F490380

General Info

Members Datasets Scaffolds Average Seq Length
1120 516 2240 105

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100586962|Ga0075434_1005869622
Length 125
Sequence MFILVSWIKTCEAKTVNNGDMIDFDFDEKKILISKVNNKFFATDRICTHAYADLSTGFVNEDEITVTCPLHMSRFNLESGEPENLPAEEPLKTYSIEIRDGWVYILINPIHNVSFPCSTFFGLIE

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
17 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
18 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
19 3300003391 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM Metagenome Rhizosphere
20 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
21 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
22 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
23 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
24 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
25 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
26 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
27 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
28 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
35 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
37 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
137 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
138 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
139 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
140 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
141 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
142 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
143 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
144 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
145 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
146 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
147 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
148 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
149 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
150 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
151 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
152 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
153 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
154 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
155 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
156 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
157 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
158 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
159 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
160 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
173 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
174 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
185 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
186 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
278 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
279 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
284 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
295 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
296 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
299 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
300 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
303 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
304 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
305 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
306 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
307 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
308 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
309 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
310 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
311 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
312 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
313 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
314 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
315 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
316 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
317 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
318 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
319 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
320 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
321 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
324 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
325 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
326 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
327 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
328 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
331 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
332 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
340 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
341 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
374 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
375 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
376 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
377 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
378 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
379 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
380 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
397 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
406 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
407 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
408 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
409 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
410 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
411 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
412 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
413 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
414 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
415 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
416 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
417 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
418 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
419 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
420 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
421 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
422 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
423 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
424 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
425 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
426 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
427 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
428 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
429 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
430 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
431 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
432 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
433 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
434 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
435 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
436 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
437 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
438 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
439 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
443 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
444 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
445 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
446 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
447 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
448 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
449 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
450 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
451 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
452 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
453 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
454 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
455 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
459 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
460 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
461 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
462 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
463 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
464 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
465 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
466 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
467 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
468 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
469 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
470 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
471 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
474 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
475 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
476 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
477 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
516 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.8
Metatranscriptomes 9.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 3.04
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100586962 3300006871 Archaea 1133
2 MBSR1b_contig_5535578 2162886012 Archaea 2829
3 2214811879 2209111006 Archaea 1972
4 ARSoilYngRDRAFT_c00519 3300000042 Archaea 4485
5 ARcpr5yngRDRAFT_c000860 3300000043 Archaea 3597
6 ARcpr5yngRDRAFT_c006578 3300000043 Archaea 1044
7 ARSoilOldRDRAFT_c000523 3300000044 Archaea 4275
8 ARSoilOldRDRAFT_c001156 3300000044 Archaea 2528
9 ARCol0oldRDRAFT_c00236 3300000045 Archaea 5140
10 bgg_mtDRAFT_1068989 3300000305 Archaea 510
11 JGI24737J22298_10271644 3300001990 Bacteria 501
12 JGI24738J21930_10130390 3300002075 Archaea 550
13 JGI24035J26624_1003749 3300002126 Archaea 1437
14 JGI24033J26618_1036723 3300002155 Unclassified 673
15 Ga0006778J45830_1015045 3300003162 Unclassified 3292
16 Ga0006759J45824_1011425 3300003163 Unclassified 3299
17 JGI25407J50210_10184790 3300003373 Archaea 514
18 JGI26144J50225_100040 3300003380 Archaea 5555
19 JGI26139J50223_100053 3300003382 Archaea 5893
20 JGI26140J50224_100238 3300003383 Archaea 3116
21 JGI26135J50243_100060 3300003391 Archaea 3158
22 JGI26134J50242_100096 3300003392 Archaea 4782
23 JGI26137J50245_100071 3300003396 Archaea 4913
24 JGI26130J50248_100483 3300003398 Archaea 1486
25 JGI26131J50246_100169 3300003400 Archaea 3260
26 JGI26132J50249_101159 3300003405 Archaea 859
27 JGI26143J51219_1000221 3300003502 Archaea 2429
28 JGI26141J51220_1000112 3300003503 Archaea 3897
29 JGI26138J51218_100319 3300003504 Archaea 2006
30 Ga0007417J51691_1011505 3300003544 Archaea 3277
31 Ga0007409J51694_1012353 3300003575 Archaea 3217
32 Ga0007429J51699_1010930 3300003579 Unclassified 3241
33 Ga0032354_1004678 3300003693 Unclassified 3294
34 Ga0006780_1001397 3300003735 Unclassified 3238
35 Ga0058863_10756987 3300004799 Unclassified 590
36 Ga0058860_12240927 3300004801 Unclassified 525
37 Ga0058862_10259667 3300004803 Archaea 1945
38 Ga0065717_1003373 3300005276 Archaea 1298
39 Ga0065716_1005796 3300005277 Archaea 851
40 Ga0065704_10004619 3300005289 Archaea 6038
41 Ga0065704_10013720 3300005289 Archaea 2528
42 Ga0065704_10318422 3300005289 Archaea 857
