0207693_10107991 3300025915 Bacteria 2183
505 Ga0207663_10266962 3300025916 Bacteria 1266
506 Ga0207660_10000080 3300025917 Bacteria 50991
507 Ga0207660_10011506 3300025917 Bacteria 5763
508 Ga0207660_10021757 3300025917 Bacteria 4315
509 Ga0207660_10037471 3300025917 Bacteria 3379
510 Ga0207660_10082740 3300025917 Bacteria 2362
511 Ga0207660_10138191 3300025917 Bacteria 1861
512 Ga0207660_10324961 3300025917 Bacteria 1229
513 Ga0207660_10936337 3300025917 Bacteria 707
514 Ga0207662_10009092 3300025918 Bacteria 5459
515 Ga0207662_10345307 3300025918 Bacteria 998
516 Ga0207657_10025007 3300025919 Bacteria 5517
517 Ga0207657_10164670 3300025919 Bacteria 1799
518 Ga0207657_10199572 3300025919 Bacteria 1610
519 Ga0207657_10405598 3300025919 Bacteria 1072
520 Ga0207649_10001073 3300025920 Bacteria 16700
521 Ga0207649_10016885 3300025920 Bacteria 4129
522 Ga0207649_10181844 3300025920 Bacteria 1472
523 Ga0207649_10190129 3300025920 Bacteria 1443
524 Ga0207649_10356317 3300025920 Bacteria 1084
525 Ga0207649_10451736 3300025920 Bacteria 970
526 Ga0207649_10633114 3300025920 Bacteria 825
527 Ga0207649_10737367 3300025920 Bacteria 766
528 Ga0207652_10004216 3300025921 Bacteria 11735
529 Ga0207652_10007199 3300025921 Bacteria 8976
530 Ga0207652_10008762 3300025921 Bacteria 8143
531 Ga0207652_10013121 3300025921 Bacteria 6708
532 Ga0207652_10016538 3300025921 Bacteria 6024
533 Ga0207652_10020260 3300025921 Bacteria 5476
534 Ga0207652_10025790 3300025921 Bacteria 4891
535 Ga0207652_10159426 3300025921 Bacteria 2022
536 Ga0207652_10180483 3300025921 Bacteria 1897
537 Ga0207652_11050044 3300025921 Bacteria 714
538 Ga0207652_11226465 3300025921 Bacteria 652
539 Ga0207646_10309751 3300025922 Bacteria 1427
540 Ga0207681_10080433 3300025923 Bacteria 2298
541 Ga0207681_10940439 3300025923 Bacteria 724
542 Ga0207681_11379939 3300025923 Bacteria 591
543 Ga0207694_10086136 3300025924 Bacteria 2473
544 Ga0207694_10600309 3300025924 Bacteria 926
545 Ga0207650_10603732 3300025925 Bacteria 923
546 Ga0207650_10616025 3300025925 Bacteria 913
547 Ga0207650_10683091 3300025925 Bacteria 867
548 Ga0207650_11099075 3300025925 Bacteria 677
549 Ga0207650_11670881 3300025925 Bacteria 540
550 Ga0207659_10002602 3300025926 Bacteria 10744
551 Ga0207659_10328582 3300025926 Bacteria 1263
552 Ga0207659_10793614 3300025926 Bacteria 813
553 Ga0207659_11239246 3300025926 Bacteria 641
554 Ga0207659_11497289 3300025926 Bacteria 577
555 Ga0207659_11666813 3300025926 Bacteria 543
556 Ga0207687_10330585 3300025927 Bacteria 1236
557 Ga0207687_11740111 3300025927 Bacteria 534
558 Ga0207700_10016571 3300025928 Bacteria 4900
559 Ga0207664_10005812 3300025929 Bacteria 8436
560 Ga0207644_10285518 3300025931 Bacteria 1326
561 Ga0207644_10475263 3300025931 Bacteria 1029
562 Ga0207690_10029881 3300025932 Bacteria 3469
563 Ga0207690_10065616 3300025932 Bacteria 2483
564 Ga0207690_10177685 3300025932 Bacteria 1600
565 Ga0207690_10380502 3300025932 Bacteria 1122
566 Ga0207690_11659037 3300025932 Bacteria 534
567 Ga0207706_10027898 3300025933 Bacteria 5047
568 Ga0207706_11008701 3300025933 Bacteria 699
569 Ga0207686_10059253 3300025934 Bacteria 2418
570 Ga0207686_10813755 3300025934 Bacteria 750
571 Ga0207709_10070905 3300025935 Bacteria 2211
572 Ga0207709_10911312 3300025935 Bacteria 715
573 Ga0207670_10000955 3300025936 Bacteria 15246
574 Ga0207670_10566030 3300025936 Bacteria 930
575 Ga0207669_11379555 3300025937 Bacteria 600
576 Ga0207669_11424965 3300025937 Bacteria 590
577 Ga0207704_10313012 3300025938 Bacteria 1208
578 Ga0207704_11175201 3300025938 Bacteria 654
579 Ga0207665_10577722 3300025939 Bacteria 876
580 Ga0207691_10028519 3300025940 Bacteria 5227
581 Ga0207691_10188956 3300025940 Bacteria 1797
582 Ga0207691_10870512 3300025940 Bacteria 755
583 Ga0207711_10009083 3300025941 Bacteria 8300
584 Ga0207711_10411796 3300025941 Bacteria 1257
585 Ga0207711_11101025 3300025941 Unclassified 735
586 Ga0207689_10062065 3300025942 Bacteria 3073
587 Ga0207689_10192564 3300025942 Bacteria 1682
588 Ga0207689_10544740 3300025942 Bacteria 974
589 Ga0207689_11436703 3300025942 Bacteria 577
590 Ga0207661_10030536 3300025944 Bacteria 4152
591 Ga0207661_10041689 3300025944 Bacteria 3614
592 Ga0207661_10174835 3300025944 Bacteria 1871
593 Ga0207661_10295663 3300025944 Bacteria 1450
594 Ga0207661_10447882 3300025944 Bacteria 1176
595 Ga0207679_10010978 3300025945 Bacteria 5844
596 Ga0207679_10042253 3300025945 Bacteria 3275
597 Ga0207679_10152680 3300025945 Bacteria 1882
598 Ga0207679_10164764 3300025945 Bacteria 1819
599 Ga0207679_10559186 3300025945 Bacteria 1027
600 Ga0207679_10846136 3300025945 Bacteria 835
601 Ga0207679_11588660 3300025945 Bacteria 599
602 Ga0207667_10001111 3300025949 Bacteria 33935
603 Ga0207667_10023375 3300025949 Bacteria 6806
604 Ga0207667_10069264 3300025949 Bacteria 3672
605 Ga0207667_10089651 3300025949 Bacteria 3178
606 Ga0207667_10099195 3300025949 Bacteria 3005
607 Ga0207667_11037087 3300025949 Bacteria 806
608 Ga0207651_10054087 3300025960 Bacteria 2748
609 Ga0207651_10202142 3300025960 Bacteria 1593
610 Ga0207651_10821212 3300025960 Bacteria 825
611 Ga0207651_11699774 3300025960 Bacteria 568
612 Ga0207712_10371524 3300025961 Bacteria 1194
613 Ga0207668_10002142 3300025972 Bacteria 11514
614 Ga0207640_10001700 3300025981 Bacteria 11794
615 Ga0207640_10003799 3300025981 Bacteria 8136
616 Ga0207640_10199819 3300025981 Bacteria 1514
617 Ga0207640_10563281 3300025981 Bacteria 959
618 Ga0207640_10604769 3300025981 Bacteria 928
619 Ga0207640_11238473 3300025981 Bacteria 664
620 Ga0207658_10328117 3300025986 Bacteria 1327
621 Ga0207677_10248711 3300026023 Bacteria 1443
622 Ga0207677_10797751 3300026023 Bacteria 845
623 Ga0207703_10056564 3300026035 Bacteria 3195
624 Ga0207703_10933453 3300026035 Bacteria 831
625 Ga0207703_11775666 3300026035 Bacteria 593
626 Ga0207639_10002481 3300026041 Bacteria 12369
627 Ga0207639_10584733 3300026041 Bacteria 1028
628 Ga0207639_11516399 3300026041 Bacteria 629
629 Ga0207678_10345183 3300026067 Bacteria 1283
630 Ga0207678_10735832 3300026067 Bacteria 869
631 Ga0207678_10765255 3300026067 Bacteria 852
632 Ga0207678_11004132 3300026067 Bacteria 738
633 Ga0207708_10048258 3300026075 Bacteria 3241
634 Ga0207708_10506386 3300026075 Bacteria 1013
635 Ga0207708_10886013 3300026075 Bacteria 772
636 Ga0207702_10004145 3300026078 Bacteria 12990
637 Ga0207702_10024167 3300026078 Bacteria 5041
638 Ga0207702_10080281 3300026078 Bacteria 2829
639 Ga0207702_10261634 3300026078 Bacteria 1629
640 Ga0207702_10312752 3300026078 Bacteria 1494
641 Ga0207641_10051766 3300026088 Bacteria 3477
642 Ga0207641_11260911 3300026088 Bacteria 739
643 Ga0207641_11343247 3300026088 Bacteria 716
644 Ga0207641_12371002 3300026088 Unclassified 530
645 Ga0207648_10060535 3300026089 Bacteria 3302
646 Ga0207648_10111593 3300026089 Bacteria 2401
647 Ga0207648_11813793 3300026089 Bacteria 572
648 Ga0207648_12271143 3300026089 Bacteria 503
649 Ga0207676_10002529 3300026095 Bacteria 13044
650 Ga0207676_11819921 3300026095 Bacteria 608
651 Ga0207674_10011504 3300026116 Bacteria 9939
652 Ga0207674_10246743 3300026116 Bacteria 1733
653 Ga0207674_10254630 3300026116 Bacteria 1702
654 Ga0207674_10394180 3300026116 Bacteria 1338
655 Ga0207674_10539147 3300026116 Bacteria 1127
656 Ga0207674_10910208 3300026116 Bacteria 848
657 Ga0207674_10950995 3300026116 Bacteria 828
658 Ga0207675_100023624 3300026118 Bacteria 5719
659 Ga0207675_100781314 3300026118 Bacteria 967
660 Ga0207683_10031461 3300026121 Bacteria 4605
661 Ga0207683_10130226 3300026121 Bacteria 2262
662 Ga0207683_10676712 3300026121 Bacteria 956
663 Ga0207683_11561305 3300026121 Bacteria 609
664 Ga0207698_10000983 3300026142 Bacteria 16579
665 Ga0207698_10024975 3300026142 Bacteria 4201
666 Ga0207698_10046809 3300026142 Bacteria 3270
667 Ga0207698_10065798 3300026142 Bacteria 2849
668 Ga0207698_10074460 3300026142 Bacteria 2709
669 Ga0207698_10785599 3300026142 Bacteria 953
670 Ga0207698_10862961 3300026142 Bacteria 911
671 Ga0209973_1028199 3300027252 Bacteria 780
672 Ga0209969_1004771 3300027360 Bacteria 1896
673 Ga0209967_1009251 3300027364 Bacteria 1365
674 Ga0209981_1001337 3300027378 Bacteria 3118
675 Ga0209981_1065415 3300027378 Bacteria 559
676 Ga0209995_1030700 3300027471 Bacteria 899
677 Ga0209995_1033043 3300027471 Bacteria 869
678 Ga0209179_1033853 3300027512 Bacteria 1058
679 Ga0209999_1000092 3300027543 Bacteria 10795
680 Ga0209982_1002643 3300027552 Bacteria 2520
681 Ga0209970_1025601 3300027614 Bacteria 1011
682 Ga0210002_1011194 3300027617 Bacteria 1385
683 Ga0209983_1000216 3300027665 Bacteria 11518
684 Ga0209588_1131804 3300027671 Bacteria 797
685 Ga0209971_1000244 3300027682 Bacteria 15445
686 Ga0209971_1047827 3300027682 Bacteria 1032
687 Ga0209998_10163167 3300027717 Bacteria 576
688 Ga0209813_10200175 3300027866 Bacteria 739
689 Ga0209974_10003853 3300027876 Bacteria 5375
690 Ga0207428_10015261 3300027907 Bacteria 6649
691 Ga0207428_10025945 3300027907 Bacteria 4896
692 Ga0207428_10066622 3300027907 Bacteria 2837
693 Ga0207428_10106399 3300027907 Bacteria 2163
694 Ga0207428_10429416 3300027907 Bacteria 965
695 Ga0268266_10014847 3300028379 Bacteria 6690
696 Ga0268266_10036486 3300028379 Bacteria 4184
697 Ga0268266_10114151 3300028379 Bacteria 2396
698 Ga0268266_10117808 3300028379 Bacteria 2360
699 Ga0268266_10231290 3300028379 Bacteria 1703
700 Ga0268266_12157187 3300028379 Bacteria 529
701 Ga0268265_10004900 3300028380 Bacteria 9212
702 Ga0268265_10042806 3300028380 Bacteria 3362
703 Ga0268265_10081454 3300028380 Bacteria 2556
704 Ga0268265_10204269 3300028380 Bacteria 1716
705 Ga0268265_10975401 3300028380 Bacteria 836
706 Ga0268264_10014907 3300028381 Bacteria 6385
707 Ga0268264_10466261 3300028381 Bacteria 1226
708 Ga0268264_11125356 3300028381 Bacteria 794
709 Ga0265334_10000009 3300028573 Bacteria 194312
710 Ga0265334_10016689 3300028573 Bacteria 3036
711 Ga0265334_10019278 3300028573 Bacteria 2808
712 Ga0265338_10030752 3300028800 Bacteria 5279
713 Ga0265338_10061743 3300028800 Bacteria 3283
714 Ga0265338_10849248 3300028800 Bacteria 624
715 Ga0265324_10309304 3300029957 Bacteria 538
716 Ga0316177_1078971 3300030731 Bacteria 1698
717 Ga0316176_1126462 3300030732 Bacteria 1714
718 Ga0314311_1072280 3300030733 Bacteria 2532
719 Ga0316178_1037950 3300030735 Bacteria 1847
720 Ga0265332_10040268 3300031238 Bacteria 2023
721 Ga0265325_10146906 3300031241 Bacteria 1118
722 Ga0265340_10194160 3300031247 Bacteria 915
723 Ga0265327_10089220 3300031251 Bacteria 1506
724 Ga0265316_10268047 3300031344 Bacteria 1250
725 Ga0307408_100104606 3300031548 Bacteria 2163
726 Ga0307408_100132187 3300031548 Bacteria 1948
727 Ga0307408_100219023 3300031548 Bacteria 1552
728 Ga0307408_100226482 3300031548 Bacteria 1528
729 Ga0307408_102445464 3300031548 Bacteria 507
730 Ga0265313_10000628 3300031595 Bacteria 36547
731 Ga0307508_10893633 3300031616 Bacteria 514
732 Ga0316575_10012371 3300031665 Bacteria 3174
733 Ga0316575_10054891 3300031665 Bacteria 1586
734 Ga0316575_10191231 3300031665 Bacteria 851
735 Ga0316579_10001255 3300031691 Bacteria 9121
736 Ga0316579_10321743 3300031691 Bacteria 748
737 Ga0316579_10344646 3300031691 Bacteria 720
738 Ga0316579_10479688 3300031691 Bacteria 602
739 Ga0316579_10637711 3300031691 Bacteria 516
740 Ga0265314_10009334 3300031711 Bacteria 8301
741 Ga0265342_10426261 3300031712 Bacteria 683
742 Ga0316576_10002711 3300031727 Bacteria 10129
743 Ga0316576_10004680 3300031727 Bacteria 8250
744 Ga0316576_10005793 3300031727 Bacteria 7613
745 Ga0316576_10006718 3300031727 Bacteria 7189
746 Ga0316576_10010662 3300031727 Bacteria 5985
747 Ga0316576_10045306 3300031727 Bacteria 3180
748 Ga0316576_10182926 3300031727 Bacteria 1581
749 Ga0316576_10273020 3300031727 Bacteria 1267
750 Ga0316576_10638126 3300031727 Bacteria 775
751 Ga0316576_10676212 3300031727 Bacteria 749
752 Ga0316578_10000469 3300031728 Bacteria 13481
753 Ga0316578_10028616 3300031728 Bacteria 3157
754 Ga0316578_10130955 3300031728 Bacteria 1509
755 Ga0316578_10316434 3300031728 Bacteria 932
756 Ga0307405_10031842 3300031731 Bacteria 3109
757 Ga0307405_10537175 3300031731 Bacteria 944
758 Ga0307405_10734265 3300031731 Bacteria 821
759 Ga0316577_10001512 3300031733 Bacteria 11029
760 Ga0316577_10003045 3300031733 Bacteria 8413
761 Ga0316577_10050851 3300031733 Bacteria 2313
762 Ga0316577_10074888 3300031733 Bacteria 1890
763 Ga0316577_10122706 3300031733 Bacteria 1460
764 Ga0316577_10681857 3300031733 Bacteria 584
765 Ga0307413_10068873 3300031824 Bacteria 2218
766 Ga0307413_10153351 3300031824 Bacteria 1608
767 Ga0307413_10270337 3300031824 Bacteria 1272
768 Ga0307413_10600199 3300031824 Bacteria 901
769 Ga0307413_10673757 3300031824 Bacteria 856
770 Ga0307413_11031278 3300031824 Bacteria 707
771 Ga0307413_11101118 3300031824 Bacteria 686
772 Ga0307413_11303718 3300031824 Bacteria 635
773 Ga0307413_11729384 3300031824 Bacteria 558
774 Ga0307410_10049850 3300031852 Bacteria 2812
775 Ga0307410_10441579 3300031852 Bacteria 1060
776 Ga0307406_10740795 3300031901 Bacteria 824
777 Ga0307406_10786424 3300031901 Bacteria 802
778 Ga0307406_12134608 3300031901 Bacteria 502
779 Ga0307407_10415974 3300031903 Bacteria 968
780 Ga0307407_10472106 3300031903 Bacteria 914
781 Ga0307407_10892395 3300031903 Bacteria 682
782 Ga0307412_10113674 3300031911 Bacteria 1937
783 Ga0307412_10319141 3300031911 Bacteria 1235
784 Ga0307412_10640871 3300031911 Bacteria 905
785 Ga0307412_11118825 3300031911 Bacteria 702
786 Ga0307412_12314694 3300031911 Bacteria 501
787 Ga0307409_100260956 3300031995 Bacteria 1590
