F490006
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1097 | 492 | 1068 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300048919|Ga0496116_0008933|Ga0496116_0008933_4666_5661 |
| Length | 312 |
| Sequence | MNRTAKSNKASQKVAQRKPVTAAKKAKVHTKVARRVVAKPTKLITNKRHFSTEAAPAEMMIASETKGRVGIVRLNRPKALNALCDQLITELTAQLKAYNEDPKIAAIIITGSDKAFAAGADIKEMADQTYMTAYKKNMLAFWHDFTHFQKPTIAAVNGYALGGGCELAMMCDIIIAGEKAKFGQPEVKIGTIPGCGGTQRLTRAVGKSKAMEWILTGDMFTAQQAESAGLVSRVVPVDKLMDEAMATAEKIAKNSIPIIALAKESVNAAYETTLQQGVVFERRLFHSTFAISDQKEGMGAFKDKREPSFKDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 2 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 3 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 4 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 5 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 6 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 7 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 8 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 9 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 10 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 13 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 14 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 15 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 16 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 17 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 18 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 19 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 20 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 21 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 22 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 23 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 24 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 25 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 26 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 27 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 28 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 29 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 30 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 31 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 32 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 33 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 34 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 35 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 37 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 40 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 113 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 115 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 116 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 118 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 119 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 120 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 121 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 122 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 126 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 133 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 134 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 135 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 136 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 137 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 138 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 141 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 142 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 143 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 173 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 174 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 175 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 176 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 252 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 253 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 254 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 255 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 260 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 263 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 265 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 266 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 267 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 269 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 272 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 274 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 275 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 276 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 277 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 278 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 279 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 288 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 289 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 291 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 292 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 296 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 299 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 300 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 301 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 302 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 307 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 308 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 309 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 310 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 312 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 313 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 314 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 315 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 316 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 317 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 320 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 321 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 322 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 323 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 324 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 325 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 326 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 327 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 328 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 329 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 330 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 331 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 332 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 333 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 334 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 335 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 336 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 337 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 338 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 339 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 415 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 416 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 417 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 418 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 425 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 452 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 457 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 471 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 475 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 479 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 480 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 481 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 482 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 489 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 490 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 491 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 492 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.72 |
| Metatranscriptomes | 0.64 |
| Isolates | 2.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 7.93 |
| Nodule | 0.18 |
| Rhizoplane | 6.56 |
| Rhizosphere | 77.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1010763 | 3300000546 | Bacteria | 976 |
| 2 | JGI24744J21845_10001840 | 3300002077 | Bacteria | 4258 |
| 3 | JGI24742J22300_10003712 | 3300002244 | Bacteria | 2479 |
| 4 | JGI25162J39368_1000598 | 3300002737 | Bacteria | 26161 |
| 5 | JGI25158J39367_1002218 | 3300002739 | Bacteria | 3230 |
| 6 | JGI25163J39215_1004202 | 3300002771 | Bacteria | 1041 |
| 7 | JGI25159J45721_1000001 | 3300002987 | Bacteria | 303489 |
| 8 | JGI25159J45721_1005684 | 3300002987 | Bacteria | 3868 |
| 9 | JGI25151J46595_10000672 | 3300003187 | Bacteria | 28951 |
| 10 | JGI25406J46586_10000563 | 3300003203 | Bacteria | 17507 |
| 11 | JGI25165J46597_1000713 | 3300003214 | Bacteria | 26161 |
| 12 | rootH1_10054217 | 3300003316 | Bacteria | 2159 |
| 13 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 14 | JGI25161J50226_1002505 | 3300003374 | Bacteria | 4672 |
| 15 | Ga0055538_1000281 | 3300003751 | Bacteria | 26161 |
| 16 | Ga0055539_1000305 | 3300003752 | Bacteria | 26161 |
| 17 | Ga0055533_1000286 | 3300003756 | Bacteria | 26161 |
| 18 | Ga0055525_1000405 | 3300003759 | Bacteria | 26891 |
| 19 | Ga0055540_1000702 | 3300003792 | Bacteria | 23030 |
| 20 | Ga0055540_1000980 | 3300003792 | Bacteria | 18425 |
| 21 | Ga0055541_1000198 | 3300003841 | Bacteria | 26161 |