43 Ga0065704_10706204 3300005289 Unclassified 555
44 Ga0065715_10097924 3300005293 Archaea 3624
45 Ga0065715_10663227 3300005293 Unclassified 672
46 Ga0065707_10000745 3300005295 Archaea 12004
47 Ga0065707_10007165 3300005295 Archaea 2406
48 Ga0065707_10007407 3300005295 Archaea 2656
49 Ga0070676_10006386 3300005328 Archaea 6298
50 Ga0070676_10025266 3300005328 Archaea 3355
51 Ga0070676_10527756 3300005328 Archaea 842
52 Ga0070683_100399387 3300005329 Archaea 1311
53 Ga0070670_100019087 3300005331 Bacteria 5880
54 Ga0070670_100027712 3300005331 Archaea 4873
55 Ga0070670_100096631 3300005331 Archaea 2541
56 Ga0068869_100001442 3300005334 Archaea 14088
57 Ga0068869_100018896 3300005334 Archaea 4699
58 Ga0068869_100039381 3300005334 Archaea 3374
59 Ga0068869_101523315 3300005334 Archaea 594
60 Ga0070666_10089258 3300005335 Archaea 2115
61 Ga0070680_100011429 3300005336 Archaea 6868
62 Ga0070680_100013892 3300005336 Archaea 6283
63 Ga0070680_100147306 3300005336 Archaea 1976
64 Ga0070682_100170577 3300005337 Archaea 1512
65 Ga0070682_100973234 3300005337 Archaea 702
66 Ga0068868_100084028 3300005338 Archaea 2557
67 Ga0068868_100097671 3300005338 Archaea 2374
68 Ga0068868_100234722 3300005338 Archaea 1539
69 Ga0070660_100417359 3300005339 Archaea 1111
70 Ga0070689_100207232 3300005340 Archaea 1603
71 Ga0070691_10106282 3300005341 Archaea 1399
72 Ga0070691_10542714 3300005341 Archaea 678
73 Ga0070687_100002432 3300005343 Archaea 6976
74 Ga0070687_100234890 3300005343 Archaea 1130
75 Ga0070692_10006278 3300005345 Archaea 5150
76 Ga0070692_10080391 3300005345 Archaea 1754
77 Ga0070692_10093241 3300005345 Archaea 1639
78 Ga0070692_10214171 3300005345 Archaea 1135
79 Ga0070692_10268166 3300005345 Bacteria 1029
80 Ga0070668_100104806 3300005347 Archaea 2245
81 Ga0070668_100199952 3300005347 Archaea 1640
82 Ga0070669_100084053 3300005353 Archaea 2374
83 Ga0070669_100138125 3300005353 Archaea 1876
84 Ga0070669_100874974 3300005353 Archaea 766
85 Ga0070675_100343844 3300005354 Archaea 1322
86 Ga0070674_100082858 3300005356 Archaea 2295
87 Ga0070673_100002477 3300005364 Archaea 11270
88 Ga0070673_100016323 3300005364 Archaea 5247
89 Ga0070688_101377970 3300005365 Unclassified 571
90 Ga0070659_100399052 3300005366 Archaea 1161
91 Ga0070667_100048778 3300005367 Archaea 3564
92 Ga0070667_100513499 3300005367 Unclassified 1099
93 Ga0070703_10217477 3300005406 Archaea 759
94 Ga0070709_10003691 3300005434 Archaea 8224
95 Ga0070709_10045315 3300005434 Archaea 2728
96 Ga0070709_10634585 3300005434 Unclassified 825
97 Ga0070709_10797002 3300005434 Archaea 741
98 Ga0070714_100056160 3300005435 Archaea 3367
99 Ga0070713_100056122 3300005436 Archaea 3276
100 Ga0070713_100519895 3300005436 Unclassified 1125
101 Ga0070710_10049405 3300005437 Archaea 2353
102 Ga0070710_10060194 3300005437 Archaea 2159
103 Ga0070710_10742774 3300005437 Archaea 696
104 Ga0070701_10006099 3300005438 Archaea 5044
105 Ga0070701_10122776 3300005438 Archaea 1466
106 Ga0070711_100000411 3300005439 Archaea 22195
107 Ga0070711_100002140 3300005439 Archaea 11203
108 Ga0070711_100006357 3300005439 Archaea 7118
109 Ga0070705_100005988 3300005440 Archaea 5947
110 Ga0070705_100219809 3300005440 Bacteria 1315
111 Ga0070705_100753402 3300005440 Unclassified 770
112 Ga0070700_100010790 3300005441 Archaea 5050
113 Ga0070700_100167845 3300005441 Archaea 1517
114 Ga0070700_100592822 3300005441 Archaea 867
115 Ga0070700_100598411 3300005441 Archaea 863
116 Ga0070694_100000033 3300005444 Archaea 63822
117 Ga0070694_100075607 3300005444 Archaea 2330
118 Ga0070694_100085738 3300005444 Archaea 2200
119 Ga0070694_100136730 3300005444 Archaea 1776
120 Ga0070694_100415555 3300005444 Archaea 1056
121 Ga0070694_100664549 3300005444 Archaea 844
122 Ga0070694_100827883 3300005444 Archaea 760
123 Ga0070708_100003268 3300005445 Archaea 12654
124 Ga0070708_100095525 3300005445 Archaea 2714
125 Ga0070708_100831744 3300005445 Archaea 868
126 Ga0070663_100434906 3300005455 Archaea 1079
127 Ga0070678_100257871 3300005456 Archaea 1465
128 Ga0070678_101902606 3300005456 Archaea 562
129 Ga0070662_100129380 3300005457 Archaea 1944
130 Ga0070662_100292884 3300005457 Archaea 1320
131 Ga0070662_100457608 3300005457 Archaea 1060
132 Ga0070681_10022369 3300005458 Archaea 6348
133 Ga0070681_10170643 3300005458 Archaea 2097
134 Ga0070681_10204028 3300005458 Archaea 1895
135 Ga0068867_100001704 3300005459 Archaea 15314
136 Ga0068867_100016228 3300005459 Archaea 5289
137 Ga0068867_100026652 3300005459 Archaea 4150
138 Ga0068867_100094671 3300005459 Archaea 2272
139 Ga0068867_100966806 3300005459 Unclassified 770
140 Ga0070685_10391795 3300005466 Archaea 960
141 Ga0070707_100007390 3300005468 Bacteria 10203
142 Ga0070707_100228498 3300005468 Bacteria 1812
143 Ga0070698_100003121 3300005471 Archaea 18265
144 Ga0070698_100246590 3300005471 Archaea 1719
145 Ga0070698_100466520 3300005471 Archaea 1199
146 Ga0070698_100581404 3300005471 Archaea 1060
147 Ga0070699_100198982 3300005518 Archaea 1781
148 Ga0070699_100256301 3300005518 Archaea 1564
149 Ga0070699_100355891 3300005518 Archaea 1319
150 Ga0070679_100107107 3300005530 Archaea 2781
151 Ga0070679_100195971 3300005530 Archaea 1988
152 Ga0070679_101791421 3300005530 Unclassified 562
153 Ga0070684_101416591 3300005535 Archaea 654
154 Ga0070697_100007966 3300005536 Archaea 8258
155 Ga0070697_100031836 3300005536 Archaea 4243
156 Ga0070697_100095502 3300005536 Archaea 2465
157 Ga0070697_100379432 3300005536 Archaea 1224
158 Ga0070697_100460429 3300005536 Unclassified 1109
159 Ga0070697_100595894 3300005536 Archaea 971
160 Ga0070697_101128228 3300005536 Archaea 698
161 Ga0068853_100490742 3300005539 Archaea 1159
162 Ga0070672_100017917 3300005543 Archaea 5108
163 Ga0070672_100021998 3300005543 Archaea 4676
164 Ga0070672_100034531 3300005543 Unclassified 3838
165 Ga0070672_100900313 3300005543 Archaea 781
166 Ga0070686_100280679 3300005544 Unclassified 1228
167 Ga0070695_100027107 3300005545 Archaea 3547
168 Ga0070695_100170344 3300005545 Archaea 1536
169 Ga0070695_100217644 3300005545 Archaea 1374
170 Ga0070695_100250666 3300005545 Archaea 1288
171 Ga0070695_100418019 3300005545 Archaea 1020
172 Ga0070696_100030604 3300005546 Archaea 3686
173 Ga0070696_100063556 3300005546 Unclassified 2585
174 Ga0070696_100186624 3300005546 Archaea 1541
175 Ga0070696_100303499 3300005546 Archaea 1223
176 Ga0070696_100505190 3300005546 Archaea 962
177 Ga0070693_100010302 3300005547 Archaea 4680
178 Ga0070693_100309294 3300005547 Archaea 1068
179 Ga0070704_100029326 3300005549 Archaea 3672
180 Ga0070704_100489713 3300005549 Archaea 1065
181 Ga0070704_100511167 3300005549 Unclassified 1044
182 Ga0070704_100723999 3300005549 Archaea 884
183 Ga0070704_100737829 3300005549 Archaea 876
184 Ga0070664_100030063 3300005564 Archaea 4530
185 Ga0070664_100057651 3300005564 Archaea 3302
186 Ga0070664_101063591 3300005564 Bacteria 761
187 Ga0068857_100114318 3300005577 Archaea 2427
188 Ga0068857_100357338 3300005577 Archaea 1354
189 Ga0068854_100104075 3300005578 Archaea 2132
190 Ga0068854_101014934 3300005578 Bacteria 735
191 Ga0068856_100057881 3300005614 Archaea 3827
192 Ga0068856_100994382 3300005614 Unclassified 857
193 Ga0070702_100054071 3300005615 Archaea 2308
194 Ga0070702_100065274 3300005615 Archaea 2132
195 Ga0070702_101091611 3300005615 Unclassified 637
196 Ga0068852_100031659 3300005616 Archaea 4369
197 Ga0068852_102697554 3300005616 Unclassified 516
198 Ga0068859_100084367 3300005617 Archaea 3222
199 Ga0068859_100405529 3300005617 Unclassified 1459
200 Ga0068864_100010644 3300005618 Archaea 7603
201 Ga0068864_100106457 3300005618 Archaea 2494
202 Ga0068864_100142039 3300005618 Archaea 2167
203 Ga0068864_100599048 3300005618 Archaea 1069
204 Ga0068866_10126191 3300005718 Archaea 1449
205 Ga0068866_10861256 3300005718 Archaea 634
206 Ga0068861_100127772 3300005719 Archaea 2059
207 Ga0068870_10004855 3300005840 Archaea 5816
208 Ga0068870_10005359 3300005840 Archaea 5594
209 Ga0068870_10009396 3300005840 Archaea 4446
210 Ga0068870_10182348 3300005840 Archaea 1261
211 Ga0068858_102420629 3300005842 Archaea 519
212 Ga0068860_100046197 3300005843 Archaea 4152
213 Ga0068860_100094019 3300005843 Archaea 2858
214 Ga0068860_100135710 3300005843 Archaea 2363
215 Ga0068862_100476332 3300005844 Archaea 1181
216 Ga0081455_10003949 3300005937 Archaea 16849
217 Ga0081455_10040472 3300005937 Archaea 4109
218 Ga0081455_10162838 3300005937 Archaea 1708
219 Ga0081455_10192647 3300005937 Archaea 1534
220 Ga0081538_10001440 3300005981 Archaea 24474
221 Ga0081538_10003513 3300005981 Bacteria 14770
222 Ga0081538_10025987 3300005981 Archaea 4111
223 Ga0081538_10162488 3300005981 Archaea 990
224 Ga0075432_10010959 3300006058 Archaea 3079
225 Ga0070715_10000811 3300006163 Archaea 8527
226 Ga0070715_10008487 3300006163 Archaea 3583
227 Ga0070716_100002205 3300006173 Archaea 8974
228 Ga0070716_100006062 3300006173 Archaea 5892
229 Ga0070716_100587681 3300006173 Unclassified 836
230 Ga0070712_100001754 3300006175 Archaea 13271
231 Ga0070712_100011221 3300006175 Archaea 5673
232 Ga0075427_10015845 3300006194 Archaea 1166
233 Ga0097621_100250040 3300006237 Archaea 1552
234 Ga0097621_100519738 3300006237 Archaea 1080
235 Ga0068871_100018374 3300006358 Archaea 5312
236 Ga0068871_100176213 3300006358 Archaea 1836
237 Ga0075428_100005660 3300006844 Archaea 13892
238 Ga0075428_100063579 3300006844 Bacteria 4041
239 Ga0075428_100110652 3300006844 Archaea 2992
240 Ga0075428_100498309 3300006844 Archaea 1303
241 Ga0075428_100642004 3300006844 Archaea 1132
242 Ga0075428_100907415 3300006844 Archaea 934
243 Ga0075428_101274921 3300006844 Archaea 773
244 Ga0075430_100000829 3300006846 Archaea 24173
245 Ga0075430_100003097 3300006846 Archaea 13894
246 Ga0075430_100028357 3300006846 Bacteria 4756
247 Ga0075430_100106981 3300006846 Archaea 2333
248 Ga0075430_100132826 3300006846 Archaea 2075
249 Ga0075430_101790285 3300006846 Unclassified 504
250 Ga0075431_100005784 3300006847 Archaea 12232
251 Ga0075431_100020347 3300006847 Archaea 6779
252 Ga0075431_100086520 3300006847 Archaea 3234
253 Ga0075431_100253471 3300006847 Unclassified 1788
254 Ga0075431_100333145 3300006847 Archaea 1528
255 Ga0075431_100359040 3300006847 Archaea 1464
256 Ga0075431_100435714 3300006847 Archaea 1308
257 Ga0075431_100466174 3300006847 Archaea 1257
258 Ga0075431_100557826 3300006847 Archaea 1132
259 Ga0075431_101237172 3300006847 Archaea 709
260 Ga0075433_10037500 3300006852 Archaea 4182
261 Ga0075433_10040991 3300006852 Bacteria 4010
262 Ga0075433_10052862 3300006852 Archaea 3540
263 Ga0075433_10875867 3300006852 Archaea 783
264 Ga0075433_11609657 3300006852 Archaea 560
265 Ga0075434_100050861 3300006871 Archaea 4116
266 Ga0075434_100240044 3300006871 Archaea 1832
267 Ga0075434_100367546 3300006871 Archaea 1459
268 Ga0075429_100003166 3300006880 Archaea 13988
269 Ga0075429_100031140 3300006880 Archaea 4636
270 Ga0075429_100040590 3300006880 Archaea 4052
271 Ga0075429_100041439 3300006880 Archaea 4010
272 Ga0075429_100129533 3300006880 Unclassified 2207
273 Ga0075429_100544229 3300006880 Archaea 1017
274 Ga0075429_101550432 3300006880 Archaea 576
275 Ga0068865_100013097 3300006881 Archaea 5233
276 Ga0068865_100181870 3300006881 Archaea 1620
277 Ga0075436_100011724 3300006914 Archaea 6017
278 Ga0075436_100052416 3300006914 Archaea 2816