788 Ga0307409_100426573 3300031995 Bacteria 1273
789 Ga0307409_100486245 3300031995 Bacteria 1199
790 Ga0307416_100098925 3300032002 Bacteria 2531
791 Ga0307416_100154839 3300032002 Bacteria 2108
792 Ga0307416_100170274 3300032002 Bacteria 2026
793 Ga0307416_100439317 3300032002 Bacteria 1354
794 Ga0307416_101965261 3300032002 Bacteria 688
795 Ga0307416_102365520 3300032002 Bacteria 631
796 Ga0307414_10190887 3300032004 Bacteria 1657
797 Ga0307414_10397133 3300032004 Bacteria 1196
798 Ga0307414_10941640 3300032004 Bacteria 793
799 Ga0307414_11687408 3300032004 Bacteria 591
800 Ga0307411_10095506 3300032005 Bacteria 2087
801 Ga0307411_10366906 3300032005 Bacteria 1179
802 Ga0307411_10638037 3300032005 Bacteria 920
803 Ga0307411_10939846 3300032005 Bacteria 770
804 Ga0307415_100005213 3300032126 Bacteria 6870
805 Ga0307415_100448318 3300032126 Bacteria 1115
806 Ga0307415_100635529 3300032126 Bacteria 955
807 Ga0307415_100968319 3300032126 Bacteria 789
808 Ga0307415_101398084 3300032126 Bacteria 666
809 Ga0307415_102402672 3300032126 Bacteria 518
810 Ga0316583_10004293 3300032133 Bacteria 5082
811 Ga0316583_10032173 3300032133 Bacteria 1865
812 Ga0316583_10059532 3300032133 Bacteria 1340
813 Ga0316585_10000686 3300032137 Bacteria 8446
814 Ga0316585_10106233 3300032137 Bacteria 922
815 Ga0316580_10000381 3300032139 Bacteria 9989
816 Ga0316580_10005234 3300032139 Bacteria 3779
817 Ga0316580_10059784 3300032139 Bacteria 1170
818 Ga0316580_10217561 3300032139 Bacteria 589
819 Ga0316593_10000769 3300032168 Bacteria 6356
820 Ga0316593_10350026 3300032168 Bacteria 565
821 Ga0316586_1022360 3300033527 Bacteria 1050
822 Ga0316596_1000111 3300033541 Bacteria 10492
823 Ga0373950_0129735 3300034818 Bacteria 564
824 Ga0373938_0234578 3300034957 Bacteria 520
825 Ga0373929_0023849 3300035085 Bacteria 1260
826 Ga0373949_0083144 3300035090 Bacteria 856
827 Ga0373951_0134154 3300035091 Bacteria 683
828 Ga0373939_0389905 3300035114 Bacteria 575
829 Ga0373941_0204504 3300035115 Bacteria 752
830 Ga0373945_0077177 3300035116 Bacteria 1271
831 Ga0373954_0383164 3300035118 Bacteria 695
832 Ga0373954_0636757 3300035118 Bacteria 529
833 Ga0373956_0232577 3300035119 Bacteria 876
834 Ga0373946_0316423 3300035171 Bacteria 775
835 Ga0373946_0596934 3300035171 Bacteria 572
836 Ga0373942_0265705 3300035207 Bacteria 587
837 Ga0373962_0158564 3300035242 Bacteria 745
838 Ga0316574_0000505 3300035398 Bacteria 15853
839 Ga0316574_0002851 3300035398 Bacteria 8777
840 Ga0316574_0005191 3300035398 Bacteria 6930
841 Ga0316574_0009989 3300035398 Bacteria 5340
842 Ga0316574_0023955 3300035398 Bacteria 3649
843 Ga0316574_0032827 3300035398 Bacteria 3157
844 Ga0316574_0056770 3300035398 Bacteria 2450
845 Ga0316574_0088612 3300035398 Bacteria 1971
846 Ga0316574_0173345 3300035398 Bacteria 1388
847 Ga0316574_0270473 3300035398 Bacteria 1084
848 Ga0316574_0307403 3300035398 Bacteria 1008
849 Ga0316574_0350827 3300035398 Bacteria 933
850 Ga0316574_0435023 3300035398 Bacteria 823
851 Ga0373931_0058100 3300035691 Bacteria 2077
852 Ga0373931_0961773 3300035691 Bacteria 576
853 Ga0373935_0167268 3300035692 Bacteria 1502
854 Ga0373935_0731206 3300035692 Bacteria 729
855 Ga0373927_0000003 3300035695 Bacteria 480348
856 Ga0373933_0336330 3300035724 Bacteria 980
857 Ga0373933_1172007 3300035724 Bacteria 506
858 Ga0373947_0109656 3300035725 Bacteria 1743
859 Ga0373947_0497026 3300035725 Bacteria 829
860 Ga0373937_0376784 3300036401 Bacteria 1346
861 Ga0373937_1404323 3300036401 Bacteria 646
862 Ga0316582_0001472 3300036647 Bacteria 10369
863 Ga0316582_0024839 3300036647 Bacteria 3591
864 Ga0316582_1094741 3300036647 Bacteria 543
865 Ga0316584_0004416 3300036712 Bacteria 9310
866 Ga0316584_0005187 3300036712 Bacteria 8712
867 Ga0316584_0223352 3300036712 Bacteria 1383
868 Ga0316584_0270727 3300036712 Bacteria 1236
869 Ga0316584_0415858 3300036712 Bacteria 956
870 Ga0316584_0991486 3300036712 Bacteria 561
871 Ga0373925_0050662 3300037068 Bacteria 3098
872 Ga0373925_0206781 3300037068 Bacteria 1563
873 Ga0395899_0003047 3300037312 Bacteria 13379
874 Ga0395899_0040867 3300037312 Bacteria 3467
875 Ga0395899_0084866 3300037312 Bacteria 2301
876 Ga0395899_0235618 3300037312 Bacteria 1262
877 Ga0395900_0002026 3300037418 Bacteria 22791
878 Ga0395900_0002792 3300037418 Bacteria 19093
879 Ga0395900_0036061 3300037418 Bacteria 5096
880 Ga0395900_0039505 3300037418 Bacteria 4862
881 Ga0395900_0100964 3300037418 Bacteria 2963
882 Ga0395900_0162599 3300037418 Bacteria 2276
883 Ga0395900_0197353 3300037418 Bacteria 2038
884 Ga0395900_0240748 3300037418 Bacteria 1815
885 Ga0395900_0836808 3300037418 Bacteria 846
886 Ga0395898_0009118 3300037466 Bacteria 10449
887 Ga0395898_0025582 3300037466 Bacteria 5945
888 Ga0395898_0034635 3300037466 Bacteria 5029
889 Ga0395898_0487202 3300037466 Bacteria 1173
890 Ga0395898_1294729 3300037466 Bacteria 658
891 Ga0395898_1781138 3300037466 Bacteria 537
892 Ga0395905_1005578 3300037471 Bacteria 737
893 Ga0395905_1195406 3300037471 Bacteria 664
894 Ga0395901_0003592 3300038443 Bacteria 15640
895 Ga0395901_0009897 3300038443 Bacteria 9665
896 Ga0395901_0012227 3300038443 Bacteria 8711
897 Ga0395901_0024914 3300038443 Bacteria 6142
898 Ga0395901_0063211 3300038443 Bacteria 3852
899 Ga0395901_0743314 3300038443 Bacteria 975
900 Ga0400490_07618 3300038726 Bacteria 12059
901 Ga0400486_18067 3300038742 Bacteria 1959
902 Ga0400483_036792 3300039062 Bacteria 4834
903 Ga0400483_038990 3300039062 Bacteria 1289
904 Ga0400483_180247 3300039062 Bacteria 5981
905 Ga0400483_181669 3300039062 Bacteria 2055
906 Ga0400489_53512 3300039093 Bacteria 1216
907 Ga0400487_66249 3300039110 Bacteria 1256
908 Ga0436365_0012766 3300039437 Bacteria 2011
909 Ga0436360_0253706 3300039438 Bacteria 14356
910 Ga0436360_0457170 3300039438 Bacteria 592
911 Ga0436361_0629730 3300039447 Bacteria 1530
912 Ga0436361_1086284 3300039447 Bacteria 4680
913 Ga0436363_0607560 3300039450 Bacteria 1313
914 Ga0436362_0195822 3300039453 Bacteria 1506
915 Ga0439439_0007650 3300041406 Bacteria 2532
916 Ga0439439_0102742 3300041406 Bacteria 788
917 Ga0439465_0385051 3300041413 Bacteria 532
918 Ga0451791_1427860 3300041451 Bacteria 1278
919 Ga0451793_1589387 3300041452 Bacteria 691
920 Ga0451797_1211170 3300041453 Bacteria 718
921 Ga0451797_1365695 3300041453 Bacteria 1089
922 Ga0451795_1294879 3300041456 Bacteria 711
923 Ga0451800_0097612 3300041459 Bacteria 565
924 Ga0451807_0346592 3300041486 Bacteria 2174
925 Ga0451807_0622679 3300041486 Bacteria 907
926 Ga0451837_0436478 3300041494 Bacteria 833
927 Ga0451837_1077267 3300041494 Bacteria 865
928 Ga0451841_0576354 3300041498 Bacteria 667
929 Ga0451845_0691868 3300041501 Bacteria 1049
930 Ga0451849_0458457 3300041505 Bacteria 998
931 Ga0451853_0558631 3300041512 Bacteria 776
932 Ga0439437_062255 3300042000 Bacteria 508
933 Ga0439441_001948 3300042001 Bacteria 2833
934 Ga0439443_013863 3300042003 Bacteria 1209
935 Ga0439445_0118935 3300042004 Bacteria 758
936 Ga0439448_0149770 3300042005 Bacteria 809
937 Ga0439449_0013715 3300042007 Bacteria 3050
938 Ga0439456_137969 3300042013 Bacteria 565
939 Ga0439457_075826 3300042014 Bacteria 770
940 Ga0450896_002550 3300042133 Bacteria 2362
941 Ga0439446_0007690 3300042156 Bacteria 2841
942 Ga0439446_0012350 3300042156 Bacteria 2332
943 Ga0439435_0000245 3300042436 Bacteria 7822
944 Ga0439444_0000819 3300042437 Bacteria 3750
945 Ga0439459_0049242 3300042438 Bacteria 920
946 Ga0439459_0079456 3300042438 Bacteria 772
947 Ga0439459_0124276 3300042438 Bacteria 654
948 Ga0439464_0060669 3300042439 Bacteria 1107
949 Ga0439464_0179268 3300042439 Bacteria 670
950 Ga0439464_0321557 3300042439 Bacteria 508
951 Ga0439460_0038163 3300042461 Bacteria 1400
952 Ga0450893_0040196 3300042532 Bacteria 855
953 Ga0451577_0608168 3300042876 Bacteria 992
954 Ga0439440_0078827 3300042993 Bacteria 868
955 Ga0453683_0000032 3300044673 Bacteria 241702
956 Ga0453683_0009223 3300044673 Bacteria 6590
957 Ga0453683_0017770 3300044673 Bacteria 4574
958 Ga0453683_0020317 3300044673 Bacteria 4245
959 Ga0453683_0066690 3300044673 Bacteria 2249
960 Ga0453683_0136124 3300044673 Bacteria 1549
961 Ga0453683_0148416 3300044673 Bacteria 1481
962 Ga0453683_0308039 3300044673 Bacteria 1014
963 Ga0453684_0001733 3300044712 Bacteria 58391
964 Ga0453684_0085624 3300044712 Bacteria 3914
965 Ga0453684_0146325 3300044712 Bacteria 2814
966 Ga0453684_0253350 3300044712 Bacteria 2020
967 Ga0453684_0292369 3300044712 Unclassified 1855
968 Ga0453684_0422354 3300044712 Bacteria 1489
969 Ga0453684_0700262 3300044712 Bacteria 1101
970 Ga0451576_0004794 3300045051 Bacteria 17336
971 Ga0451576_0008374 3300045051 Bacteria 12143
972 Ga0451576_0061299 3300045051 Bacteria 3923
973 Ga0451576_0097813 3300045051 Bacteria 3052
974 Ga0451576_0152648 3300045051 Bacteria 2409
975 Ga0451576_0265047 3300045051 Bacteria 1796
976 Ga0451576_0638834 3300045051 Bacteria 1118
977 Ga0451576_0954320 3300045051 Bacteria 899
978 Ga0451576_1551875 3300045051 Unclassified 687
979 Ga0466967_0289914 3300045976 Bacteria 1572
980 Ga0466967_1302879 3300045976 Bacteria 723
981 Ga0495651_1001983 3300046462 Bacteria 507
982 Ga0495664_0443934 3300046477 Bacteria 777
983 Ga0495584_0688684 3300046491 Bacteria 521
984 Ga0495583_0182942 3300046506 Bacteria 857
985 Ga0495628_1029490 3300046516 Bacteria 565
986 Ga0495630_1077588 3300046517 Bacteria 609
987 Ga0495630_1162612 3300046517 Bacteria 584
988 Ga0495652_0536179 3300046529 Bacteria 807
989 Ga0495621_0409546 3300046539 Bacteria 576
990 Ga0495622_0381757 3300046557 Bacteria 608
991 Ga0495667_0918921 3300046559 Bacteria 536
992 Ga0495625_0484352 3300046660 Bacteria 759
993 Ga0495625_0768660 3300046660 Bacteria 563
994 Ga0495599_0836478 3300046678 Bacteria 524
995 Ga0495647_0058416 3300046681 Bacteria 1516
996 Ga0495669_0225438 3300046684 Bacteria 899
997 Ga0495604_0627271 3300047317 Bacteria 687
998 Ga0495604_0869084 3300047317 Bacteria 565
999 Ga0495674_0849802 3300047319 Bacteria 707
1000 Ga0495672_0108070 3300047320 Bacteria 1497
1001 Ga0495672_0310688 3300047320 Bacteria 743
1002 Ga0495680_0761927 3300047322 Bacteria 635
1003 Ga0496100_0421868 3300048903 Bacteria 1019
1004 Ga0496102_0425706 3300048905 Bacteria 1247
1005 Ga0496105_1358588 3300048908 Bacteria 516
1006 Ga0496106_0609077 3300048909 Bacteria 874
1007 Ga0496108_0762198 3300048911 Bacteria 837
1008 Ga0496109_0702894 3300048912 Bacteria 948
1009 Ga0496109_1387016 3300048912 Bacteria 638
1010 Ga0496110_0132646 3300048913 Bacteria 2250
1011 Ga0496111_0982424 3300048914 Bacteria 605
1012 Ga0496112_0064201 3300048915 Bacteria 3623
1013 Ga0496112_1005348 3300048915 Bacteria 754
1014 Ga0496113_0212463 3300048916 Bacteria 1540
1015 Ga0496125_0147615 3300048928 Bacteria 1622
1016 Ga0496126_0060378 3300048929 Bacteria 3410
1017 Ga0495682_0189225 3300049460 Bacteria 731
1018 Ga0495682_0375173 3300049460 Bacteria 501
1019 Ga0501031_0002792 3300049568 Bacteria 11140
1020 Ga0501031_0163074 3300049568 Bacteria 1457
1021 Ga0501032_0216506 3300049569 Bacteria 1247
1022 Ga0501032_0253784 3300049569 Bacteria 1141
1023 Ga0501033_0000085 3300049570 Bacteria 88350
1024 Ga0501033_0090458 3300049570 Bacteria 2239
1025 Ga0501033_0478985 3300049570 Bacteria 862
1026 Ga0501034_0001212 3300049571 Bacteria 35390
1027 Ga0501034_0034188 3300049571 Bacteria 5154
1028 Ga0501034_0049580 3300049571 Bacteria 4236
1029 Ga0501034_0817949 3300049571 Bacteria 823
1030 Ga0501036_0188338 3300049572 Bacteria 1736
1031 Ga0501036_0324031 3300049572 Bacteria 1287
1032 Ga0501036_0928300 3300049572 Bacteria 714
1033 Ga0501036_1672578 3300049572 Bacteria 513
1034 Ga0501037_0015737 3300049573 Bacteria 5566
1035 Ga0501037_0156366 3300049573 Bacteria 1627
1036 Ga0501037_0269954 3300049573 Bacteria 1187
1037 Ga0501038_0012467 3300049574 Bacteria 7767
1038 Ga0501038_0017727 3300049574 Bacteria 6435
1039 Ga0501038_0266568 3300049574 Bacteria 1352
1040 Ga0501038_0490525 3300049574 Bacteria 940
1041 Ga0501038_0612491 3300049574 Bacteria 823
1042 Ga0501038_0880794 3300049574 Bacteria 662
1043 Ga0501039_0011528 3300049575 Bacteria 6728
1044 Ga0501039_1367532 3300049575 Bacteria 545
1045 Ga0501041_0271626 3300049577 Bacteria 1066
1046 Ga0501041_0332201 3300049577 Bacteria 959
1047 Ga0501041_0532795 3300049577 Bacteria 748
1048 Ga0501041_0743536 3300049577 Bacteria 628
1049 Ga0501041_0971019 3300049577 Bacteria 546
1050 Ga0501041_1018570 3300049577 Bacteria 533
1051 Ga0501042_1341633 3300049578 Bacteria 522
1052 Ga0501043_0013251 3300049579 Bacteria 6446
1053 Ga0501043_0171257 3300049579 Bacteria 1694
1054 Ga0501043_0188436 3300049579 Bacteria 1605
1055 Ga0501046_0342532 3300049580 Bacteria 1086
1056 Ga0501047_0072634 3300049581 Bacteria 3312
1057 Ga0501047_0097067 3300049581 Bacteria 2825
1058 Ga0501047_0177182 3300049581 Bacteria 1999
1059 Ga0501048_0248023 3300049582 Bacteria 1264
1060 Ga0501068_0033874 3300049584 Bacteria 3044
1061 Ga0501068_0265977 3300049584 Bacteria 1094
1062 Ga0501069_0078745 3300049585 Bacteria 1854
1063 Ga0501069_0118933 3300049585 Bacteria 1508
1064 Ga0501069_0202168 3300049585 Bacteria 1151
1065 Ga0501069_0400882 3300049585 Bacteria 812
1066 Ga0501070_0000205 3300049586 Bacteria 55714
1067 Ga0501070_0010339 3300049586 Bacteria 7887
1068 Ga0501070_0047310 3300049586 Bacteria 3575
1069 Ga0501070_0047315 3300049586 Bacteria 3575
1070 Ga0501070_0072567 3300049586 Bacteria 2849
1071 Ga0501070_0079771 3300049586 Bacteria 2708
1072 Ga0501070_0092877 3300049586 Bacteria 2497
1073 Ga0501070_0284218 3300049586 Bacteria 1349
1074 Ga0501070_0322926 3300049586 Bacteria 1255
1075 Ga0501070_0614077 3300049586 Bacteria 866
1076 Ga0501070_1005204 3300049586 Bacteria 647