| 22 | Ga0055543_1000010 | 3300004625 | Bacteria | 198371 |
| 23 | Ga0065165_1000004 | 3300005262 | Bacteria | 377081 |
| 24 | Ga0065165_1002857 | 3300005262 | Bacteria | 13394 |
| 25 | Ga0070658_10003541 | 3300005327 | Bacteria | 12818 |
| 26 | Ga0070658_10025550 | 3300005327 | Bacteria | 4735 |
| 27 | Ga0070658_10040353 | 3300005327 | Bacteria | 3765 |
| 28 | Ga0070676_10146297 | 3300005328 | Bacteria | 1509 |
| 29 | Ga0070683_100110989 | 3300005329 | Bacteria | 2587 |
| 30 | Ga0070670_100000020 | 3300005331 | Bacteria | 215458 |
| 31 | Ga0070670_100045141 | 3300005331 | Bacteria | 3788 |
| 32 | Ga0070666_10024729 | 3300005335 | Bacteria | 3915 |
| 33 | Ga0070682_100022524 | 3300005337 | Bacteria | 3733 |
| 34 | Ga0068868_100005133 | 3300005338 | Bacteria | 9196 |
| 35 | Ga0068868_100116928 | 3300005338 | Bacteria | 2172 |
| 36 | Ga0068868_100216232 | 3300005338 | Bacteria | 1603 |
| 37 | Ga0070660_100022139 | 3300005339 | Bacteria | 4696 |
| 38 | Ga0070660_100243003 | 3300005339 | Bacteria | 1467 |
| 39 | Ga0070660_100382068 | 3300005339 | Bacteria | 1163 |
| 40 | Ga0070689_100031249 | 3300005340 | Bacteria | 4046 |
| 41 | Ga0070691_10043297 | 3300005341 | Bacteria | 2133 |
| 42 | Ga0070687_100289269 | 3300005343 | Bacteria | 1035 |
| 43 | Ga0070661_100025891 | 3300005344 | Bacteria | 4216 |
| 44 | Ga0070661_100161357 | 3300005344 | Bacteria | 1698 |
| 45 | Ga0070692_10000346 | 3300005345 | Bacteria | 13515 |
| 46 | Ga0070692_10086494 | 3300005345 | Bacteria | 1697 |
| 47 | Ga0070668_100002097 | 3300005347 | Bacteria | 14580 |
| 48 | Ga0070668_100204665 | 3300005347 | Bacteria | 1621 |
| 49 | Ga0070668_100467222 | 3300005347 | Bacteria | 1087 |
| 50 | Ga0070669_100003646 | 3300005353 | Bacteria | 11103 |
| 51 | Ga0070669_100006848 | 3300005353 | Bacteria | 8197 |
| 52 | Ga0070669_100126647 | 3300005353 | Bacteria | 1955 |
| 53 | Ga0070675_100059478 | 3300005354 | Bacteria | 3152 |
| 54 | Ga0070675_100105956 | 3300005354 | Bacteria | 2373 |
| 55 | Ga0070671_100003533 | 3300005355 | Bacteria | 12222 |
| 56 | Ga0070671_100087697 | 3300005355 | Bacteria | 2604 |
| 57 | Ga0070674_100122707 | 3300005356 | Bacteria | 1925 |
| 58 | Ga0070674_100127923 | 3300005356 | Bacteria | 1890 |
| 59 | Ga0070674_100170237 | 3300005356 | Bacteria | 1660 |
| 60 | Ga0070674_100350332 | 3300005356 | Bacteria | 1192 |
| 61 | Ga0070673_100336251 | 3300005364 | Bacteria | 1337 |
| 62 | Ga0070688_100025163 | 3300005365 | Bacteria | 3522 |
| 63 | Ga0070659_100001752 | 3300005366 | Bacteria | 15587 |
| 64 | Ga0070659_100110797 | 3300005366 | Bacteria | 2216 |
| 65 | Ga0070667_100000118 | 3300005367 | Bacteria | 100395 |
| 66 | Ga0070667_100000190 | 3300005367 | Bacteria | 73682 |
| 67 | Ga0070667_100000658 | 3300005367 | Bacteria | 33550 |
| 68 | Ga0070667_100007906 | 3300005367 | Bacteria | 8819 |
| 69 | Ga0070667_100015478 | 3300005367 | Bacteria | 6307 |
| 70 | Ga0070709_10002573 | 3300005434 | Bacteria | 9812 |
| 71 | Ga0070709_10055126 | 3300005434 | Bacteria | 2509 |
| 72 | Ga0070714_100162127 | 3300005435 | Bacteria | 2024 |
| 73 | Ga0070713_100013539 | 3300005436 | Bacteria | 6028 |
| 74 | Ga0070713_100524489 | 3300005436 | Bacteria | 1119 |
| 75 | Ga0070710_10017543 | 3300005437 | Bacteria | 3665 |
| 76 | Ga0070710_10186310 | 3300005437 | Bacteria | 1303 |
| 77 | Ga0070701_10008518 | 3300005438 | Bacteria | 4441 |
| 78 | Ga0070711_100000220 | 3300005439 | Bacteria | 30189 |
| 79 | Ga0070711_100146690 | 3300005439 | Bacteria | 1775 |
| 80 | Ga0070705_100070313 | 3300005440 | Bacteria | 2114 |
| 81 | Ga0070705_100094783 | 3300005440 | Bacteria | 1870 |
| 82 | Ga0070700_100364968 | 3300005441 | Bacteria | 1075 |
| 83 | Ga0070694_100000117 | 3300005444 | Bacteria | 38520 |
| 84 | Ga0070694_100012696 | 3300005444 | Bacteria | 5244 |
| 85 | Ga0070694_100203760 | 3300005444 | Bacteria | 1476 |
| 86 | Ga0070694_100219954 | 3300005444 | Bacteria | 1424 |
| 87 | Ga0070708_100002549 | 3300005445 | Bacteria | 14082 |
| 88 | Ga0070708_100017079 | 3300005445 | Bacteria | 6043 |
| 89 | Ga0070708_100070754 | 3300005445 | Bacteria | 3139 |
| 90 | Ga0070708_100262095 | 3300005445 | Bacteria | 1625 |
| 91 | Ga0070663_100195322 | 3300005455 | Bacteria | 1577 |
| 92 | Ga0070678_100000231 | 3300005456 | Bacteria | 25410 |
| 93 | Ga0070678_100054293 | 3300005456 | Bacteria | 2919 |
| 94 | Ga0070678_100069019 | 3300005456 | Bacteria | 2638 |
| 95 | Ga0070678_100138005 | 3300005456 | Bacteria | 1947 |
| 96 | Ga0070678_100600170 | 3300005456 | Bacteria | 983 |
| 97 | Ga0070662_100003854 | 3300005457 | Bacteria | 9404 |
| 98 | Ga0070662_100203518 | 3300005457 | Bacteria | 1572 |
| 99 | Ga0070662_100256533 | 3300005457 | Bacteria | 1407 |
| 100 | Ga0070681_10156098 | 3300005458 | Bacteria | 2207 |
| 101 | Ga0070681_10188930 | 3300005458 | Bacteria | 1980 |
| 102 | Ga0070681_10535474 | 3300005458 | Bacteria | 1085 |
| 103 | Ga0068867_100056402 | 3300005459 | Bacteria | 2907 |
| 104 | Ga0068867_100096189 | 3300005459 | Bacteria | 2254 |
| 105 | Ga0068867_100260392 | 3300005459 | Bacteria | 1414 |
| 106 | Ga0070706_100000386 | 3300005467 | Bacteria | 52878 |
| 107 | Ga0070706_100033105 | 3300005467 | Bacteria | 4770 |
| 108 | Ga0070707_100086462 | 3300005468 | Bacteria | 3032 |
| 109 | Ga0070707_100313297 | 3300005468 | Bacteria | 1525 |
| 110 | Ga0070707_100344019 | 3300005468 | Bacteria | 1449 |
| 111 | Ga0070698_100063592 | 3300005471 | Bacteria | 3721 |
| 112 | Ga0070699_100016226 | 3300005518 | Bacteria | 6393 |
| 113 | Ga0070699_100244679 | 3300005518 | Bacteria | 1602 |
| 114 | Ga0070699_100262805 | 3300005518 | Bacteria | 1544 |
| 115 | Ga0070679_100031622 | 3300005530 | Bacteria | 5230 |
| 116 | Ga0070679_100045536 | 3300005530 | Bacteria | 4372 |
| 117 | Ga0070679_100161498 | 3300005530 | Bacteria | 2215 |
| 118 | Ga0070679_100356591 | 3300005530 | Bacteria | 1410 |
| 119 | Ga0070684_100171621 | 3300005535 | Bacteria | 1970 |
| 120 | Ga0070697_100004974 | 3300005536 | Bacteria | 10206 |
| 121 | Ga0070697_100006640 | 3300005536 | Bacteria | 8970 |
| 122 | Ga0068853_100002612 | 3300005539 | Bacteria | 13547 |
| 123 | Ga0068853_100046750 | 3300005539 | Bacteria | 3712 |
| 124 | Ga0068853_100047221 | 3300005539 | Bacteria | 3695 |
| 125 | Ga0068853_100204631 | 3300005539 | Bacteria | 1797 |
| 126 | Ga0068853_100653364 | 3300005539 | Bacteria | 1001 |
| 127 | Ga0070695_100003240 | 3300005545 | Bacteria | 9499 |
| 128 | Ga0070695_100075322 | 3300005545 | Bacteria | 2220 |
| 129 | Ga0070695_100219480 | 3300005545 | Bacteria | 1369 |
| 130 | Ga0070696_100000829 | 3300005546 | Bacteria | 19923 |
| 131 | Ga0070696_100050408 | 3300005546 | Bacteria | 2894 |
| 132 | Ga0070693_100012908 | 3300005547 | Bacteria | 4242 |
| 133 | Ga0070693_100166395 | 3300005547 | Bacteria | 1409 |
| 134 | Ga0070665_100000419 | 3300005548 | Bacteria | 62030 |
| 135 | Ga0070665_100001988 | 3300005548 | Bacteria | 23002 |
| 136 | Ga0070665_100609506 | 3300005548 | Bacteria | 1105 |
| 137 | Ga0070704_100002414 | 3300005549 | Bacteria | 10494 |
| 138 | Ga0070704_100004068 | 3300005549 | Bacteria | 8441 |
| 139 | Ga0070704_100037402 | 3300005549 | Bacteria | 3316 |
| 140 | Ga0068855_100047049 | 3300005563 | Bacteria | 5097 |
| 141 | Ga0068855_100084417 | 3300005563 | Bacteria | 3677 |
| 142 | Ga0068855_100630288 | 3300005563 | Bacteria | 1153 |
| 143 | Ga0070664_100039694 | 3300005564 | Bacteria | 3967 |
| 144 | Ga0068854_100000198 | 3300005578 | Bacteria | 40596 |
| 145 | Ga0068854_100077559 | 3300005578 | Bacteria | 2446 |
| 146 | Ga0068854_100202328 | 3300005578 | Bacteria | 1562 |
| 147 | Ga0068856_100252974 | 3300005614 | Bacteria | 1777 |
| 148 | Ga0068856_100719261 | 3300005614 | Bacteria | 1019 |
| 149 | Ga0070702_100000682 | 3300005615 | Bacteria | 12751 |
| 150 | Ga0070702_100156436 | 3300005615 | Bacteria | 1468 |
| 151 | Ga0068852_100004074 | 3300005616 | Bacteria | 10282 |
| 152 | Ga0068852_100206654 | 3300005616 | Bacteria | 1860 |
| 153 | Ga0068859_100001075 | 3300005617 | Bacteria | 27961 |
| 154 | Ga0068859_100003525 | 3300005617 | Bacteria | 15932 |
| 155 | Ga0068859_100015720 | 3300005617 | Bacteria | 7606 |
| 156 | Ga0068859_100031870 | 3300005617 | Bacteria | 5295 |
| 157 | Ga0068859_100046450 | 3300005617 | Bacteria | 4361 |
| 158 | Ga0068864_100000206 | 3300005618 | Bacteria | 53509 |
| 159 | Ga0068864_100138140 | 3300005618 | Bacteria | 2196 |
| 160 | Ga0068866_10000535 | 3300005718 | Bacteria | 17395 |
| 161 | Ga0068861_100000696 | 3300005719 | Bacteria | 20143 |
| 162 | Ga0068861_100110753 | 3300005719 | Bacteria | 2199 |
| 163 | Ga0068861_100179360 | 3300005719 | Bacteria | 1762 |
| 164 | Ga0068863_100000071 | 3300005841 | Bacteria | 115525 |
| 165 | Ga0068863_100001658 | 3300005841 | Bacteria | 22010 |
| 166 | Ga0068863_100028731 | 3300005841 | Bacteria | 5309 |
| 167 | Ga0068858_100013158 | 3300005842 | Bacteria | 7801 |
| 168 | Ga0068858_100015779 | 3300005842 | Bacteria | 7105 |
| 169 | Ga0068858_100019858 | 3300005842 | Bacteria | 6282 |
| 170 | Ga0068860_100000099 | 3300005843 | Bacteria | 145436 |
| 171 | Ga0068860_100000205 | 3300005843 | Bacteria | 93929 |
| 172 | Ga0068860_100000954 | 3300005843 | Bacteria | 31985 |
| 173 | Ga0068860_100003120 | 3300005843 | Bacteria | 17129 |
| 174 | Ga0068862_100000057 | 3300005844 | Bacteria | 140795 |
| 175 | Ga0068862_100000086 | 3300005844 | Bacteria | 110489 |
| 176 | Ga0068862_100013447 | 3300005844 | Bacteria | 6774 |
| 177 | Ga0068862_100144308 | 3300005844 | Bacteria | 2114 |
| 178 | Ga0081455_10000453 | 3300005937 | Bacteria | 53921 |