279 Ga0075436_100277220 3300006914 Unclassified 1198
280 Ga0075436_100362120 3300006914 Bacteria 1046
281 Ga0075436_100853605 3300006914 Unclassified 680
282 Ga0097620_100084367 3300006931 Archaea 3222
283 Ga0097620_100405569 3300006931 Unclassified 1459
284 Ga0075435_100001606 3300007076 Archaea 14605
285 Ga0075435_100036475 3300007076 Archaea 3908
286 Ga0075435_100622079 3300007076 Unclassified 937
287 Ga0075435_100939971 3300007076 Archaea 754
288 Ga0105244_10100419 3300009036 Archaea 1416
289 Ga0105240_10836304 3300009093 Archaea 995
290 Ga0111539_10001925 3300009094 Archaea 27661
291 Ga0111539_10056270 3300009094 Archaea 4675
292 Ga0111539_10070728 3300009094 Archaea 4119
293 Ga0111539_10127155 3300009094 Bacteria 2985
294 Ga0111539_10133420 3300009094 Archaea 2907
295 Ga0111539_10231163 3300009094 Archaea 2153
296 Ga0111539_11102534 3300009094 Unclassified 922
297 Ga0105245_10053432 3300009098 Archaea 3626
298 Ga0105245_10743225 3300009098 Archaea 1016
299 Ga0105245_10777766 3300009098 Archaea 994
300 Ga0114129_10001905 3300009147 Archaea 28434
301 Ga0114129_10036208 3300009147 Archaea 6970
302 Ga0114129_10041563 3300009147 Archaea 6477
303 Ga0114129_10084207 3300009147 Bacteria 4415
304 Ga0114129_10118726 3300009147 Archaea 3643
305 Ga0114129_10248925 3300009147 Unclassified 2386
306 Ga0114129_10278315 3300009147 Archaea 2236
307 Ga0114129_10289709 3300009147 Archaea 2185
308 Ga0114129_11152941 3300009147 Archaea 968
309 Ga0114129_11244686 3300009147 Archaea 925
310 Ga0114129_12219521 3300009147 Archaea 660
311 Ga0114129_12309219 3300009147 Archaea 645
312 Ga0114129_12977656 3300009147 Archaea 558
313 Ga0105243_11400764 3300009148 Archaea 720
314 Ga0105241_10241966 3300009174 Archaea 1526
315 Ga0105242_10117629 3300009176 Archaea 2276
316 Ga0105242_10477990 3300009176 Bacteria 1180
317 Ga0105237_10040916 3300009545 Archaea 4675
318 Ga0105237_10568964 3300009545 Archaea 1140
319 Ga0105249_10000864 3300009553 Archaea 26984
320 Ga0105249_10076311 3300009553 Archaea 3106
321 Ga0105249_11438740 3300009553 Bacteria 761
322 Ga0105239_10207186 3300010375 Unclassified 2197
323 Ga0105239_10658593 3300010375 Archaea 1196
324 Ga0105239_12298888 3300010375 Archaea 627
325 Ga0105246_10023757 3300011119 Archaea 3970
326 Ga0105246_10135833 3300011119 Archaea 1843
327 Ga0105246_10174773 3300011119 Archaea 1648
328 Ga0105246_10191449 3300011119 Archaea 1583
329 Ga0157340_1000038 3300012473 Archaea 3635
330 Ga0157344_1000144 3300012476 Archaea 2287
331 Ga0157336_1000178 3300012477 Archaea 2692
332 Ga0157328_1002140 3300012478 Archaea 921
333 Ga0157346_1004025 3300012480 Archaea 851
334 Ga0157320_1006993 3300012481 Archaea 796
335 Ga0157318_1000244 3300012482 Archaea 2139
336 Ga0157337_1000144 3300012483 Archaea 3238
337 Ga0157325_1000623 3300012485 Archaea 1460
338 Ga0157321_1000208 3300012487 Archaea 2709
339 Ga0157343_1000016 3300012488 Archaea 4630
340 Ga0157335_1000167 3300012492 Archaea 2677
341 Ga0157341_1000834 3300012494 Archaea 1695
342 Ga0157323_1017035 3300012495 Archaea 652
343 Ga0157345_1000480 3300012498 Archaea 3799
344 Ga0157314_1004274 3300012500 Archaea 1045
345 Ga0157347_1001098 3300012502 Archaea 2031
346 Ga0157313_1000044 3300012503 Archaea 5305
347 Ga0157339_1000920 3300012505 Archaea 1649
348 Ga0157324_1000071 3300012506 Archaea 4637
349 Ga0157342_1000267 3300012507 Archaea 2911
350 Ga0157315_1000112 3300012508 Archaea 3345
351 Ga0157316_1000101 3300012510 Archaea 3935
352 Ga0157327_1004283 3300012512 Archaea 1097
353 Ga0157326_1000967 3300012513 Archaea 3260
354 Ga0157371_10030476 3300013102 Archaea 3892
355 Ga0157374_10041319 3300013296 Archaea 4249
356 Ga0157374_10187044 3300013296 Archaea 2025
357 Ga0157374_11167467 3300013296 Archaea 791
358 Ga0157378_10001020 3300013297 Archaea 25571
359 Ga0157378_10019369 3300013297 Archaea 5983
360 Ga0157378_10031801 3300013297 Bacteria 4661
361 Ga0157378_10059882 3300013297 Archaea 3398
362 Ga0157378_10216187 3300013297 Archaea 1820
363 Ga0163162_10154311 3300013306 Archaea 2415
364 Ga0157372_10062919 3300013307 Archaea 4159
365 Ga0157372_11709725 3300013307 Archaea 724
366 Ga0157375_10176674 3300013308 Archaea 2285
367 Ga0157375_11090634 3300013308 Archaea 934
368 Ga0157375_11916464 3300013308 Archaea 704
369 Ga0157375_13744297 3300013308 Archaea 505
370 Ga0157380_10107730 3300014326 Archaea 2334
371 Ga0182008_10001458 3300014497 Archaea 15814
372 Ga0182008_10010339 3300014497 Unclassified 4995
373 Ga0182008_10011722 3300014497 Unclassified 4651
374 Ga0182008_10017009 3300014497 Bacteria 3773
375 Ga0182008_10398889 3300014497 Unclassified 738
376 Ga0157377_10011605 3300014745 Archaea 4404
377 Ga0157377_10035098 3300014745 Archaea 2749
378 Ga0157377_10062679 3300014745 Archaea 2128
379 Ga0157377_10177681 3300014745 Archaea 1336
380 Ga0157379_10168641 3300014968 Archaea 1976
381 Ga0157376_10819589 3300014969 Archaea 944
382 Ga0157376_11638064 3300014969 Archaea 678
383 Ga0182006_1028440 3300015261 Archaea 2273
384 Ga0182007_10020187 3300015262 Archaea 2386
385 Ga0182005_1176778 3300015265 Unclassified 632
386 Ga0163161_10004363 3300017792 Archaea 9859
387 Ga0197907_10051373 3300020069 Unclassified 513
388 Ga0206356_10130563 3300020070 Archaea 2117
389 Ga0206349_1224032 3300020075 Archaea 970
390 Ga0206351_10300108 3300020077 Archaea 2072
391 Ga0206351_10770831 3300020077 Archaea 1251
392 Ga0206352_10179015 3300020078 Archaea 1142
393 Ga0206352_10863416 3300020078 Archaea 2207
394 Ga0206350_10347588 3300020080 Archaea 1814
395 Ga0206350_11067267 3300020080 Archaea 657
396 Ga0206353_10977570 3300020082 Archaea 1864
397 Ga0206353_11680876 3300020082 Archaea 1028
398 Ga0154015_1236668 3300020610 Archaea 596
399 Ga0213873_10049029 3300021358 Bacteria 1112
400 Ga0213876_10087834 3300021384 Bacteria 1646
401 Ga0224712_10033181 3300022467 Archaea 1887
402 Ga0207673_1001555 3300025290 Archaea 2526
403 Ga0207697_10000311 3300025315 Archaea 27196
404 Ga0207653_10094352 3300025885 Archaea 1052
405 Ga0207682_10013176 3300025893 Archaea 3224
406 Ga0207692_10032061 3300025898 Bacteria 2522
407 Ga0207692_10532675 3300025898 Archaea 749
408 Ga0207642_10279429 3300025899 Archaea 960
409 Ga0207688_10000312 3300025901 Archaea 22378
410 Ga0207688_10211754 3300025901 Archaea 1165
411 Ga0207688_10378477 3300025901 Archaea 875
412 Ga0207647_10006444 3300025904 Archaea 8530
413 Ga0207647_10015914 3300025904 Archaea 5146
414 Ga0207647_10016608 3300025904 Archaea 5021
415 Ga0207647_10474969 3300025904 Archaea 699
416 Ga0207685_10004917 3300025905 Archaea 3462
417 Ga0207699_10039759 3300025906 Archaea 2705
418 Ga0207699_10056769 3300025906 Archaea 2335
419 Ga0207699_10491088 3300025906 Archaea 885
420 Ga0207645_10004141 3300025907 Archaea 10787
421 Ga0207645_10019243 3300025907 Archaea 4478
422 Ga0207645_10047590 3300025907 Archaea 2738
423 Ga0207643_10001104 3300025908 Archaea 15997
424 Ga0207643_10004430 3300025908 Archaea 7549
425 Ga0207643_10006006 3300025908 Archaea 6490
426 Ga0207707_10174613 3300025912 Archaea 1877
427 Ga0207707_10691855 3300025912 Unclassified 857
428 Ga0207695_11248498 3300025913 Archaea 623
429 Ga0207671_10065762 3300025914 Archaea 2697
430 Ga0207671_11055278 3300025914 Archaea 639
431 Ga0207693_10001131 3300025915 Archaea 23915
432 Ga0207693_10006420 3300025915 Archaea 9744
433 Ga0207663_10000088 3300025916 Archaea 43811
434 Ga0207663_10000299 3300025916 Archaea 21555
435 Ga0207663_10004475 3300025916 Archaea 6953
436 Ga0207660_10027516 3300025917 Archaea 3881
437 Ga0207660_10047094 3300025917 Archaea 3046
438 Ga0207660_10054181 3300025917 Archaea 2862
439 Ga0207660_11086848 3300025917 Unclassified 652
440 Ga0207662_10002932 3300025918 Archaea 8661
441 Ga0207662_10010756 3300025918 Archaea 5059
442 Ga0207662_10255198 3300025918 Archaea 1152
443 Ga0207662_10960039 3300025918 Unclassified 606
444 Ga0207657_10252453 3300025919 Archaea 1405
445 Ga0207649_10226521 3300025920 Archaea 1334
446 Ga0207652_10192119 3300025921 Unclassified 1836
447 Ga0207652_10219531 3300025921 Archaea 1713
448 Ga0207646_10013923 3300025922 Archaea 7667
449 Ga0207681_10001577 3300025923 Archaea 14664
450 Ga0207681_10025073 3300025923 Archaea 3832
451 Ga0207650_10016560 3300025925 Archaea 5155
452 Ga0207650_10148575 3300025925 Archaea 1848
453 Ga0207659_10035531 3300025926 Archaea 3445
454 Ga0207659_10224196 3300025926 Archaea 1513
455 Ga0207687_10855302 3300025927 Archaea 777
456 Ga0207700_10246296 3300025928 Archaea 1525
457 Ga0207700_10635314 3300025928 Unclassified 951
458 Ga0207664_10040659 3300025929 Bacteria 3617
459 Ga0207664_10135651 3300025929 Archaea 2077
460 Ga0207690_10529263 3300025932 Archaea 956
461 Ga0207690_10553212 3300025932 Archaea 936
462 Ga0207690_10662022 3300025932 Archaea 856
463 Ga0207706_10003962 3300025933 Archaea 14027
464 Ga0207706_10011856 3300025933 Archaea 7937
465 Ga0207706_10277047 3300025933 Archaea 1463
466 Ga0207709_10758678 3300025935 Archaea 780
467 Ga0207670_10456901 3300025936 Archaea 1031
468 Ga0207704_10616273 3300025938 Unclassified 890
469 Ga0207704_10920514 3300025938 Archaea 736
470 Ga0207665_10004237 3300025939 Archaea 9543
471 Ga0207665_10004872 3300025939 Archaea 8938
472 Ga0207665_10144543 3300025939 Archaea 1699
473 Ga0207691_10006561 3300025940 Archaea 11238
474 Ga0207691_10048399 3300025940 Archaea 3899
475 Ga0207691_10151166 3300025940 Archaea 2041
476 Ga0207689_10003152 3300025942 Archaea 15126
477 Ga0207689_10034866 3300025942 Archaea 4179
478 Ga0207689_10868688 3300025942 Unclassified 761
479 Ga0207689_11194859 3300025942 Archaea 640
480 Ga0207661_10547468 3300025944 Bacteria 1060
481 Ga0207679_10297329 3300025945 Archaea 1390
482 Ga0207679_10909340 3300025945 Archaea 805
483 Ga0207667_11655290 3300025949 Archaea 607
484 Ga0207651_10014717 3300025960 Archaea 4526
485 Ga0207651_10050434 3300025960 Archaea 2826
486 Ga0207712_10009985 3300025961 Archaea 6017
487 Ga0207712_10040773 3300025961 Archaea 3189
488 Ga0207668_10026838 3300025972 Archaea 3746
489 Ga0207658_10006719 3300025986 Archaea 7832
490 Ga0207658_11493319 3300025986 Archaea 618
491 Ga0207677_10015956 3300026023 Archaea 4435
492 Ga0207677_10026345 3300026023 Archaea 3644
493 Ga0207677_10079834 3300026023 Archaea 2341
494 Ga0207703_10801902 3300026035 Archaea 899
495 Ga0207703_11414201 3300026035 Archaea 669
496 Ga0207708_10019693 3300026075 Archaea 5089
497 Ga0207708_10035791 3300026075 Unclassified 3778
498 Ga0207702_10050288 3300026078 Archaea 3519
499 Ga0207648_10008075 3300026089 Archaea 10254
500 Ga0207648_10010970 3300026089 Archaea 8561
501 Ga0207648_10023860 3300026089 Archaea 5471
502 Ga0207648_10091212 3300026089 Archaea 2664
503 Ga0207676_10028272 3300026095 Archaea 4186
504 Ga0207676_10308129 3300026095 Archaea 1448
505 Ga0207674_10918784 3300026116 Archaea 843
506 Ga0207675_100217061 3300026118 Archaea 1842
507 Ga0207683_11066675 3300026121 Archaea 750
508 Ga0207698_10412843 3300026142 Archaea 1293
509 Ga0207698_10707687 3300026142 Archaea 1003
510 Ga0209969_1000642 3300027360 Archaea 4650
511 Ga0209969_1015519 3300027360 Archaea 1113
512 Ga0209969_1022572 3300027360 Archaea 942
513 Ga0209967_1000983 3300027364 Archaea 3640
514 Ga0209967_1005278 3300027364 Archaea 1733
515 Ga0209981_1001005 3300027378 Archaea 3559
516 Ga0209984_1006611 3300027424 Archaea 1425
517 Ga0210000_1001257 3300027462 Archaea 3573