1077 Ga0501071_0094000 3300049587 Bacteria 2205
1078 Ga0501071_0398382 3300049587 Bacteria 1051
1079 Ga0501071_0736066 3300049587 Bacteria 760
1080 Ga0501072_0328267 3300049588 Bacteria 1216
1081 Ga0501072_0443767 3300049588 Bacteria 1028
1082 Ga0501072_0520425 3300049588 Bacteria 940
1083 Ga0501072_0737821 3300049588 Bacteria 773
1084 Ga0501072_1105164 3300049588 Bacteria 617
1085 Ga0501073_0012256 3300049589 Bacteria 6256
1086 Ga0501073_0247457 3300049589 Bacteria 1231
1087 Ga0501073_0474504 3300049589 Bacteria 865
1088 Ga0501073_0760608 3300049589 Bacteria 668
1089 Ga0501074_0008681 3300049590 Bacteria 7361
1090 Ga0501074_0034570 3300049590 Bacteria 3663
1091 Ga0501074_0538840 3300049590 Bacteria 826
1092 Ga0501075_0027238 3300049591 Bacteria 4211
1093 Ga0501075_0053690 3300049591 Bacteria 3031
1094 Ga0501075_0242458 3300049591 Bacteria 1374
1095 Ga0501075_0596398 3300049591 Bacteria 843
1096 Ga0501076_0025159 3300049592 Bacteria 4605
1097 Ga0501076_0813723 3300049592 Bacteria 771
1098 Ga0501076_0996662 3300049592 Bacteria 690
1099 Ga0501077_0158129 3300049593 Bacteria 1439
1100 Ga0501077_0330153 3300049593 Bacteria 972
1101 Ga0501211_015065 3300049658 Bacteria 778
1102 Ga0501239_030106 3300049672 Bacteria 709
1103 Ga0501249_160610 3300049679 Bacteria 571
1104 Ga0501079_0026434 3300049741 Bacteria 4450
1105 Ga0501079_0292252 3300049741 Bacteria 1274
1106 Ga0501079_0651321 3300049741 Bacteria 829
1107 Ga0501079_1075017 3300049741 Bacteria 634
1108 Ga0501080_0012268 3300049742 Bacteria 7849
1109 Ga0501080_0025763 3300049742 Bacteria 5462
1110 Ga0501080_0092523 3300049742 Bacteria 2808
1111 Ga0501080_0202291 3300049742 Bacteria 1823
1112 Ga0501080_0869247 3300049742 Bacteria 787
1113 Ga0501080_1466511 3300049742 Bacteria 581
1114 Ga0501081_0028494 3300049743 Bacteria 3769
1115 Ga0501081_0054930 3300049743 Bacteria 2752
1116 Ga0501263_023819 3300049760 Bacteria 836
1117 Ga0501035_0027119 3300049822 Bacteria 5237
1118 Ga0501035_0078930 3300049822 Bacteria 2907
1119 Ga0501035_0094461 3300049822 Bacteria 2629
1120 Ga0501035_0206765 3300049822 Bacteria 1681
1121 Ga0501035_0226715 3300049822 Bacteria 1594
1122 Ga0501035_0258125 3300049822 Bacteria 1478
1123 Ga0501044_0025207 3300049823 Bacteria 6305
1124 Ga0501044_0101649 3300049823 Bacteria 2892
1125 Ga0501044_0419094 3300049823 Bacteria 1249
1126 Ga0501045_0000020 3300049824 Bacteria 68659
1127 Ga0501045_0180250 3300049824 Bacteria 1574
1128 Ga0501226_017026 3300049853 Bacteria 800
1129 nmdc:mga03683_1042_c1 3300050489 Bacteria 6227
1130 nmdc:mga03683_115128_c1 3300050489 Bacteria 1192
1131 nmdc:mga03683_154203_c1 3300050489 Bacteria 1038
1132 nmdc:mga03683_342106_c1 3300050489 Bacteria 707
1133 nmdc:mga03683_49692_c1 3300050489 Bacteria 1747
1134 nmdc:mga03683_98643_c1 3300050489 Bacteria 1282
1135 nmdc:mga00v17_420774_c1 3300050491 Bacteria 868
1136 nmdc:mga0yw44_159268_c1 3300050492 Bacteria 1477
1137 nmdc:mga0yw44_179062_c1 3300050492 Bacteria 1395
1138 nmdc:mga0yw44_225849_c1 3300050492 Bacteria 1242
1139 nmdc:mga0yw44_609616_c1 3300050492 Bacteria 742
1140 nmdc:mga0yw44_645585_c1 3300050492 Bacteria 719
1141 nmdc:mga0k408_140414_c1 3300050493 Bacteria 1119
1142 nmdc:mga0k408_302813_c1 3300050493 Bacteria 954
1143 nmdc:mga06z11_104251_c1 3300050494 Bacteria 1561
1144 nmdc:mga06z11_180098_c1 3300050494 Bacteria 1218
1145 nmdc:mga06z11_251464_c1 3300050494 Bacteria 1041
1146 nmdc:mga06z11_390740_c1 3300050494 Bacteria 837
1147 nmdc:mga06z11_589833_c1 3300050494 Bacteria 676
1148 nmdc:mga04h51_79426_c1 3300050495 Bacteria 1161
1149 nmdc:mga07m45_56264_c2 3300050496 Bacteria 1853
1150 nmdc:mga07m45_846538_c1 3300050496 Bacteria 524
1151 nmdc:mga07m45_9131_c1 3300050496 Bacteria 4158
1152 nmdc:mga05p37_2119605_c1 3300050507 Bacteria 526
1153 nmdc:mga05p37_57894_c1 3300050507 Bacteria 4773
1154 nmdc:mga05p37_642932_c1 3300050507 Bacteria 1189
1155 nmdc:mga09592_1126591_c1 3300050508 Bacteria 651
1156 nmdc:mga09592_117461_c1 3300050508 Bacteria 2283
1157 nmdc:mga09592_1625_c1 3300050508 Bacteria 18092
1158 nmdc:mga09592_828035_c1 3300050508 Bacteria 781
1159 nmdc:mga0qj67_101746_c1 3300050509 Bacteria 2317
1160 nmdc:mga0qj67_291240_c1 3300050509 Bacteria 1323
1161 nmdc:mga0qj67_403095_c1 3300050509 Bacteria 1104
1162 nmdc:mga06r32_1247364_c1 3300050510 Bacteria 689
1163 nmdc:mga06r32_146441_c1 3300050510 Bacteria 2339
1164 nmdc:mga06r32_354889_c1 3300050510 Bacteria 1451
1165 nmdc:mga06r32_7529_c1 3300050510 Bacteria 9791
1166 nmdc:mga08y16_281982_c1 3300050511 Bacteria 1714
1167 nmdc:mga08y16_303578_c1 3300050511 Bacteria 1645
1168 nmdc:mga08y16_346922_c1 3300050511 Bacteria 1526
1169 nmdc:mga08y16_46278_c1 3300050511 Bacteria 4555
1170 nmdc:mga08y16_511137_c1 3300050511 Bacteria 1219
1171 nmdc:mga08y16_7763_c1 3300050511 Bacteria 11240
1172 nmdc:mga0n895_659860_c1 3300050512 Bacteria 1044
1173 nmdc:mga0n895_67879_c1 3300050512 Bacteria 3532
1174 nmdc:mga0a205_13260_c1 3300050515 Bacteria 7664
1175 nmdc:mga0a205_578032_c1 3300050515 Bacteria 977
1176 nmdc:mga0a205_636955_c1 3300050515 Bacteria 918
1177 nmdc:mga0sz30_102_c1 3300050516 Bacteria 31707
1178 nmdc:mga0sz30_2362_c3 3300050516 Bacteria 4744
1179 nmdc:mga0sz30_71838_c1 3300050516 Bacteria 1490
1180 Ga0495601_0061880 3300053077 Bacteria 2377
1181 Ga0495619_0139532 3300053085 Bacteria 1669
1182 Ga0495619_0140851 3300053085 Bacteria 1661
1183 Ga0500651_0000291 3300053093 Bacteria 29128
1184 Ga0500651_0292341 3300053093 Bacteria 937
1185 Ga0500641_0001583 3300053096 Bacteria 8107
1186 Ga0500617_174776 3300053124 Bacteria 820
1187 Ga0500642_0476713 3300053130 Bacteria 531
1188 Ga0500642_0498325 3300053130 Bacteria 515
1189 Ga0500658_0059449 3300053134 Bacteria 1586
1190 Ga0500616_0005860 3300053153 Bacteria 8227
1191 Ga0500620_316208 3300053155 Bacteria 502
1192 Ga0500637_0202398 3300053178 Bacteria 1130
1193 Ga0500645_056333 3300053730 Bacteria 1141
1194 Ga0500609_020995 3300053731 Bacteria 891
1195 Ga0500552_000219 3300053733 Bacteria 5169
1196 Ga0500596_068619 3300053735 Bacteria 603
1197 Ga0501084_0022989 3300054114 Bacteria 5204
1198 Ga0501084_1337863 3300054114 Bacteria 600
1199 Ga0501082_0074716 3300060353 Bacteria 2919
1200 Ga0501082_0665126 3300060353 Bacteria 912
1201 Ga0501082_0781625 3300060353 Bacteria 835
1202 Ga0501082_0826763 3300060353 Bacteria 810
1203 Ga0530510_0025314 3300061734 Bacteria 4242
1204 Ga0530510_0662755 3300061734 Bacteria 795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0004794 Ga0451576_0004794_9773_10102 80
2 3300049586 Ga0501070_0072567 Ga0501070_0072567_2551_2820 89
3 3300026142 Ga0207698_10024975 Ga0207698_100249752 91
4 3300035114 Ga0373939_0389905 Ga0373939_0389905_280_558 92
5 3300001979 JGI24740J21852_10084797 JGI24740J21852_100847972 93
6 3300035171 Ga0373946_0316423 Ga0373946_0316423_10_291 93
7 3300044712 Ga0453684_0292369 Ga0453684_0292369_727_1056 93
8 3300048908 Ga0496105_1358588 Ga0496105_1358588_20_301 93
9 3300049585 Ga0501069_0118933 Ga0501069_0118933_17_298 93
10 3300029957 Ga0265324_10309304 Ga0265324_103093041 95
11 3300031344 Ga0265316_10268047 Ga0265316_102680472 95
12 3300031711 Ga0265314_10009334 Ga0265314_100093342 95
13 3300042876 Ga0451577_0608168 Ga0451577_0608168_199_528 96
14 3300044712 Ga0453684_0085624 Ga0453684_0085624_242_571 96
15 3300044712 Ga0453684_0253350 Ga0453684_0253350_1660_1989 96
16 iso_pu_bacteria 2524614729 2525556895 97
17 iso_pu_bacteria 2627854209 2630648491 97
18 iso_pu_bacteria 2816332141 2816519088 97
19 iso_pu_bacteria 2842391507 2842394831 97
20 iso_pu_bacteria 2961064222 2961065991 97
21 3300028800 Ga0265338_10061743 Ga0265338_100617433 99
22 3300031824 Ga0307413_11729384 Ga0307413_117293841 100
23 3300031901 Ga0307406_10786424 Ga0307406_107864242 100
24 3300031911 Ga0307412_10319141 Ga0307412_103191413 100
25 3300032004 Ga0307414_10190887 Ga0307414_101908872 100
26 3300032004 Ga0307414_10397133 Ga0307414_103971332 100
27 3300002070 JGI24750J21931_1053125 JGI24750J21931_10531251 101
28 3300003187 JGI25151J46595_10015776 JGI25151J46595_100157765 101
29 3300003320 rootH2_10005458 rootH2_100054582 101
30 3300003371 JGI26145J50221_1034951 JGI26145J50221_10349512 101
31 3300005288 Ga0065714_10278487 Ga0065714_102784872 101
32 3300005290 Ga0065712_10069820 Ga0065712_100698203 101
33 3300005293 Ga0065715_10208296 Ga0065715_102082963 101
34 3300005295 Ga0065707_10069677 Ga0065707_100696772 101
35 3300005295 Ga0065707_10102239 Ga0065707_101022392 101
36 3300005295 Ga0065707_10234435 Ga0065707_102344352 101
37 3300005327 Ga0070658_11371670 Ga0070658_113716701 101
38 3300005328 Ga0070676_10106384 Ga0070676_101063843 101
39 3300005329 Ga0070683_100349994 Ga0070683_1003499942 101
40 3300005329 Ga0070683_100456368 Ga0070683_1004563682 101
41 3300005329 Ga0070683_100944054 Ga0070683_1009440542 101
42 3300005330 Ga0070690_100002812 Ga0070690_1000028125 101
43 3300005331 Ga0070670_100471116 Ga0070670_1004711162 101
44 3300005331 Ga0070670_100479182 Ga0070670_1004791822 101
45 3300005331 Ga0070670_101540248 Ga0070670_1015402482 101
46 3300005333 Ga0070677_10737337 Ga0070677_107373372 101
47 3300005334 Ga0068869_100002841 Ga0068869_10000284113 101
48 3300005334 Ga0068869_100619687 Ga0068869_1006196872 101
49 3300005337 Ga0070682_100472054 Ga0070682_1004720542 101
50 3300005338 Ga0068868_100450414 Ga0068868_1004504142 101
51 3300005339 Ga0070660_100308013 Ga0070660_1003080132 101
52 3300005340 Ga0070689_100001094 Ga0070689_1000010946 101
53 3300005340 Ga0070689_100762462 Ga0070689_1007624621 101
54 3300005343 Ga0070687_100216339 Ga0070687_1002163392 101
55 3300005344 Ga0070661_100259807 Ga0070661_1002598072 101
56 3300005344 Ga0070661_100815713 Ga0070661_1008157132 101
57 3300005344 Ga0070661_101080655 Ga0070661_1010806551 101
58 3300005344 Ga0070661_101871062 Ga0070661_1018710622 101
59 3300005345 Ga0070692_10126257 Ga0070692_101262572 101
60 3300005345 Ga0070692_10817083 Ga0070692_108170832 101
61 3300005347 Ga0070668_100013940 Ga0070668_1000139405 101
62 3300005353 Ga0070669_100067122 Ga0070669_1000671223 101
63 3300005354 Ga0070675_100013649 Ga0070675_1000136495 101
64 3300005354 Ga0070675_100430036 Ga0070675_1004300362 101
65 3300005354 Ga0070675_100517223 Ga0070675_1005172232 101
66 3300005354 Ga0070675_101607120 Ga0070675_1016071201 101
67 3300005355 Ga0070671_100253366 Ga0070671_1002533661 101
68 3300005355 Ga0070671_100389916 Ga0070671_1003899162 101
69 3300005356 Ga0070674_100242958 Ga0070674_1002429582 101
70 3300005356 Ga0070674_100872610 Ga0070674_1008726102 101
71 3300005356 Ga0070674_101222385 Ga0070674_1012223852 101
72 3300005364 Ga0070673_100077357 Ga0070673_1000773574 101
73 3300005364 Ga0070673_101360780 Ga0070673_1013607802 101
74 3300005365 Ga0070688_100040619 Ga0070688_1000406194 101
75 3300005366 Ga0070659_100133905 Ga0070659_1001339052 101
76 3300005366 Ga0070659_100392854 Ga0070659_1003928542 101
77 3300005367 Ga0070667_100183217 Ga0070667_1001832174 101
78 3300005367 Ga0070667_100397993 Ga0070667_1003979932 101
79 3300005367 Ga0070667_101841245 Ga0070667_1018412452 101
80 3300005434 Ga0070709_10086413 Ga0070709_100864132 101
81 3300005434 Ga0070709_10362792 Ga0070709_103627922 101
82 3300005434 Ga0070709_11538156 Ga0070709_115381562 101
83 3300005435 Ga0070714_100000372 Ga0070714_10000037233 101
84 3300005438 Ga0070701_10060266 Ga0070701_100602662 101
85 3300005439 Ga0070711_100214462 Ga0070711_1002144623 101
86 3300005440 Ga0070705_100107192 Ga0070705_1001071923 101
87 3300005441 Ga0070700_101233972 Ga0070700_1012339721 101
88 3300005444 Ga0070694_100144351 Ga0070694_1001443512 101
89 3300005444 Ga0070694_100430741 Ga0070694_1004307412 101
90 3300005456 Ga0070678_100134571 Ga0070678_1001345712 101
91 3300005456 Ga0070678_100798663 Ga0070678_1007986631 101
92 3300005456 Ga0070678_100953179 Ga0070678_1009531792 101
93 3300005457 Ga0070662_100394935 Ga0070662_1003949352 101
94 3300005458 Ga0070681_10000058 Ga0070681_1000005811 101
95 3300005458 Ga0070681_10700586 Ga0070681_107005862 101
96 3300005458 Ga0070681_11260446 Ga0070681_112604461 101
97 3300005459 Ga0068867_100095095 Ga0068867_1000950952 101
98 3300005466 Ga0070685_10104090 Ga0070685_101040904 101
99 3300005471 Ga0070698_102171070 Ga0070698_1021710701 101
100 3300005530 Ga0070679_100118349 Ga0070679_1001183494 101
101 3300005530 Ga0070679_101284148 Ga0070679_1012841481 101
102 3300005530 Ga0070679_101724266 Ga0070679_1017242661 101
103 3300005535 Ga0070684_100001643 Ga0070684_10000164313 101
104 3300005539 Ga0068853_100799278 Ga0068853_1007992782 101
105 3300005539 Ga0068853_101545957 Ga0068853_1015459572 101
106 3300005543 Ga0070672_100016355 Ga0070672_1000163554 101
107 3300005545 Ga0070695_100829185 Ga0070695_1008291852 101
108 3300005545 Ga0070695_101025889 Ga0070695_1010258892 101
109 3300005547 Ga0070693_100210333 Ga0070693_1002103332 101
110 3300005548 Ga0070665_100041133 Ga0070665_1000411333 101
111 3300005563 Ga0068855_101271904 Ga0068855_1012719042 101
112 3300005563 Ga0068855_101333165 Ga0068855_1013331652 101
113 3300005564 Ga0070664_100004119 Ga0070664_10000411913 101
114 3300005564 Ga0070664_101389890 Ga0070664_1013898902 101
115 3300005577 Ga0068857_100313758 Ga0068857_1003137583 101
116 3300005577 Ga0068857_100596321 Ga0068857_1005963212 101
117 3300005578 Ga0068854_100147801 Ga0068854_1001478012 101
118 3300005614 Ga0068856_101559671 Ga0068856_1015596712 101
119 3300005615 Ga0070702_100007955 Ga0070702_1000079555 101
120 3300005616 Ga0068852_100431312 Ga0068852_1004313123 101
121 3300005617 Ga0068859_100003542 Ga0068859_1000035427 101
122 3300005617 Ga0068859_100161732 Ga0068859_1001617323 101