| 179 | Ga0081455_10005282 | 3300005937 | Bacteria | 14190 |
| 180 | Ga0081455_10032235 | 3300005937 | Bacteria | 4725 |
| 181 | Ga0081455_10084834 | 3300005937 | Bacteria | 2584 |
| 182 | Ga0081455_10199039 | 3300005937 | Bacteria | 1502 |
| 183 | Ga0081538_10025003 | 3300005981 | Bacteria | 4233 |
| 184 | Ga0081540_1029206 | 3300005983 | Bacteria | 3077 |
| 185 | Ga0081539_10050344 | 3300005985 | Bacteria | 2358 |
| 186 | Ga0070717_10021477 | 3300006028 | Bacteria | 5087 |
| 187 | Ga0070717_10049176 | 3300006028 | Bacteria | 3460 |
| 188 | Ga0070717_10200199 | 3300006028 | Bacteria | 1749 |
| 189 | Ga0070717_10255901 | 3300006028 | Bacteria | 1548 |
| 190 | Ga0070717_10291271 | 3300006028 | Bacteria | 1450 |
| 191 | Ga0075365_10031894 | 3300006038 | Bacteria | 3384 |
| 192 | Ga0075368_10013438 | 3300006042 | Bacteria | 3007 |
| 193 | Ga0075363_100065606 | 3300006048 | Bacteria | 1963 |
| 194 | Ga0075364_10003638 | 3300006051 | Bacteria | 8794 |
| 195 | Ga0075364_10008968 | 3300006051 | Bacteria | 5989 |
| 196 | Ga0075364_10080880 | 3300006051 | Bacteria | 2148 |
| 197 | Ga0075364_10374158 | 3300006051 | Bacteria | 972 |
| 198 | Ga0075432_10000194 | 3300006058 | Bacteria | 15798 |
| 199 | Ga0075432_10012711 | 3300006058 | Bacteria | 2860 |
| 200 | Ga0075432_10015901 | 3300006058 | Bacteria | 2569 |
| 201 | Ga0070715_10002296 | 3300006163 | Bacteria | 5830 |
| 202 | Ga0070716_100305982 | 3300006173 | Bacteria | 1108 |
| 203 | Ga0070716_100334580 | 3300006173 | Bacteria | 1066 |
| 204 | Ga0070712_100000493 | 3300006175 | Bacteria | 22536 |
| 205 | Ga0070712_100007822 | 3300006175 | Bacteria | 6693 |
| 206 | Ga0070712_100197867 | 3300006175 | Bacteria | 1577 |
| 207 | Ga0070712_100207337 | 3300006175 | Bacteria | 1544 |
| 208 | Ga0075367_10009109 | 3300006178 | Bacteria | 5172 |
| 209 | Ga0075367_10110737 | 3300006178 | Bacteria | 1685 |
| 210 | Ga0075369_10000808 | 3300006186 | Bacteria | 10271 |
| 211 | Ga0075369_10002242 | 3300006186 | Bacteria | 6854 |
| 212 | Ga0075369_10187789 | 3300006186 | Bacteria | 952 |
| 213 | Ga0075366_10003168 | 3300006195 | Bacteria | 8617 |
| 214 | Ga0075366_10021721 | 3300006195 | Bacteria | 3731 |
| 215 | Ga0075366_10376802 | 3300006195 | Bacteria | 872 |
| 216 | Ga0097621_100032821 | 3300006237 | Bacteria | 4130 |
| 217 | Ga0097621_100062455 | 3300006237 | Bacteria | 3058 |
| 218 | Ga0097621_100370368 | 3300006237 | Bacteria | 1278 |
| 219 | Ga0075370_10013728 | 3300006353 | Bacteria | 4311 |
| 220 | Ga0075370_10035515 | 3300006353 | Bacteria | 2798 |
| 221 | Ga0068871_100064969 | 3300006358 | Bacteria | 2988 |
| 222 | Ga0068871_100176800 | 3300006358 | Bacteria | 1832 |
| 223 | Ga0075428_100009454 | 3300006844 | Bacteria | 10823 |
| 224 | Ga0075430_100000129 | 3300006846 | Bacteria | 47714 |
| 225 | Ga0075431_100000948 | 3300006847 | Bacteria | 25623 |
| 226 | Ga0075431_100005861 | 3300006847 | Bacteria | 12157 |
| 227 | Ga0075431_100007219 | 3300006847 | Bacteria | 11055 |
| 228 | Ga0075431_100069140 | 3300006847 | Bacteria | 3644 |
| 229 | Ga0075431_100070913 | 3300006847 | Bacteria | 3595 |
| 230 | Ga0075433_10000100 | 3300006852 | Bacteria | 41448 |
| 231 | Ga0075433_10029228 | 3300006852 | Bacteria | 4694 |
| 232 | Ga0075434_100001229 | 3300006871 | Bacteria | 21306 |
| 233 | Ga0075434_100056186 | 3300006871 | Bacteria | 3912 |
| 234 | Ga0075434_100092646 | 3300006871 | Bacteria | 3024 |
| 235 | Ga0075434_100386342 | 3300006871 | Bacteria | 1421 |
| 236 | Ga0075434_100606672 | 3300006871 | Bacteria | 1113 |
| 237 | Ga0075429_100000278 | 3300006880 | Bacteria | 36057 |
| 238 | Ga0075429_100033426 | 3300006880 | Bacteria | 4469 |
| 239 | Ga0075429_100195689 | 3300006880 | Bacteria | 1771 |
| 240 | Ga0068865_100004610 | 3300006881 | Bacteria | 8322 |
| 241 | Ga0075436_100005498 | 3300006914 | Bacteria | 8713 |
| 242 | Ga0075436_100061696 | 3300006914 | Bacteria | 2590 |
| 243 | Ga0075436_100307460 | 3300006914 | Bacteria | 1137 |
| 244 | Ga0097620_100001075 | 3300006931 | Bacteria | 27961 |
| 245 | Ga0097620_100003525 | 3300006931 | Bacteria | 15932 |
| 246 | Ga0097620_100015720 | 3300006931 | Bacteria | 7606 |
| 247 | Ga0097620_100031871 | 3300006931 | Bacteria | 5295 |
| 248 | Ga0097620_100046450 | 3300006931 | Bacteria | 4361 |
| 249 | Ga0075435_100051450 | 3300007076 | Bacteria | 3318 |
| 250 | Ga0075435_100293300 | 3300007076 | Bacteria | 1390 |
| 251 | Ga0075435_100368178 | 3300007076 | Bacteria | 1233 |
| 252 | Ga0099794_10005388 | 3300007265 | Bacteria | 5122 |
| 253 | Ga0099794_10007960 | 3300007265 | Bacteria | 4382 |
| 254 | Ga0099794_10011070 | 3300007265 | Bacteria | 3854 |
| 255 | Ga0099794_10012928 | 3300007265 | Bacteria | 3620 |
| 256 | Ga0099794_10029642 | 3300007265 | Bacteria | 2550 |
| 257 | Ga0099795_10050943 | 3300007788 | Bacteria | 1508 |
| 258 | Ga0105240_10002741 | 3300009093 | Bacteria | 27878 |
| 259 | Ga0111539_10001748 | 3300009094 | Bacteria | 28854 |
| 260 | Ga0111539_10010096 | 3300009094 | Bacteria | 11901 |
| 261 | Ga0105245_10001366 | 3300009098 | Bacteria | 22092 |
| 262 | Ga0105245_10006252 | 3300009098 | Bacteria | 10478 |
| 263 | Ga0105245_10288875 | 3300009098 | Bacteria | 1606 |
| 264 | Ga0105245_10299469 | 3300009098 | Bacteria | 1577 |
| 265 | Ga0105245_10490037 | 3300009098 | Bacteria | 1244 |
| 266 | Ga0105247_10000051 | 3300009101 | Bacteria | 145981 |
| 267 | Ga0105247_10000094 | 3300009101 | Bacteria | 96396 |
| 268 | Ga0105247_10000698 | 3300009101 | Bacteria | 26249 |
| 269 | Ga0105247_10132205 | 3300009101 | Bacteria | 1627 |
| 270 | Ga0114129_10002143 | 3300009147 | Bacteria | 27207 |
| 271 | Ga0114129_10005210 | 3300009147 | Bacteria | 18321 |
| 272 | Ga0114129_10017959 | 3300009147 | Bacteria | 10073 |
| 273 | Ga0114129_10176827 | 3300009147 | Bacteria | 2907 |
| 274 | Ga0114129_10182145 | 3300009147 | Bacteria | 2857 |
| 275 | Ga0105243_10001379 | 3300009148 | Bacteria | 21532 |
| 276 | Ga0105243_10344436 | 3300009148 | Bacteria | 1366 |
| 277 | Ga0105242_10051642 | 3300009176 | Bacteria | 3351 |
| 278 | Ga0105242_10060441 | 3300009176 | Bacteria | 3114 |
| 279 | Ga0105248_10000281 | 3300009177 | Bacteria | 60208 |
| 280 | Ga0105248_10017837 | 3300009177 | Bacteria | 7835 |
| 281 | Ga0105248_10028311 | 3300009177 | Bacteria | 6242 |
| 282 | Ga0105248_10030113 | 3300009177 | Bacteria | 6058 |
| 283 | Ga0105248_10101242 | 3300009177 | Bacteria | 3247 |
| 284 | Ga0105248_10352507 | 3300009177 | Bacteria | 1657 |
| 285 | Ga0105248_10608605 | 3300009177 | Bacteria | 1233 |
| 286 | Ga0105248_10722386 | 3300009177 | Bacteria | 1124 |
| 287 | Ga0105248_11074248 | 3300009177 | Bacteria | 909 |
| 288 | Ga0105237_10007876 | 3300009545 | Bacteria | 11613 |
| 289 | Ga0105237_10048690 | 3300009545 | Bacteria | 4260 |
| 290 | Ga0105237_10087058 | 3300009545 | Bacteria | 3113 |
| 291 | Ga0105238_10000412 | 3300009551 | Bacteria | 45119 |
| 292 | Ga0105238_10055286 | 3300009551 | Bacteria | 3985 |
| 293 | Ga0105238_10266682 | 3300009551 | Bacteria | 1693 |
| 294 | Ga0105249_10000020 | 3300009553 | Bacteria | 260634 |
| 295 | Ga0105249_10008943 | 3300009553 | Bacteria | 8749 |
| 296 | Ga0105249_10009971 | 3300009553 | Bacteria | 8332 |
| 297 | Ga0105239_10066546 | 3300010375 | Bacteria | 3958 |
| 298 | Ga0105239_10163162 | 3300010375 | Bacteria | 2490 |
| 299 | Ga0105239_10305627 | 3300010375 | Bacteria | 1792 |
| 300 | Ga0105239_10318804 | 3300010375 | Bacteria | 1752 |
| 301 | Ga0105246_10035410 | 3300011119 | Bacteria | 3336 |
| 302 | Ga0157370_10067625 | 3300013104 | Bacteria | 3377 |
| 303 | Ga0157370_10219539 | 3300013104 | Bacteria | 1761 |
| 304 | Ga0157374_10003582 | 3300013296 | Bacteria | 13075 |
| 305 | Ga0157374_10038300 | 3300013296 | Bacteria | 4406 |
| 306 | Ga0157378_10012499 | 3300013297 | Bacteria | 7431 |
| 307 | Ga0157378_10536164 | 3300013297 | Bacteria | 1174 |
| 308 | Ga0163162_10002550 | 3300013306 | Bacteria | 17237 |
| 309 | Ga0163162_10030910 | 3300013306 | Bacteria | 5309 |
| 310 | Ga0163162_10062258 | 3300013306 | Bacteria | 3772 |
| 311 | Ga0163162_10226125 | 3300013306 | Bacteria | 2001 |
| 312 | Ga0157372_10006318 | 3300013307 | Bacteria | 12605 |
| 313 | Ga0157372_10018790 | 3300013307 | Bacteria | 7435 |
| 314 | Ga0157372_10053351 | 3300013307 | Bacteria | 4506 |
| 315 | Ga0157372_10072158 | 3300013307 | Bacteria | 3890 |
| 316 | Ga0157372_10287839 | 3300013307 | Bacteria | 1911 |
| 317 | Ga0157372_10576008 | 3300013307 | Bacteria | 1312 |
| 318 | Ga0157375_10000478 | 3300013308 | Bacteria | 36449 |
| 319 | Ga0163163_10136668 | 3300014325 | Bacteria | 2492 |
| 320 | Ga0163163_10243197 | 3300014325 | Bacteria | 1849 |
| 321 | Ga0157380_10000372 | 3300014326 | Bacteria | 26981 |
| 322 | Ga0157377_10013849 | 3300014745 | Bacteria | 4089 |
| 323 | Ga0157379_10000949 | 3300014968 | Bacteria | 23517 |
| 324 | Ga0157379_10008683 | 3300014968 | Bacteria | 8849 |
| 325 | Ga0157379_10019585 | 3300014968 | Bacteria | 5977 |
| 326 | Ga0157379_10029929 | 3300014968 | Bacteria | 4842 |
| 327 | Ga0157379_10908118 | 3300014968 | Bacteria | 836 |
| 328 | Ga0157376_10408572 | 3300014969 | Bacteria | 1314 |
| 329 | Ga0182005_1001434 | 3300015265 | Bacteria | 9601 |
| 330 | Ga0163161_10000595 | 3300017792 | Bacteria | 28928 |
| 331 | Ga0206350_10788292 | 3300020080 | Eukaryota | 1202 |
| 332 | Ga0206354_11469071 | 3300020081 | Eukaryota | 1592 |
| 333 | Ga0206353_10536454 | 3300020082 | Eukaryota | 2645 |
| 334 | Ga0213872_10000430 | 3300021361 | Bacteria | 34377 |
| 335 | Ga0213872_10004434 | 3300021361 | Bacteria | 7457 |