518 Ga0209995_1000507 3300027471 Archaea 5963
519 Ga0209968_1001413 3300027526 Archaea 3633
520 Ga0209968_1030545 3300027526 Archaea 900
521 Ga0209999_1031502 3300027543 Unclassified 985
522 Ga0209982_1000492 3300027552 Archaea 4904
523 Ga0209982_1001341 3300027552 Archaea 3338
524 Ga0209982_1089801 3300027552 Archaea 509
525 Ga0209970_1000666 3300027614 Archaea 5942
526 Ga0210002_1000452 3300027617 Archaea 5552
527 Ga0210002_1075235 3300027617 Unclassified 598
528 Ga0209983_1006260 3300027665 Archaea 2451
529 Ga0209983_1096206 3300027665 Unclassified 669
530 Ga0209971_1005030 3300027682 Archaea 3141
531 Ga0209966_1001124 3300027695 Archaea 4792
532 Ga0209998_10001267 3300027717 Archaea 6180
533 Ga0209974_10001373 3300027876 Bacteria 8790
534 Ga0209974_10003090 3300027876 Archaea 6021
535 Ga0207428_10000500 3300027907 Archaea 46800
536 Ga0207428_10001091 3300027907 Archaea 29557
537 Ga0207428_10019918 3300027907 Archaea 5714
538 Ga0207428_10198767 3300027907 Archaea 1509
539 Ga0207428_10606130 3300027907 Archaea 789
540 Ga0207428_10737525 3300027907 Archaea 703
541 Ga0268265_10024805 3300028380 Archaea 4248
542 Ga0268265_10037176 3300028380 Unclassified 3571
543 Ga0268265_10251418 3300028380 Archaea 1566
544 Ga0268265_10471883 3300028380 Archaea 1176
545 Ga0268264_10085708 3300028381 Archaea 2704
546 Ga0307408_100379869 3300031548 Archaea 1207
547 Ga0307408_100518207 3300031548 Unclassified 1047
548 Ga0307405_10096287 3300031731 Unclassified 1973
549 Ga0307413_10038415 3300031824 Archaea 2774
550 Ga0307413_10060344 3300031824 Bacteria 2334
551 Ga0307410_10093908 3300031852 Archaea 2135
552 Ga0307410_10855882 3300031852 Archaea 776
553 Ga0307410_11840445 3300031852 Archaea 538
554 Ga0307406_10010155 3300031901 Archaea 5306
555 Ga0307406_11638774 3300031901 Archaea 569
556 Ga0307407_10000901 3300031903 Archaea 10029
557 Ga0307407_10100758 3300031903 Archaea 1792
558 Ga0307407_10204488 3300031903 Archaea 1325
559 Ga0307407_11135464 3300031903 Archaea 608
560 Ga0307412_10086897 3300031911 Unclassified 2177
561 Ga0307412_10136894 3300031911 Archaea 1788
562 Ga0307409_100013089 3300031995 Bacteria 5320
563 Ga0307409_100063321 3300031995 Archaea 2900
564 Ga0307409_100090313 3300031995 Archaea 2507
565 Ga0307409_101112193 3300031995 Archaea 811
566 Ga0307416_100005170 3300032002 Archaea 7975
567 Ga0307416_100122960 3300032002 Archaea 2318
568 Ga0307416_100410053 3300032002 Archaea 1395
569 Ga0307416_100540411 3300032002 Archaea 1237
570 Ga0307416_100784975 3300032002 Bacteria 1047
571 Ga0307416_103579140 3300032002 Archaea 520
572 Ga0307414_10158160 3300032004 Archaea 1796
573 Ga0307414_10205305 3300032004 Unclassified 1606
574 Ga0307414_10230526 3300032004 Archaea 1526
575 Ga0307411_10197032 3300032005 Unclassified 1543
576 Ga0307411_10758549 3300032005 Archaea 851
577 Ga0307411_11330335 3300032005 Archaea 655
578 Ga0307415_100004884 3300032126 Archaea 7041
579 Ga0307415_100012344 3300032126 Archaea 4937
580 Ga0307415_100026392 3300032126 Archaea 3663
581 Ga0373959_0167779 3300034820 Archaea 564
582 Ga0373934_0022319 3300035086 Archaea 2441
583 Ga0373940_0115344 3300035088 Archaea 828
584 Ga0373952_0012744 3300035092 Archaea 1658
585 Ga0373923_0015802 3300035111 Archaea 2856
586 Ga0373932_0003568 3300035112 Archaea 3728
587 Ga0373939_0305904 3300035114 Archaea 635
588 Ga0373941_0177030 3300035115 Archaea 798
589 Ga0373953_0023133 3300035117 Archaea 2350
590 Ga0373954_0011942 3300035118 Unclassified 3858
591 Ga0373956_0013409 3300035119 Archaea 3410
592 Ga0373960_0001460 3300035121 Archaea 5232
593 Ga0373943_0279993 3300035170 Archaea 943
594 Ga0373955_0004089 3300035172 Archaea 6443
595 Ga0373942_0112456 3300035207 Archaea 843
596 Ga0373961_0010497 3300035241 Bacteria 2283
597 Ga0373962_0003177 3300035242 Archaea 3940
598 Ga0373924_0004252 3300035410 Archaea 4987
599 Ga0373931_0025296 3300035691 Archaea 3015
600 Ga0373933_0000053 3300035724 Archaea 69882
601 Ga0373937_0000246 3300036401 Archaea 52898
602 Ga0373925_0308938 3300037068 Archaea 1278
603 Ga0242419_000002 3300038698 Archaea 13567
604 Ga0242422_01642 3300038699 Archaea 1542
605 Ga0242420_000005 3300038996 Archaea 30965
606 Ga0242420_007199 3300038996 Archaea 1780
607 Ga0242420_016624 3300038996 Unclassified 1283
608 Ga0436365_1387592 3300039437 Bacteria 1636
609 Ga0436362_1031797 3300039453 Bacteria 1970
610 Ga0439436_0184075 3300041404 Archaea 595
611 Ga0439439_0008260 3300041406 Unclassified 2454
612 Ga0439439_0040588 3300041406 Archaea 1205
613 Ga0439453_0008351 3300041408 Archaea 1662
614 Ga0439453_0180814 3300041408 Archaea 514
615 Ga0439461_0013113 3300041410 Archaea 1560
616 Ga0439461_0045164 3300041410 Archaea 963
617 Ga0439437_000120 3300042000 Archaea 6160
618 Ga0439441_000217 3300042001 Archaea 5413
619 Ga0439443_000144 3300042003 Archaea 4917
620 Ga0439443_027024 3300042003 Archaea 931
621 Ga0439432_020423 3300042006 Unclassified 2202
622 Ga0439450_000075 3300042008 Archaea 9505
623 Ga0439450_137903 3300042008 Archaea 635
624 Ga0439450_170882 3300042008 Archaea 575
625 Ga0439451_006195 3300042009 Archaea 2446
626 Ga0439452_006132 3300042010 Unclassified 3792
627 Ga0439454_000214 3300042011 Archaea 4127
628 Ga0439455_0003194 3300042012 Archaea 3099
629 Ga0439455_0014247 3300042012 Archaea 1813
630 Ga0439456_000667 3300042013 Archaea 7048
631 Ga0439456_015328 3300042013 Archaea 1600
632 Ga0439462_0014939 3300042015 Unclassified 1999
633 Ga0439463_000970 3300042016 Archaea 7824
634 Ga0450913_035343 3300042117 Archaea 506
635 Ga0450914_001449 3300042118 Archaea 1492
636 Ga0450920_049296 3300042122 Archaea 844
637 Ga0450923_022741 3300042125 Archaea 1231
638 Ga0450889_030902 3300042144 Unclassified 626
639 Ga0439446_0011886 3300042156 Unclassified 2371
640 Ga0439446_0367366 3300042156 Archaea 515
641 Ga0439458_0047732 3300042157 Archaea 1051
642 Ga0439434_0005576 3300042435 Archaea 3677
643 Ga0439434_0012884 3300042435 Archaea 2478
644 Ga0439435_0000944 3300042436 Archaea 5051
645 Ga0439435_0002747 3300042436 Archaea 3549
646 Ga0439444_0000528 3300042437 Archaea 4324
647 Ga0439459_0025997 3300042438 Archaea 1160
648 Ga0439464_0000900 3300042439 Archaea 6649
649 Ga0439464_0019049 3300042439 Unclassified 1872
650 Ga0439464_0064901 3300042439 Archaea 1073
651 Ga0439460_0000821 3300042461 Archaea 7054
652 Ga0439460_0075756 3300042461 Archaea 1049
653 Ga0450893_0001700 3300042532 Archaea 3384
654 Ga0451577_1263011 3300042876 Archaea 658
655 Ga0439440_0000324 3300042993 Archaea 7822
656 Ga0439440_0050062 3300042993 Archaea 1042
657 Ga0466964_0038357 3300044706 Bacteria 1926
658 Ga0453684_1107404 3300044712 Archaea 836
659 Ga0466960_0263429 3300044901 Archaea 961
660 Ga0451576_0062297 3300045051 Archaea 3888
661 Ga0466967_1216695 3300045976 Archaea 750
662 Ga0466967_2460662 3300045976 Archaea 516
663 Ga0495592_0033519 3300046454 Unclassified 3873
664 Ga0495651_0021696 3300046462 Archaea 4992
665 Ga0495653_0043023 3300046463 Unclassified 3514
666 Ga0495664_0395767 3300046477 Archaea 830
667 Ga0495628_0061803 3300046516 Unclassified 2937
668 Ga0495637_0209668 3300046520 Archaea 713
669 Ga0495652_0016331 3300046529 Archaea 6641
670 Ga0495640_0280442 3300046533 Archaea 1038
671 Ga0495587_0003315 3300046536 Archaea 10751
672 Ga0495645_0047597 3300046543 Archaea 3124
673 Ga0495667_0051837 3300046559 Archaea 2706
674 Ga0495635_0038634 3300046663 Unclassified 3304
675 Ga0495657_0015330 3300046675 Archaea 5612
676 Ga0495599_0029659 3300046678 Bacteria 3430
677 Ga0495623_0127492 3300046679 Archaea 1527
678 Ga0495646_0065808 3300046680 Archaea 2145
679 Ga0495658_0874831 3300046683 Unclassified 575
680 Ga0495624_0365390 3300046690 Archaea 868
681 Ga0495600_0027287 3300046809 Archaea 3690
682 Ga0495604_0013790 3300047317 Archaea 6444
683 Ga0495680_0438003 3300047322 Archaea 896
684 Ga0495602_0000051 3300048088 Archaea 113947
685 Ga0496100_0013592 3300048903 Archaea 4701
686 Ga0496100_0077419 3300048903 Archaea 2236
687 Ga0496100_0300149 3300048903 Archaea 1202
688 Ga0496100_1165405 3300048903 Unclassified 608
689 Ga0496101_0039464 3300048904 Archaea 3358
690 Ga0496102_0065845 3300048905 Archaea 3321
691 Ga0496103_0211135 3300048906 Archaea 1248
692 Ga0496103_0295947 3300048906 Archaea 1041
693 Ga0496104_0375652 3300048907 Archaea 1334
694 Ga0496104_1141131 3300048907 Unclassified 683
695 Ga0496104_1234276 3300048907 Bacteria 651
696 Ga0496105_1368539 3300048908 Unclassified 514
697 Ga0496106_0004924 3300048909 Archaea 9883
698 Ga0496106_0031160 3300048909 Archaea 3973
699 Ga0496106_0057306 3300048909 Archaea 2946
700 Ga0496106_0148849 3300048909 Unclassified 1846
701 Ga0496106_0672150 3300048909 Archaea 827
702 Ga0496106_1048488 3300048909 Unclassified 640
703 Ga0496106_1067822 3300048909 Archaea 633
704 Ga0496107_0004265 3300048910 Archaea 9672
705 Ga0496107_0080323 3300048910 Archaea 2378
706 Ga0496107_0672299 3300048910 Unclassified 763
707 Ga0496108_0094681 3300048911 Archaea 2542
708 Ga0496108_0471429 3300048911 Archaea 1097
709 Ga0496109_0128942 3300048912 Archaea 2360
710 Ga0496109_0544207 3300048912 Archaea 1095
711 Ga0496110_0441117 3300048913 Archaea 1187
712 Ga0496110_0483763 3300048913 Archaea 1128
713 Ga0496111_0018835 3300048914 Archaea 4785
714 Ga0496112_0064163 3300048915 Unclassified 3624
715 Ga0496112_0397271 3300048915 Archaea 1318
716 Ga0496112_1700665 3300048915 Archaea 543
717 Ga0496113_0558242 3300048916 Archaea 918
718 Ga0496114_0282422 3300048917 Archaea 1464
719 Ga0501291_000358 3300049514 Archaea 5587
720 Ga0501291_003418 3300049514 Archaea 1972
721 Ga0501292_000859 3300049515 Archaea 3684
722 Ga0501292_054992 3300049515 Bacteria 712
723 Ga0501293_013182 3300049516 Archaea 740
724 Ga0501294_011694 3300049517 Archaea 876
725 Ga0501295_000714 3300049518 Archaea 3119
726 Ga0501295_019999 3300049518 Archaea 1208
727 Ga0501295_055461 3300049518 Archaea 857
728 Ga0501299_183009 3300049522 Archaea 548
729 Ga0501300_002537 3300049523 Archaea 2732
730 Ga0501317_000161 3300049533 Bacteria 3850
731 Ga0501321_007099 3300049537 Unclassified 1156
732 Ga0501031_0011743 3300049568 Archaea 5713
733 Ga0501031_0014021 3300049568 Archaea 5218
734 Ga0501031_0037706 3300049568 Archaea 3155
735 Ga0501031_0130910 3300049568 Archaea 1639
736 Ga0501031_0335816 3300049568 Bacteria 978
737 Ga0501031_0616745 3300049568 Archaea 698
738 Ga0501032_0476541 3300049569 Archaea 798
739 Ga0501033_0181233 3300049570 Archaea 1510
740 Ga0501033_0251568 3300049570 Archaea 1252
741 Ga0501036_0044357 3300049572 Archaea 3766
742 Ga0501036_0056660 3300049572 Archaea 3321
743 Ga0501036_0071025 3300049572 Archaea 2944
744 Ga0501036_0091659 3300049572 Archaea 2567
745 Ga0501036_0202381 3300049572 Archaea 1670
746 Ga0501036_0237498 3300049572 Bacteria 1529
747 Ga0501036_0315991 3300049572 Archaea 1305
748 Ga0501036_0767185 3300049572 Archaea 795
749 Ga0501037_0060375 3300049573 Archaea 2765
750 Ga0501037_0109319 3300049573 Archaea 1992
751 Ga0501037_0330592 3300049573 Archaea 1054
752 Ga0501037_1031875 3300049573 Unclassified 535
753 Ga0501038_0047256 3300049574 Archaea 3729
754 Ga0501038_0048625 3300049574 Archaea 3669
755 Ga0501038_0121592 3300049574 Archaea 2152
756 Ga0501038_0185624 3300049574 Archaea 1676
757 Ga0501038_0239878 3300049574 Archaea 1440
758 Ga0501038_0264237 3300049574 Archaea 1359
759 Ga0501038_0408611 3300049574 Bacteria 1049