123 3300005617 Ga0068859_102628498 Ga0068859_1026284981 101
124 3300005618 Ga0068864_100002080 Ga0068864_10000208012 101
125 3300005719 Ga0068861_102281560 Ga0068861_1022815602 101
126 3300005834 Ga0068851_10502967 Ga0068851_105029672 101
127 3300005840 Ga0068870_10163763 Ga0068870_101637632 101
128 3300005841 Ga0068863_100003431 Ga0068863_10000343117 101
129 3300005841 Ga0068863_101845345 Ga0068863_1018453451 101
130 3300005842 Ga0068858_100150154 Ga0068858_1001501544 101
131 3300005843 Ga0068860_100065835 Ga0068860_1000658352 101
132 3300005843 Ga0068860_101323069 Ga0068860_1013230692 101
133 3300005843 Ga0068860_101627468 Ga0068860_1016274682 101
134 3300005844 Ga0068862_101191206 Ga0068862_1011912062 101
135 3300005937 Ga0081455_10054750 Ga0081455_100547502 101
136 3300005985 Ga0081539_10042275 Ga0081539_100422752 101
137 3300006028 Ga0070717_11034841 Ga0070717_110348412 101
138 3300006175 Ga0070712_100081916 Ga0070712_1000819164 101
139 3300006237 Ga0097621_100118997 Ga0097621_1001189972 101
140 3300006358 Ga0068871_100109737 Ga0068871_1001097372 101
141 3300006844 Ga0075428_100005214 Ga0075428_10000521418 101
142 3300006844 Ga0075428_100104078 Ga0075428_1001040784 101
143 3300006844 Ga0075428_100353694 Ga0075428_1003536943 101
144 3300006844 Ga0075428_101662488 Ga0075428_1016624882 101
145 3300006846 Ga0075430_100006334 Ga0075430_10000633410 101
146 3300006846 Ga0075430_100225756 Ga0075430_1002257563 101
147 3300006847 Ga0075431_100055692 Ga0075431_1000556922 101
148 3300006847 Ga0075431_100163788 Ga0075431_1001637882 101
149 3300006852 Ga0075433_10004060 Ga0075433_100040604 101
150 3300006852 Ga0075433_10593433 Ga0075433_105934332 101
151 3300006852 Ga0075433_11874624 Ga0075433_118746241 101
152 3300006871 Ga0075434_100006745 Ga0075434_10000674511 101
153 3300006880 Ga0075429_100007100 Ga0075429_1000071007 101
154 3300006880 Ga0075429_100936264 Ga0075429_1009362642 101
155 3300006881 Ga0068865_100204877 Ga0068865_1002048772 101
156 3300006931 Ga0097620_100003542 Ga0097620_1000035427 101
157 3300006931 Ga0097620_100161733 Ga0097620_1001617333 101
158 3300006931 Ga0097620_102628778 Ga0097620_1026287782 101
159 3300009036 Ga0105244_10151516 Ga0105244_101515162 101
160 3300009092 Ga0105250_10000023 Ga0105250_1000002371 101
161 3300009092 Ga0105250_10180981 Ga0105250_101809812 101
162 3300009093 Ga0105240_10015264 Ga0105240_100152642 101
163 3300009094 Ga0111539_10006091 Ga0111539_1000609113 101
164 3300009094 Ga0111539_10038677 Ga0111539_100386774 101
165 3300009094 Ga0111539_10656833 Ga0111539_106568332 101
166 3300009094 Ga0111539_11044874 Ga0111539_110448742 101
167 3300009098 Ga0105245_11450088 Ga0105245_114500882 101
168 3300009098 Ga0105245_12238577 Ga0105245_122385772 101
169 3300009147 Ga0114129_10012049 Ga0114129_100120497 101
170 3300009147 Ga0114129_10589038 Ga0114129_105890383 101
171 3300009148 Ga0105243_11057020 Ga0105243_110570202 101
172 3300009174 Ga0105241_12506530 Ga0105241_125065302 101
173 3300009176 Ga0105242_10159634 Ga0105242_101596342 101
174 3300009176 Ga0105242_11423816 Ga0105242_114238162 101
175 3300009176 Ga0105242_11484397 Ga0105242_114843972 101
176 3300009177 Ga0105248_10013091 Ga0105248_100130914 101
177 3300009177 Ga0105248_11649917 Ga0105248_116499171 101
178 3300009177 Ga0105248_12071450 Ga0105248_120714502 101
179 3300009551 Ga0105238_11703811 Ga0105238_117038112 101
180 3300009553 Ga0105249_10010911 Ga0105249_100109114 101
181 3300009553 Ga0105249_10068998 Ga0105249_100689985 101
182 3300009553 Ga0105249_10712431 Ga0105249_107124311 101
183 3300009979 Ga0105032_101327 Ga0105032_1013272 101
184 3300009988 Ga0105035_105563 Ga0105035_1055632 101
185 3300010159 Ga0099796_10059854 Ga0099796_100598542 101
186 3300010375 Ga0105239_11176614 Ga0105239_111766142 101
187 3300012478 Ga0157328_1012371 Ga0157328_10123712 101
188 3300012485 Ga0157325_1022663 Ga0157325_10226631 101
189 3300012487 Ga0157321_1016396 Ga0157321_10163962 101
190 3300012490 Ga0157322_1011930 Ga0157322_10119302 101
191 3300012491 Ga0157329_1047268 Ga0157329_10472682 101
192 3300012492 Ga0157335_1007582 Ga0157335_10075822 101
193 3300012497 Ga0157319_1028887 Ga0157319_10288872 101
194 3300012500 Ga0157314_1026926 Ga0157314_10269262 101
195 3300012503 Ga0157313_1008230 Ga0157313_10082302 101
196 3300012505 Ga0157339_1019563 Ga0157339_10195632 101
197 3300012510 Ga0157316_1001729 Ga0157316_10017292 101
198 3300013100 Ga0157373_10076846 Ga0157373_100768464 101
199 3300013102 Ga0157371_10116033 Ga0157371_101160332 101
200 3300013102 Ga0157371_10702630 Ga0157371_107026302 101
201 3300013104 Ga0157370_10492511 Ga0157370_104925112 101
202 3300013105 Ga0157369_10032420 Ga0157369_100324202 101
203 3300013297 Ga0157378_10202557 Ga0157378_102025573 101
204 3300013297 Ga0157378_10254609 Ga0157378_102546092 101
205 3300013297 Ga0157378_10357402 Ga0157378_103574021 101
206 3300013297 Ga0157378_10466658 Ga0157378_104666582 101
207 3300013306 Ga0163162_11035510 Ga0163162_110355102 101
208 3300013308 Ga0157375_10358117 Ga0157375_103581172 101
209 3300013308 Ga0157375_11581043 Ga0157375_115810432 101
210 3300013308 Ga0157375_11969545 Ga0157375_119695452 101
211 3300014325 Ga0163163_10030882 Ga0163163_100308822 101
212 3300014325 Ga0163163_12318229 Ga0163163_123182292 101
213 3300014326 Ga0157380_10088498 Ga0157380_100884984 101
214 3300014326 Ga0157380_10351176 Ga0157380_103511763 101
215 3300014326 Ga0157380_10475325 Ga0157380_104753252 101
216 3300014326 Ga0157380_10872203 Ga0157380_108722032 101
217 3300014745 Ga0157377_10018611 Ga0157377_100186112 101
218 3300014745 Ga0157377_11503113 Ga0157377_115031132 101
219 3300014968 Ga0157379_10021307 Ga0157379_100213072 101
220 3300014968 Ga0157379_10084854 Ga0157379_100848542 101
221 3300014969 Ga0157376_11748617 Ga0157376_117486172 101
222 3300017792 Ga0163161_11003190 Ga0163161_110031901 101
223 3300021361 Ga0213872_10037234 Ga0213872_100372342 101
224 3300021441 Ga0213871_10003275 Ga0213871_100032753 101
225 3300025292 Ga0209676_1025789 Ga0209676_10257892 101
226 3300025302 Ga0207426_1062561 Ga0207426_10625613 101
227 3300025711 Ga0207696_1000098 Ga0207696_100009842 101
228 3300025899 Ga0207642_10364956 Ga0207642_103649562 101
229 3300025901 Ga0207688_10052206 Ga0207688_100522062 101
230 3300025901 Ga0207688_10604299 Ga0207688_106042992 101
231 3300025906 Ga0207699_10310358 Ga0207699_103103582 101
232 3300025906 Ga0207699_11130928 Ga0207699_111309282 101
233 3300025907 Ga0207645_10010902 Ga0207645_100109023 101
234 3300025908 Ga0207643_10502761 Ga0207643_105027612 101
235 3300025909 Ga0207705_10387986 Ga0207705_103879862 101
236 3300025911 Ga0207654_11016646 Ga0207654_110166462 101
237 3300025912 Ga0207707_10000912 Ga0207707_1000091215 101
238 3300025912 Ga0207707_10541983 Ga0207707_105419832 101
239 3300025913 Ga0207695_10161639 Ga0207695_101616392 101
240 3300025915 Ga0207693_10107991 Ga0207693_101079912 101
241 3300025916 Ga0207663_10266962 Ga0207663_102669622 101
242 3300025918 Ga0207662_10009092 Ga0207662_100090922 101
243 3300025919 Ga0207657_10025007 Ga0207657_100250075 101
244 3300025920 Ga0207649_10016885 Ga0207649_100168852 101
245 3300025920 Ga0207649_10451736 Ga0207649_104517362 101
246 3300025920 Ga0207649_10737367 Ga0207649_107373672 101
247 3300025921 Ga0207652_10180483 Ga0207652_101804832 101
248 3300025923 Ga0207681_10080433 Ga0207681_100804333 101
249 3300025923 Ga0207681_10940439 Ga0207681_109404392 101
250 3300025924 Ga0207694_10600309 Ga0207694_106003092 101
251 3300025925 Ga0207650_10603732 Ga0207650_106037322 101
252 3300025925 Ga0207650_10683091 Ga0207650_106830912 101
253 3300025926 Ga0207659_10002602 Ga0207659_100026023 101
254 3300025926 Ga0207659_11239246 Ga0207659_112392462 101
255 3300025926 Ga0207659_11497289 Ga0207659_114972892 101
256 3300025926 Ga0207659_11666813 Ga0207659_116668132 101
257 3300025927 Ga0207687_10330585 Ga0207687_103305852 101
258 3300025927 Ga0207687_11740111 Ga0207687_117401112 101
259 3300025928 Ga0207700_10016571 Ga0207700_100165713 101
260 3300025929 Ga0207664_10005812 Ga0207664_100058122 101
261 3300025931 Ga0207644_10285518 Ga0207644_102855183 101
262 3300025931 Ga0207644_10475263 Ga0207644_104752632 101
263 3300025932 Ga0207690_10065616 Ga0207690_100656162 101
264 3300025934 Ga0207686_10059253 Ga0207686_100592531 101
265 3300025935 Ga0207709_10070905 Ga0207709_100709052 101
266 3300025935 Ga0207709_10911312 Ga0207709_109113121 101
267 3300025936 Ga0207670_10000955 Ga0207670_100009558 101
268 3300025936 Ga0207670_10566030 Ga0207670_105660302 101
269 3300025938 Ga0207704_10313012 Ga0207704_103130122 101
270 3300025939 Ga0207665_10577722 Ga0207665_105777222 101
271 3300025940 Ga0207691_10028519 Ga0207691_100285194 101
272 3300025940 Ga0207691_10188956 Ga0207691_101889562 101
273 3300025941 Ga0207711_10009083 Ga0207711_100090835 101
274 3300025941 Ga0207711_11101025 Ga0207711_111010251 101
275 3300025942 Ga0207689_10062065 Ga0207689_100620652 101
276 3300025942 Ga0207689_10192564 Ga0207689_101925643 101
277 3300025942 Ga0207689_10544740 Ga0207689_105447402 101
278 3300025944 Ga0207661_10447882 Ga0207661_104478822 101
279 3300025945 Ga0207679_10152680 Ga0207679_101526803 101
280 3300025945 Ga0207679_10164764 Ga0207679_101647642 101
281 3300025945 Ga0207679_10846136 Ga0207679_108461362 101
282 3300025960 Ga0207651_10054087 Ga0207651_100540874 101
283 3300025960 Ga0207651_11699774 Ga0207651_116997742 101
284 3300025972 Ga0207668_10002142 Ga0207668_100021425 101
285 3300025981 Ga0207640_10563281 Ga0207640_105632812 101
286 3300026023 Ga0207677_10248711 Ga0207677_102487112 101
287 3300026035 Ga0207703_10056564 Ga0207703_100565642 101
288 3300026035 Ga0207703_11775666 Ga0207703_117756662 101
289 3300026075 Ga0207708_10506386 Ga0207708_105063861 101
290 3300026088 Ga0207641_10051766 Ga0207641_100517663 101
291 3300026088 Ga0207641_12371002 Ga0207641_123710021 101
292 3300026089 Ga0207648_10111593 Ga0207648_101115932 101
293 3300026089 Ga0207648_11813793 Ga0207648_118137932 101
294 3300026089 Ga0207648_12271143 Ga0207648_122711431 101
295 3300026095 Ga0207676_10002529 Ga0207676_1000252915 101
296 3300026116 Ga0207674_10254630 Ga0207674_102546302 101
297 3300026116 Ga0207674_10910208 Ga0207674_109102082 101
298 3300026116 Ga0207674_10950995 Ga0207674_109509952 101
299 3300026121 Ga0207683_10130226 Ga0207683_101302262 101
300 3300026121 Ga0207683_10676712 Ga0207683_106767122 101
301 3300026121 Ga0207683_11561305 Ga0207683_115613052 101
302 3300026142 Ga0207698_10785599 Ga0207698_107855992 101
303 3300026142 Ga0207698_10862961 Ga0207698_108629612 101
304 3300027252 Ga0209973_1028199 Ga0209973_10281992 101
305 3300027360 Ga0209969_1004771 Ga0209969_10047713 101
306 3300027364 Ga0209967_1009251 Ga0209967_10092512 101
307 3300027378 Ga0209981_1001337 Ga0209981_10013374 101
308 3300027378 Ga0209981_1065415 Ga0209981_10654153 101
309 3300027471 Ga0209995_1030700 Ga0209995_10307002 101
310 3300027471 Ga0209995_1033043 Ga0209995_10330432 101
311 3300027543 Ga0209999_1000092 Ga0209999_10000927 101
312 3300027552 Ga0209982_1002643 Ga0209982_10026432 101
313 3300027614 Ga0209970_1025601 Ga0209970_10256012 101
314 3300027617 Ga0210002_1011194 Ga0210002_10111942 101
315 3300027665 Ga0209983_1000216 Ga0209983_10002165 101
316 3300027682 Ga0209971_1000244 Ga0209971_10002445 101
317 3300027682 Ga0209971_1047827 Ga0209971_10478272 101
318 3300027876 Ga0209974_10003853 Ga0209974_100038535 101
319 3300027907 Ga0207428_10015261 Ga0207428_100152612 101
320 3300027907 Ga0207428_10025945 Ga0207428_100259455 101
321 3300027907 Ga0207428_10066622 Ga0207428_100666223 101
322 3300027907 Ga0207428_10429416 Ga0207428_104294162 101
323 3300028379 Ga0268266_10014847 Ga0268266_100148474 101
324 3300028379 Ga0268266_12157187 Ga0268266_121571872 101
325 3300028380 Ga0268265_10004900 Ga0268265_100049003 101
326 3300028380 Ga0268265_10042806 Ga0268265_100428062 101
327 3300028380 Ga0268265_10975401 Ga0268265_109754012 101
328 3300028381 Ga0268264_10014907 Ga0268264_100149072 101
329 3300028381 Ga0268264_11125356 Ga0268264_111253562 101
330 3300028573 Ga0265334_10000009 Ga0265334_10000009129 101
331 3300028573 Ga0265334_10016689 Ga0265334_100166893 101
332 3300028800 Ga0265338_10030752 Ga0265338_100307524 101
333 3300028800 Ga0265338_10849248 Ga0265338_108492482 101
334 3300030731 Ga0316177_1078971 Ga0316177_10789713 101
335 3300030732 Ga0316176_1126462 Ga0316176_11264622 101
336 3300030733 Ga0314311_1072280 Ga0314311_10722802 101
337 3300030735 Ga0316178_1037950 Ga0316178_10379503 101
338 3300031251 Ga0265327_10089220 Ga0265327_100892202 101
339 3300031548 Ga0307408_100104606 Ga0307408_1001046064 101
340 3300031548 Ga0307408_100132187 Ga0307408_1001321874 101
341 3300031548 Ga0307408_100226482 Ga0307408_1002264822 101
342 3300031595 Ga0265313_10000628 Ga0265313_1000062828 101
343 3300031616 Ga0307508_10893633 Ga0307508_108936331 101
344 3300031665 Ga0316575_10012371 Ga0316575_100123714 101
345 3300031665 Ga0316575_10054891 Ga0316575_100548913 101
346 3300031665 Ga0316575_10191231 Ga0316575_101912312 101
347 3300031691 Ga0316579_10001255 Ga0316579_100012556 101
348 3300031691 Ga0316579_10321743 Ga0316579_103217432 101
349 3300031691 Ga0316579_10344646 Ga0316579_103446462 101
350 3300031691 Ga0316579_10479688 Ga0316579_104796882 101
351 3300031691 Ga0316579_10637711 Ga0316579_106377111 101
352 3300031727 Ga0316576_10002711 Ga0316576_100027116 101
353 3300031727 Ga0316576_10004680 Ga0316576_100046807 101
354 3300031727 Ga0316576_10005793 Ga0316576_100057937 101
355 3300031727 Ga0316576_10006718 Ga0316576_100067182 101
356 3300031727 Ga0316576_10010662 Ga0316576_100106624 101