| 336 | Ga0213874_10016992 | 3300021377 | Bacteria | 1945 |
| 337 | Ga0213876_10000150 | 3300021384 | Bacteria | 74357 |
| 338 | Ga0213876_10039528 | 3300021384 | Bacteria | 2493 |
| 339 | Ga0213876_10104246 | 3300021384 | Bacteria | 1504 |
| 340 | Ga0213876_10104480 | 3300021384 | Bacteria | 1502 |
| 341 | Ga0213876_10248192 | 3300021384 | Bacteria | 946 |
| 342 | Ga0224572_1029510 | 3300024225 | Bacteria | 1049 |
| 343 | Ga0209436_100076 | 3300025208 | Bacteria | 50420 |
| 344 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 345 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 346 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 347 | Ga0209672_103283 | 3300025228 | Bacteria | 3421 |
| 348 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 349 | Ga0207427_100759 | 3300025231 | Bacteria | 14690 |
| 350 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 351 | Ga0209026_1007808 | 3300025250 | Bacteria | 2332 |
| 352 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 353 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 354 | Ga0209673_1016009 | 3300025273 | Bacteria | 2821 |
| 355 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 356 | Ga0209130_1000169 | 3300025284 | Bacteria | 95167 |
| 357 | Ga0209025_1000636 | 3300025294 | Bacteria | 62083 |
| 358 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 359 | Ga0209051_1000108 | 3300025303 | Bacteria | 155280 |
| 360 | Ga0209051_1001757 | 3300025303 | Bacteria | 17214 |
| 361 | Ga0209051_1006242 | 3300025303 | Bacteria | 6758 |
| 362 | Ga0209051_1014327 | 3300025303 | Bacteria | 3707 |
| 363 | Ga0207656_10004501 | 3300025321 | Bacteria | 4875 |
| 364 | Ga0207692_10031885 | 3300025898 | Bacteria | 2527 |
| 365 | Ga0207642_10012631 | 3300025899 | Bacteria | 3056 |
| 366 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 367 | Ga0207710_10000119 | 3300025900 | Bacteria | 97053 |
| 368 | Ga0207710_10004339 | 3300025900 | Bacteria | 6204 |
| 369 | Ga0207688_10011321 | 3300025901 | Bacteria | 4857 |
| 370 | Ga0207680_10008954 | 3300025903 | Bacteria | 4938 |
| 371 | Ga0207699_10022200 | 3300025906 | Bacteria | 3435 |
| 372 | Ga0207699_10079399 | 3300025906 | Bacteria | 2030 |
| 373 | Ga0207705_10008048 | 3300025909 | Bacteria | 7727 |
| 374 | Ga0207705_10011917 | 3300025909 | Bacteria | 6283 |
| 375 | Ga0207705_10233019 | 3300025909 | Bacteria | 1401 |
| 376 | Ga0207684_10000062 | 3300025910 | Bacteria | 202863 |
| 377 | Ga0207684_10188291 | 3300025910 | Bacteria | 1780 |
| 378 | Ga0207684_10208174 | 3300025910 | Bacteria | 1687 |
| 379 | Ga0207707_10083655 | 3300025912 | Bacteria | 2786 |
| 380 | Ga0207707_10096556 | 3300025912 | Bacteria | 2583 |
| 381 | Ga0207695_10001360 | 3300025913 | Bacteria | 41481 |
| 382 | Ga0207695_10142162 | 3300025913 | Bacteria | 2347 |
| 383 | Ga0207671_10025042 | 3300025914 | Bacteria | 4484 |
| 384 | Ga0207671_10026071 | 3300025914 | Bacteria | 4385 |
| 385 | Ga0207671_10061967 | 3300025914 | Bacteria | 2776 |
| 386 | Ga0207693_10000430 | 3300025915 | Bacteria | 38189 |
| 387 | Ga0207693_10051634 | 3300025915 | Bacteria | 3226 |
| 388 | Ga0207663_10001439 | 3300025916 | Bacteria | 11063 |
| 389 | Ga0207663_10042206 | 3300025916 | Bacteria | 2786 |
| 390 | Ga0207662_10187750 | 3300025918 | Bacteria | 1332 |
| 391 | Ga0207657_10003181 | 3300025919 | Bacteria | 17566 |
| 392 | Ga0207657_10012688 | 3300025919 | Bacteria | 8304 |
| 393 | Ga0207657_10099109 | 3300025919 | Bacteria | 2421 |
| 394 | Ga0207657_10122545 | 3300025919 | Bacteria | 2138 |
| 395 | Ga0207657_10196992 | 3300025919 | Bacteria | 1622 |
| 396 | Ga0207649_10009529 | 3300025920 | Bacteria | 5316 |
| 397 | Ga0207649_10096139 | 3300025920 | Bacteria | 1951 |
| 398 | Ga0207652_10042590 | 3300025921 | Bacteria | 3865 |
| 399 | Ga0207646_10023510 | 3300025922 | Bacteria | 5660 |
| 400 | Ga0207646_10368900 | 3300025922 | Bacteria | 1297 |
| 401 | Ga0207681_10010378 | 3300025923 | Bacteria | 5699 |
| 402 | Ga0207681_10134276 | 3300025923 | Bacteria | 1834 |
| 403 | Ga0207681_10241198 | 3300025923 | Bacteria | 1407 |
| 404 | Ga0207694_10009212 | 3300025924 | Bacteria | 7449 |
| 405 | Ga0207694_10305647 | 3300025924 | Bacteria | 1310 |
| 406 | Ga0207694_10359904 | 3300025924 | Bacteria | 1206 |
| 407 | Ga0207650_10000032 | 3300025925 | Bacteria | 229538 |
| 408 | Ga0207650_10054123 | 3300025925 | Bacteria | 2976 |
| 409 | Ga0207659_10058015 | 3300025926 | Bacteria | 2778 |
| 410 | Ga0207659_10177343 | 3300025926 | Bacteria | 1685 |
| 411 | Ga0207687_10000803 | 3300025927 | Bacteria | 21200 |
| 412 | Ga0207687_10200019 | 3300025927 | Bacteria | 1561 |
| 413 | Ga0207687_10575766 | 3300025927 | Bacteria | 947 |
| 414 | Ga0207700_10060220 | 3300025928 | Bacteria | 2874 |
| 415 | Ga0207700_10307821 | 3300025928 | Bacteria | 1370 |
| 416 | Ga0207700_10351074 | 3300025928 | Bacteria | 1284 |
| 417 | Ga0207700_10364193 | 3300025928 | Bacteria | 1261 |
| 418 | Ga0207664_10030063 | 3300025929 | Bacteria | 4145 |
| 419 | Ga0207664_10096640 | 3300025929 | Bacteria | 2432 |
| 420 | Ga0207664_10122087 | 3300025929 | Bacteria | 2182 |
| 421 | Ga0207664_10134151 | 3300025929 | Bacteria | 2087 |
| 422 | Ga0207690_10000951 | 3300025932 | Bacteria | 18563 |
| 423 | Ga0207690_10022582 | 3300025932 | Bacteria | 3916 |
| 424 | Ga0207690_10135694 | 3300025932 | Bacteria | 1806 |
| 425 | Ga0207686_10005781 | 3300025934 | Bacteria | 6636 |
| 426 | Ga0207669_10001734 | 3300025937 | Bacteria | 9264 |
| 427 | Ga0207669_10056934 | 3300025937 | Bacteria | 2377 |
| 428 | Ga0207669_10147477 | 3300025937 | Bacteria | 1643 |
| 429 | Ga0207669_10282195 | 3300025937 | Bacteria | 1253 |
| 430 | Ga0207669_10402911 | 3300025937 | Bacteria | 1072 |
| 431 | Ga0207704_10491074 | 3300025938 | Bacteria | 988 |
| 432 | Ga0207665_10399111 | 3300025939 | Bacteria | 1047 |
| 433 | Ga0207711_10000364 | 3300025941 | Bacteria | 48006 |
| 434 | Ga0207711_10006457 | 3300025941 | Bacteria | 9870 |
| 435 | Ga0207711_10020465 | 3300025941 | Bacteria | 5517 |
| 436 | Ga0207711_10084930 | 3300025941 | Bacteria | 2772 |
| 437 | Ga0207711_10459410 | 3300025941 | Bacteria | 1186 |
| 438 | Ga0207689_10046184 | 3300025942 | Bacteria | 3600 |
| 439 | Ga0207661_10066571 | 3300025944 | Bacteria | 2927 |
| 440 | Ga0207661_10420557 | 3300025944 | Bacteria | 1214 |
| 441 | Ga0207661_10669856 | 3300025944 | Bacteria | 954 |
| 442 | Ga0207679_10010560 | 3300025945 | Bacteria | 5952 |
| 443 | Ga0207667_10005399 | 3300025949 | Bacteria | 15585 |
| 444 | Ga0207667_10057635 | 3300025949 | Bacteria | 4077 |
| 445 | Ga0207667_10106634 | 3300025949 | Bacteria | 2890 |
| 446 | Ga0207667_10808803 | 3300025949 | Bacteria | 934 |
| 447 | Ga0207651_10127807 | 3300025960 | Bacteria | 1940 |
| 448 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 449 | Ga0207712_10001841 | 3300025961 | Bacteria | 13983 |
| 450 | Ga0207712_10009907 | 3300025961 | Bacteria | 6039 |
| 451 | Ga0207668_10001136 | 3300025972 | Bacteria | 15864 |
| 452 | Ga0207668_10001570 | 3300025972 | Bacteria | 13369 |
| 453 | Ga0207668_10005253 | 3300025972 | Bacteria | 7618 |
| 454 | Ga0207668_10196416 | 3300025972 | Bacteria | 1603 |
| 455 | Ga0207640_10055576 | 3300025981 | Bacteria | 2594 |
| 456 | Ga0207640_10423210 | 3300025981 | Bacteria | 1090 |
| 457 | Ga0207658_10000116 | 3300025986 | Bacteria | 88456 |
| 458 | Ga0207658_10001232 | 3300025986 | Bacteria | 20240 |
| 459 | Ga0207658_10011465 | 3300025986 | Bacteria | 6032 |
| 460 | Ga0207658_10018175 | 3300025986 | Bacteria | 4850 |
| 461 | Ga0207658_10027964 | 3300025986 | Bacteria | 3967 |
| 462 | Ga0207677_10045702 | 3300026023 | Bacteria | 2925 |
| 463 | Ga0207677_10102788 | 3300026023 | Bacteria | 2108 |
| 464 | Ga0207703_10003382 | 3300026035 | Bacteria | 13397 |
| 465 | Ga0207703_10010738 | 3300026035 | Bacteria | 7148 |
| 466 | Ga0207703_10010789 | 3300026035 | Bacteria | 7128 |
| 467 | Ga0207703_10046150 | 3300026035 | Bacteria | 3508 |
| 468 | Ga0207639_10013486 | 3300026041 | Bacteria | 5721 |
| 469 | Ga0207639_10033277 | 3300026041 | Bacteria | 3801 |
| 470 | Ga0207639_10163353 | 3300026041 | Bacteria | 1879 |
| 471 | Ga0207678_10045277 | 3300026067 | Bacteria | 3806 |
| 472 | Ga0207678_10222501 | 3300026067 | Bacteria | 1616 |
| 473 | Ga0207708_10259785 | 3300026075 | Bacteria | 1402 |
| 474 | Ga0207702_10069233 | 3300026078 | Bacteria | 3033 |
| 475 | Ga0207641_10001609 | 3300026088 | Bacteria | 22047 |
| 476 | Ga0207641_10002816 | 3300026088 | Bacteria | 15822 |
| 477 | Ga0207641_10063518 | 3300026088 | Bacteria | 3154 |
| 478 | Ga0207641_10731733 | 3300026088 | Bacteria | 976 |
| 479 | Ga0207648_10002033 | 3300026089 | Bacteria | 22080 |
| 480 | Ga0207648_10036167 | 3300026089 | Bacteria | 4350 |
| 481 | Ga0207648_10199168 | 3300026089 | Bacteria | 1776 |
| 482 | Ga0207676_10000237 | 3300026095 | Bacteria | 48354 |
| 483 | Ga0207675_100000192 | 3300026118 | Bacteria | 55745 |
| 484 | Ga0207675_100067387 | 3300026118 | Bacteria | 3346 |
| 485 | Ga0207683_10001366 | 3300026121 | Bacteria | 22060 |
| 486 | Ga0207683_10011413 | 3300026121 | Bacteria | 7581 |
| 487 | Ga0207683_10074997 | 3300026121 | Bacteria | 2994 |
| 488 | Ga0207683_10503246 | 3300026121 | Bacteria | 1119 |
| 489 | Ga0207698_10001247 | 3300026142 | Bacteria | 14877 |
| 490 | Ga0207698_10013635 | 3300026142 | Bacteria | 5372 |
| 491 | Ga0207698_10740524 | 3300026142 | Bacteria | 981 |
| 492 | Ga0209588_1006100 | 3300027671 | Bacteria | 3484 |
| 493 | Ga0209588_1009001 | 3300027671 | Bacteria | 2972 |
| 494 | Ga0209974_10051148 | 3300027876 | Bacteria | 1389 |