760 Ga0501038_0627826 3300049574 Archaea 811
761 Ga0501039_0061679 3300049575 Bacteria 2904
762 Ga0501039_0066786 3300049575 Archaea 2792
763 Ga0501039_0088941 3300049575 Archaea 2406
764 Ga0501039_0101863 3300049575 Archaea 2241
765 Ga0501039_0112734 3300049575 Archaea 2126
766 Ga0501039_0115056 3300049575 Archaea 2105
767 Ga0501039_0160786 3300049575 Archaea 1765
768 Ga0501040_0000779 3300049576 Archaea 19830
769 Ga0501040_0008214 3300049576 Bacteria 6788
770 Ga0501040_0187649 3300049576 Archaea 1467
771 Ga0501040_1056859 3300049576 Unclassified 589
772 Ga0501041_0001310 3300049577 Archaea 13692
773 Ga0501041_0016211 3300049577 Archaea 4428
774 Ga0501041_0018497 3300049577 Bacteria 4151
775 Ga0501041_0113152 3300049577 Unclassified 1684
776 Ga0501041_0743096 3300049577 Archaea 628
777 Ga0501041_0835178 3300049577 Archaea 591
778 Ga0501042_0004963 3300049578 Archaea 8519
779 Ga0501042_0012271 3300049578 Archaea 5799
780 Ga0501042_0078006 3300049578 Archaea 2372
781 Ga0501042_0121154 3300049578 Bacteria 1883
782 Ga0501042_0159658 3300049578 Archaea 1626
783 Ga0501042_0275473 3300049578 Bacteria 1215
784 Ga0501042_0325622 3300049578 Archaea 1110
785 Ga0501042_0326692 3300049578 Archaea 1108
786 Ga0501043_0035758 3300049579 Archaea 3908
787 Ga0501043_0045853 3300049579 Archaea 3437
788 Ga0501043_0096645 3300049579 Archaea 2322
789 Ga0501043_0167577 3300049579 Bacteria 1715
790 Ga0501043_0358436 3300049579 Unclassified 1107
791 Ga0501043_0384969 3300049579 Archaea 1061
792 Ga0501046_0039530 3300049580 Archaea 3777
793 Ga0501046_0039971 3300049580 Bacteria 3752
794 Ga0501046_0044251 3300049580 Archaea 3541
795 Ga0501046_0110983 3300049580 Archaea 2095
796 Ga0501046_0221442 3300049580 Archaea 1400
797 Ga0501046_0239618 3300049580 Unclassified 1338
798 Ga0501046_0696674 3300049580 Unclassified 716
799 Ga0501046_1024059 3300049580 Archaea 572
800 Ga0501048_0003334 3300049582 Archaea 12219
801 Ga0501048_0040897 3300049582 Archaea 3321
802 Ga0501048_0068967 3300049582 Unclassified 2497
803 Ga0501048_0090885 3300049582 Archaea 2153
804 Ga0501048_0251597 3300049582 Archaea 1254
805 Ga0501048_0632316 3300049582 Unclassified 768
806 Ga0501067_0098277 3300049583 Archaea 1626
807 Ga0501067_0508243 3300049583 Archaea 674
808 Ga0501067_0559346 3300049583 Unclassified 641
809 Ga0501068_0413462 3300049584 Archaea 870
810 Ga0501068_0533485 3300049584 Archaea 762
811 Ga0501069_0191743 3300049585 Archaea 1183
812 Ga0501071_0005626 3300049587 Archaea 8077
813 Ga0501071_0023406 3300049587 Archaea 4313
814 Ga0501071_0065500 3300049587 Archaea 2638
815 Ga0501071_0159410 3300049587 Unclassified 1686
816 Ga0501071_0319792 3300049587 Archaea 1178
817 Ga0501072_0002468 3300049588 Archaea 13848
818 Ga0501072_0002604 3300049588 Archaea 13515
819 Ga0501072_0021867 3300049588 Archaea 4961
820 Ga0501072_0026420 3300049588 Archaea 4526
821 Ga0501072_0195995 3300049588 Bacteria 1611
822 Ga0501073_0200721 3300049589 Archaea 1379
823 Ga0501073_0224490 3300049589 Archaea 1298
824 Ga0501074_0047313 3300049590 Archaea 3110
825 Ga0501074_0196640 3300049590 Archaea 1437
826 Ga0501074_0252756 3300049590 Archaea 1253
827 Ga0501074_0478050 3300049590 Unclassified 883
828 Ga0501074_0513415 3300049590 Unclassified 849
829 Ga0501075_0002026 3300049591 Archaea 13402
830 Ga0501075_0003169 3300049591 Archaea 11011
831 Ga0501075_0008648 3300049591 Bacteria 7099
832 Ga0501075_0010272 3300049591 Unclassified 6577
833 Ga0501075_0080815 3300049591 Archaea 2460
834 Ga0501075_0104445 3300049591 Archaea 2153
835 Ga0501075_0328364 3300049591 Archaea 1166
836 Ga0501075_0738510 3300049591 Unclassified 749
837 Ga0501075_0797420 3300049591 Archaea 719
838 Ga0501076_0000557 3300049592 Archaea 23736
839 Ga0501076_0008730 3300049592 Bacteria 7444
840 Ga0501076_0034054 3300049592 Archaea 3979
841 Ga0501076_0065526 3300049592 Archaea 2897
842 Ga0501076_0075822 3300049592 Bacteria 2696
843 Ga0501076_0087737 3300049592 Archaea 2500
844 Ga0501076_0099845 3300049592 Archaea 2338
845 Ga0501076_0362707 3300049592 Archaea 1190
846 Ga0501076_0419566 3300049592 Archaea 1101
847 Ga0501076_0475233 3300049592 Archaea 1030
848 Ga0501077_0058369 3300049593 Archaea 2450
849 Ga0501077_0281935 3300049593 Archaea 1058
850 Ga0501077_0665488 3300049593 Archaea 669
851 Ga0501198_000782 3300049649 Archaea 3956
852 Ga0501201_003136 3300049651 Archaea 1518
853 Ga0501202_038092 3300049652 Archaea 1029
854 Ga0501202_061677 3300049652 Archaea 849
855 Ga0501202_074433 3300049652 Archaea 788
856 Ga0501206_001964 3300049653 Archaea 2593
857 Ga0501207_003532 3300049654 Unclassified 2088
858 Ga0501208_016733 3300049655 Archaea 1145
859 Ga0501208_065468 3300049655 Archaea 721
860 Ga0501209_000285 3300049656 Archaea 6099
861 Ga0501209_047998 3300049656 Archaea 1155
862 Ga0501209_065221 3300049656 Archaea 1025
863 Ga0501211_022429 3300049658 Archaea 670
864 Ga0501214_000186 3300049659 Archaea 3716
865 Ga0501214_030212 3300049659 Archaea 740
866 Ga0501217_008182 3300049661 Archaea 2254
867 Ga0501217_009769 3300049661 Archaea 2092
868 Ga0501217_009973 3300049661 Archaea 2073
869 Ga0501217_034500 3300049661 Bacteria 1262
870 Ga0501222_009113 3300049662 Archaea 1314
871 Ga0501223_001538 3300049663 Archaea 5323
872 Ga0501224_001102 3300049664 Archaea 3517
873 Ga0501227_006804 3300049665 Archaea 2453
874 Ga0501228_007830 3300049666 Archaea 1008
875 Ga0501230_058540 3300049667 Bacteria 777
876 Ga0501233_003069 3300049668 Archaea 2986
877 Ga0501242_035029 3300049674 Archaea 692
878 Ga0501243_000996 3300049675 Archaea 3985
879 Ga0501246_001118 3300049676 Archaea 2025
880 Ga0501247_058681 3300049677 Archaea 587
881 Ga0501248_001962 3300049678 Unclassified 1362
882 Ga0501249_047846 3300049679 Archaea 978
883 Ga0501249_061236 3300049679 Bacteria 872
884 Ga0501250_015703 3300049680 Archaea 933
885 Ga0501250_021801 3300049680 Archaea 834
886 Ga0501251_004906 3300049681 Archaea 1398
887 Ga0501251_018000 3300049681 Archaea 913
888 Ga0501251_018769 3300049681 Archaea 901
889 Ga0501253_001008 3300049683 Archaea 2711
890 Ga0501255_009037 3300049684 Archaea 1096
891 Ga0501256_000569 3300049685 Archaea 2411
892 Ga0501256_001701 3300049685 Unclassified 1664
893 Ga0501256_032694 3300049685 Archaea 592
894 Ga0501259_055831 3300049688 Archaea 813
895 Ga0501261_000643 3300049690 Archaea 4393
896 Ga0501261_004446 3300049690 Archaea 1734
897 Ga0501219_003932 3300049703 Archaea 1062
898 Ga0501221_001643 3300049704 Unclassified 3716
899 Ga0501221_095400 3300049704 Archaea 732
900 Ga0501225_0003040 3300049705 Archaea 5125
901 Ga0501225_0165565 3300049705 Bacteria 682
902 Ga0501234_001428 3300049707 Archaea 3755
903 Ga0501234_026465 3300049707 Archaea 932
904 Ga0501234_039609 3300049707 Archaea 770
905 Ga0501245_002425 3300049708 Archaea 2491
906 Ga0501245_053313 3300049708 Unclassified 722
907 Ga0501079_0029572 3300049741 Archaea 4207
908 Ga0501079_0054777 3300049741 Archaea 3076
909 Ga0501079_0083372 3300049741 Archaea 2473
910 Ga0501079_0370944 3300049741 Archaea 1122
911 Ga0501079_1467452 3300049741 Archaea 537
912 Ga0501080_0241399 3300049742 Archaea 1649
913 Ga0501080_0314958 3300049742 Bacteria 1418
914 Ga0501080_0320206 3300049742 Archaea 1404
915 Ga0501080_0728686 3300049742 Archaea 873
916 Ga0501080_0867820 3300049742 Archaea 788
917 Ga0501081_0002944 3300049743 Archaea 10803
918 Ga0501081_0009067 3300049743 Archaea 6469
919 Ga0501081_0058568 3300049743 Archaea 2666
920 Ga0501081_0087162 3300049743 Archaea 2192
921 Ga0501081_0099884 3300049743 Archaea 2050
922 Ga0501081_0247453 3300049743 Archaea 1301
923 Ga0501081_0447152 3300049743 Archaea 960
924 Ga0501081_0514118 3300049743 Archaea 893
925 Ga0501081_0615241 3300049743 Unclassified 813
926 Ga0501083_0251739 3300049744 Archaea 1150
927 Ga0501083_0303260 3300049744 Archaea 1039
928 Ga0501083_0559966 3300049744 Archaea 744
929 Ga0501241_017933 3300049758 Archaea 1295
930 Ga0501263_057685 3300049760 Archaea 603
931 Ga0501265_048345 3300049762 Bacteria 662
932 Ga0501266_000510 3300049763 Archaea 5149
933 Ga0501266_025910 3300049763 Archaea 819
934 Ga0501268_030101 3300049765 Bacteria 979
935 Ga0501270_002888 3300049767 Archaea 1803
936 Ga0501274_002214 3300049771 Archaea 1518
937 Ga0501275_000841 3300049772 Archaea 3314
938 Ga0501276_000236 3300049773 Archaea 3141
939 Ga0501279_001699 3300049775 Archaea 2899
940 Ga0501283_001962 3300049779 Archaea 2659
941 Ga0501283_012261 3300049779 Archaea 1287
942 Ga0501035_0042919 3300049822 Archaea 4077
943 Ga0501035_0091410 3300049822 Archaea 2679
944 Ga0501035_0246804 3300049822 Archaea 1517
945 Ga0501044_0236575 3300049823 Archaea 1772
946 Ga0501044_1362449 3300049823 Unclassified 575
947 Ga0501045_0009810 3300049824 Archaea 6699
948 Ga0501045_0028235 3300049824 Bacteria 4047
949 Ga0501045_0157712 3300049824 Archaea 1688
950 Ga0501045_0320942 3300049824 Archaea 1152
951 Ga0501045_0860853 3300049824 Archaea 666
952 Ga0501045_0942952 3300049824 Unclassified 633
953 Ga0501045_1093386 3300049824 Unclassified 583
954 Ga0501204_007201 3300049850 Archaea 1248
955 Ga0501204_022850 3300049850 Archaea 827
956 Ga0501212_000255 3300049851 Archaea 4801
957 Ga0501212_025484 3300049851 Archaea 934
958 Ga0501212_033828 3300049851 Archaea 831
959 Ga0501226_003536 3300049853 Archaea 1843
960 nmdc:mga0yw44_775403_c1 3300050492 Archaea 651
961 nmdc:mga05p37_1454683_c1 3300050507 Unclassified 686
962 nmdc:mga05p37_16925_c1 3300050507 Archaea 8791
963 nmdc:mga05p37_265970_c1 3300050507 Archaea 2051
964 nmdc:mga05p37_287973_c1 3300050507 Archaea 1956
965 nmdc:mga05p37_33337_c1 3300050507 Archaea 6308
966 nmdc:mga05p37_388142_c1 3300050507 Archaea 1634
967 nmdc:mga05p37_40747_c1 3300050507 Archaea 5704
968 nmdc:mga05p37_741489_c1 3300050507 Archaea 1084
969 nmdc:mga05p37_8254_c1 3300050507 Archaea 12314
970 nmdc:mga05p37_866605_c1 3300050507 Archaea 979
971 nmdc:mga09592_174050_c1 3300050508 Archaea 1862
972 nmdc:mga09592_19582_c1 3300050508 Archaea 5556
973 nmdc:mga09592_264395_c1 3300050508 Archaea 1492
974 nmdc:mga09592_289345_c1 3300050508 Archaea 1421
975 nmdc:mga09592_339_c1 3300050508 Archaea 22976
976 nmdc:mga09592_595322_c1 3300050508 Archaea 948
977 nmdc:mga0qj67_10826_c1 3300050509 Archaea 6823
978 nmdc:mga0qj67_1176107_c1 3300050509 Archaea 597
979 nmdc:mga0qj67_15446_c1 3300050509 Archaea 5781
980 nmdc:mga0qj67_262193_c1 3300050509 Archaea 1402
981 nmdc:mga0qj67_368924_c1 3300050509 Archaea 1160
982 nmdc:mga0qj67_410_c1 3300050509 Archaea 29558
983 nmdc:mga0qj67_502154_c1 3300050509 Archaea 975
984 nmdc:mga0qj67_51839_c1 3300050509 Bacteria 3246
985 nmdc:mga06r32_164754_c1 3300050510 Archaea 2200
986 nmdc:mga06r32_24070_c1 3300050510 Archaea 5646
987 nmdc:mga06r32_434994_c1 3300050510 Archaea 1293
988 nmdc:mga06r32_587374_c1 3300050510 Archaea 1086
989 nmdc:mga06r32_589802_c1 3300050510 Archaea 1083
990 nmdc:mga06r32_736990_c1 3300050510 Archaea 949
991 nmdc:mga06r32_97280_c1 3300050510 Bacteria 2884
992 nmdc:mga08y16_36440_c1 3300050511 Archaea 5167
993 nmdc:mga08y16_40899_c1 3300050511 Archaea 4857
994 nmdc:mga08y16_44296_c1 3300050511 Archaea 4662
995 nmdc:mga08y16_56390_c1 3300050511 Archaea 4107
996 nmdc:mga08y16_70385_c1 3300050511 Archaea 3647
997 nmdc:mga08y16_750554_c1 3300050511 Unclassified 972
998 nmdc:mga08y16_78470_c1 3300050511 Bacteria 3442
999 nmdc:mga0n895_17568_c1 3300050512 Archaea 6597