357 3300031727 Ga0316576_10045306 Ga0316576_100453061 101
358 3300031727 Ga0316576_10182926 Ga0316576_101829262 101
359 3300031727 Ga0316576_10273020 Ga0316576_102730201 101
360 3300031727 Ga0316576_10638126 Ga0316576_106381262 101
361 3300031727 Ga0316576_10676212 Ga0316576_106762121 101
362 3300031728 Ga0316578_10000469 Ga0316578_100004694 101
363 3300031728 Ga0316578_10028616 Ga0316578_100286164 101
364 3300031728 Ga0316578_10130955 Ga0316578_101309551 101
365 3300031728 Ga0316578_10316434 Ga0316578_103164342 101
366 3300031731 Ga0307405_10031842 Ga0307405_100318424 101
367 3300031731 Ga0307405_10734265 Ga0307405_107342652 101
368 3300031733 Ga0316577_10001512 Ga0316577_100015129 101
369 3300031733 Ga0316577_10003045 Ga0316577_100030454 101
370 3300031733 Ga0316577_10050851 Ga0316577_100508512 101
371 3300031733 Ga0316577_10074888 Ga0316577_100748882 101
372 3300031733 Ga0316577_10122706 Ga0316577_101227062 101
373 3300031733 Ga0316577_10681857 Ga0316577_106818571 101
374 3300031824 Ga0307413_10068873 Ga0307413_100688733 101
375 3300031824 Ga0307413_10153351 Ga0307413_101533513 101
376 3300031824 Ga0307413_10270337 Ga0307413_102703372 101
377 3300031824 Ga0307413_10600199 Ga0307413_106001992 101
378 3300031824 Ga0307413_10673757 Ga0307413_106737572 101
379 3300031824 Ga0307413_11101118 Ga0307413_111011181 101
380 3300031824 Ga0307413_11303718 Ga0307413_113037181 101
381 3300031852 Ga0307410_10049850 Ga0307410_100498504 101
382 3300031852 Ga0307410_10441579 Ga0307410_104415792 101
383 3300031901 Ga0307406_10740795 Ga0307406_107407952 101
384 3300031901 Ga0307406_12134608 Ga0307406_121346081 101
385 3300031903 Ga0307407_10415974 Ga0307407_104159742 101
386 3300031903 Ga0307407_10472106 Ga0307407_104721061 101
387 3300031903 Ga0307407_10892395 Ga0307407_108923952 101
388 3300031911 Ga0307412_10113674 Ga0307412_101136742 101
389 3300031911 Ga0307412_10640871 Ga0307412_106408712 101
390 3300031911 Ga0307412_12314694 Ga0307412_123146942 101
391 3300031995 Ga0307409_100260956 Ga0307409_1002609562 101
392 3300031995 Ga0307409_100426573 Ga0307409_1004265732 101
393 3300031995 Ga0307409_100486245 Ga0307409_1004862452 101
394 3300032002 Ga0307416_100098925 Ga0307416_1000989254 101
395 3300032002 Ga0307416_100154839 Ga0307416_1001548393 101
396 3300032002 Ga0307416_100170274 Ga0307416_1001702741 101
397 3300032002 Ga0307416_100439317 Ga0307416_1004393173 101
398 3300032002 Ga0307416_101965261 Ga0307416_1019652612 101
399 3300032002 Ga0307416_102365520 Ga0307416_1023655202 101
400 3300032004 Ga0307414_10941640 Ga0307414_109416402 101
401 3300032004 Ga0307414_11687408 Ga0307414_116874081 101
402 3300032005 Ga0307411_10095506 Ga0307411_100955063 101
403 3300032005 Ga0307411_10366906 Ga0307411_103669062 101
404 3300032005 Ga0307411_10638037 Ga0307411_106380372 101
405 3300032005 Ga0307411_10939846 Ga0307411_109398462 101
406 3300032126 Ga0307415_100005213 Ga0307415_1000052137 101
407 3300032126 Ga0307415_100448318 Ga0307415_1004483181 101
408 3300032126 Ga0307415_100635529 Ga0307415_1006355292 101
409 3300032126 Ga0307415_100968319 Ga0307415_1009683192 101
410 3300032126 Ga0307415_102402672 Ga0307415_1024026722 101
411 3300032133 Ga0316583_10004293 Ga0316583_100042935 101
412 3300032133 Ga0316583_10032173 Ga0316583_100321731 101
413 3300032133 Ga0316583_10059532 Ga0316583_100595322 101
414 3300032137 Ga0316585_10000686 Ga0316585_100006863 101
415 3300032137 Ga0316585_10106233 Ga0316585_101062332 101
416 3300032139 Ga0316580_10000381 Ga0316580_100003814 101
417 3300032139 Ga0316580_10005234 Ga0316580_100052342 101
418 3300032139 Ga0316580_10059784 Ga0316580_100597842 101
419 3300032139 Ga0316580_10217561 Ga0316580_102175612 101
420 3300032168 Ga0316593_10000769 Ga0316593_100007692 101
421 3300032168 Ga0316593_10350026 Ga0316593_103500262 101
422 3300033527 Ga0316586_1022360 Ga0316586_10223602 101
423 3300033541 Ga0316596_1000111 Ga0316596_100011112 101
424 3300034818 Ga0373950_0129735 Ga0373950_0129735_244_549 101
425 3300035090 Ga0373949_0083144 Ga0373949_0083144_524_829 101
426 3300035091 Ga0373951_0134154 Ga0373951_0134154_163_468 101
427 3300035115 Ga0373941_0204504 Ga0373941_0204504_272_577 101
428 3300035118 Ga0373954_0383164 Ga0373954_0383164_167_472 101
429 3300035119 Ga0373956_0232577 Ga0373956_0232577_333_638 101
430 3300035171 Ga0373946_0596934 Ga0373946_0596934_96_401 101
431 3300035242 Ga0373962_0158564 Ga0373962_0158564_266_571 101
432 3300035398 Ga0316574_0000505 Ga0316574_0000505_4913_5218 101
433 3300035398 Ga0316574_0002851 Ga0316574_0002851_7143_7448 101
434 3300035398 Ga0316574_0005191 Ga0316574_0005191_4961_5266 101
435 3300035398 Ga0316574_0009989 Ga0316574_0009989_377_682 101
436 3300035398 Ga0316574_0023955 Ga0316574_0023955_3206_3511 101
437 3300035398 Ga0316574_0032827 Ga0316574_0032827_775_1080 101
438 3300035398 Ga0316574_0056770 Ga0316574_0056770_1153_1458 101
439 3300035398 Ga0316574_0088612 Ga0316574_0088612_1097_1402 101
440 3300035398 Ga0316574_0173345 Ga0316574_0173345_843_1148 101
441 3300035398 Ga0316574_0270473 Ga0316574_0270473_319_624 101
442 3300035398 Ga0316574_0307403 Ga0316574_0307403_29_334 101
443 3300035398 Ga0316574_0350827 Ga0316574_0350827_544_849 101
444 3300035398 Ga0316574_0435023 Ga0316574_0435023_353_658 101
445 3300035692 Ga0373935_0731206 Ga0373935_0731206_179_484 101
446 3300035695 Ga0373927_0000003 Ga0373927_0000003_343921_344226 101
447 3300035724 Ga0373933_0336330 Ga0373933_0336330_336_641 101
448 3300035725 Ga0373947_0497026 Ga0373947_0497026_56_361 101
449 3300036647 Ga0316582_0001472 Ga0316582_0001472_6054_6359 101
450 3300036647 Ga0316582_0024839 Ga0316582_0024839_1902_2207 101
451 3300036647 Ga0316582_1094741 Ga0316582_1094741_11_316 101
452 3300036712 Ga0316584_0004416 Ga0316584_0004416_5959_6264 101
453 3300036712 Ga0316584_0005187 Ga0316584_0005187_6432_6737 101
454 3300036712 Ga0316584_0223352 Ga0316584_0223352_725_1030 101
455 3300036712 Ga0316584_0270727 Ga0316584_0270727_28_333 101
456 3300036712 Ga0316584_0415858 Ga0316584_0415858_317_622 101
457 3300036712 Ga0316584_0991486 Ga0316584_0991486_133_438 101
458 3300037068 Ga0373925_0050662 Ga0373925_0050662_1620_1925 101
459 3300037418 Ga0395900_0197353 Ga0395900_0197353_141_464 101
460 3300037466 Ga0395898_0487202 Ga0395898_0487202_89_412 101
461 3300037466 Ga0395898_1781138 Ga0395898_1781138_109_432 101
462 3300037471 Ga0395905_1195406 Ga0395905_1195406_208_531 101
463 3300038443 Ga0395901_0743314 Ga0395901_0743314_634_939 101
464 3300038726 Ga0400490_07618 Ga0400490_07618_9056_9361 101
465 3300038742 Ga0400486_18067 Ga0400486_18067_756_1061 101
466 3300039062 Ga0400483_036792 Ga0400483_036792_4180_4485 101
467 3300039062 Ga0400483_038990 Ga0400483_038990_544_849 101
468 3300039062 Ga0400483_180247 Ga0400483_180247_2772_3077 101
469 3300039062 Ga0400483_181669 Ga0400483_181669_37_342 101
470 3300039093 Ga0400489_53512 Ga0400489_53512_473_778 101
471 3300039110 Ga0400487_66249 Ga0400487_66249_381_686 101
472 3300039438 Ga0436360_0253706 Ga0436360_0253706_9799_10104 101
473 3300039447 Ga0436361_1086284 Ga0436361_1086284_1802_2107 101
474 3300039450 Ga0436363_0607560 Ga0436363_0607560_626_931 101
475 3300039453 Ga0436362_0195822 Ga0436362_0195822_1124_1429 101
476 3300041406 Ga0439439_0007650 Ga0439439_0007650_1165_1470 101
477 3300041406 Ga0439439_0102742 Ga0439439_0102742_90_395 101
478 3300041451 Ga0451791_1427860 Ga0451791_1427860_418_723 101
479 3300041453 Ga0451797_1211170 Ga0451797_1211170_329_634 101
480 3300041453 Ga0451797_1365695 Ga0451797_1365695_523_828 101
481 3300041456 Ga0451795_1294879 Ga0451795_1294879_88_393 101
482 3300041459 Ga0451800_0097612 Ga0451800_0097612_123_428 101
483 3300041486 Ga0451807_0346592 Ga0451807_0346592_828_1133 101
484 3300041494 Ga0451837_0436478 Ga0451837_0436478_496_819 101
485 3300041494 Ga0451837_1077267 Ga0451837_1077267_216_521 101
486 3300041498 Ga0451841_0576354 Ga0451841_0576354_59_373 101
487 3300041501 Ga0451845_0691868 Ga0451845_0691868_188_493 101
488 3300041505 Ga0451849_0458457 Ga0451849_0458457_387_692 101
489 3300041512 Ga0451853_0558631 Ga0451853_0558631_255_560 101
490 3300042003 Ga0439443_013863 Ga0439443_013863_113_418 101
491 3300042007 Ga0439449_0013715 Ga0439449_0013715_2366_2689 101
492 3300042014 Ga0439457_075826 Ga0439457_075826_90_395 101
493 3300042133 Ga0450896_002550 Ga0450896_002550_1410_1715 101
494 3300042156 Ga0439446_0007690 Ga0439446_0007690_1608_1913 101
495 3300042156 Ga0439446_0012350 Ga0439446_0012350_928_1233 101
496 3300042436 Ga0439435_0000245 Ga0439435_0000245_7025_7330 101
497 3300042437 Ga0439444_0000819 Ga0439444_0000819_2170_2475 101
498 3300042438 Ga0439459_0124276 Ga0439459_0124276_213_518 101
499 3300042439 Ga0439464_0060669 Ga0439464_0060669_502_807 101
500 3300042439 Ga0439464_0179268 Ga0439464_0179268_322_627 101
501 3300042439 Ga0439464_0321557 Ga0439464_0321557_33_338 101
502 3300042461 Ga0439460_0038163 Ga0439460_0038163_1053_1358 101
503 3300042532 Ga0450893_0040196 Ga0450893_0040196_379_684 101
504 3300042993 Ga0439440_0078827 Ga0439440_0078827_92_397 101
505 3300044673 Ga0453683_0000032 Ga0453683_0000032_6449_6778 101
506 3300044673 Ga0453683_0009223 Ga0453683_0009223_4260_4589 101
507 3300044673 Ga0453683_0017770 Ga0453683_0017770_2304_2633 101
508 3300044673 Ga0453683_0020317 Ga0453683_0020317_523_852 101
509 3300044673 Ga0453683_0066690 Ga0453683_0066690_611_919 101
510 3300044673 Ga0453683_0136124 Ga0453683_0136124_815_1120 101
511 3300044673 Ga0453683_0148416 Ga0453683_0148416_34_363 101
512 3300044673 Ga0453683_0308039 Ga0453683_0308039_11_340 101
513 3300044712 Ga0453684_0001733 Ga0453684_0001733_27182_27511 101
514 3300044712 Ga0453684_0146325 Ga0453684_0146325_2425_2733 101
515 3300044712 Ga0453684_0422354 Ga0453684_0422354_92_421 101
516 3300044712 Ga0453684_0700262 Ga0453684_0700262_543_872 101
517 3300045051 Ga0451576_0008374 Ga0451576_0008374_10176_10505 101
518 3300045051 Ga0451576_0061299 Ga0451576_0061299_2343_2672 101
519 3300045051 Ga0451576_0097813 Ga0451576_0097813_2541_2849 101
520 3300045051 Ga0451576_0152648 Ga0451576_0152648_1820_2149 101
521 3300045051 Ga0451576_0265047 Ga0451576_0265047_1173_1502 101
522 3300045051 Ga0451576_0638834 Ga0451576_0638834_576_881 101
523 3300045051 Ga0451576_0954320 Ga0451576_0954320_233_538 101
524 3300045051 Ga0451576_1551875 Ga0451576_1551875_254_583 101
525 3300046477 Ga0495664_0443934 Ga0495664_0443934_313_618 101
526 3300046491 Ga0495584_0688684 Ga0495584_0688684_183_488 101
527 3300046506 Ga0495583_0182942 Ga0495583_0182942_149_454 101
528 3300046516 Ga0495628_1029490 Ga0495628_1029490_87_392 101
529 3300046517 Ga0495630_1077588 Ga0495630_1077588_236_541 101
530 3300046517 Ga0495630_1162612 Ga0495630_1162612_112_417 101
531 3300046529 Ga0495652_0536179 Ga0495652_0536179_203_508 101
532 3300046539 Ga0495621_0409546 Ga0495621_0409546_96_401 101
533 3300046557 Ga0495622_0381757 Ga0495622_0381757_163_468 101
534 3300046559 Ga0495667_0918921 Ga0495667_0918921_197_502 101
535 3300046660 Ga0495625_0484352 Ga0495625_0484352_353_658 101
536 3300046660 Ga0495625_0768660 Ga0495625_0768660_246_551 101
537 3300046678 Ga0495599_0836478 Ga0495599_0836478_126_431 101
538 3300046681 Ga0495647_0058416 Ga0495647_0058416_1088_1393 101
539 3300046684 Ga0495669_0225438 Ga0495669_0225438_267_572 101
540 3300047317 Ga0495604_0627271 Ga0495604_0627271_16_321 101
541 3300047317 Ga0495604_0869084 Ga0495604_0869084_114_419 101
542 3300047319 Ga0495674_0849802 Ga0495674_0849802_338_643 101
543 3300047320 Ga0495672_0108070 Ga0495672_0108070_760_1065 101
544 3300047320 Ga0495672_0310688 Ga0495672_0310688_218_523 101
545 3300047322 Ga0495680_0761927 Ga0495680_0761927_179_484 101
546 3300048903 Ga0496100_0421868 Ga0496100_0421868_392_697 101
547 3300048905 Ga0496102_0425706 Ga0496102_0425706_409_738 101
548 3300048909 Ga0496106_0609077 Ga0496106_0609077_141_446 101
549 3300048911 Ga0496108_0762198 Ga0496108_0762198_83_403 101
550 3300048912 Ga0496109_0702894 Ga0496109_0702894_446_766 101
551 3300048912 Ga0496109_1387016 Ga0496109_1387016_91_402 101
552 3300048913 Ga0496110_0132646 Ga0496110_0132646_865_1170 101
553 3300048914 Ga0496111_0982424 Ga0496111_0982424_50_355 101
554 3300048915 Ga0496112_0064201 Ga0496112_0064201_2485_2790 101
555 3300048916 Ga0496113_0212463 Ga0496113_0212463_1056_1361 101
556 3300049460 Ga0495682_0189225 Ga0495682_0189225_126_431 101
557 3300049460 Ga0495682_0375173 Ga0495682_0375173_179_484 101
558 3300049568 Ga0501031_0002792 Ga0501031_0002792_3693_4022 101
559 3300049568 Ga0501031_0163074 Ga0501031_0163074_930_1256 101
560 3300049569 Ga0501032_0216506 Ga0501032_0216506_497_826 101
561 3300049569 Ga0501032_0253784 Ga0501032_0253784_409_735 101
562 3300049570 Ga0501033_0000085 Ga0501033_0000085_6473_6802 101
563 3300049570 Ga0501033_0090458 Ga0501033_0090458_1663_1989 101
564 3300049570 Ga0501033_0478985 Ga0501033_0478985_291_596 101
565 3300049571 Ga0501034_0001212 Ga0501034_0001212_13901_14206 101
566 3300049571 Ga0501034_0034188 Ga0501034_0034188_389_721 101
567 3300049571 Ga0501034_0049580 Ga0501034_0049580_536_865 101
568 3300049571 Ga0501034_0817949 Ga0501034_0817949_479_805 101
569 3300049572 Ga0501036_0188338 Ga0501036_0188338_1319_1648 101
570 3300049572 Ga0501036_0324031 Ga0501036_0324031_802_1128 101
571 3300049572 Ga0501036_1672578 Ga0501036_1672578_163_495 101
572 3300049573 Ga0501037_0015737 Ga0501037_0015737_4919_5248 101
573 3300049573 Ga0501037_0269954 Ga0501037_0269954_435_761 101
574 3300049574 Ga0501038_0012467 Ga0501038_0012467_3856_4188 101
575 3300049574 Ga0501038_0017727 Ga0501038_0017727_5262_5591 101