| 495 | Ga0207428_10000146 | 3300027907 | Bacteria | 95417 |
| 496 | Ga0207428_10027306 | 3300027907 | Bacteria | 4753 |
| 497 | Ga0268266_10001306 | 3300028379 | Bacteria | 30304 |
| 498 | Ga0268266_10001716 | 3300028379 | Bacteria | 25097 |
| 499 | Ga0268266_10049960 | 3300028379 | Bacteria | 3587 |
| 500 | Ga0268266_10121585 | 3300028379 | Bacteria | 2324 |
| 501 | Ga0268265_10000014 | 3300028380 | Bacteria | 330186 |
| 502 | Ga0268265_10001602 | 3300028380 | Bacteria | 18690 |
| 503 | Ga0268265_10008139 | 3300028380 | Bacteria | 7085 |
| 504 | Ga0268264_10000137 | 3300028381 | Bacteria | 176081 |
| 505 | Ga0268264_10000202 | 3300028381 | Bacteria | 121481 |
| 506 | Ga0268264_10019775 | 3300028381 | Bacteria | 5500 |
| 507 | Ga0268264_10022290 | 3300028381 | Bacteria | 5172 |
| 508 | Ga0265319_1056914 | 3300028563 | Bacteria | 1276 |
| 509 | Ga0265318_10002566 | 3300028577 | Bacteria | 9633 |
| 510 | Ga0307511_10081677 | 3300030521 | Bacteria | 2266 |
| 511 | Ga0265325_10000095 | 3300031241 | Bacteria | 62028 |
| 512 | Ga0265325_10003702 | 3300031241 | Bacteria | 9895 |
| 513 | Ga0265340_10074817 | 3300031247 | Bacteria | 1601 |
| 514 | Ga0265339_10108246 | 3300031249 | Bacteria | 1441 |
| 515 | Ga0265327_10000200 | 3300031251 | Bacteria | 125094 |
| 516 | Ga0265327_10000662 | 3300031251 | Bacteria | 55374 |
| 517 | Ga0307513_10116631 | 3300031456 | Bacteria | 2649 |
| 518 | Ga0307408_100032136 | 3300031548 | Bacteria | 3659 |
| 519 | Ga0307408_100037695 | 3300031548 | Bacteria | 3406 |
| 520 | Ga0307408_100143962 | 3300031548 | Bacteria | 1874 |
| 521 | Ga0307408_100353809 | 3300031548 | Bacteria | 1247 |
| 522 | Ga0265313_10000175 | 3300031595 | Bacteria | 68104 |
| 523 | Ga0265313_10010531 | 3300031595 | Bacteria | 5833 |
| 524 | Ga0307508_10145289 | 3300031616 | Bacteria | 1976 |
| 525 | Ga0316575_10092024 | 3300031665 | Bacteria | 1229 |
| 526 | Ga0265314_10144503 | 3300031711 | Bacteria | 1467 |
| 527 | Ga0316576_10007205 | 3300031727 | Bacteria | 6979 |
| 528 | Ga0316576_10267092 | 3300031727 | Bacteria | 1283 |
| 529 | Ga0316578_10007808 | 3300031728 | Bacteria | 5401 |
| 530 | Ga0307516_10003174 | 3300031730 | Bacteria | 21384 |
| 531 | Ga0307516_10225540 | 3300031730 | Bacteria | 1580 |
| 532 | Ga0307405_10014640 | 3300031731 | Bacteria | 4224 |
| 533 | Ga0307405_10023002 | 3300031731 | Bacteria | 3534 |
| 534 | Ga0307413_10006334 | 3300031824 | Bacteria | 5390 |
| 535 | Ga0307413_10019596 | 3300031824 | Bacteria | 3579 |
| 536 | Ga0307413_10154710 | 3300031824 | Bacteria | 1602 |
| 537 | Ga0307413_10254179 | 3300031824 | Bacteria | 1306 |
| 538 | Ga0307410_10112920 | 3300031852 | Bacteria | 1968 |
| 539 | Ga0307406_10013622 | 3300031901 | Bacteria | 4661 |
| 540 | Ga0307406_10032595 | 3300031901 | Bacteria | 3182 |
| 541 | Ga0307406_10049769 | 3300031901 | Bacteria | 2653 |
| 542 | Ga0307406_10175227 | 3300031901 | Bacteria | 1556 |
| 543 | Ga0307406_10321216 | 3300031901 | Bacteria | 1198 |
| 544 | Ga0307407_10001217 | 3300031903 | Bacteria | 9127 |
| 545 | Ga0307412_10008185 | 3300031911 | Bacteria | 5961 |
| 546 | Ga0307412_10063292 | 3300031911 | Bacteria | 2495 |
| 547 | Ga0307412_10125088 | 3300031911 | Bacteria | 1858 |
| 548 | Ga0307409_100000151 | 3300031995 | Bacteria | 26404 |
| 549 | Ga0307409_100024592 | 3300031995 | Bacteria | 4204 |
| 550 | Ga0307409_100406015 | 3300031995 | Bacteria | 1303 |
| 551 | Ga0307409_100767566 | 3300031995 | Bacteria | 969 |
| 552 | Ga0307409_100830785 | 3300031995 | Bacteria | 933 |
| 553 | Ga0307416_100002868 | 3300032002 | Bacteria | 10038 |
| 554 | Ga0307416_100021376 | 3300032002 | Bacteria | 4644 |
| 555 | Ga0307416_100088997 | 3300032002 | Bacteria | 2642 |
| 556 | Ga0307416_100187266 | 3300032002 | Bacteria | 1947 |
| 557 | Ga0307416_100417997 | 3300032002 | Bacteria | 1384 |
| 558 | Ga0307416_100463334 | 3300032002 | Bacteria | 1323 |
| 559 | Ga0307414_10091971 | 3300032004 | Bacteria | 2256 |
| 560 | Ga0307414_10180735 | 3300032004 | Bacteria | 1696 |
| 561 | Ga0307414_10380610 | 3300032004 | Bacteria | 1220 |
| 562 | Ga0307411_10000531 | 3300032005 | Bacteria | 13452 |
| 563 | Ga0307411_10121370 | 3300032005 | Bacteria | 1892 |
| 564 | Ga0307415_100002128 | 3300032126 | Bacteria | 9811 |
| 565 | Ga0307415_100033141 | 3300032126 | Bacteria | 3351 |
| 566 | Ga0307415_100269863 | 3300032126 | Bacteria | 1393 |
| 567 | Ga0307415_100511869 | 3300032126 | Bacteria | 1052 |
| 568 | Ga0307510_10094351 | 3300033180 | Bacteria | 2818 |
| 569 | Ga0373936_0178933 | 3300035113 | Bacteria | 930 |
| 570 | Ga0373953_0004282 | 3300035117 | Bacteria | 4534 |
| 571 | Ga0373957_0012598 | 3300035120 | Bacteria | 2851 |
| 572 | Ga0373957_0022072 | 3300035120 | Bacteria | 2265 |
| 573 | Ga0373946_0065214 | 3300035171 | Bacteria | 1559 |
| 574 | Ga0373955_0008867 | 3300035172 | Bacteria | 4690 |
| 575 | Ga0316574_0014216 | 3300035398 | Bacteria | 4593 |
| 576 | Ga0373931_0201463 | 3300035691 | Bacteria | 1189 |
| 577 | Ga0373935_0477490 | 3300035692 | Bacteria | 903 |
| 578 | Ga0373933_0021746 | 3300035724 | Bacteria | 3647 |
| 579 | Ga0373947_0034853 | 3300035725 | Bacteria | 2978 |
| 580 | Ga0373947_0038147 | 3300035725 | Bacteria | 2853 |
| 581 | Ga0373947_0180842 | 3300035725 | Bacteria | 1373 |
| 582 | Ga0373937_0022515 | 3300036401 | Bacteria | 5666 |
| 583 | Ga0373937_0029111 | 3300036401 | Bacteria | 5001 |
| 584 | Ga0373937_0046708 | 3300036401 | Bacteria | 3960 |
| 585 | Ga0373937_0176476 | 3300036401 | Bacteria | 2006 |
| 586 | Ga0316582_0010884 | 3300036647 | Bacteria | 5005 |
| 587 | Ga0316582_0047849 | 3300036647 | Bacteria | 2702 |
| 588 | Ga0316584_0000425 | 3300036712 | Bacteria | 22007 |
| 589 | Ga0316584_0362992 | 3300036712 | Bacteria | 1038 |
| 590 | Ga0373925_0015304 | 3300037068 | Bacteria | 5547 |
| 591 | Ga0395899_0002806 | 3300037312 | Bacteria | 14038 |
| 592 | Ga0395899_0003641 | 3300037312 | Bacteria | 12200 |
| 593 | Ga0395899_0003830 | 3300037312 | Bacteria | 11871 |
| 594 | Ga0395899_0011850 | 3300037312 | Bacteria | 6675 |
| 595 | Ga0395899_0017676 | 3300037312 | Bacteria | 5432 |
| 596 | Ga0395899_0073563 | 3300037312 | Bacteria | 2498 |
| 597 | Ga0395900_0014022 | 3300037418 | Bacteria | 8184 |
| 598 | Ga0395900_0016004 | 3300037418 | Bacteria | 7642 |
| 599 | Ga0395900_0028256 | 3300037418 | Bacteria | 5746 |
| 600 | Ga0395900_0034856 | 3300037418 | Bacteria | 5185 |
| 601 | Ga0395900_0056359 | 3300037418 | Bacteria | 4045 |
| 602 | Ga0395900_0138864 | 3300037418 | Bacteria | 2489 |
| 603 | Ga0395900_0319114 | 3300037418 | Bacteria | 1534 |
| 604 | Ga0395900_0596007 | 3300037418 | Bacteria | 1046 |
| 605 | Ga0395898_0004724 | 3300037466 | Bacteria | 14826 |
| 606 | Ga0395898_0006941 | 3300037466 | Bacteria | 12036 |
| 607 | Ga0395898_0020590 | 3300037466 | Bacteria | 6699 |
| 608 | Ga0395898_0094612 | 3300037466 | Bacteria | 2871 |
| 609 | Ga0395905_0010442 | 3300037471 | Bacteria | 9034 |
| 610 | Ga0395905_0010661 | 3300037471 | Bacteria | 8915 |
| 611 | Ga0395905_0013127 | 3300037471 | Bacteria | 7952 |
| 612 | Ga0395905_0030081 | 3300037471 | Bacteria | 5118 |
| 613 | Ga0395905_0047862 | 3300037471 | Bacteria | 4007 |
| 614 | Ga0395905_0095371 | 3300037471 | Bacteria | 2792 |
| 615 | Ga0395905_0242218 | 3300037471 | Bacteria | 1685 |
| 616 | Ga0395901_0008586 | 3300038443 | Bacteria | 10326 |
| 617 | Ga0395901_0091572 | 3300038443 | Bacteria | 3183 |
| 618 | Ga0395901_0127664 | 3300038443 | Bacteria | 2673 |
| 619 | Ga0395901_0199617 | 3300038443 | Bacteria | 2097 |
| 620 | Ga0395901_0606202 | 3300038443 | Bacteria | 1104 |
| 621 | Ga0400490_39147 | 3300038726 | Bacteria | 1505 |
| 622 | Ga0400490_42507 | 3300038726 | Bacteria | 7064 |
| 623 | Ga0400488_33533 | 3300038741 | Bacteria | 1399 |
| 624 | Ga0400488_46326 | 3300038741 | Unclassified | 1686 |
| 625 | Ga0400486_05058 | 3300038742 | Bacteria | 11068 |
| 626 | Ga0400483_269206 | 3300039062 | Bacteria | 85448 |
| 627 | Ga0400487_15433 | 3300039110 | Bacteria | 4403 |
| 628 | Ga0436365_1083994 | 3300039437 | Bacteria | 225582 |
| 629 | Ga0436365_1178839 | 3300039437 | Bacteria | 4209 |
| 630 | Ga0436365_1247886 | 3300039437 | Bacteria | 61397 |
| 631 | Ga0436365_1463057 | 3300039437 | Bacteria | 8209 |
| 632 | Ga0436365_1709394 | 3300039437 | Bacteria | 51419 |
| 633 | Ga0436365_1830770 | 3300039437 | Bacteria | 1032 |
| 634 | Ga0436360_0382408 | 3300039438 | Bacteria | 2144 |
| 635 | Ga0436360_0993747 | 3300039438 | Bacteria | 5104 |
| 636 | Ga0436360_1007975 | 3300039438 | Bacteria | 1211 |
| 637 | Ga0436361_0009051 | 3300039447 | Bacteria | 7525 |
| 638 | Ga0436361_0013073 | 3300039447 | Bacteria | 17617 |
| 639 | Ga0436361_0362627 | 3300039447 | Bacteria | 2784 |
| 640 | Ga0436361_0576744 | 3300039447 | Bacteria | 2939 |
| 641 | Ga0436363_1641698 | 3300039450 | Bacteria | 4115 |
| 642 | Ga0436362_0979548 | 3300039453 | Bacteria | 1118 |
| 643 | Ga0439453_0000704 | 3300041408 | Bacteria | 3846 |
| 644 | Ga0439465_0002245 | 3300041413 | Bacteria | 6346 |
| 645 | Ga0439465_0002436 | 3300041413 | Bacteria | 6088 |
| 646 | Ga0439465_0034013 | 3300041413 | Bacteria | 1631 |
| 647 | Ga0451807_1428362 | 3300041486 | Bacteria | 2064 |
| 648 | Ga0451835_0159614 | 3300041492 | Bacteria | 1124 |
| 649 | Ga0451849_0460671 | 3300041505 | Bacteria | 5861 |
| 650 | Ga0451853_0197269 | 3300041512 | Bacteria | 27774 |
| 651 | Ga0451853_2327740 | 3300041512 | Bacteria | 1213 |
| 652 | Ga0439431_0002763 | 3300041997 | Bacteria | 3862 |
| 653 | Ga0439443_005046 | 3300042003 | Bacteria | 1751 |