1000 nmdc:mga0n895_22_c1 3300050512 Archaea 92594
1001 nmdc:mga0n895_3989_c1 3300050512 Archaea 11999
1002 nmdc:mga0n895_47882_c1 3300050512 Archaea 4182
1003 nmdc:mga0rr50_1180197_c1 3300050513 Unclassified 650
1004 nmdc:mga0rr50_15074_c1 3300050513 Archaea 5094
1005 nmdc:mga0rr50_283285_c1 3300050513 Archaea 1383
1006 nmdc:mga0rr50_3785_c1 3300050513 Archaea 8779
1007 nmdc:mga08x19_10654_c1 3300050514 Archaea 5529
1008 nmdc:mga08x19_230886_c1 3300050514 Archaea 1273
1009 nmdc:mga08x19_256054_c1 3300050514 Archaea 1209
1010 nmdc:mga08x19_43883_c1 3300050514 Archaea 2853
1011 nmdc:mga08x19_661416_c1 3300050514 Archaea 741
1012 nmdc:mga0a205_29295_c1 3300050515 Archaea 5268
1013 nmdc:mga0a205_400341_c1 3300050515 Archaea 1237
1014 nmdc:mga0a205_9110_c1 3300050515 Archaea 9058
1015 nmdc:mga0a205_997934_c1 3300050515 Archaea 684
1016 Ga0495612_0021168 3300053078 Archaea 2609
1017 Ga0495619_0000072 3300053085 Archaea 79440
1018 Ga0501084_0005873 3300054114 Archaea 10103
1019 Ga0501084_0011196 3300054114 Archaea 7430
1020 Ga0501084_0046206 3300054114 Archaea 3647
1021 Ga0501084_0089854 3300054114 Archaea 2578
1022 Ga0501084_0095518 3300054114 Archaea 2496
1023 Ga0501084_0321374 3300054114 Archaea 1307
1024 Ga0501084_0488040 3300054114 Archaea 1041
1025 Ga0590074_007521 3300059423 Archaea 1810
1026 Ga0590075_001683 3300059424 Archaea 5440
1027 Ga0590075_002030 3300059424 Archaea 4880
1028 Ga0590075_190918 3300059424 Unclassified 542
1029 Ga0590077_005693 3300059426 Archaea 2548
1030 Ga0590077_016543 3300059426 Unclassified 1549
1031 Ga0590077_036708 3300059426 Unclassified 1081
1032 Ga0590077_038297 3300059426 Archaea 1061
1033 Ga0587084_000340 3300059477 Archaea 3460
1034 Ga0587093_000063 3300059478 Archaea 4730
1035 Ga0587093_014371 3300059478 Archaea 987
1036 Ga0587066_000085 3300059490 Archaea 5074
1037 Ga0587066_000205 3300059490 Archaea 4051
1038 Ga0587066_000247 3300059490 Archaea 3836
1039 Ga0587066_000438 3300059490 Archaea 3337
1040 Ga0587066_109783 3300059490 Archaea 638
1041 Ga0587070_000246 3300059491 Archaea 3891
1042 Ga0587070_002652 3300059491 Unclassified 2058
1043 Ga0587073_0000233 3300059492 Archaea 4400
1044 Ga0587073_0000281 3300059492 Archaea 4121
1045 Ga0587073_0000572 3300059492 Archaea 3525
1046 Ga0587073_0003613 3300059492 Unclassified 2139
1047 Ga0587073_0333134 3300059492 Unclassified 504
1048 Ga0587077_000152 3300059493 Archaea 4517
1049 Ga0587077_000189 3300059493 Archaea 4312
1050 Ga0587077_003235 3300059493 Unclassified 2028
1051 Ga0587080_000477 3300059503 Archaea 3420
1052 Ga0587080_003219 3300059503 Bacteria 2011
1053 Ga0587080_014206 3300059503 Archaea 1229
1054 Ga0587080_015763 3300059503 Unclassified 1184
1055 Ga0587082_122701 3300059504 Unclassified 589
1056 Ga0587083_0000123 3300059505 Archaea 4918
1057 Ga0587083_0000187 3300059505 Unclassified 4455
1058 Ga0587083_0001206 3300059505 Unclassified 2813
1059 Ga0587086_000296 3300059507 Unclassified 3300
1060 Ga0587088_000421 3300059508 Archaea 3406
1061 Ga0587088_014814 3300059508 Archaea 1219
1062 Ga0587089_070651 3300059509 Unclassified 592
1063 Ga0587090_001140 3300059510 Unclassified 2595
1064 Ga0587090_004020 3300059510 Archaea 1755
1065 Ga0587091_000384 3300059511 Archaea 3665
1066 Ga0587091_033561 3300059511 Archaea 977
1067 Ga0587092_000391 3300059512 Archaea 3374
1068 Ga0587092_007795 3300059512 Unclassified 1399
1069 Ga0587092_012541 3300059512 Archaea 1197
1070 Ga0587094_000326 3300059513 Archaea 3417
1071 Ga0587094_001377 3300059513 Archaea 2278
1072 Ga0587097_03003 3300059603 Archaea 704
1073 Ga0587131_000595 3300059609 Archaea 1520
1074 Ga0587131_000808 3300059609 Unclassified 1389
1075 Ga0587101_001679 3300059623 Archaea 1964
1076 Ga0587109_000858 3300059624 Unclassified 3240
1077 Ga0587109_027649 3300059624 Archaea 1057
1078 Ga0587109_050592 3300059624 Archaea 850
1079 Ga0587115_000413 3300059626 Archaea 3081
1080 Ga0587117_000703 3300059627 Unclassified 2453
1081 Ga0587117_006270 3300059627 Archaea 1321
1082 Ga0587122_000045 3300059628 Archaea 4122
1083 Ga0587062_001016 3300059639 Unclassified 2251
1084 Ga0587067_000409 3300059640 Archaea 3690
1085 Ga0587067_000484 3300059640 Archaea 3505
1086 Ga0587067_009387 3300059640 Archaea 1457
1087 Ga0587068_015855 3300059641 Archaea 1190
1088 Ga0587068_026813 3300059641 Archaea 977
1089 Ga0587069_000306 3300059642 Archaea 3464
1090 Ga0587069_000387 3300059642 Bacteria 3220
1091 Ga0587069_000765 3300059642 Archaea 2645
1092 Ga0587075_002808 3300059644 Archaea 1884
1093 Ga0587075_025262 3300059644 Archaea 912
1094 Ga0587075_058586 3300059644 Archaea 689
1095 Ga0587076_000392 3300059645 Archaea 3460
1096 Ga0587076_000505 3300059645 Archaea 3229
1097 Ga0587076_003518 3300059645 Archaea 1874
1098 Ga0587079_046855 3300059647 Archaea 894
1099 Ga0587102_012738 3300059649 Archaea 862
1100 Ga0587105_002195 3300059651 Archaea 1095
1101 Ga0587107_000242 3300059652 Archaea 3221
1102 Ga0587114_000078 3300059655 Archaea 4279
1103 Ga0587114_000220 3300059655 Archaea 3315
1104 Ga0587116_03042 3300059656 Unclassified 918
1105 Ga0587120_000128 3300059659 Archaea 2905
1106 Ga0587060_000083 3300060243 Archaea 3524
1107 Ga0587060_003183 3300060243 Archaea 1197
1108 Ga0587071_000937 3300060344 Archaea 3369
1109 Ga0587071_001069 3300060344 Archaea 3247
1110 Ga0501082_0001241 3300060353 Archaea 22435
1111 Ga0501082_0004935 3300060353 Archaea 11642
1112 Ga0501082_0059577 3300060353 Unclassified 3290
1113 Ga0501082_0106770 3300060353 Archaea 2422
1114 Ga0501082_0175700 3300060353 Archaea 1862
1115 Ga0501082_0300872 3300060353 Archaea 1397
1116 Ga0501082_0449532 3300060353 Archaea 1126
1117 Ga0530510_0000346 3300061734 Archaea 29908
1118 Ga0530510_0006123 3300061734 Archaea 8353
1119 Ga0530510_0022961 3300061734 Archaea 4445
1120 Ga0530510_0302943 3300061734 Archaea 1196
1121 Ga0075434_100586962
1122 MBSR1b_contig_5535578
1123 2214811879
1124 ARSoilYngRDRAFT_c00519
1125 ARcpr5yngRDRAFT_c000860
1126 ARcpr5yngRDRAFT_c006578
1127 ARSoilOldRDRAFT_c000523
1128 ARSoilOldRDRAFT_c001156
1129 ARCol0oldRDRAFT_c00236
1130 bgg_mtDRAFT_1068989
1131 JGI24737J22298_10271644
1132 JGI24738J21930_10130390
1133 JGI24035J26624_1003749
1134 JGI24033J26618_1036723
1135 Ga0006778J45830_1015045
1136 Ga0006759J45824_1011425
1137 JGI25407J50210_10184790
1138 JGI26144J50225_100040
1139 JGI26139J50223_100053
1140 JGI26140J50224_100238
1141 JGI26135J50243_100060
1142 JGI26134J50242_100096
1143 JGI26137J50245_100071
1144 JGI26130J50248_100483
1145 JGI26131J50246_100169
1146 JGI26132J50249_101159
1147 JGI26143J51219_1000221
1148 JGI26141J51220_1000112
1149 JGI26138J51218_100319
1150 Ga0007417J51691_1011505
1151 Ga0007409J51694_1012353
1152 Ga0007429J51699_1010930
1153 Ga0032354_1004678
1154 Ga0006780_1001397
1155 Ga0058863_10756987
1156 Ga0058860_12240927
1157 Ga0058862_10259667
1158 Ga0065717_1003373
1159 Ga0065716_1005796
1160 Ga0065704_10004619
1161 Ga0065704_10013720
1162 Ga0065704_10318422
1163 Ga0065704_10706204
1164 Ga0065715_10097924
1165 Ga0065715_10663227
1166 Ga0065707_10000745
1167 Ga0065707_10007165
1168 Ga0065707_10007407
1169 Ga0070676_10006386
1170 Ga0070676_10025266
1171 Ga0070676_10527756
1172 Ga0070683_100399387
1173 Ga0070670_100019087
1174 Ga0070670_100027712
1175 Ga0070670_100096631
1176 Ga0068869_100001442
1177 Ga0068869_100018896
1178 Ga0068869_100039381
1179 Ga0068869_101523315
1180 Ga0070666_10089258
1181 Ga0070680_100011429
1182 Ga0070680_100013892
1183 Ga0070680_100147306
1184 Ga0070682_100170577
1185 Ga0070682_100973234
1186 Ga0068868_100084028
1187 Ga0068868_100097671
1188 Ga0068868_100234722
1189 Ga0070660_100417359
1190 Ga0070689_100207232
1191 Ga0070691_10106282
1192 Ga0070691_10542714
1193 Ga0070687_100002432
1194 Ga0070687_100234890
1195 Ga0070692_10006278
1196 Ga0070692_10080391
1197 Ga0070692_10093241
1198 Ga0070692_10214171
1199 Ga0070692_10268166
1200 Ga0070668_100104806
1201 Ga0070668_100199952
1202 Ga0070669_100084053
1203 Ga0070669_100138125
1204 Ga0070669_100874974
1205 Ga0070675_100343844
1206 Ga0070674_100082858
1207 Ga0070673_100002477
1208 Ga0070673_100016323
1209 Ga0070688_101377970
1210 Ga0070659_100399052
1211 Ga0070667_100048778
1212 Ga0070667_100513499
1213 Ga0070703_10217477
1214 Ga0070709_10003691
1215 Ga0070709_10045315
1216 Ga0070709_10634585
1217 Ga0070709_10797002
1218 Ga0070714_100056160
1219 Ga0070713_100056122
1220 Ga0070713_100519895
1221 Ga0070710_10049405
1222 Ga0070710_10060194
1223 Ga0070710_10742774
1224 Ga0070701_10006099
1225 Ga0070701_10122776
1226 Ga0070711_100000411
1227 Ga0070711_100002140
1228 Ga0070711_100006357
1229 Ga0070705_100005988
1230 Ga0070705_100219809
1231 Ga0070705_100753402
1232 Ga0070700_100010790
1233 Ga0070700_100167845
1234 Ga0070700_100592822
1235 Ga0070700_100598411
1236 Ga0070694_100000033
1237 Ga0070694_100075607
1238 Ga0070694_100085738
1239 Ga0070694_100136730
1240 Ga0070694_100415555
1241 Ga0070694_100664549
1242 Ga0070694_100827883
1243 Ga0070708_100003268
1244 Ga0070708_100095525
1245 Ga0070708_100831744
1246 Ga0070663_100434906
1247 Ga0070678_100257871
1248 Ga0070678_101902606
1249 Ga0070662_100129380
1250 Ga0070662_100292884
1251 Ga0070662_100457608
1252 Ga0070681_10022369
1253 Ga0070681_10170643
1254 Ga0070681_10204028
1255 Ga0068867_100001704
1256 Ga0068867_100016228
1257 Ga0068867_100026652
1258 Ga0068867_100094671
1259 Ga0068867_100966806
1260 Ga0070685_10391795
1261 Ga0070707_100007390
1262 Ga0070707_100228498
1263 Ga0070698_100003121
1264 Ga0070698_100246590
1265 Ga0070698_100466520
1266 Ga0070698_100581404
1267 Ga0070699_100198982
1268 Ga0070699_100256301
1269 Ga0070699_100355891
1270 Ga0070679_100107107
1271 Ga0070679_100195971
1272 Ga0070679_101791421
1273 Ga0070684_101416591
1274 Ga0070697_100007966
1275 Ga0070697_100031836
1276 Ga0070697_100095502
1277 Ga0070697_100379432
1278 Ga0070697_100460429
1279 Ga0070697_100595894
1280 Ga0070697_101128228
1281 Ga0068853_100490742
1282 Ga0070672_100017917
1283 Ga0070672_100021998
1284 Ga0070672_100034531
1285 Ga0070672_100900313
1286 Ga0070686_100280679
1287 Ga0070695_100027107
1288 Ga0070695_100170344
1289 Ga0070695_100217644
1290 Ga0070695_100250666
1291 Ga0070695_100418019
1292 Ga0070696_100030604
1293 Ga0070696_100063556
1294 Ga0070696_100186624
1295 Ga0070696_100303499
1296 Ga0070696_100505190
1297 Ga0070693_100010302
1298 Ga0070693_100309294
1299 Ga0070704_100029326
1300 Ga0070704_100489713
1301 Ga0070704_100511167
1302 Ga0070704_100723999
1303 Ga0070704_100737829
1304 Ga0070664_100030063
1305 Ga0070664_100057651
1306 Ga0070664_101063591
1307 Ga0068857_100114318
1308 Ga0068857_100357338
1309 Ga0068854_100104075
1310 Ga0068854_101014934
1311 Ga0068856_100057881
1312 Ga0068856_100994382
1313 Ga0070702_100054071
1314 Ga0070702_100065274
1315 Ga0070702_101091611
1316 Ga0068852_100031659
1317 Ga0068852_102697554
1318 Ga0068859_100084367
1319 Ga0068859_100405529
1320 Ga0068864_100010644
1321 Ga0068864_100106457
1322 Ga0068864_100142039
1323 Ga0068864_100599048
1324 Ga0068866_10126191
1325 Ga0068866_10861256
1326 Ga0068861_100127772
1327 Ga0068870_10004855
1328 Ga0068870_10005359
1329 Ga0068870_10009396
1330 Ga0068870_10182348
1331 Ga0068858_102420629
1332 Ga0068860_100046197
1333 Ga0068860_100094019
1334 Ga0068860_100135710
1335 Ga0068862_100476332
1336 Ga0081455_10003949
1337 Ga0081455_10040472
1338 Ga0081455_10162838
1339 Ga0081455_10192647
1340 Ga0081538_10001440