576 3300049574 Ga0501038_0266568 Ga0501038_0266568_325_630 101
577 3300049574 Ga0501038_0490525 Ga0501038_0490525_233_559 101
578 3300049574 Ga0501038_0880794 Ga0501038_0880794_91_396 101
579 3300049575 Ga0501039_0011528 Ga0501039_0011528_5115_5444 101
580 3300049575 Ga0501039_1367532 Ga0501039_1367532_105_410 101
581 3300049577 Ga0501041_0271626 Ga0501041_0271626_735_1040 101
582 3300049577 Ga0501041_0332201 Ga0501041_0332201_148_453 101
583 3300049577 Ga0501041_0743536 Ga0501041_0743536_40_345 101
584 3300049577 Ga0501041_1018570 Ga0501041_1018570_22_327 101
585 3300049578 Ga0501042_1341633 Ga0501042_1341633_91_396 101
586 3300049579 Ga0501043_0013251 Ga0501043_0013251_975_1304 101
587 3300049580 Ga0501046_0342532 Ga0501046_0342532_393_698 101
588 3300049581 Ga0501047_0072634 Ga0501047_0072634_1805_2134 101
589 3300049582 Ga0501048_0248023 Ga0501048_0248023_907_1212 101
590 3300049584 Ga0501068_0033874 Ga0501068_0033874_765_1070 101
591 3300049584 Ga0501068_0265977 Ga0501068_0265977_748_1053 101
592 3300049585 Ga0501069_0400882 Ga0501069_0400882_10_315 101
593 3300049586 Ga0501070_0322926 Ga0501070_0322926_409_735 101
594 3300049586 Ga0501070_0614077 Ga0501070_0614077_460_789 101
595 3300049587 Ga0501071_0094000 Ga0501071_0094000_1047_1352 101
596 3300049587 Ga0501071_0398382 Ga0501071_0398382_280_585 101
597 3300049587 Ga0501071_0736066 Ga0501071_0736066_426_731 101
598 3300049588 Ga0501072_0443767 Ga0501072_0443767_373_678 101
599 3300049588 Ga0501072_0520425 Ga0501072_0520425_29_334 101
600 3300049588 Ga0501072_0737821 Ga0501072_0737821_134_439 101
601 3300049589 Ga0501073_0247457 Ga0501073_0247457_393_698 101
602 3300049589 Ga0501073_0474504 Ga0501073_0474504_397_702 101
603 3300049589 Ga0501073_0760608 Ga0501073_0760608_237_563 101
604 3300049591 Ga0501075_0027238 Ga0501075_0027238_3314_3619 101
605 3300049591 Ga0501075_0053690 Ga0501075_0053690_1773_2078 101
606 3300049591 Ga0501075_0242458 Ga0501075_0242458_237_542 101
607 3300049592 Ga0501076_0025159 Ga0501076_0025159_1845_2150 101
608 3300049592 Ga0501076_0813723 Ga0501076_0813723_124_429 101
609 3300049593 Ga0501077_0158129 Ga0501077_0158129_584_889 101
610 3300049658 Ga0501211_015065 Ga0501211_015065_346_651 101
611 3300049672 Ga0501239_030106 Ga0501239_030106_219_524 101
612 3300049679 Ga0501249_160610 Ga0501249_160610_52_357 101
613 3300049741 Ga0501079_0026434 Ga0501079_0026434_3995_4300 101
614 3300049741 Ga0501079_0292252 Ga0501079_0292252_615_920 101
615 3300049741 Ga0501079_1075017 Ga0501079_1075017_250_555 101
616 3300049742 Ga0501080_0202291 Ga0501080_0202291_1137_1442 101
617 3300049742 Ga0501080_0869247 Ga0501080_0869247_10_336 101
618 3300049742 Ga0501080_1466511 Ga0501080_1466511_101_406 101
619 3300049743 Ga0501081_0028494 Ga0501081_0028494_1038_1343 101
620 3300049743 Ga0501081_0054930 Ga0501081_0054930_814_1119 101
621 3300049760 Ga0501263_023819 Ga0501263_023819_434_760 101
622 3300049822 Ga0501035_0078930 Ga0501035_0078930_160_489 101
623 3300049822 Ga0501035_0206765 Ga0501035_0206765_989_1315 101
624 3300049822 Ga0501035_0226715 Ga0501035_0226715_597_902 101
625 3300049823 Ga0501044_0025207 Ga0501044_0025207_1164_1493 101
626 3300049824 Ga0501045_0000020 Ga0501045_0000020_59246_59575 101
627 3300049824 Ga0501045_0180250 Ga0501045_0180250_776_1081 101
628 3300049853 Ga0501226_017026 Ga0501226_017026_277_582 101
629 3300050507 nmdc:mga05p37_2119605_c1 nmdc:mga05p37_2119605_c1_87_392 101
630 3300050507 nmdc:mga05p37_57894_c1 nmdc:mga05p37_57894_c1_91_396 101
631 3300050507 nmdc:mga05p37_642932_c1 nmdc:mga05p37_642932_c1_377_682 101
632 3300050508 nmdc:mga09592_1126591_c1 nmdc:mga09592_1126591_c1_317_622 101
633 3300050508 nmdc:mga09592_117461_c1 nmdc:mga09592_117461_c1_206_511 101
634 3300050508 nmdc:mga09592_1625_c1 nmdc:mga09592_1625_c1_14112_14417 101
635 3300050509 nmdc:mga0qj67_101746_c1 nmdc:mga0qj67_101746_c1_328_633 101
636 3300050509 nmdc:mga0qj67_403095_c1 nmdc:mga0qj67_403095_c1_37_342 101
637 3300050510 nmdc:mga06r32_1247364_c1 nmdc:mga06r32_1247364_c1_12_317 101
638 3300050510 nmdc:mga06r32_146441_c1 nmdc:mga06r32_146441_c1_1272_1577 101
639 3300050510 nmdc:mga06r32_354889_c1 nmdc:mga06r32_354889_c1_1085_1390 101
640 3300050510 nmdc:mga06r32_7529_c1 nmdc:mga06r32_7529_c1_1513_1818 101
641 3300050511 nmdc:mga08y16_303578_c1 nmdc:mga08y16_303578_c1_740_1045 101
642 3300050511 nmdc:mga08y16_346922_c1 nmdc:mga08y16_346922_c1_1084_1389 101
643 3300050511 nmdc:mga08y16_46278_c1 nmdc:mga08y16_46278_c1_1488_1793 101
644 3300050511 nmdc:mga08y16_7763_c1 nmdc:mga08y16_7763_c1_8646_8951 101
645 3300050512 nmdc:mga0n895_67879_c1 nmdc:mga0n895_67879_c1_912_1217 101
646 3300050515 nmdc:mga0a205_13260_c1 nmdc:mga0a205_13260_c1_5425_5730 101
647 3300050515 nmdc:mga0a205_578032_c1 nmdc:mga0a205_578032_c1_177_482 101
648 3300053077 Ga0495601_0061880 Ga0495601_0061880_1113_1418 101
649 3300053085 Ga0495619_0139532 Ga0495619_0139532_679_984 101
650 3300053093 Ga0500651_0000291 Ga0500651_0000291_960_1265 101
651 3300053124 Ga0500617_174776 Ga0500617_174776_202_507 101
652 3300053178 Ga0500637_0202398 Ga0500637_0202398_750_1055 101
653 3300054114 Ga0501084_0022989 Ga0501084_0022989_2001_2306 101
654 3300054114 Ga0501084_1337863 Ga0501084_1337863_282_587 101
655 3300060353 Ga0501082_0074716 Ga0501082_0074716_2267_2572 101
656 3300060353 Ga0501082_0665126 Ga0501082_0665126_480_785 101
657 3300060353 Ga0501082_0781625 Ga0501082_0781625_96_401 101
658 3300060353 Ga0501082_0826763 Ga0501082_0826763_220_525 101
659 3300061734 Ga0530510_0025314 Ga0530510_0025314_1013_1318 101
660 iso_pu_bacteria 2894414249 2894415878 101
661 iso_pu_bacteria 8003014200 8003014559 101
662 3300001915 JGI24741J21665_1006058 JGI24741J21665_10060582 102
663 3300001979 JGI24740J21852_10000237 JGI24740J21852_1000023724 102
664 3300001979 JGI24740J21852_10011357 JGI24740J21852_100113573 102
665 3300001990 JGI24737J22298_10211635 JGI24737J22298_102116352 102
666 3300001991 JGI24743J22301_10155886 JGI24743J22301_101558861 102
667 3300005295 Ga0065707_10054676 Ga0065707_100546761 102
668 3300005328 Ga0070676_10405320 Ga0070676_104053202 102
669 3300005328 Ga0070676_10756693 Ga0070676_107566932 102
670 3300005329 Ga0070683_100136912 Ga0070683_1001369123 102
671 3300005329 Ga0070683_100273316 Ga0070683_1002733162 102
672 3300005329 Ga0070683_100919141 Ga0070683_1009191411 102
673 3300005329 Ga0070683_102417418 Ga0070683_1024174182 102
674 3300005334 Ga0068869_101473734 Ga0068869_1014737341 102
675 3300005335 Ga0070666_11206043 Ga0070666_112060432 102
676 3300005336 Ga0070680_100010185 Ga0070680_1000101852 102
677 3300005336 Ga0070680_100012762 Ga0070680_1000127625 102
678 3300005336 Ga0070680_100081997 Ga0070680_1000819972 102
679 3300005336 Ga0070680_100083592 Ga0070680_1000835922 102
680 3300005336 Ga0070680_100120220 Ga0070680_1001202202 102
681 3300005336 Ga0070680_101417565 Ga0070680_1014175652 102
682 3300005337 Ga0070682_100423380 Ga0070682_1004233802 102
683 3300005337 Ga0070682_100746539 Ga0070682_1007465392 102
684 3300005338 Ga0068868_100389275 Ga0068868_1003892753 102
685 3300005339 Ga0070660_100163303 Ga0070660_1001633032 102
686 3300005339 Ga0070660_100274175 Ga0070660_1002741751 102
687 3300005339 Ga0070660_100816918 Ga0070660_1008169182 102
688 3300005339 Ga0070660_101133197 Ga0070660_1011331972 102
689 3300005340 Ga0070689_100575973 Ga0070689_1005759732 102
690 3300005341 Ga0070691_10004253 Ga0070691_100042534 102
691 3300005341 Ga0070691_10011711 Ga0070691_100117113 102
692 3300005341 Ga0070691_10070928 Ga0070691_100709281 102
693 3300005341 Ga0070691_10233691 Ga0070691_102336912 102
694 3300005341 Ga0070691_10293733 Ga0070691_102937332 102
695 3300005341 Ga0070691_10465498 Ga0070691_104654982 102
696 3300005343 Ga0070687_100266341 Ga0070687_1002663412 102
697 3300005344 Ga0070661_100195995 Ga0070661_1001959952 102
698 3300005344 Ga0070661_100246458 Ga0070661_1002464582 102
699 3300005344 Ga0070661_100286391 Ga0070661_1002863912 102
700 3300005345 Ga0070692_10057240 Ga0070692_100572402 102
701 3300005345 Ga0070692_10104041 Ga0070692_101040412 102
702 3300005345 Ga0070692_10207647 Ga0070692_102076472 102
703 3300005345 Ga0070692_10268720 Ga0070692_102687202 102
704 3300005345 Ga0070692_10292766 Ga0070692_102927662 102
705 3300005354 Ga0070675_100388095 Ga0070675_1003880952 102
706 3300005364 Ga0070673_100243847 Ga0070673_1002438473 102
707 3300005365 Ga0070688_100254433 Ga0070688_1002544332 102
708 3300005365 Ga0070688_101140230 Ga0070688_1011402302 102
709 3300005365 Ga0070688_101159335 Ga0070688_1011593352 102
710 3300005366 Ga0070659_100413522 Ga0070659_1004135222 102
711 3300005366 Ga0070659_100481130 Ga0070659_1004811302 102
712 3300005366 Ga0070659_100490138 Ga0070659_1004901382 102
713 3300005367 Ga0070667_100885685 Ga0070667_1008856852 102
714 3300005406 Ga0070703_10018767 Ga0070703_100187672 102
715 3300005406 Ga0070703_10349306 Ga0070703_103493062 102
716 3300005437 Ga0070710_11254403 Ga0070710_112544031 102
717 3300005438 Ga0070701_10127975 Ga0070701_101279752 102
718 3300005438 Ga0070701_10489333 Ga0070701_104893332 102
719 3300005441 Ga0070700_100047238 Ga0070700_1000472382 102
720 3300005444 Ga0070694_100209070 Ga0070694_1002090702 102
721 3300005444 Ga0070694_100546655 Ga0070694_1005466552 102
722 3300005445 Ga0070708_100079144 Ga0070708_1000791442 102
723 3300005455 Ga0070663_100141159 Ga0070663_1001411592 102
724 3300005455 Ga0070663_100220903 Ga0070663_1002209032 102
725 3300005455 Ga0070663_100610469 Ga0070663_1006104692 102
726 3300005455 Ga0070663_100862664 Ga0070663_1008626642 102
727 3300005455 Ga0070663_101595517 Ga0070663_1015955171 102
728 3300005456 Ga0070678_100010243 Ga0070678_1000102433 102
729 3300005457 Ga0070662_100019867 Ga0070662_1000198673 102
730 3300005458 Ga0070681_10004547 Ga0070681_1000454710 102
731 3300005458 Ga0070681_10008405 Ga0070681_100084052 102
732 3300005458 Ga0070681_10015299 Ga0070681_100152997 102
733 3300005458 Ga0070681_10017110 Ga0070681_100171104 102
734 3300005458 Ga0070681_10370064 Ga0070681_103700642 102
735 3300005458 Ga0070681_10595502 Ga0070681_105955022 102
736 3300005458 Ga0070681_10718045 Ga0070681_107180451 102
737 3300005458 Ga0070681_10941455 Ga0070681_109414552 102
738 3300005459 Ga0068867_100452282 Ga0068867_1004522822 102
739 3300005466 Ga0070685_10738716 Ga0070685_107387162 102
740 3300005467 Ga0070706_100009220 Ga0070706_10000922010 102
741 3300005467 Ga0070706_100598445 Ga0070706_1005984451 102
742 3300005471 Ga0070698_100002102 Ga0070698_10000210222 102
743 3300005471 Ga0070698_100549186 Ga0070698_1005491862 102
744 3300005518 Ga0070699_100072373 Ga0070699_1000723732 102
745 3300005530 Ga0070679_100001961 Ga0070679_1000019613 102
746 3300005530 Ga0070679_100004237 Ga0070679_1000042375 102
747 3300005530 Ga0070679_100015882 Ga0070679_1000158824 102
748 3300005530 Ga0070679_100064213 Ga0070679_1000642134 102
749 3300005530 Ga0070679_100225500 Ga0070679_1002255002 102
750 3300005530 Ga0070679_101551627 Ga0070679_1015516271 102
751 3300005530 Ga0070679_101878527 Ga0070679_1018785271 102
752 3300005535 Ga0070684_100156802 Ga0070684_1001568022 102
753 3300005535 Ga0070684_100328958 Ga0070684_1003289582 102
754 3300005535 Ga0070684_100558539 Ga0070684_1005585392 102
755 3300005536 Ga0070697_100224180 Ga0070697_1002241802 102
756 3300005539 Ga0068853_100187786 Ga0068853_1001877862 102
757 3300005539 Ga0068853_100272660 Ga0068853_1002726603 102
758 3300005539 Ga0068853_101344939 Ga0068853_1013449392 102
759 3300005544 Ga0070686_101053025 Ga0070686_1010530252 102
760 3300005545 Ga0070695_100534388 Ga0070695_1005343882 102
761 3300005546 Ga0070696_100002369 Ga0070696_10000236911 102
762 3300005546 Ga0070696_100216133 Ga0070696_1002161332 102
763 3300005546 Ga0070696_101611169 Ga0070696_1016111692 102
764 3300005547 Ga0070693_100005733 Ga0070693_1000057335 102
765 3300005547 Ga0070693_100316979 Ga0070693_1003169792 102
766 3300005548 Ga0070665_100082650 Ga0070665_1000826503 102
767 3300005548 Ga0070665_100092027 Ga0070665_1000920273 102
768 3300005548 Ga0070665_101127947 Ga0070665_1011279472 102
769 3300005549 Ga0070704_100337583 Ga0070704_1003375831 102
770 3300005563 Ga0068855_100002743 Ga0068855_10000274318 102
771 3300005563 Ga0068855_100375704 Ga0068855_1003757042 102
772 3300005563 Ga0068855_100434091 Ga0068855_1004340912 102
773 3300005563 Ga0068855_101908594 Ga0068855_1019085942 102
774 3300005564 Ga0070664_100095569 Ga0070664_1000955692 102
775 3300005564 Ga0070664_100637936 Ga0070664_1006379362 102
776 3300005564 Ga0070664_101529743 Ga0070664_1015297432 102
777 3300005577 Ga0068857_100080822 Ga0068857_1000808224 102
778 3300005577 Ga0068857_100478674 Ga0068857_1004786742 102
779 3300005577 Ga0068857_101036320 Ga0068857_1010363202 102
780 3300005578 Ga0068854_100090261 Ga0068854_1000902612 102
781 3300005578 Ga0068854_100392414 Ga0068854_1003924142 102
782 3300005578 Ga0068854_100747621 Ga0068854_1007476212 102
783 3300005578 Ga0068854_102135244 Ga0068854_1021352441 102
784 3300005578 Ga0068854_102188257 Ga0068854_1021882572 102
785 3300005614 Ga0068856_100012478 Ga0068856_1000124782 102
786 3300005614 Ga0068856_100249036 Ga0068856_1002490362 102
787 3300005614 Ga0068856_101093939 Ga0068856_1010939392 102
788 3300005615 Ga0070702_100623626 Ga0070702_1006236261 102
789 3300005616 Ga0068852_100212154 Ga0068852_1002121543 102
790 3300005616 Ga0068852_100322544 Ga0068852_1003225442 102
791 3300005616 Ga0068852_100502481 Ga0068852_1005024812 102
792 3300005616 Ga0068852_100831271 Ga0068852_1008312712 102
793 3300005617 Ga0068859_100065390 Ga0068859_1000653903 102