| 654 | Ga0439448_0011129 | 3300042005 | Bacteria | 2677 |
| 655 | Ga0439460_0006884 | 3300042461 | Bacteria | 2832 |
| 656 | Ga0451577_0029833 | 3300042876 | Bacteria | 4928 |
| 657 | Ga0451577_0042019 | 3300042876 | Bacteria | 4102 |
| 658 | Ga0466969_0000361 | 3300044656 | Bacteria | 24953 |
| 659 | Ga0466969_0112099 | 3300044656 | Bacteria | 1276 |
| 660 | Ga0466972_0000420 | 3300044658 | Bacteria | 22023 |
| 661 | Ga0466972_0039574 | 3300044658 | Bacteria | 2300 |
| 662 | Ga0466972_0090765 | 3300044658 | Bacteria | 1449 |
| 663 | Ga0466973_0035531 | 3300044659 | Bacteria | 4736 |
| 664 | Ga0466982_0188692 | 3300044672 | Bacteria | 1242 |
| 665 | Ga0453683_0003486 | 3300044673 | Bacteria | 11575 |
| 666 | Ga0453683_0058594 | 3300044673 | Bacteria | 2409 |
| 667 | Ga0466965_0007481 | 3300044683 | Bacteria | 5020 |
| 668 | Ga0466965_0022045 | 3300044683 | Bacteria | 3070 |
| 669 | Ga0466965_0171766 | 3300044683 | Bacteria | 1141 |
| 670 | Ga0466966_0007793 | 3300044684 | Bacteria | 7091 |
| 671 | Ga0466966_0013203 | 3300044684 | Bacteria | 5470 |
| 672 | Ga0466966_0124291 | 3300044684 | Bacteria | 1583 |
| 673 | Ga0466961_0006278 | 3300044693 | Bacteria | 7548 |
| 674 | Ga0466961_0008364 | 3300044693 | Bacteria | 6589 |
| 675 | Ga0466963_0004494 | 3300044694 | Bacteria | 8111 |
| 676 | Ga0466963_0022728 | 3300044694 | Bacteria | 3975 |
| 677 | Ga0466963_0048518 | 3300044694 | Bacteria | 2806 |
| 678 | Ga0466963_0142438 | 3300044694 | Bacteria | 1661 |
| 679 | Ga0466964_0007346 | 3300044706 | Bacteria | 4120 |
| 680 | Ga0466964_0048901 | 3300044706 | Bacteria | 1730 |
| 681 | Ga0453684_0093446 | 3300044712 | Bacteria | 3705 |
| 682 | Ga0466971_0022214 | 3300044719 | Bacteria | 2826 |
| 683 | Ga0466971_0044289 | 3300044719 | Bacteria | 1998 |
| 684 | Ga0466971_0105567 | 3300044719 | Bacteria | 1297 |
| 685 | Ga0466971_0136595 | 3300044719 | Bacteria | 1140 |
| 686 | Ga0466968_0006767 | 3300044735 | Bacteria | 4335 |
| 687 | Ga0466968_0037819 | 3300044735 | Bacteria | 2026 |
| 688 | Ga0466968_0131601 | 3300044735 | Bacteria | 1139 |
| 689 | Ga0466970_0006849 | 3300044765 | Bacteria | 5705 |
| 690 | Ga0466970_0087619 | 3300044765 | Bacteria | 1688 |
| 691 | Ga0466970_0115331 | 3300044765 | Bacteria | 1469 |
| 692 | Ga0466970_0126654 | 3300044765 | Bacteria | 1401 |
| 693 | Ga0466970_0149468 | 3300044765 | Bacteria | 1289 |
| 694 | Ga0466957_0005590 | 3300044842 | Bacteria | 7064 |
| 695 | Ga0466957_0014795 | 3300044842 | Bacteria | 4546 |
| 696 | Ga0466957_0035342 | 3300044842 | Bacteria | 2999 |
| 697 | Ga0466957_0078937 | 3300044842 | Bacteria | 2047 |
| 698 | Ga0466960_0004284 | 3300044901 | Bacteria | 5560 |
| 699 | Ga0466960_0018539 | 3300044901 | Bacteria | 3052 |
| 700 | Ga0466960_0313706 | 3300044901 | Bacteria | 886 |
| 701 | Ga0466959_0105705 | 3300045049 | Bacteria | 2013 |
| 702 | Ga0451576_0271998 | 3300045051 | Bacteria | 1771 |
| 703 | Ga0451576_0456792 | 3300045051 | Bacteria | 1341 |
| 704 | Ga0451576_0580614 | 3300045051 | Bacteria | 1178 |
| 705 | Ga0451576_0584523 | 3300045051 | Bacteria | 1174 |
| 706 | Ga0466958_0012293 | 3300045836 | Bacteria | 4847 |
| 707 | Ga0466958_0026343 | 3300045836 | Bacteria | 3436 |
| 708 | Ga0466958_0052237 | 3300045836 | Bacteria | 2477 |
| 709 | Ga0466958_0053315 | 3300045836 | Bacteria | 2451 |
| 710 | Ga0466958_0105658 | 3300045836 | Bacteria | 1755 |
| 711 | Ga0466967_0001683 | 3300045976 | Bacteria | 13124 |
| 712 | Ga0466967_0034747 | 3300045976 | Bacteria | 4283 |
| 713 | Ga0466967_0090115 | 3300045976 | Bacteria | 2786 |
| 714 | Ga0466967_0150992 | 3300045976 | Bacteria | 2171 |
| 715 | Ga0466967_0210863 | 3300045976 | Bacteria | 1842 |
| 716 | Ga0466967_0316134 | 3300045976 | Bacteria | 1505 |
| 717 | Ga0466967_0550476 | 3300045976 | Bacteria | 1136 |
| 718 | Ga0495617_013481 | 3300046452 | Bacteria | 2782 |
| 719 | Ga0495592_0002825 | 3300046454 | Bacteria | 12317 |
| 720 | Ga0495592_0003233 | 3300046454 | Bacteria | 11679 |
| 721 | Ga0495590_0102318 | 3300046457 | Bacteria | 1018 |
| 722 | Ga0495629_0065721 | 3300046459 | Bacteria | 2531 |
| 723 | Ga0495638_0000806 | 3300046460 | Bacteria | 33072 |
| 724 | Ga0495638_0005942 | 3300046460 | Bacteria | 8959 |
| 725 | Ga0495638_0023484 | 3300046460 | Bacteria | 4032 |
| 726 | Ga0495641_0036978 | 3300046461 | Bacteria | 2291 |
| 727 | Ga0495651_0240611 | 3300046462 | Bacteria | 1241 |
| 728 | Ga0495653_0029750 | 3300046463 | Bacteria | 4355 |
| 729 | Ga0495650_0001749 | 3300046471 | Bacteria | 19780 |
| 730 | Ga0495580_0002602 | 3300046472 | Bacteria | 15676 |
| 731 | Ga0495580_0009043 | 3300046472 | Bacteria | 7860 |
| 732 | Ga0495582_0138772 | 3300046473 | Bacteria | 1377 |
| 733 | Ga0495605_0004251 | 3300046474 | Bacteria | 8439 |
| 734 | Ga0495639_0022709 | 3300046475 | Bacteria | 2753 |
| 735 | Ga0495664_0033641 | 3300046477 | Bacteria | 3013 |
| 736 | Ga0495584_0023449 | 3300046491 | Bacteria | 3128 |
| 737 | Ga0495584_0051818 | 3300046491 | Bacteria | 2066 |
| 738 | Ga0495584_0080751 | 3300046491 | Bacteria | 1636 |
| 739 | Ga0495585_0039691 | 3300046492 | Bacteria | 2645 |
| 740 | Ga0495607_0015975 | 3300046501 | Bacteria | 4852 |
| 741 | Ga0495607_0024047 | 3300046501 | Bacteria | 3804 |
| 742 | Ga0495606_0135680 | 3300046507 | Bacteria | 1458 |
| 743 | Ga0495608_0012925 | 3300046511 | Bacteria | 5795 |
| 744 | Ga0495608_0057345 | 3300046511 | Bacteria | 2570 |
| 745 | Ga0495616_0000632 | 3300046513 | Bacteria | 26334 |
| 746 | Ga0495616_0033528 | 3300046513 | Bacteria | 2674 |
| 747 | Ga0495628_0000382 | 3300046516 | Bacteria | 40502 |
| 748 | Ga0495628_0005505 | 3300046516 | Bacteria | 11083 |
| 749 | Ga0495630_0323515 | 3300046517 | Bacteria | 1179 |
| 750 | Ga0495630_0361060 | 3300046517 | Bacteria | 1112 |
| 751 | Ga0495643_0049663 | 3300046522 | Bacteria | 2262 |
| 752 | Ga0495652_0049004 | 3300046529 | Bacteria | 3617 |
| 753 | Ga0495654_0161137 | 3300046530 | Bacteria | 985 |
| 754 | Ga0495665_0010196 | 3300046531 | Bacteria | 5091 |
| 755 | Ga0495587_0008211 | 3300046536 | Bacteria | 6726 |
| 756 | Ga0495598_0000136 | 3300046537 | Bacteria | 12449 |
| 757 | Ga0495609_0000676 | 3300046538 | Bacteria | 26334 |
| 758 | Ga0495621_0058145 | 3300046539 | Bacteria | 1398 |
| 759 | Ga0495597_0000833 | 3300046542 | Bacteria | 24241 |
| 760 | Ga0495645_0016724 | 3300046543 | Bacteria | 5246 |
| 761 | Ga0495645_0096766 | 3300046543 | Bacteria | 2103 |
| 762 | Ga0495633_0015374 | 3300046558 | Bacteria | 3971 |
| 763 | Ga0495633_0021245 | 3300046558 | Bacteria | 3249 |
| 764 | Ga0495633_0125421 | 3300046558 | Eukaryota | 1188 |
| 765 | Ga0495667_0003376 | 3300046559 | Bacteria | 10682 |
| 766 | Ga0495667_0048852 | 3300046559 | Bacteria | 2793 |
| 767 | Ga0495667_0135039 | 3300046559 | Bacteria | 1590 |
| 768 | Ga0495668_0167437 | 3300046616 | Bacteria | 1204 |
| 769 | Ga0495625_0011811 | 3300046660 | Bacteria | 7094 |
| 770 | Ga0495635_0006033 | 3300046663 | Bacteria | 8450 |
| 771 | Ga0495661_0000938 | 3300046665 | Bacteria | 26522 |
| 772 | Ga0495661_0103364 | 3300046665 | Bacteria | 1599 |
| 773 | Ga0495657_0048208 | 3300046675 | Bacteria | 2875 |
| 774 | Ga0495657_0158375 | 3300046675 | Bacteria | 1402 |
| 775 | Ga0495599_0002274 | 3300046678 | Bacteria | 11183 |
| 776 | Ga0495599_0032804 | 3300046678 | Bacteria | 3260 |
| 777 | Ga0495623_0059789 | 3300046679 | Bacteria | 2392 |
| 778 | Ga0495646_0086011 | 3300046680 | Bacteria | 1824 |
| 779 | Ga0495646_0109155 | 3300046680 | Bacteria | 1577 |
| 780 | Ga0495658_0220436 | 3300046683 | Bacteria | 1187 |
| 781 | Ga0495624_0032247 | 3300046690 | Bacteria | 3398 |
| 782 | Ga0495670_0000859 | 3300046691 | Bacteria | 14714 |
| 783 | Ga0495671_0123346 | 3300046692 | Bacteria | 1263 |
| 784 | Ga0495589_0000532 | 3300046794 | Bacteria | 26669 |
| 785 | Ga0495600_0008938 | 3300046809 | Bacteria | 6172 |
| 786 | Ga0495600_0015355 | 3300046809 | Bacteria | 4841 |
| 787 | Ga0495604_0006062 | 3300047317 | Bacteria | 9591 |
| 788 | Ga0495604_0199964 | 3300047317 | Bacteria | 1387 |
| 789 | Ga0495604_0408292 | 3300047317 | Bacteria | 893 |
| 790 | Ga0495674_0040893 | 3300047319 | Bacteria | 4144 |
| 791 | Ga0495680_0049405 | 3300047322 | Bacteria | 3294 |
| 792 | Ga0495687_000132 | 3300047443 | Bacteria | 114685 |
| 793 | Ga0495687_000308 | 3300047443 | Bacteria | 64153 |
| 794 | Ga0495687_010094 | 3300047443 | Bacteria | 5206 |
| 795 | Ga0495675_0046893 | 3300047444 | Bacteria | 2750 |
| 796 | Ga0495675_0048115 | 3300047444 | Bacteria | 2713 |
| 797 | Ga0495677_0000191 | 3300047445 | Bacteria | 28406 |
| 798 | Ga0495673_0057964 | 3300047469 | Bacteria | 1671 |
| 799 | Ga0495684_0016220 | 3300047471 | Bacteria | 5736 |
| 800 | Ga0495684_0275400 | 3300047471 | Bacteria | 1216 |
| 801 | Ga0495686_0002311 | 3300047472 | Bacteria | 18236 |
| 802 | Ga0495686_0113726 | 3300047472 | Bacteria | 1620 |
| 803 | Ga0495602_0002983 | 3300048088 | Bacteria | 17354 |
| 804 | Ga0495602_0045260 | 3300048088 | Bacteria | 3983 |
| 805 | Ga0495626_0004263 | 3300048091 | Bacteria | 8832 |
| 806 | Ga0496100_0000110 | 3300048903 | Bacteria | 47145 |
| 807 | Ga0496100_0000412 | 3300048903 | Bacteria | 20666 |
| 808 | Ga0496100_0058186 | 3300048903 | Bacteria | 2535 |
| 809 | Ga0496100_0586719 | 3300048903 | Bacteria | 864 |
| 810 | Ga0496101_0000054 | 3300048904 | Bacteria | 137699 |
| 811 | Ga0496101_0000073 | 3300048904 | Bacteria | 113870 |
| 812 | Ga0496101_0009780 | 3300048904 | Bacteria | 6316 |
| 813 | Ga0496101_0011053 | 3300048904 | Bacteria | 5980 |
| 814 | Ga0496101_0036664 | 3300048904 | Bacteria | 3474 |