1341 Ga0081538_10003513
1342 Ga0081538_10025987
1343 Ga0081538_10162488
1344 Ga0075432_10010959
1345 Ga0070715_10000811
1346 Ga0070715_10008487
1347 Ga0070716_100002205
1348 Ga0070716_100006062
1349 Ga0070716_100587681
1350 Ga0070712_100001754
1351 Ga0070712_100011221
1352 Ga0075427_10015845
1353 Ga0097621_100250040
1354 Ga0097621_100519738
1355 Ga0068871_100018374
1356 Ga0068871_100176213
1357 Ga0075428_100005660
1358 Ga0075428_100063579
1359 Ga0075428_100110652
1360 Ga0075428_100498309
1361 Ga0075428_100642004
1362 Ga0075428_100907415
1363 Ga0075428_101274921
1364 Ga0075430_100000829
1365 Ga0075430_100003097
1366 Ga0075430_100028357
1367 Ga0075430_100106981
1368 Ga0075430_100132826
1369 Ga0075430_101790285
1370 Ga0075431_100005784
1371 Ga0075431_100020347
1372 Ga0075431_100086520
1373 Ga0075431_100253471
1374 Ga0075431_100333145
1375 Ga0075431_100359040
1376 Ga0075431_100435714
1377 Ga0075431_100466174
1378 Ga0075431_100557826
1379 Ga0075431_101237172
1380 Ga0075433_10037500
1381 Ga0075433_10040991
1382 Ga0075433_10052862
1383 Ga0075433_10875867
1384 Ga0075433_11609657
1385 Ga0075434_100050861
1386 Ga0075434_100240044
1387 Ga0075434_100367546
1388 Ga0075429_100003166
1389 Ga0075429_100031140
1390 Ga0075429_100040590
1391 Ga0075429_100041439
1392 Ga0075429_100129533
1393 Ga0075429_100544229
1394 Ga0075429_101550432
1395 Ga0068865_100013097
1396 Ga0068865_100181870
1397 Ga0075436_100011724
1398 Ga0075436_100052416
1399 Ga0075436_100277220
1400 Ga0075436_100362120
1401 Ga0075436_100853605
1402 Ga0097620_100084367
1403 Ga0097620_100405569
1404 Ga0075435_100001606
1405 Ga0075435_100036475
1406 Ga0075435_100622079
1407 Ga0075435_100939971
1408 Ga0105244_10100419
1409 Ga0105240_10836304
1410 Ga0111539_10001925
1411 Ga0111539_10056270
1412 Ga0111539_10070728
1413 Ga0111539_10127155
1414 Ga0111539_10133420
1415 Ga0111539_10231163
1416 Ga0111539_11102534
1417 Ga0105245_10053432
1418 Ga0105245_10743225
1419 Ga0105245_10777766
1420 Ga0114129_10001905
1421 Ga0114129_10036208
1422 Ga0114129_10041563
1423 Ga0114129_10084207
1424 Ga0114129_10118726
1425 Ga0114129_10248925
1426 Ga0114129_10278315
1427 Ga0114129_10289709
1428 Ga0114129_11152941
1429 Ga0114129_11244686
1430 Ga0114129_12219521
1431 Ga0114129_12309219
1432 Ga0114129_12977656
1433 Ga0105243_11400764
1434 Ga0105241_10241966
1435 Ga0105242_10117629
1436 Ga0105242_10477990
1437 Ga0105237_10040916
1438 Ga0105237_10568964
1439 Ga0105249_10000864
1440 Ga0105249_10076311
1441 Ga0105249_11438740
1442 Ga0105239_10207186
1443 Ga0105239_10658593
1444 Ga0105239_12298888
1445 Ga0105246_10023757
1446 Ga0105246_10135833
1447 Ga0105246_10174773
1448 Ga0105246_10191449
1449 Ga0157340_1000038
1450 Ga0157344_1000144
1451 Ga0157336_1000178
1452 Ga0157328_1002140
1453 Ga0157346_1004025
1454 Ga0157320_1006993
1455 Ga0157318_1000244
1456 Ga0157337_1000144
1457 Ga0157325_1000623
1458 Ga0157321_1000208
1459 Ga0157343_1000016
1460 Ga0157335_1000167
1461 Ga0157341_1000834
1462 Ga0157323_1017035
1463 Ga0157345_1000480
1464 Ga0157314_1004274
1465 Ga0157347_1001098
1466 Ga0157313_1000044
1467 Ga0157339_1000920
1468 Ga0157324_1000071
1469 Ga0157342_1000267
1470 Ga0157315_1000112
1471 Ga0157316_1000101
1472 Ga0157327_1004283
1473 Ga0157326_1000967
1474 Ga0157371_10030476
1475 Ga0157374_10041319
1476 Ga0157374_10187044
1477 Ga0157374_11167467
1478 Ga0157378_10001020
1479 Ga0157378_10019369
1480 Ga0157378_10031801
1481 Ga0157378_10059882
1482 Ga0157378_10216187
1483 Ga0163162_10154311
1484 Ga0157372_10062919
1485 Ga0157372_11709725
1486 Ga0157375_10176674
1487 Ga0157375_11090634
1488 Ga0157375_11916464
1489 Ga0157375_13744297
1490 Ga0157380_10107730
1491 Ga0182008_10001458
1492 Ga0182008_10010339
1493 Ga0182008_10011722
1494 Ga0182008_10017009
1495 Ga0182008_10398889
1496 Ga0157377_10011605
1497 Ga0157377_10035098
1498 Ga0157377_10062679
1499 Ga0157377_10177681
1500 Ga0157379_10168641
1501 Ga0157376_10819589
1502 Ga0157376_11638064
1503 Ga0182006_1028440
1504 Ga0182007_10020187
1505 Ga0182005_1176778
1506 Ga0163161_10004363
1507 Ga0197907_10051373
1508 Ga0206356_10130563
1509 Ga0206349_1224032
1510 Ga0206351_10300108
1511 Ga0206351_10770831
1512 Ga0206352_10179015
1513 Ga0206352_10863416
1514 Ga0206350_10347588
1515 Ga0206350_11067267
1516 Ga0206353_10977570
1517 Ga0206353_11680876
1518 Ga0154015_1236668
1519 Ga0213873_10049029
1520 Ga0213876_10087834
1521 Ga0224712_10033181
1522 Ga0207673_1001555
1523 Ga0207697_10000311
1524 Ga0207653_10094352
1525 Ga0207682_10013176
1526 Ga0207692_10032061
1527 Ga0207692_10532675
1528 Ga0207642_10279429
1529 Ga0207688_10000312
1530 Ga0207688_10211754
1531 Ga0207688_10378477
1532 Ga0207647_10006444
1533 Ga0207647_10015914
1534 Ga0207647_10016608
1535 Ga0207647_10474969
1536 Ga0207685_10004917
1537 Ga0207699_10039759
1538 Ga0207699_10056769
1539 Ga0207699_10491088
1540 Ga0207645_10004141
1541 Ga0207645_10019243
1542 Ga0207645_10047590
1543 Ga0207643_10001104
1544 Ga0207643_10004430
1545 Ga0207643_10006006
1546 Ga0207707_10174613
1547 Ga0207707_10691855
1548 Ga0207695_11248498
1549 Ga0207671_10065762
1550 Ga0207671_11055278
1551 Ga0207693_10001131
1552 Ga0207693_10006420
1553 Ga0207663_10000088
1554 Ga0207663_10000299
1555 Ga0207663_10004475
1556 Ga0207660_10027516
1557 Ga0207660_10047094
1558 Ga0207660_10054181
1559 Ga0207660_11086848
1560 Ga0207662_10002932
1561 Ga0207662_10010756
1562 Ga0207662_10255198
1563 Ga0207662_10960039
1564 Ga0207657_10252453
1565 Ga0207649_10226521
1566 Ga0207652_10192119
1567 Ga0207652_10219531
1568 Ga0207646_10013923
1569 Ga0207681_10001577
1570 Ga0207681_10025073
1571 Ga0207650_10016560
1572 Ga0207650_10148575
1573 Ga0207659_10035531
1574 Ga0207659_10224196
1575 Ga0207687_10855302
1576 Ga0207700_10246296
1577 Ga0207700_10635314
1578 Ga0207664_10040659
1579 Ga0207664_10135651
1580 Ga0207690_10529263
1581 Ga0207690_10553212
1582 Ga0207690_10662022
1583 Ga0207706_10003962
1584 Ga0207706_10011856
1585 Ga0207706_10277047
1586 Ga0207709_10758678
1587 Ga0207670_10456901
1588 Ga0207704_10616273
1589 Ga0207704_10920514
1590 Ga0207665_10004237
1591 Ga0207665_10004872
1592 Ga0207665_10144543
1593 Ga0207691_10006561
1594 Ga0207691_10048399
1595 Ga0207691_10151166
1596 Ga0207689_10003152
1597 Ga0207689_10034866
1598 Ga0207689_10868688
1599 Ga0207689_11194859
1600 Ga0207661_10547468
1601 Ga0207679_10297329
1602 Ga0207679_10909340
1603 Ga0207667_11655290
1604 Ga0207651_10014717
1605 Ga0207651_10050434
1606 Ga0207712_10009985
1607 Ga0207712_10040773
1608 Ga0207668_10026838
1609 Ga0207658_10006719
1610 Ga0207658_11493319
1611 Ga0207677_10015956
1612 Ga0207677_10026345
1613 Ga0207677_10079834
1614 Ga0207703_10801902
1615 Ga0207703_11414201
1616 Ga0207708_10019693
1617 Ga0207708_10035791
1618 Ga0207702_10050288
1619 Ga0207648_10008075
1620 Ga0207648_10010970
1621 Ga0207648_10023860
1622 Ga0207648_10091212
1623 Ga0207676_10028272
1624 Ga0207676_10308129
1625 Ga0207674_10918784
1626 Ga0207675_100217061
1627 Ga0207683_11066675
1628 Ga0207698_10412843
1629 Ga0207698_10707687
1630 Ga0209969_1000642
1631 Ga0209969_1015519
1632 Ga0209969_1022572
1633 Ga0209967_1000983
1634 Ga0209967_1005278
1635 Ga0209981_1001005
1636 Ga0209984_1006611
1637 Ga0210000_1001257
1638 Ga0209995_1000507
1639 Ga0209968_1001413
1640 Ga0209968_1030545
1641 Ga0209999_1031502
1642 Ga0209982_1000492
1643 Ga0209982_1001341
1644 Ga0209982_1089801
1645 Ga0209970_1000666
1646 Ga0210002_1000452
1647 Ga0210002_1075235
1648 Ga0209983_1006260
1649 Ga0209983_1096206
1650 Ga0209971_1005030
1651 Ga0209966_1001124
1652 Ga0209998_10001267
1653 Ga0209974_10001373
1654 Ga0209974_10003090
1655 Ga0207428_10000500
1656 Ga0207428_10001091
1657 Ga0207428_10019918
1658 Ga0207428_10198767
1659 Ga0207428_10606130
1660 Ga0207428_10737525
1661 Ga0268265_10024805
1662 Ga0268265_10037176
1663 Ga0268265_10251418
1664 Ga0268265_10471883
1665 Ga0268264_10085708
1666 Ga0307408_100379869
1667 Ga0307408_100518207
1668 Ga0307405_10096287
1669 Ga0307413_10038415
1670 Ga0307413_10060344
1671 Ga0307410_10093908
1672 Ga0307410_10855882
1673 Ga0307410_11840445
1674 Ga0307406_10010155
1675 Ga0307406_11638774
1676 Ga0307407_10000901
1677 Ga0307407_10100758
1678 Ga0307407_10204488
1679 Ga0307407_11135464
1680 Ga0307412_10086897
1681 Ga0307412_10136894
1682 Ga0307409_100013089
1683 Ga0307409_100063321
1684 Ga0307409_100090313
1685 Ga0307409_101112193
1686 Ga0307416_100005170
1687 Ga0307416_100122960
1688 Ga0307416_100410053
1689 Ga0307416_100540411
1690 Ga0307416_100784975
1691 Ga0307416_103579140
1692 Ga0307414_10158160
1693 Ga0307414_10205305
1694 Ga0307414_10230526
1695 Ga0307411_10197032
1696 Ga0307411_10758549
1697 Ga0307411_11330335
1698 Ga0307415_100004884
1699 Ga0307415_100012344
1700 Ga0307415_100026392
1701 Ga0373959_0167779
1702 Ga0373934_0022319
1703 Ga0373940_0115344
1704 Ga0373952_0012744
1705 Ga0373923_0015802
1706 Ga0373932_0003568
1707 Ga0373939_0305904
1708 Ga0373941_0177030
1709 Ga0373953_0023133
1710 Ga0373954_0011942
1711 Ga0373956_0013409
1712 Ga0373960_0001460
1713 Ga0373943_0279993
1714 Ga0373955_0004089
1715 Ga0373942_0112456
1716 Ga0373961_0010497
1717 Ga0373962_0003177
1718 Ga0373924_0004252
1719 Ga0373931_0025296
1720 Ga0373933_0000053
1721 Ga0373937_0000246
1722 Ga0373925_0308938
1723 Ga0242419_000002
1724 Ga0242422_01642
1725 Ga0242420_000005
1726 Ga0242420_007199
1727 Ga0242420_016624
1728 Ga0436365_1387592
1729 Ga0436362_1031797
1730 Ga0439436_0184075
1731 Ga0439439_0008260
1732 Ga0439439_0040588
1733 Ga0439453_0008351
1734 Ga0439453_0180814
1735 Ga0439461_0013113
1736 Ga0439461_0045164
1737 Ga0439437_000120
1738 Ga0439441_000217
1739 Ga0439443_000144
1740 Ga0439443_027024
1741 Ga0439432_020423
1742 Ga0439450_000075
1743 Ga0439450_137903
1744 Ga0439450_170882
1745 Ga0439451_006195
1746 Ga0439452_006132
1747 Ga0439454_000214
1748 Ga0439455_0003194
1749 Ga0439455_0014247
1750 Ga0439456_000667
1751 Ga0439456_015328
1752 Ga0439462_0014939
1753 Ga0439463_000970
1754 Ga0450913_035343
1755 Ga0450914_001449
1756 Ga0450920_049296
1757 Ga0450923_022741
1758 Ga0450889_030902
1759 Ga0439446_0011886
1760 Ga0439446_0367366
1761 Ga0439458_0047732
1762 Ga0439434_0005576
1763 Ga0439434_0012884
1764 Ga0439435_0000944
1765 Ga0439435_0002747
1766 Ga0439444_0000528
1767 Ga0439459_0025997
1768 Ga0439464_0000900
1769 Ga0439464_0019049
1770 Ga0439464_0064901
1771 Ga0439460_0000821
1772 Ga0439460_0075756
1773 Ga0450893_0001700
1774 Ga0451577_1263011
1775 Ga0439440_0000324
1776 Ga0439440_0050062
1777 Ga0466964_0038357
1778 Ga0453684_1107404
1779 Ga0466960_0263429
1780 Ga0451576_0062297
1781 Ga0466967_1216695
1782 Ga0466967_2460662
1783 Ga0495592_0033519
1784 Ga0495651_0021696
1785 Ga0495653_0043023
1786 Ga0495664_0395767
1787 Ga0495628_0061803
1788 Ga0495637_0209668
1789 Ga0495652_0016331
1790 Ga0495640_0280442
1791 Ga0495587_0003315
1792 Ga0495645_0047597
1793 Ga0495667_0051837
1794 Ga0495635_0038634
1795 Ga0495657_0015330
1796 Ga0495599_0029659
1797 Ga0495623_0127492
1798 Ga0495646_0065808
1799 Ga0495658_0874831
1800 Ga0495624_0365390
1801 Ga0495600_0027287
1802 Ga0495604_0013790
1803 Ga0495680_0438003
1804 Ga0495602_0000051
1805 Ga0496100_0013592
1806 Ga0496100_0077419
1807 Ga0496100_0300149
1808 Ga0496100_1165405
1809 Ga0496101_0039464
1810 Ga0496102_0065845
1811 Ga0496103_0211135
1812 Ga0496103_0295947
1813 Ga0496104_0375652
1814 Ga0496104_1141131
1815 Ga0496104_1234276