794 3300005617 Ga0068859_100296267 Ga0068859_1002962672 102
795 3300005617 Ga0068859_101621020 Ga0068859_1016210202 102
796 3300005618 Ga0068864_100480311 Ga0068864_1004803112 102
797 3300005718 Ga0068866_10424016 Ga0068866_104240162 102
798 3300005719 Ga0068861_100291376 Ga0068861_1002913762 102
799 3300005719 Ga0068861_102681873 Ga0068861_1026818732 102
800 3300005834 Ga0068851_10119168 Ga0068851_101191682 102
801 3300005834 Ga0068851_11023400 Ga0068851_110234002 102
802 3300005841 Ga0068863_101033480 Ga0068863_1010334802 102
803 3300005841 Ga0068863_102032468 Ga0068863_1020324682 102
804 3300005842 Ga0068858_101384966 Ga0068858_1013849662 102
805 3300005843 Ga0068860_100300092 Ga0068860_1003000922 102
806 3300005843 Ga0068860_100494327 Ga0068860_1004943272 102
807 3300005843 Ga0068860_102021474 Ga0068860_1020214742 102
808 3300005844 Ga0068862_100168706 Ga0068862_1001687064 102
809 3300005844 Ga0068862_100613855 Ga0068862_1006138552 102
810 3300005844 Ga0068862_101083502 Ga0068862_1010835022 102
811 3300005937 Ga0081455_10000268 Ga0081455_100002683 102
812 3300005937 Ga0081455_10204578 Ga0081455_102045782 102
813 3300005981 Ga0081538_10084296 Ga0081538_100842961 102
814 3300005985 Ga0081539_10013083 Ga0081539_100130836 102
815 3300006038 Ga0075365_10558830 Ga0075365_105588302 102
816 3300006042 Ga0075368_10050117 Ga0075368_100501171 102
817 3300006042 Ga0075368_10055615 Ga0075368_100556152 102
818 3300006048 Ga0075363_100236481 Ga0075363_1002364812 102
819 3300006051 Ga0075364_10543097 Ga0075364_105430971 102
820 3300006051 Ga0075364_10559743 Ga0075364_105597432 102
821 3300006175 Ga0070712_100583517 Ga0070712_1005835171 102
822 3300006177 Ga0075362_10008923 Ga0075362_100089233 102
823 3300006177 Ga0075362_10020897 Ga0075362_100208972 102
824 3300006177 Ga0075362_10047714 Ga0075362_100477142 102
825 3300006177 Ga0075362_10167732 Ga0075362_101677321 102
826 3300006177 Ga0075362_10625954 Ga0075362_106259542 102
827 3300006178 Ga0075367_10041520 Ga0075367_100415203 102
828 3300006178 Ga0075367_10168964 Ga0075367_101689642 102
829 3300006178 Ga0075367_10238885 Ga0075367_102388852 102
830 3300006186 Ga0075369_10008002 Ga0075369_100080023 102
831 3300006186 Ga0075369_10030877 Ga0075369_100308772 102
832 3300006186 Ga0075369_10272459 Ga0075369_102724592 102
833 3300006195 Ga0075366_10305473 Ga0075366_103054732 102
834 3300006195 Ga0075366_10414108 Ga0075366_104141082 102
835 3300006195 Ga0075366_11058337 Ga0075366_110583372 102
836 3300006237 Ga0097621_100733281 Ga0097621_1007332812 102
837 3300006353 Ga0075370_10064170 Ga0075370_100641704 102
838 3300006353 Ga0075370_10139524 Ga0075370_101395243 102
839 3300006353 Ga0075370_10278040 Ga0075370_102780402 102
840 3300006358 Ga0068871_100874852 Ga0068871_1008748522 102
841 3300006844 Ga0075428_100346444 Ga0075428_1003464442 102
842 3300006844 Ga0075428_100481381 Ga0075428_1004813812 102
843 3300006846 Ga0075430_100282401 Ga0075430_1002824012 102
844 3300006852 Ga0075433_10488278 Ga0075433_104882782 102
845 3300006871 Ga0075434_100753152 Ga0075434_1007531522 102
846 3300006880 Ga0075429_101336271 Ga0075429_1013362712 102
847 3300006931 Ga0097620_100065389 Ga0097620_1000653893 102
848 3300006931 Ga0097620_100296272 Ga0097620_1002962722 102
849 3300006931 Ga0097620_101620990 Ga0097620_1016209902 102
850 3300007265 Ga0099794_10518170 Ga0099794_105181702 102
851 3300007788 Ga0099795_10025934 Ga0099795_100259342 102
852 3300009093 Ga0105240_10019139 Ga0105240_100191394 102
853 3300009093 Ga0105240_10223820 Ga0105240_102238204 102
854 3300009093 Ga0105240_10291794 Ga0105240_102917942 102
855 3300009094 Ga0111539_10277704 Ga0111539_102777042 102
856 3300009094 Ga0111539_10371852 Ga0111539_103718521 102
857 3300009094 Ga0111539_10378882 Ga0111539_103788822 102
858 3300009094 Ga0111539_12290432 Ga0111539_122904322 102
859 3300009094 Ga0111539_13435686 Ga0111539_134356862 102
860 3300009098 Ga0105245_10993126 Ga0105245_109931261 102
861 3300009101 Ga0105247_11181634 Ga0105247_111816342 102
862 3300009148 Ga0105243_10578939 Ga0105243_105789392 102
863 3300009176 Ga0105242_11888983 Ga0105242_118889831 102
864 3300009545 Ga0105237_10350907 Ga0105237_103509072 102
865 3300009545 Ga0105237_11572704 Ga0105237_115727042 102
866 3300009551 Ga0105238_10082734 Ga0105238_100827345 102
867 3300009551 Ga0105238_10405318 Ga0105238_104053182 102
868 3300009551 Ga0105238_10644448 Ga0105238_106444482 102
869 3300009553 Ga0105249_10929115 Ga0105249_109291152 102
870 3300009553 Ga0105249_11460237 Ga0105249_114602372 102
871 3300009988 Ga0105035_104908 Ga0105035_1049082 102
872 3300009988 Ga0105035_115012 Ga0105035_1150121 102
873 3300010159 Ga0099796_10152403 Ga0099796_101524032 102
874 3300010375 Ga0105239_10746592 Ga0105239_107465922 102
875 3300010375 Ga0105239_11525377 Ga0105239_115253772 102
876 3300011119 Ga0105246_11230406 Ga0105246_112304061 102
877 3300012510 Ga0157316_1020032 Ga0157316_10200322 102
878 3300013100 Ga0157373_10128973 Ga0157373_101289734 102
879 3300013100 Ga0157373_10163294 Ga0157373_101632943 102
880 3300013100 Ga0157373_10397466 Ga0157373_103974662 102
881 3300013100 Ga0157373_10586227 Ga0157373_105862271 102
882 3300013102 Ga0157371_10272431 Ga0157371_102724312 102
883 3300013104 Ga0157370_10232982 Ga0157370_102329822 102
884 3300013104 Ga0157370_10263741 Ga0157370_102637412 102
885 3300013104 Ga0157370_10283780 Ga0157370_102837802 102
886 3300013104 Ga0157370_10384293 Ga0157370_103842932 102
887 3300013104 Ga0157370_10501829 Ga0157370_105018292 102
888 3300013104 Ga0157370_10898316 Ga0157370_108983162 102
889 3300013104 Ga0157370_11922971 Ga0157370_119229711 102
890 3300013105 Ga0157369_10535490 Ga0157369_105354902 102
891 3300013105 Ga0157369_10560682 Ga0157369_105606822 102
892 3300013105 Ga0157369_10815163 Ga0157369_108151632 102
893 3300013105 Ga0157369_11588552 Ga0157369_115885522 102
894 3300013105 Ga0157369_11712607 Ga0157369_117126072 102
895 3300013296 Ga0157374_10660366 Ga0157374_106603662 102
896 3300013296 Ga0157374_11047909 Ga0157374_110479092 102
897 3300013306 Ga0163162_12276857 Ga0163162_122768572 102
898 3300013307 Ga0157372_10125411 Ga0157372_101254112 102
899 3300013307 Ga0157372_10228057 Ga0157372_102280572 102
900 3300013307 Ga0157372_10338190 Ga0157372_103381902 102
901 3300013307 Ga0157372_10924129 Ga0157372_109241292 102
902 3300013308 Ga0157375_10962784 Ga0157375_109627842 102
903 3300013308 Ga0157375_11092958 Ga0157375_110929582 102
904 3300013875 Ga0157515_112177 Ga0157515_1121772 102
905 3300014325 Ga0163163_12410127 Ga0163163_124101271 102
906 3300014326 Ga0157380_12627350 Ga0157380_126273501 102
907 3300014497 Ga0182008_10128865 Ga0182008_101288652 102
908 3300014745 Ga0157377_10898458 Ga0157377_108984582 102
909 3300014745 Ga0157377_10901973 Ga0157377_109019732 102
910 3300014968 Ga0157379_11897178 Ga0157379_118971782 102
911 3300014969 Ga0157376_10261648 Ga0157376_102616483 102
912 3300015262 Ga0182007_10145999 Ga0182007_101459991 102
913 3300017792 Ga0163161_10692538 Ga0163161_106925382 102
914 3300020080 Ga0206350_10919969 Ga0206350_109199692 102
915 3300020081 Ga0206354_10021222 Ga0206354_100212224 102
916 3300020082 Ga0206353_10035558 Ga0206353_100355582 102
917 3300020082 Ga0206353_11001100 Ga0206353_110011002 102
918 3300020610 Ga0154015_1173312 Ga0154015_11733122 102
919 3300025321 Ga0207656_10143901 Ga0207656_101439011 102
920 3300025901 Ga0207688_10214010 Ga0207688_102140102 102
921 3300025903 Ga0207680_11054491 Ga0207680_110544912 102
922 3300025904 Ga0207647_10016579 Ga0207647_100165795 102
923 3300025904 Ga0207647_10309413 Ga0207647_103094132 102
924 3300025906 Ga0207699_10486394 Ga0207699_104863942 102
925 3300025907 Ga0207645_10179437 Ga0207645_101794372 102
926 3300025908 Ga0207643_10638341 Ga0207643_106383411 102
927 3300025909 Ga0207705_10000083 Ga0207705_1000008329 102
928 3300025909 Ga0207705_10016964 Ga0207705_100169645 102
929 3300025909 Ga0207705_10132869 Ga0207705_101328692 102
930 3300025909 Ga0207705_10182418 Ga0207705_101824182 102
931 3300025909 Ga0207705_10470595 Ga0207705_104705951 102
932 3300025910 Ga0207684_10057826 Ga0207684_100578264 102
933 3300025911 Ga0207654_10100628 Ga0207654_101006283 102
934 3300025911 Ga0207654_10138259 Ga0207654_101382592 102
935 3300025912 Ga0207707_10000069 Ga0207707_100000692 102
936 3300025912 Ga0207707_10000292 Ga0207707_1000029249 102
937 3300025912 Ga0207707_10001098 Ga0207707_1000109810 102
938 3300025912 Ga0207707_10002049 Ga0207707_100020497 102
939 3300025912 Ga0207707_10002853 Ga0207707_100028539 102
940 3300025912 Ga0207707_10014746 Ga0207707_100147464 102
941 3300025912 Ga0207707_10042268 Ga0207707_100422682 102
942 3300025912 Ga0207707_10665327 Ga0207707_106653272 102
943 3300025913 Ga0207695_10003936 Ga0207695_1000393612 102
944 3300025913 Ga0207695_10004599 Ga0207695_100045996 102
945 3300025913 Ga0207695_10021124 Ga0207695_100211247 102
946 3300025913 Ga0207695_10149525 Ga0207695_101495252 102
947 3300025913 Ga0207695_10186630 Ga0207695_101866302 102
948 3300025913 Ga0207695_10205245 Ga0207695_102052452 102
949 3300025913 Ga0207695_10213921 Ga0207695_102139213 102
950 3300025914 Ga0207671_10538157 Ga0207671_105381572 102
951 3300025917 Ga0207660_10000080 Ga0207660_100000804 102
952 3300025917 Ga0207660_10011506 Ga0207660_100115063 102
953 3300025917 Ga0207660_10021757 Ga0207660_100217572 102
954 3300025917 Ga0207660_10037471 Ga0207660_100374712 102
955 3300025917 Ga0207660_10082740 Ga0207660_100827402 102
956 3300025917 Ga0207660_10138191 Ga0207660_101381912 102
957 3300025917 Ga0207660_10324961 Ga0207660_103249612 102
958 3300025917 Ga0207660_10936337 Ga0207660_109363372 102
959 3300025918 Ga0207662_10345307 Ga0207662_103453072 102
960 3300025919 Ga0207657_10164670 Ga0207657_101646702 102
961 3300025919 Ga0207657_10199572 Ga0207657_101995723 102
962 3300025919 Ga0207657_10405598 Ga0207657_104055982 102
963 3300025920 Ga0207649_10001073 Ga0207649_100010734 102
964 3300025920 Ga0207649_10181844 Ga0207649_101818443 102
965 3300025920 Ga0207649_10190129 Ga0207649_101901292 102
966 3300025920 Ga0207649_10356317 Ga0207649_103563172 102
967 3300025920 Ga0207649_10633114 Ga0207649_106331142 102
968 3300025921 Ga0207652_10004216 Ga0207652_100042164 102
969 3300025921 Ga0207652_10007199 Ga0207652_100071996 102
970 3300025921 Ga0207652_10008762 Ga0207652_100087625 102
971 3300025921 Ga0207652_10013121 Ga0207652_100131213 102
972 3300025921 Ga0207652_10016538 Ga0207652_100165382 102
973 3300025921 Ga0207652_10020260 Ga0207652_100202605 102
974 3300025921 Ga0207652_10025790 Ga0207652_100257905 102
975 3300025921 Ga0207652_10159426 Ga0207652_101594262 102
976 3300025921 Ga0207652_11050044 Ga0207652_110500442 102
977 3300025921 Ga0207652_11226465 Ga0207652_112264652 102
978 3300025922 Ga0207646_10309751 Ga0207646_103097512 102
979 3300025923 Ga0207681_11379939 Ga0207681_113799392 102
980 3300025924 Ga0207694_10086136 Ga0207694_100861362 102
981 3300025925 Ga0207650_10616025 Ga0207650_106160252 102
982 3300025925 Ga0207650_11099075 Ga0207650_110990752 102
983 3300025925 Ga0207650_11670881 Ga0207650_116708811 102
984 3300025926 Ga0207659_10328582 Ga0207659_103285822 102
985 3300025926 Ga0207659_10793614 Ga0207659_107936142 102
986 3300025932 Ga0207690_10029881 Ga0207690_100298814 102
987 3300025932 Ga0207690_10177685 Ga0207690_101776853 102
988 3300025932 Ga0207690_10380502 Ga0207690_103805022 102
989 3300025932 Ga0207690_11659037 Ga0207690_116590372 102
990 3300025933 Ga0207706_10027898 Ga0207706_100278983 102
991 3300025933 Ga0207706_11008701 Ga0207706_110087012 102
992 3300025934 Ga0207686_10813755 Ga0207686_108137552 102
993 3300025937 Ga0207669_11379555 Ga0207669_113795551 102
994 3300025937 Ga0207669_11424965 Ga0207669_114249652 102
995 3300025938 Ga0207704_11175201 Ga0207704_111752011 102
996 3300025940 Ga0207691_10870512 Ga0207691_108705122 102
997 3300025941 Ga0207711_10411796 Ga0207711_104117961 102
998 3300025942 Ga0207689_11436703 Ga0207689_114367031 102
999 3300025944 Ga0207661_10030536 Ga0207661_100305365 102
1000 3300025944 Ga0207661_10041689 Ga0207661_100416895 102
1001 3300025944 Ga0207661_10174835 Ga0207661_101748352 102
1002 3300025944 Ga0207661_10295663 Ga0207661_102956633 102
1003 3300025945 Ga0207679_10010978 Ga0207679_100109785 102
1004 3300025945 Ga0207679_10042253 Ga0207679_100422532 102
1005 3300025945 Ga0207679_10559186 Ga0207679_105591862 102
1006 3300025945 Ga0207679_11588660 Ga0207679_115886601 102
1007 3300025949 Ga0207667_10001111 Ga0207667_1000111121 102
1008 3300025949 Ga0207667_10023375 Ga0207667_100233754 102
1009 3300025949 Ga0207667_10069264 Ga0207667_100692645 102
1010 3300025949 Ga0207667_10089651 Ga0207667_100896514 102
1011 3300025949 Ga0207667_10099195 Ga0207667_100991952 102
1012 3300025949 Ga0207667_11037087 Ga0207667_110370871 102
1013 3300025960 Ga0207651_10202142 Ga0207651_102021423 102
1014 3300025960 Ga0207651_10821212 Ga0207651_108212122 102
1015 3300025961 Ga0207712_10371524 Ga0207712_103715242 102
1016 3300025981 Ga0207640_10001700 Ga0207640_1000170012 102
1017 3300025981 Ga0207640_10003799 Ga0207640_100037994 102
1018 3300025981 Ga0207640_10199819 Ga0207640_101998192 102
1019 3300025981 Ga0207640_10604769 Ga0207640_106047692 102
1020 3300025981 Ga0207640_11238473 Ga0207640_112384732 102
1021 3300025986 Ga0207658_10328117 Ga0207658_103281172 102
1022 3300026023 Ga0207677_10797751 Ga0207677_107977511 102
1023 3300026035 Ga0207703_10933453 Ga0207703_109334532 102
1024 3300026041 Ga0207639_10002481 Ga0207639_1000248114 102
1025 3300026041 Ga0207639_10584733 Ga0207639_105847332 102
1026 3300026041 Ga0207639_11516399 Ga0207639_115163992 102