| 815 | Ga0496101_0082532 | 3300048904 | Bacteria | 2379 |
| 816 | Ga0496101_0136930 | 3300048904 | Bacteria | 1864 |
| 817 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 818 | Ga0496102_0000118 | 3300048905 | Bacteria | 113499 |
| 819 | Ga0496102_0001687 | 3300048905 | Bacteria | 19374 |
| 820 | Ga0496102_0006452 | 3300048905 | Bacteria | 10003 |
| 821 | Ga0496102_0018330 | 3300048905 | Bacteria | 6149 |
| 822 | Ga0496102_0019560 | 3300048905 | Bacteria | 5964 |
| 823 | Ga0496102_0026398 | 3300048905 | Bacteria | 5180 |
| 824 | Ga0496102_0056000 | 3300048905 | Bacteria | 3596 |
| 825 | Ga0496102_0149145 | 3300048905 | Bacteria | 2196 |
| 826 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 827 | Ga0496103_0000129 | 3300048906 | Bacteria | 81081 |
| 828 | Ga0496103_0000945 | 3300048906 | Bacteria | 20803 |
| 829 | Ga0496103_0001200 | 3300048906 | Bacteria | 17782 |
| 830 | Ga0496103_0014319 | 3300048906 | Bacteria | 4710 |
| 831 | Ga0496104_0003117 | 3300048907 | Bacteria | 14295 |
| 832 | Ga0496104_0235693 | 3300048907 | Bacteria | 1742 |
| 833 | Ga0496104_0279574 | 3300048907 | Bacteria | 1582 |
| 834 | Ga0496105_0000168 | 3300048908 | Bacteria | 43805 |
| 835 | Ga0496105_0066343 | 3300048908 | Bacteria | 2979 |
| 836 | Ga0496105_0283123 | 3300048908 | Bacteria | 1336 |
| 837 | Ga0496105_0295665 | 3300048908 | Bacteria | 1303 |
| 838 | Ga0496106_0000901 | 3300048909 | Bacteria | 21691 |
| 839 | Ga0496106_0002231 | 3300048909 | Bacteria | 14449 |
| 840 | Ga0496106_0020313 | 3300048909 | Bacteria | 4929 |
| 841 | Ga0496106_0068643 | 3300048909 | Bacteria | 2704 |
| 842 | Ga0496106_0334040 | 3300048909 | Bacteria | 1217 |
| 843 | Ga0496107_0000261 | 3300048910 | Bacteria | 28034 |
| 844 | Ga0496107_0000264 | 3300048910 | Bacteria | 27701 |
| 845 | Ga0496107_0097149 | 3300048910 | Bacteria | 2156 |
| 846 | Ga0496108_0014047 | 3300048911 | Bacteria | 6533 |
| 847 | Ga0496108_0016290 | 3300048911 | Bacteria | 6062 |
| 848 | Ga0496108_0020733 | 3300048911 | Bacteria | 5403 |
| 849 | Ga0496108_0600533 | 3300048911 | Bacteria | 959 |
| 850 | Ga0496109_0000152 | 3300048912 | Bacteria | 68036 |
| 851 | Ga0496109_0019674 | 3300048912 | Bacteria | 5955 |
| 852 | Ga0496109_0061711 | 3300048912 | Bacteria | 3428 |
| 853 | Ga0496109_0352244 | 3300048912 | Bacteria | 1391 |
| 854 | Ga0496109_0645810 | 3300048912 | Bacteria | 995 |
| 855 | Ga0496110_0001576 | 3300048913 | Bacteria | 16638 |
| 856 | Ga0496110_0028547 | 3300048913 | Bacteria | 4794 |
| 857 | Ga0496110_0029709 | 3300048913 | Bacteria | 4707 |
| 858 | Ga0496110_0060603 | 3300048913 | Bacteria | 3338 |
| 859 | Ga0496111_0035267 | 3300048914 | Bacteria | 3574 |
| 860 | Ga0496111_0099170 | 3300048914 | Bacteria | 2139 |
| 861 | Ga0496111_0155845 | 3300048914 | Bacteria | 1695 |
| 862 | Ga0496112_0002426 | 3300048915 | Bacteria | 15009 |
| 863 | Ga0496112_0184279 | 3300048915 | Bacteria | 2051 |
| 864 | Ga0496112_0264862 | 3300048915 | Bacteria | 1668 |
| 865 | Ga0496113_0039155 | 3300048916 | Bacteria | 3489 |
| 866 | Ga0496114_0000047 | 3300048917 | Bacteria | 119106 |
| 867 | Ga0496114_0002699 | 3300048917 | Bacteria | 13559 |
| 868 | Ga0496114_0038083 | 3300048917 | Bacteria | 3978 |
| 869 | Ga0496114_0067999 | 3300048917 | Bacteria | 2990 |
| 870 | Ga0496114_0274679 | 3300048917 | Bacteria | 1485 |
| 871 | Ga0496114_0663166 | 3300048917 | Bacteria | 917 |
| 872 | Ga0496115_0006427 | 3300048918 | Bacteria | 8611 |
| 873 | Ga0496115_0021228 | 3300048918 | Bacteria | 5014 |
| 874 | Ga0496115_0047070 | 3300048918 | Bacteria | 3448 |
| 875 | Ga0496115_0129077 | 3300048918 | Bacteria | 2083 |
| 876 | Ga0496115_0508164 | 3300048918 | Bacteria | 968 |
| 877 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 878 | Ga0496116_0000968 | 3300048919 | Bacteria | 35439 |
| 879 | Ga0496116_0003154 | 3300048919 | Bacteria | 16511 |
| 880 | Ga0496116_0005030 | 3300048919 | Bacteria | 12443 |
| 881 | Ga0496116_0008933 | 3300048919 | Unclassified | 8617 |
| 882 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 883 | Ga0496117_0001082 | 3300048920 | Bacteria | 41248 |
| 884 | Ga0496117_0027062 | 3300048920 | Bacteria | 4475 |
| 885 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 886 | Ga0496118_0001016 | 3300048921 | Bacteria | 43635 |
| 887 | Ga0496118_0001424 | 3300048921 | Bacteria | 36051 |
| 888 | Ga0496119_0000041 | 3300048922 | Bacteria | 203687 |
| 889 | Ga0496119_0000514 | 3300048922 | Bacteria | 52716 |
| 890 | Ga0496119_0001956 | 3300048922 | Bacteria | 23443 |
| 891 | Ga0496119_0012066 | 3300048922 | Bacteria | 7062 |
| 892 | Ga0496120_0000027 | 3300048923 | Bacteria | 231507 |
| 893 | Ga0496120_0000224 | 3300048923 | Bacteria | 97511 |
| 894 | Ga0496120_0014259 | 3300048923 | Bacteria | 5304 |
| 895 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 896 | Ga0496121_0002353 | 3300048924 | Bacteria | 29156 |
| 897 | Ga0496121_0002460 | 3300048924 | Bacteria | 28275 |
| 898 | Ga0496122_0000313 | 3300048925 | Bacteria | 107106 |
| 899 | Ga0496122_0035029 | 3300048925 | Bacteria | 4095 |
| 900 | Ga0496122_0035956 | 3300048925 | Eukaryota | 4017 |
| 901 | Ga0496123_0006622 | 3300048926 | Bacteria | 11185 |
| 902 | Ga0496123_0020859 | 3300048926 | Bacteria | 5110 |
| 903 | Ga0496124_0000117 | 3300048927 | Bacteria | 164439 |
| 904 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 905 | Ga0496125_0000368 | 3300048928 | Bacteria | 84924 |
| 906 | Ga0496125_0024119 | 3300048928 | Bacteria | 5600 |
| 907 | Ga0496125_0159015 | 3300048928 | Eukaryota | 1538 |
| 908 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 909 | Ga0496126_0001241 | 3300048929 | Bacteria | 41382 |
| 910 | Ga0496126_0001576 | 3300048929 | Bacteria | 34867 |
| 911 | Ga0496126_0005051 | 3300048929 | Bacteria | 15319 |
| 912 | Ga0496126_0053450 | 3300048929 | Bacteria | 3665 |
| 913 | Ga0496126_0291949 | 3300048929 | Bacteria | 1348 |
| 914 | Ga0501032_0001371 | 3300049569 | Bacteria | 19327 |
| 915 | Ga0501032_0003212 | 3300049569 | Bacteria | 12566 |
| 916 | Ga0501032_0034563 | 3300049569 | Bacteria | 3460 |
| 917 | Ga0501032_0087365 | 3300049569 | Bacteria | 2071 |
| 918 | Ga0501032_0097164 | 3300049569 | Bacteria | 1952 |
| 919 | Ga0501033_0072360 | 3300049570 | Bacteria | 2531 |
| 920 | Ga0501033_0145944 | 3300049570 | Bacteria | 1709 |
| 921 | Ga0501033_0185289 | 3300049570 | Bacteria | 1491 |
| 922 | Ga0501034_0003796 | 3300049571 | Bacteria | 17047 |
| 923 | Ga0501034_0013153 | 3300049571 | Bacteria | 8527 |
| 924 | Ga0501034_0055948 | 3300049571 | Bacteria | 3970 |
| 925 | Ga0501034_0229872 | 3300049571 | Bacteria | 1804 |
| 926 | Ga0501034_0241354 | 3300049571 | Bacteria | 1753 |
| 927 | Ga0501036_0034199 | 3300049572 | Bacteria | 4299 |
| 928 | Ga0501036_0059121 | 3300049572 | Bacteria | 3248 |
| 929 | Ga0501037_0001970 | 3300049573 | Bacteria | 14855 |
| 930 | Ga0501037_0031564 | 3300049573 | Bacteria | 3911 |
| 931 | Ga0501037_0147918 | 3300049573 | Bacteria | 1680 |
| 932 | Ga0501038_0004393 | 3300049574 | Bacteria | 13119 |
| 933 | Ga0501038_0071518 | 3300049574 | Bacteria | 2942 |
| 934 | Ga0501039_0003456 | 3300049575 | Bacteria | 11798 |
| 935 | Ga0501039_0380556 | 3300049575 | Bacteria | 1109 |
| 936 | Ga0501039_0615209 | 3300049575 | Bacteria | 851 |
| 937 | Ga0501042_0092040 | 3300049578 | Bacteria | 2177 |
| 938 | Ga0501043_0002321 | 3300049579 | Bacteria | 16107 |
| 939 | Ga0501043_0003123 | 3300049579 | Bacteria | 13737 |
| 940 | Ga0501046_0005675 | 3300049580 | Bacteria | 11140 |
| 941 | Ga0501047_0000707 | 3300049581 | Bacteria | 34754 |
| 942 | Ga0501047_0027950 | 3300049581 | Bacteria | 5437 |
| 943 | Ga0501047_0038850 | 3300049581 | Bacteria | 4604 |
| 944 | Ga0501047_0044212 | 3300049581 | Bacteria | 4303 |
| 945 | Ga0501047_0243678 | 3300049581 | Bacteria | 1647 |
| 946 | Ga0501047_0243871 | 3300049581 | Bacteria | 1646 |
| 947 | Ga0501048_0023055 | 3300049582 | Bacteria | 4550 |
| 948 | Ga0501069_0005747 | 3300049585 | Bacteria | 6465 |
| 949 | Ga0501069_0014362 | 3300049585 | Bacteria | 4233 |
| 950 | Ga0501069_0066502 | 3300049585 | Bacteria | 2016 |
| 951 | Ga0501069_0165411 | 3300049585 | Bacteria | 1275 |
| 952 | Ga0501070_0000288 | 3300049586 | Bacteria | 47185 |
| 953 | Ga0501070_0002522 | 3300049586 | Bacteria | 16054 |
| 954 | Ga0501070_0024274 | 3300049586 | Bacteria | 5084 |
| 955 | Ga0501071_0008824 | 3300049587 | Bacteria | 6683 |
| 956 | Ga0501073_0005128 | 3300049589 | Bacteria | 9830 |
| 957 | Ga0501073_0021631 | 3300049589 | Bacteria | 4635 |
| 958 | Ga0501073_0044334 | 3300049589 | Bacteria | 3135 |
| 959 | Ga0501073_0056698 | 3300049589 | Bacteria | 2740 |
| 960 | Ga0501074_0036287 | 3300049590 | Bacteria | 3571 |
| 961 | Ga0501075_0075742 | 3300049591 | Bacteria | 2544 |
| 962 | Ga0501075_0303622 | 3300049591 | Bacteria | 1216 |
| 963 | Ga0501076_0003829 | 3300049592 | Bacteria | 10597 |
| 964 | Ga0501076_0011669 | 3300049592 | Bacteria | 6558 |
| 965 | Ga0501076_0069712 | 3300049592 | Bacteria | 2810 |
| 966 | Ga0501077_0003493 | 3300049593 | Bacteria | 9437 |
| 967 | Ga0501077_0158856 | 3300049593 | Bacteria | 1435 |
| 968 | Ga0501079_0168591 | 3300049741 | Bacteria | 1707 |
| 969 | Ga0501080_0020331 | 3300049742 | Bacteria | 6144 |
| 970 | Ga0501080_0101408 | 3300049742 | Bacteria | 2670 |
| 971 | Ga0501081_0002149 | 3300049743 | Bacteria | 12350 |
| 972 | Ga0501083_0015161 | 3300049744 | Bacteria | 5396 |
| 973 | Ga0501083_0022643 | 3300049744 | Bacteria | 4360 |
| 974 | Ga0501083_0134476 | 3300049744 | Bacteria | 1620 |