1816 Ga0496105_1368539
1817 Ga0496106_0004924
1818 Ga0496106_0031160
1819 Ga0496106_0057306
1820 Ga0496106_0148849
1821 Ga0496106_0672150
1822 Ga0496106_1048488
1823 Ga0496106_1067822
1824 Ga0496107_0004265
1825 Ga0496107_0080323
1826 Ga0496107_0672299
1827 Ga0496108_0094681
1828 Ga0496108_0471429
1829 Ga0496109_0128942
1830 Ga0496109_0544207
1831 Ga0496110_0441117
1832 Ga0496110_0483763
1833 Ga0496111_0018835
1834 Ga0496112_0064163
1835 Ga0496112_0397271
1836 Ga0496112_1700665
1837 Ga0496113_0558242
1838 Ga0496114_0282422
1839 Ga0501291_000358
1840 Ga0501291_003418
1841 Ga0501292_000859
1842 Ga0501292_054992
1843 Ga0501293_013182
1844 Ga0501294_011694
1845 Ga0501295_000714
1846 Ga0501295_019999
1847 Ga0501295_055461
1848 Ga0501299_183009
1849 Ga0501300_002537
1850 Ga0501317_000161
1851 Ga0501321_007099
1852 Ga0501031_0011743
1853 Ga0501031_0014021
1854 Ga0501031_0037706
1855 Ga0501031_0130910
1856 Ga0501031_0335816
1857 Ga0501031_0616745
1858 Ga0501032_0476541
1859 Ga0501033_0181233
1860 Ga0501033_0251568
1861 Ga0501036_0044357
1862 Ga0501036_0056660
1863 Ga0501036_0071025
1864 Ga0501036_0091659
1865 Ga0501036_0202381
1866 Ga0501036_0237498
1867 Ga0501036_0315991
1868 Ga0501036_0767185
1869 Ga0501037_0060375
1870 Ga0501037_0109319
1871 Ga0501037_0330592
1872 Ga0501037_1031875
1873 Ga0501038_0047256
1874 Ga0501038_0048625
1875 Ga0501038_0121592
1876 Ga0501038_0185624
1877 Ga0501038_0239878
1878 Ga0501038_0264237
1879 Ga0501038_0408611
1880 Ga0501038_0627826
1881 Ga0501039_0061679
1882 Ga0501039_0066786
1883 Ga0501039_0088941
1884 Ga0501039_0101863
1885 Ga0501039_0112734
1886 Ga0501039_0115056
1887 Ga0501039_0160786
1888 Ga0501040_0000779
1889 Ga0501040_0008214
1890 Ga0501040_0187649
1891 Ga0501040_1056859
1892 Ga0501041_0001310
1893 Ga0501041_0016211
1894 Ga0501041_0018497
1895 Ga0501041_0113152
1896 Ga0501041_0743096
1897 Ga0501041_0835178
1898 Ga0501042_0004963
1899 Ga0501042_0012271
1900 Ga0501042_0078006
1901 Ga0501042_0121154
1902 Ga0501042_0159658
1903 Ga0501042_0275473
1904 Ga0501042_0325622
1905 Ga0501042_0326692
1906 Ga0501043_0035758
1907 Ga0501043_0045853
1908 Ga0501043_0096645
1909 Ga0501043_0167577
1910 Ga0501043_0358436
1911 Ga0501043_0384969
1912 Ga0501046_0039530
1913 Ga0501046_0039971
1914 Ga0501046_0044251
1915 Ga0501046_0110983
1916 Ga0501046_0221442
1917 Ga0501046_0239618
1918 Ga0501046_0696674
1919 Ga0501046_1024059
1920 Ga0501048_0003334
1921 Ga0501048_0040897
1922 Ga0501048_0068967
1923 Ga0501048_0090885
1924 Ga0501048_0251597
1925 Ga0501048_0632316
1926 Ga0501067_0098277
1927 Ga0501067_0508243
1928 Ga0501067_0559346
1929 Ga0501068_0413462
1930 Ga0501068_0533485
1931 Ga0501069_0191743
1932 Ga0501071_0005626
1933 Ga0501071_0023406
1934 Ga0501071_0065500
1935 Ga0501071_0159410
1936 Ga0501071_0319792
1937 Ga0501072_0002468
1938 Ga0501072_0002604
1939 Ga0501072_0021867
1940 Ga0501072_0026420
1941 Ga0501072_0195995
1942 Ga0501073_0200721
1943 Ga0501073_0224490
1944 Ga0501074_0047313
1945 Ga0501074_0196640
1946 Ga0501074_0252756
1947 Ga0501074_0478050
1948 Ga0501074_0513415
1949 Ga0501075_0002026
1950 Ga0501075_0003169
1951 Ga0501075_0008648
1952 Ga0501075_0010272
1953 Ga0501075_0080815
1954 Ga0501075_0104445
1955 Ga0501075_0328364
1956 Ga0501075_0738510
1957 Ga0501075_0797420
1958 Ga0501076_0000557
1959 Ga0501076_0008730
1960 Ga0501076_0034054
1961 Ga0501076_0065526
1962 Ga0501076_0075822
1963 Ga0501076_0087737
1964 Ga0501076_0099845
1965 Ga0501076_0362707
1966 Ga0501076_0419566
1967 Ga0501076_0475233
1968 Ga0501077_0058369
1969 Ga0501077_0281935
1970 Ga0501077_0665488
1971 Ga0501198_000782
1972 Ga0501201_003136
1973 Ga0501202_038092
1974 Ga0501202_061677
1975 Ga0501202_074433
1976 Ga0501206_001964
1977 Ga0501207_003532
1978 Ga0501208_016733
1979 Ga0501208_065468
1980 Ga0501209_000285
1981 Ga0501209_047998
1982 Ga0501209_065221
1983 Ga0501211_022429
1984 Ga0501214_000186
1985 Ga0501214_030212
1986 Ga0501217_008182
1987 Ga0501217_009769
1988 Ga0501217_009973
1989 Ga0501217_034500
1990 Ga0501222_009113
1991 Ga0501223_001538
1992 Ga0501224_001102
1993 Ga0501227_006804
1994 Ga0501228_007830
1995 Ga0501230_058540
1996 Ga0501233_003069
1997 Ga0501242_035029
1998 Ga0501243_000996
1999 Ga0501246_001118
2000 Ga0501247_058681
2001 Ga0501248_001962
2002 Ga0501249_047846
2003 Ga0501249_061236
2004 Ga0501250_015703
2005 Ga0501250_021801
2006 Ga0501251_004906
2007 Ga0501251_018000
2008 Ga0501251_018769
2009 Ga0501253_001008
2010 Ga0501255_009037
2011 Ga0501256_000569
2012 Ga0501256_001701
2013 Ga0501256_032694
2014 Ga0501259_055831
2015 Ga0501261_000643
2016 Ga0501261_004446
2017 Ga0501219_003932
2018 Ga0501221_001643
2019 Ga0501221_095400
2020 Ga0501225_0003040
2021 Ga0501225_0165565
2022 Ga0501234_001428
2023 Ga0501234_026465
2024 Ga0501234_039609
2025 Ga0501245_002425
2026 Ga0501245_053313
2027 Ga0501079_0029572
2028 Ga0501079_0054777
2029 Ga0501079_0083372
2030 Ga0501079_0370944
2031 Ga0501079_1467452
2032 Ga0501080_0241399
2033 Ga0501080_0314958
2034 Ga0501080_0320206
2035 Ga0501080_0728686
2036 Ga0501080_0867820
2037 Ga0501081_0002944
2038 Ga0501081_0009067
2039 Ga0501081_0058568
2040 Ga0501081_0087162
2041 Ga0501081_0099884
2042 Ga0501081_0247453
2043 Ga0501081_0447152
2044 Ga0501081_0514118
2045 Ga0501081_0615241
2046 Ga0501083_0251739
2047 Ga0501083_0303260
2048 Ga0501083_0559966
2049 Ga0501241_017933
2050 Ga0501263_057685
2051 Ga0501265_048345
2052 Ga0501266_000510
2053 Ga0501266_025910
2054 Ga0501268_030101
2055 Ga0501270_002888
2056 Ga0501274_002214
2057 Ga0501275_000841
2058 Ga0501276_000236
2059 Ga0501279_001699
2060 Ga0501283_001962
2061 Ga0501283_012261
2062 Ga0501035_0042919
2063 Ga0501035_0091410
2064 Ga0501035_0246804
2065 Ga0501044_0236575
2066 Ga0501044_1362449
2067 Ga0501045_0009810
2068 Ga0501045_0028235
2069 Ga0501045_0157712
2070 Ga0501045_0320942
2071 Ga0501045_0860853
2072 Ga0501045_0942952
2073 Ga0501045_1093386
2074 Ga0501204_007201
2075 Ga0501204_022850
2076 Ga0501212_000255
2077 Ga0501212_025484
2078 Ga0501212_033828
2079 Ga0501226_003536
2080 nmdc:mga0yw44_775403_c1
2081 nmdc:mga05p37_1454683_c1
2082 nmdc:mga05p37_16925_c1
2083 nmdc:mga05p37_265970_c1
2084 nmdc:mga05p37_287973_c1
2085 nmdc:mga05p37_33337_c1
2086 nmdc:mga05p37_388142_c1
2087 nmdc:mga05p37_40747_c1
2088 nmdc:mga05p37_741489_c1
2089 nmdc:mga05p37_8254_c1
2090 nmdc:mga05p37_866605_c1
2091 nmdc:mga09592_174050_c1
2092 nmdc:mga09592_19582_c1
2093 nmdc:mga09592_264395_c1
2094 nmdc:mga09592_289345_c1
2095 nmdc:mga09592_339_c1
2096 nmdc:mga09592_595322_c1
2097 nmdc:mga0qj67_10826_c1
2098 nmdc:mga0qj67_1176107_c1
2099 nmdc:mga0qj67_15446_c1
2100 nmdc:mga0qj67_262193_c1
2101 nmdc:mga0qj67_368924_c1
2102 nmdc:mga0qj67_410_c1
2103 nmdc:mga0qj67_502154_c1
2104 nmdc:mga0qj67_51839_c1
2105 nmdc:mga06r32_164754_c1
2106 nmdc:mga06r32_24070_c1
2107 nmdc:mga06r32_434994_c1
2108 nmdc:mga06r32_587374_c1
2109 nmdc:mga06r32_589802_c1
2110 nmdc:mga06r32_736990_c1
2111 nmdc:mga06r32_97280_c1
2112 nmdc:mga08y16_36440_c1
2113 nmdc:mga08y16_40899_c1
2114 nmdc:mga08y16_44296_c1
2115 nmdc:mga08y16_56390_c1
2116 nmdc:mga08y16_70385_c1
2117 nmdc:mga08y16_750554_c1
2118 nmdc:mga08y16_78470_c1
2119 nmdc:mga0n895_17568_c1
2120 nmdc:mga0n895_22_c1
2121 nmdc:mga0n895_3989_c1
2122 nmdc:mga0n895_47882_c1
2123 nmdc:mga0rr50_1180197_c1
2124 nmdc:mga0rr50_15074_c1
2125 nmdc:mga0rr50_283285_c1
2126 nmdc:mga0rr50_3785_c1
2127 nmdc:mga08x19_10654_c1
2128 nmdc:mga08x19_230886_c1
2129 nmdc:mga08x19_256054_c1
2130 nmdc:mga08x19_43883_c1
2131 nmdc:mga08x19_661416_c1
2132 nmdc:mga0a205_29295_c1
2133 nmdc:mga0a205_400341_c1
2134 nmdc:mga0a205_9110_c1
2135 nmdc:mga0a205_997934_c1
2136 Ga0495612_0021168
2137 Ga0495619_0000072
2138 Ga0501084_0005873
2139 Ga0501084_0011196
2140 Ga0501084_0046206
2141 Ga0501084_0089854
2142 Ga0501084_0095518
2143 Ga0501084_0321374
2144 Ga0501084_0488040
2145 Ga0590074_007521
2146 Ga0590075_001683
2147 Ga0590075_002030
2148 Ga0590075_190918
2149 Ga0590077_005693
2150 Ga0590077_016543
2151 Ga0590077_036708
2152 Ga0590077_038297
2153 Ga0587084_000340
2154 Ga0587093_000063
2155 Ga0587093_014371
2156 Ga0587066_000085
2157 Ga0587066_000205
2158 Ga0587066_000247
2159 Ga0587066_000438
2160 Ga0587066_109783
2161 Ga0587070_000246
2162 Ga0587070_002652
2163 Ga0587073_0000233
2164 Ga0587073_0000281
2165 Ga0587073_0000572
2166 Ga0587073_0003613
2167 Ga0587073_0333134
2168 Ga0587077_000152
2169 Ga0587077_000189
2170 Ga0587077_003235
2171 Ga0587080_000477
2172 Ga0587080_003219
2173 Ga0587080_014206
2174 Ga0587080_015763
2175 Ga0587082_122701
2176 Ga0587083_0000123
2177 Ga0587083_0000187
2178 Ga0587083_0001206
2179 Ga0587086_000296
2180 Ga0587088_000421
2181 Ga0587088_014814
2182 Ga0587089_070651
2183 Ga0587090_001140
2184 Ga0587090_004020
2185 Ga0587091_000384
2186 Ga0587091_033561
2187 Ga0587092_000391
2188 Ga0587092_007795
2189 Ga0587092_012541
2190 Ga0587094_000326
2191 Ga0587094_001377
2192 Ga0587097_03003
2193 Ga0587131_000595
2194 Ga0587131_000808
2195 Ga0587101_001679
2196 Ga0587109_000858
2197 Ga0587109_027649
2198 Ga0587109_050592
2199 Ga0587115_000413
2200 Ga0587117_000703
2201 Ga0587117_006270
2202 Ga0587122_000045
2203 Ga0587062_001016
2204 Ga0587067_000409
2205 Ga0587067_000484
2206 Ga0587067_009387
2207 Ga0587068_015855
2208 Ga0587068_026813
2209 Ga0587069_000306
2210 Ga0587069_000387
2211 Ga0587069_000765
2212 Ga0587075_002808
2213 Ga0587075_025262
2214 Ga0587075_058586
2215 Ga0587076_000392
2216 Ga0587076_000505
2217 Ga0587076_003518
2218 Ga0587079_046855
2219 Ga0587102_012738
2220 Ga0587105_002195
2221 Ga0587107_000242
2222 Ga0587114_000078
2223 Ga0587114_000220
2224 Ga0587116_03042
2225 Ga0587120_000128
2226 Ga0587060_000083
2227 Ga0587060_003183
2228 Ga0587071_000937
2229 Ga0587071_001069
2230 Ga0501082_0001241
2231 Ga0501082_0004935
2232 Ga0501082_0059577
2233 Ga0501082_0106770
2234 Ga0501082_0175700
2235 Ga0501082_0300872
2236 Ga0501082_0449532
2237 Ga0530510_0000346
2238 Ga0530510_0006123
2239 Ga0530510_0022961
2240 Ga0530510_0302943

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

6

95

0.96

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

6

106

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.9586 3 102
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9554 3 102
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9547 1 104
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9546 4 102
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.9506 3 102
ID Description Score Start End Superfamily
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.961 3 102 2.102.10.10
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9606 4 104 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.96 3 102 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9568 5 102 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9554 3 102 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A3N5UT57-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9923 3 104 GO:0046872
GO:0051537
AF-A0A850SNX2-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9885 1 104 GO:0046872
GO:0051537
AF-H0EBT0-F1-model_v4 Ferredoxin 2Fe-2S 0.9836 19 104 GO:0046872
GO:0051537
AF-A0A354B749-F1-model_v4 Bifunctional 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit 0.9822 30 104 GO:0046872
GO:0051213
GO:0051537
AF-A0A6J7KEN4-F1-model_v4 Unannotated protein 0.9807 3 104 GO:0046872
GO:0051537

Map