1027 3300026067 Ga0207678_10345183 Ga0207678_103451832 102
1028 3300026067 Ga0207678_10735832 Ga0207678_107358322 102
1029 3300026067 Ga0207678_10765255 Ga0207678_107652552 102
1030 3300026067 Ga0207678_11004132 Ga0207678_110041321 102
1031 3300026075 Ga0207708_10048258 Ga0207708_100482582 102
1032 3300026075 Ga0207708_10886013 Ga0207708_108860132 102
1033 3300026078 Ga0207702_10004145 Ga0207702_100041457 102
1034 3300026078 Ga0207702_10024167 Ga0207702_100241674 102
1035 3300026078 Ga0207702_10080281 Ga0207702_100802812 102
1036 3300026078 Ga0207702_10261634 Ga0207702_102616343 102
1037 3300026078 Ga0207702_10312752 Ga0207702_103127522 102
1038 3300026088 Ga0207641_11260911 Ga0207641_112609112 102
1039 3300026088 Ga0207641_11343247 Ga0207641_113432472 102
1040 3300026089 Ga0207648_10060535 Ga0207648_100605352 102
1041 3300026095 Ga0207676_11819921 Ga0207676_118199212 102
1042 3300026116 Ga0207674_10011504 Ga0207674_100115041 102
1043 3300026116 Ga0207674_10246743 Ga0207674_102467433 102
1044 3300026116 Ga0207674_10394180 Ga0207674_103941802 102
1045 3300026116 Ga0207674_10539147 Ga0207674_105391472 102
1046 3300026118 Ga0207675_100023624 Ga0207675_1000236244 102
1047 3300026118 Ga0207675_100781314 Ga0207675_1007813142 102
1048 3300026121 Ga0207683_10031461 Ga0207683_100314613 102
1049 3300026142 Ga0207698_10000983 Ga0207698_1000098314 102
1050 3300026142 Ga0207698_10046809 Ga0207698_100468094 102
1051 3300026142 Ga0207698_10065798 Ga0207698_100657982 102
1052 3300026142 Ga0207698_10074460 Ga0207698_100744604 102
1053 3300027512 Ga0209179_1033853 Ga0209179_10338532 102
1054 3300027671 Ga0209588_1131804 Ga0209588_11318042 102
1055 3300027717 Ga0209998_10163167 Ga0209998_101631672 102
1056 3300027866 Ga0209813_10200175 Ga0209813_102001752 102
1057 3300027907 Ga0207428_10106399 Ga0207428_101063992 102
1058 3300028379 Ga0268266_10036486 Ga0268266_100364863 102
1059 3300028379 Ga0268266_10114151 Ga0268266_101141512 102
1060 3300028379 Ga0268266_10117808 Ga0268266_101178083 102
1061 3300028379 Ga0268266_10231290 Ga0268266_102312902 102
1062 3300028380 Ga0268265_10081454 Ga0268265_100814542 102
1063 3300028380 Ga0268265_10204269 Ga0268265_102042693 102
1064 3300028381 Ga0268264_10466261 Ga0268264_104662612 102
1065 3300028573 Ga0265334_10019278 Ga0265334_100192784 102
1066 3300031238 Ga0265332_10040268 Ga0265332_100402684 102
1067 3300031241 Ga0265325_10146906 Ga0265325_101469061 102
1068 3300031247 Ga0265340_10194160 Ga0265340_101941602 102
1069 3300031548 Ga0307408_100219023 Ga0307408_1002190231 102
1070 3300031548 Ga0307408_102445464 Ga0307408_1024454642 102
1071 3300031712 Ga0265342_10426261 Ga0265342_104262612 102
1072 3300031731 Ga0307405_10537175 Ga0307405_105371752 102
1073 3300031824 Ga0307413_11031278 Ga0307413_110312782 102
1074 3300031911 Ga0307412_11118825 Ga0307412_111188252 102
1075 3300032126 Ga0307415_101398084 Ga0307415_1013980842 102
1076 3300034957 Ga0373938_0234578 Ga0373938_0234578_65_373 102
1077 3300035085 Ga0373929_0023849 Ga0373929_0023849_229_537 102
1078 3300035116 Ga0373945_0077177 Ga0373945_0077177_746_1054 102
1079 3300035118 Ga0373954_0636757 Ga0373954_0636757_73_384 102
1080 3300035207 Ga0373942_0265705 Ga0373942_0265705_184_492 102
1081 3300035691 Ga0373931_0058100 Ga0373931_0058100_609_917 102
1082 3300035691 Ga0373931_0961773 Ga0373931_0961773_71_379 102
1083 3300035692 Ga0373935_0167268 Ga0373935_0167268_746_1054 102
1084 3300035724 Ga0373933_1172007 Ga0373933_1172007_118_426 102
1085 3300035725 Ga0373947_0109656 Ga0373947_0109656_547_855 102
1086 3300036401 Ga0373937_0376784 Ga0373937_0376784_552_860 102
1087 3300036401 Ga0373937_1404323 Ga0373937_1404323_305_616 102
1088 3300037068 Ga0373925_0206781 Ga0373925_0206781_1122_1430 102
1089 3300037312 Ga0395899_0003047 Ga0395899_0003047_9807_10115 102
1090 3300037312 Ga0395899_0040867 Ga0395899_0040867_502_810 102
1091 3300037312 Ga0395899_0084866 Ga0395899_0084866_1304_1612 102
1092 3300037312 Ga0395899_0235618 Ga0395899_0235618_825_1133 102
1093 3300037418 Ga0395900_0002026 Ga0395900_0002026_13784_14092 102
1094 3300037418 Ga0395900_0002792 Ga0395900_0002792_488_796 102
1095 3300037418 Ga0395900_0036061 Ga0395900_0036061_32_340 102
1096 3300037418 Ga0395900_0039505 Ga0395900_0039505_488_796 102
1097 3300037418 Ga0395900_0100964 Ga0395900_0100964_1628_1936 102
1098 3300037418 Ga0395900_0162599 Ga0395900_0162599_99_407 102
1099 3300037418 Ga0395900_0240748 Ga0395900_0240748_329_637 102
1100 3300037418 Ga0395900_0836808 Ga0395900_0836808_507_815 102
1101 3300037466 Ga0395898_0009118 Ga0395898_0009118_7125_7433 102
1102 3300037466 Ga0395898_0025582 Ga0395898_0025582_3768_4076 102
1103 3300037466 Ga0395898_0034635 Ga0395898_0034635_3264_3572 102
1104 3300037466 Ga0395898_1294729 Ga0395898_1294729_147_455 102
1105 3300037471 Ga0395905_1005578 Ga0395905_1005578_55_363 102
1106 3300038443 Ga0395901_0003592 Ga0395901_0003592_2750_3058 102
1107 3300038443 Ga0395901_0009897 Ga0395901_0009897_6512_6820 102
1108 3300038443 Ga0395901_0012227 Ga0395901_0012227_4151_4459 102
1109 3300038443 Ga0395901_0024914 Ga0395901_0024914_5096_5404 102
1110 3300038443 Ga0395901_0063211 Ga0395901_0063211_2522_2830 102
1111 3300039437 Ga0436365_0012766 Ga0436365_0012766_147_458 102
1112 3300039438 Ga0436360_0457170 Ga0436360_0457170_49_357 102
1113 3300039447 Ga0436361_0629730 Ga0436361_0629730_829_1137 102
1114 3300041413 Ga0439465_0385051 Ga0439465_0385051_55_363 102
1115 3300041452 Ga0451793_1589387 Ga0451793_1589387_344_652 102
1116 3300041486 Ga0451807_0622679 Ga0451807_0622679_492_800 102
1117 3300042000 Ga0439437_062255 Ga0439437_062255_11_319 102
1118 3300042001 Ga0439441_001948 Ga0439441_001948_1437_1745 102
1119 3300042004 Ga0439445_0118935 Ga0439445_0118935_357_665 102
1120 3300042005 Ga0439448_0149770 Ga0439448_0149770_49_357 102
1121 3300042013 Ga0439456_137969 Ga0439456_137969_150_458 102
1122 3300042438 Ga0439459_0049242 Ga0439459_0049242_130_438 102
1123 3300042438 Ga0439459_0079456 Ga0439459_0079456_149_457 102
1124 3300045976 Ga0466967_0289914 Ga0466967_0289914_547_885 102
1125 3300045976 Ga0466967_1302879 Ga0466967_1302879_65_373 102
1126 3300046462 Ga0495651_1001983 Ga0495651_1001983_188_496 102
1127 3300048915 Ga0496112_1005348 Ga0496112_1005348_139_447 102
1128 3300048928 Ga0496125_0147615 Ga0496125_0147615_493_828 102
1129 3300048929 Ga0496126_0060378 Ga0496126_0060378_2488_2796 102
1130 3300049572 Ga0501036_0928300 Ga0501036_0928300_25_333 102
1131 3300049573 Ga0501037_0156366 Ga0501037_0156366_979_1287 102
1132 3300049574 Ga0501038_0612491 Ga0501038_0612491_160_468 102
1133 3300049577 Ga0501041_0532795 Ga0501041_0532795_148_456 102
1134 3300049577 Ga0501041_0971019 Ga0501041_0971019_62_370 102
1135 3300049579 Ga0501043_0171257 Ga0501043_0171257_1273_1581 102
1136 3300049579 Ga0501043_0188436 Ga0501043_0188436_856_1164 102
1137 3300049581 Ga0501047_0097067 Ga0501047_0097067_951_1259 102
1138 3300049581 Ga0501047_0177182 Ga0501047_0177182_818_1126 102
1139 3300049585 Ga0501069_0078745 Ga0501069_0078745_1012_1320 102
1140 3300049585 Ga0501069_0202168 Ga0501069_0202168_352_660 102
1141 3300049586 Ga0501070_0000205 Ga0501070_0000205_54436_54744 102
1142 3300049586 Ga0501070_0010339 Ga0501070_0010339_6981_7289 102
1143 3300049586 Ga0501070_0047310 Ga0501070_0047310_2609_2917 102
1144 3300049586 Ga0501070_0047315 Ga0501070_0047315_1162_1470 102
1145 3300049586 Ga0501070_0079771 Ga0501070_0079771_379_687 102
1146 3300049586 Ga0501070_0092877 Ga0501070_0092877_1133_1441 102
1147 3300049586 Ga0501070_0284218 Ga0501070_0284218_167_475 102
1148 3300049586 Ga0501070_1005204 Ga0501070_1005204_261_569 102
1149 3300049588 Ga0501072_0328267 Ga0501072_0328267_533_841 102
1150 3300049588 Ga0501072_1105164 Ga0501072_1105164_221_529 102
1151 3300049589 Ga0501073_0012256 Ga0501073_0012256_5748_6056 102
1152 3300049590 Ga0501074_0008681 Ga0501074_0008681_211_519 102
1153 3300049590 Ga0501074_0034570 Ga0501074_0034570_842_1150 102
1154 3300049590 Ga0501074_0538840 Ga0501074_0538840_233_541 102
1155 3300049591 Ga0501075_0596398 Ga0501075_0596398_359_667 102
1156 3300049592 Ga0501076_0996662 Ga0501076_0996662_297_605 102
1157 3300049593 Ga0501077_0330153 Ga0501077_0330153_491_799 102
1158 3300049741 Ga0501079_0651321 Ga0501079_0651321_362_670 102
1159 3300049742 Ga0501080_0012268 Ga0501080_0012268_2673_2981 102
1160 3300049742 Ga0501080_0025763 Ga0501080_0025763_5126_5434 102
1161 3300049742 Ga0501080_0092523 Ga0501080_0092523_897_1205 102
1162 3300049822 Ga0501035_0027119 Ga0501035_0027119_172_480 102
1163 3300049822 Ga0501035_0094461 Ga0501035_0094461_1748_2056 102
1164 3300049822 Ga0501035_0258125 Ga0501035_0258125_557_865 102
1165 3300049823 Ga0501044_0101649 Ga0501044_0101649_1806_2114 102
1166 3300049823 Ga0501044_0419094 Ga0501044_0419094_877_1185 102
1167 3300050489 nmdc:mga03683_1042_c1 nmdc:mga03683_1042_c1_5149_5457 102
1168 3300050489 nmdc:mga03683_115128_c1 nmdc:mga03683_115128_c1_716_1024 102
1169 3300050489 nmdc:mga03683_154203_c1 nmdc:mga03683_154203_c1_458_766 102
1170 3300050489 nmdc:mga03683_342106_c1 nmdc:mga03683_342106_c1_346_654 102
1171 3300050489 nmdc:mga03683_49692_c1 nmdc:mga03683_49692_c1_666_974 102
1172 3300050489 nmdc:mga03683_98643_c1 nmdc:mga03683_98643_c1_839_1147 102
1173 3300050491 nmdc:mga00v17_420774_c1 nmdc:mga00v17_420774_c1_175_483 102
1174 3300050492 nmdc:mga0yw44_159268_c1 nmdc:mga0yw44_159268_c1_931_1239 102
1175 3300050492 nmdc:mga0yw44_179062_c1 nmdc:mga0yw44_179062_c1_36_344 102
1176 3300050492 nmdc:mga0yw44_225849_c1 nmdc:mga0yw44_225849_c1_722_1030 102
1177 3300050492 nmdc:mga0yw44_609616_c1 nmdc:mga0yw44_609616_c1_172_480 102
1178 3300050492 nmdc:mga0yw44_645585_c1 nmdc:mga0yw44_645585_c1_222_530 102
1179 3300050493 nmdc:mga0k408_140414_c1 nmdc:mga0k408_140414_c1_189_497 102
1180 3300050493 nmdc:mga0k408_302813_c1 nmdc:mga0k408_302813_c1_322_630 102
1181 3300050494 nmdc:mga06z11_104251_c1 nmdc:mga06z11_104251_c1_527_835 102
1182 3300050494 nmdc:mga06z11_180098_c1 nmdc:mga06z11_180098_c1_604_912 102
1183 3300050494 nmdc:mga06z11_251464_c1 nmdc:mga06z11_251464_c1_661_969 102
1184 3300050494 nmdc:mga06z11_390740_c1 nmdc:mga06z11_390740_c1_30_338 102
1185 3300050494 nmdc:mga06z11_589833_c1 nmdc:mga06z11_589833_c1_286_594 102
1186 3300050495 nmdc:mga04h51_79426_c1 nmdc:mga04h51_79426_c1_261_569 102
1187 3300050496 nmdc:mga07m45_56264_c2 nmdc:mga07m45_56264_c2_870_1178 102
1188 3300050496 nmdc:mga07m45_846538_c1 nmdc:mga07m45_846538_c1_13_321 102
1189 3300050496 nmdc:mga07m45_9131_c1 nmdc:mga07m45_9131_c1_2573_2881 102
1190 3300050508 nmdc:mga09592_828035_c1 nmdc:mga09592_828035_c1_308_616 102
1191 3300050509 nmdc:mga0qj67_291240_c1 nmdc:mga0qj67_291240_c1_122_430 102
1192 3300050511 nmdc:mga08y16_281982_c1 nmdc:mga08y16_281982_c1_425_733 102
1193 3300050511 nmdc:mga08y16_511137_c1 nmdc:mga08y16_511137_c1_696_1004 102
1194 3300050512 nmdc:mga0n895_659860_c1 nmdc:mga0n895_659860_c1_15_323 102
1195 3300050515 nmdc:mga0a205_636955_c1 nmdc:mga0a205_636955_c1_35_343 102
1196 3300050516 nmdc:mga0sz30_102_c1 nmdc:mga0sz30_102_c1_691_999 102
1197 3300050516 nmdc:mga0sz30_2362_c3 nmdc:mga0sz30_2362_c3_1459_1767 102
1198 3300050516 nmdc:mga0sz30_71838_c1 nmdc:mga0sz30_71838_c1_312_620 102
1199 3300053085 Ga0495619_0140851 Ga0495619_0140851_849_1160 102
1200 3300053093 Ga0500651_0292341 Ga0500651_0292341_173_481 102
1201 3300053096 Ga0500641_0001583 Ga0500641_0001583_883_1191 102
1202 3300053130 Ga0500642_0476713 Ga0500642_0476713_201_509 102
1203 3300053130 Ga0500642_0498325 Ga0500642_0498325_16_324 102
1204 3300053134 Ga0500658_0059449 Ga0500658_0059449_915_1223 102
1205 3300053153 Ga0500616_0005860 Ga0500616_0005860_2072_2380 102
1206 3300053155 Ga0500620_316208 Ga0500620_316208_149_460 102
1207 3300053730 Ga0500645_056333 Ga0500645_056333_332_643 102
1208 3300053731 Ga0500609_020995 Ga0500609_020995_437_745 102
1209 3300053733 Ga0500552_000219 Ga0500552_000219_700_1008 102
1210 3300053735 Ga0500596_068619 Ga0500596_068619_116_424 102
1211 3300061734 Ga0530510_0662755 Ga0530510_0662755_157_465 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

15

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.8881 11 93
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.8697 5 87
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.8691 4 87
8bef-assembly1.cif.gz_K cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) 0.8671 5 99
8e73-assembly1.cif.gz_4L vigna radiata supercomplex i+iii2 (full bridge) 0.8641 5 99
ID Description Score Start End Superfamily
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9059 8 95 1.10.287.3510
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8887 8 99 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8849 8 97 1.10.287.3510
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8472 8 99 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8464 4 98 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A368F7W0-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) 0.9601 10 89 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
AF-A0A367IZW3-F1-model_v4 NADH dehydrogenase subunit 4 0.9487 5 93 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-Q9ZY26-F1-model_v4 NADH dehydrogenase subunit 4L (EC 1.6.5.3) 0.9459 9 90 GO:0005739
GO:0016020
GO:0016491
AF-Q2A1G0-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9302 5 97 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A0R0FEW8-F1-model_v4 NADH dehydrogenase subunit 4L 0.9182 14 94 GO:0016651
GO:0030964
GO:0042773

Feature Viewer

pLDDT pTM Quality
91.66 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map