| 975 | Ga0501035_0001318 | 3300049822 | Bacteria | 25624 |
| 976 | Ga0501035_0001771 | 3300049822 | Bacteria | 21793 |
| 977 | Ga0501035_0033079 | 3300049822 | Bacteria | 4702 |
| 978 | Ga0501035_0328769 | 3300049822 | Bacteria | 1283 |
| 979 | Ga0501035_0546014 | 3300049822 | Bacteria | 950 |
| 980 | Ga0501035_0633865 | 3300049822 | Bacteria | 868 |
| 981 | Ga0501044_0000554 | 3300049823 | Bacteria | 45441 |
| 982 | Ga0501044_0002733 | 3300049823 | Bacteria | 20064 |
| 983 | Ga0501044_0032103 | 3300049823 | Bacteria | 5521 |
| 984 | Ga0501044_0068070 | 3300049823 | Bacteria | 3627 |
| 985 | Ga0501044_0156297 | 3300049823 | Bacteria | 2260 |
| 986 | Ga0501044_0159904 | 3300049823 | Bacteria | 2230 |
| 987 | Ga0501044_0376558 | 3300049823 | Bacteria | 1335 |
| 988 | Ga0501044_0455494 | 3300049823 | Bacteria | 1185 |
| 989 | nmdc:mga03n38_21264_c1 | 3300050490 | Bacteria | 2608 |
| 990 | nmdc:mga00v17_31853_c1 | 3300050491 | Bacteria | 3112 |
| 991 | nmdc:mga00v17_344296_c1 | 3300050491 | Bacteria | 969 |
| 992 | nmdc:mga00v17_35825_c1 | 3300050491 | Bacteria | 2955 |
| 993 | nmdc:mga00v17_78318_c1 | 3300050491 | Bacteria | 2059 |
| 994 | nmdc:mga0yw44_18995_c1 | 3300050492 | Bacteria | 3780 |
| 995 | nmdc:mga0yw44_29042_c1 | 3300050492 | Bacteria | 3188 |
| 996 | nmdc:mga0k408_21552_c1 | 3300050493 | Bacteria | 3620 |
| 997 | nmdc:mga0k408_27049_c1 | 3300050493 | Bacteria | 3255 |
| 998 | nmdc:mga0k408_292544_c1 | 3300050493 | Bacteria | 972 |
| 999 | nmdc:mga0k408_69753_c1 | 3300050493 | Bacteria | 2052 |
| 1000 | nmdc:mga06z11_336241_c1 | 3300050494 | Bacteria | 902 |
| 1001 | nmdc:mga06z11_41715_c1 | 3300050494 | Bacteria | 2297 |
| 1002 | nmdc:mga07m45_1217_c1 | 3300050496 | Bacteria | 11669 |
| 1003 | nmdc:mga07m45_14092_c1 | 3300050496 | Bacteria | 4253 |
| 1004 | nmdc:mga07m45_27607_c1 | 3300050496 | Bacteria | 3128 |
| 1005 | nmdc:mga05p37_111_c2 | 3300050507 | Bacteria | 41438 |
| 1006 | nmdc:mga05p37_39065_c1 | 3300050507 | Bacteria | 5823 |
| 1007 | nmdc:mga05p37_52524_c1 | 3300050507 | Bacteria | 5012 |
| 1008 | nmdc:mga09592_137_c1 | 3300050508 | Bacteria | 48140 |
| 1009 | nmdc:mga09592_453402_c1 | 3300050508 | Bacteria | 1106 |
| 1010 | nmdc:mga09592_52342_c1 | 3300050508 | Bacteria | 3446 |
| 1011 | nmdc:mga0qj67_2255_c1 | 3300050509 | Bacteria | 13705 |
| 1012 | nmdc:mga06r32_526_c1 | 3300050510 | Bacteria | 33031 |
| 1013 | nmdc:mga06r32_84304_c1 | 3300050510 | Bacteria | 3097 |
| 1014 | nmdc:mga08y16_1030_c1 | 3300050511 | Bacteria | 27341 |
| 1015 | nmdc:mga08y16_99425_c1 | 3300050511 | Bacteria | 3029 |
| 1016 | nmdc:mga0n895_113213_c1 | 3300050512 | Bacteria | 2731 |
| 1017 | nmdc:mga0n895_331_c1 | 3300050512 | Bacteria | 31576 |
| 1018 | nmdc:mga0n895_92853_c1 | 3300050512 | Bacteria | 3021 |
| 1019 | nmdc:mga0rr50_115322_c1 | 3300050513 | Bacteria | 2132 |
| 1020 | nmdc:mga0rr50_269932_c1 | 3300050513 | Bacteria | 1417 |
| 1021 | nmdc:mga0rr50_326208_c1 | 3300050513 | Bacteria | 1288 |
| 1022 | nmdc:mga0rr50_5720_c1 | 3300050513 | Bacteria | 7453 |
| 1023 | nmdc:mga0rr50_60211_c1 | 3300050513 | Bacteria | 2193 |
| 1024 | nmdc:mga08x19_19120_c1 | 3300050514 | Bacteria | 4202 |
| 1025 | nmdc:mga08x19_424352_c1 | 3300050514 | Bacteria | 934 |
| 1026 | nmdc:mga08x19_55348_c1 | 3300050514 | Bacteria | 2557 |
| 1027 | nmdc:mga0a205_423009_c1 | 3300050515 | Bacteria | 1194 |
| 1028 | nmdc:mga0a205_50_c1 | 3300050515 | Bacteria | 64126 |
| 1029 | nmdc:mga0a205_96288_c1 | 3300050515 | Bacteria | 2859 |
| 1030 | nmdc:mga0sz30_3889_c1 | 3300050516 | Bacteria | 5385 |
| 1031 | nmdc:mga0sz30_8058_c1 | 3300050516 | Bacteria | 3969 |
| 1032 | Ga0495601_0017212 | 3300053077 | Bacteria | 4387 |
| 1033 | Ga0495612_0006121 | 3300053078 | Bacteria | 4952 |
| 1034 | Ga0500610_0005980 | 3300053079 | Bacteria | 5051 |
| 1035 | Ga0500635_0072227 | 3300053080 | Bacteria | 1226 |
| 1036 | Ga0495595_0002756 | 3300053084 | Bacteria | 6903 |
| 1037 | Ga0495595_0095490 | 3300053084 | Bacteria | 1430 |
| 1038 | Ga0495619_0000461 | 3300053085 | Bacteria | 27459 |
| 1039 | Ga0495619_0029565 | 3300053085 | Bacteria | 3541 |
| 1040 | Ga0495619_0178295 | 3300053085 | Bacteria | 1470 |
| 1041 | Ga0500643_007238 | 3300053087 | Bacteria | 4516 |
| 1042 | Ga0500643_014858 | 3300053087 | Bacteria | 2688 |
| 1043 | Ga0500647_0010299 | 3300053091 | Bacteria | 4132 |
| 1044 | Ga0500651_0029835 | 3300053093 | Bacteria | 3431 |
| 1045 | Ga0500641_0026956 | 3300053096 | Bacteria | 2235 |
| 1046 | Ga0500556_0021621 | 3300053104 | Bacteria | 2077 |
| 1047 | Ga0500595_002529 | 3300053119 | Bacteria | 8976 |
| 1048 | Ga0500595_006795 | 3300053119 | Bacteria | 4818 |
| 1049 | Ga0500595_018072 | 3300053119 | Bacteria | 2586 |
| 1050 | Ga0500574_003599 | 3300053141 | Bacteria | 2770 |
| 1051 | Ga0500588_0006984 | 3300053146 | Bacteria | 2585 |
| 1052 | Ga0500645_000046 | 3300053730 | Bacteria | 106127 |
| 1053 | Ga0501084_0003046 | 3300054114 | Bacteria | 13583 |
| 1054 | Ga0501084_0109277 | 3300054114 | Bacteria | 2323 |
| 1055 | Ga0501084_0390617 | 3300054114 | Bacteria | 1176 |
| 1056 | Ga0587090_000758 | 3300059510 | Bacteria | 2920 |
| 1057 | Ga0587109_032831 | 3300059624 | Eukaryota | 994 |
| 1058 | Ga0587114_016201 | 3300059655 | Eukaryota | 996 |
| 1059 | Ga0587118_04109 | 3300059657 | Eukaryota | 999 |
| 1060 | Ga0501082_0013704 | 3300060353 | Bacteria | 6969 |
| 1061 | Ga0501082_0203133 | 3300060353 | Bacteria | 1724 |
| 1062 | Ga0501082_0368015 | 3300060353 | Bacteria | 1254 |
| 1063 | Ga0501082_0606004 | 3300060353 | Bacteria | 958 |
| 1064 | Ga0466962_0013821 | 3300061719 | Bacteria | 3886 |
| 1065 | Ga0466962_0024354 | 3300061719 | Bacteria | 2907 |
| 1066 | Ga0466962_0099574 | 3300061719 | Bacteria | 1396 |
| 1067 | Ga0466962_0247926 | 3300061719 | Bacteria | 875 |
| 1068 | Ga0530510_0355470 | 3300061734 | Bacteria | 1101 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006058 | Ga0075432_10012711 | Ga0075432_100127113 | 201 |
| 2 | 3300006847 | Ga0075431_100005861 | Ga0075431_10000586110 | 201 |
| 3 | 3300006852 | Ga0075433_10029228 | Ga0075433_100292286 | 201 |
| 4 | 3300006914 | Ga0075436_100005498 | Ga0075436_1000054983 | 201 |
| 5 | 3300007076 | Ga0075435_100051450 | Ga0075435_1000514504 | 201 |
| 6 | 3300027907 | Ga0207428_10027306 | Ga0207428_100273065 | 201 |
| 7 | 3300006028 | Ga0070717_10255901 | Ga0070717_102559012 | 203 |
| 8 | 3300006880 | Ga0075429_100195689 | Ga0075429_1001956892 | 203 |
| 9 | 3300009094 | Ga0111539_10010096 | Ga0111539_1001009611 | 203 |
| 10 | 3300009147 | Ga0114129_10182145 | Ga0114129_101821452 | 203 |
| 11 | 3300025928 | Ga0207700_10351074 | Ga0207700_103510742 | 203 |
| 12 | 3300046559 | Ga0495667_0135039 | Ga0495667_0135039_507_1145 | 203 |
| 13 | 3300047471 | Ga0495684_0275400 | Ga0495684_0275400_331_969 | 203 |
| 14 | 3300050507 | nmdc:mga05p37_52524_c1 | nmdc:mga05p37_52524_c1_1827_2465 | 203 |
| 15 | 3300050511 | nmdc:mga08y16_99425_c1 | nmdc:mga08y16_99425_c1_1303_1941 | 203 |
| 16 | 3300050512 | nmdc:mga0n895_113213_c1 | nmdc:mga0n895_113213_c1_1827_2465 | 203 |
| 17 | 3300050513 | nmdc:mga0rr50_115322_c1 | nmdc:mga0rr50_115322_c1_1170_1808 | 203 |
| 18 | 3300050514 | nmdc:mga08x19_19120_c1 | nmdc:mga08x19_19120_c1_1008_1646 | 203 |
| 19 | 3300050515 | nmdc:mga0a205_96288_c1 | nmdc:mga0a205_96288_c1_395_1033 | 203 |
| 20 | 3300053085 | Ga0495619_0178295 | Ga0495619_0178295_399_1037 | 203 |
| 21 | 3300035113 | Ga0373936_0178933 | Ga0373936_0178933_222_917 | 222 |
| 22 | 3300006028 | Ga0070717_10021477 | Ga0070717_100214774 | 224 |
| 23 | 3300005518 | Ga0070699_100262805 | Ga0070699_1002628051 | 225 |
| 24 | 3300006178 | Ga0075367_10110737 | Ga0075367_101107372 | 225 |
| 25 | 3300006195 | Ga0075366_10003168 | Ga0075366_100031687 | 225 |
| 26 | 3300048911 | Ga0496108_0600533 | Ga0496108_0600533_11_691 | 225 |
| 27 | 3300048912 | Ga0496109_0645810 | Ga0496109_0645810_11_691 | 225 |
| 28 | 3300050493 | nmdc:mga0k408_69753_c1 | nmdc:mga0k408_69753_c1_70_873 | 225 |
| 29 | 3300050494 | nmdc:mga06z11_41715_c1 | nmdc:mga06z11_41715_c1_690_1475 | 225 |
| 30 | 3300009101 | Ga0105247_10000094 | Ga0105247_1000009474 | 227 |
| 31 | 3300009177 | Ga0105248_10028311 | Ga0105248_100283113 | 227 |
| 32 | 3300014968 | Ga0157379_10029929 | Ga0157379_100299299 | 227 |
| 33 | 3300025900 | Ga0207710_10000119 | Ga0207710_1000011975 | 227 |
| 34 | 3300025941 | Ga0207711_10020465 | Ga0207711_100204652 | 227 |
| 35 | 3300048922 | Ga0496119_0000514 | Ga0496119_0000514_24047_24880 | 227 |
| 36 | 3300048923 | Ga0496120_0000224 | Ga0496120_0000224_68857_69690 | 227 |
| 37 | 3300006847 | Ga0075431_100007219 | Ga0075431_1000072195 | 230 |
| 38 | 3300009147 | Ga0114129_10017959 | Ga0114129_100179596 | 230 |
| 39 | 3300009147 | Ga0114129_10176827 | Ga0114129_101768274 | 230 |
| 40 | 3300049578 | Ga0501042_0092040 | Ga0501042_0092040_180_971 | 230 |
| 41 | 3300049587 | Ga0501071_0008824 | Ga0501071_0008824_3150_3941 | 230 |
| 42 | 3300049591 | Ga0501075_0303622 | Ga0501075_0303622_301_1092 | 230 |
| 43 | 3300049592 | Ga0501076_0069712 | Ga0501076_0069712_411_1202 | 230 |
| 44 | 3300049742 | Ga0501080_0020331 | Ga0501080_0020331_3573_4364 | 230 |
| 45 | 3300050507 | nmdc:mga05p37_39065_c1 | nmdc:mga05p37_39065_c1_2496_3260 | 230 |
| 46 | 3300005985 | Ga0081539_10050344 | Ga0081539_100503442 | 231 |
| 47 | 3300048904 | Ga0496101_0082532 | Ga0496101_0082532_1060_1824 | 232 |
| 48 | 3300048905 | Ga0496102_0001687 | Ga0496102_0001687_8024_8857 | 232 |
| 49 | 3300048906 | Ga0496103_0014319 | Ga0496103_0014319_2985_3818 | 232 |
| 50 | 3300048909 | Ga0496106_0334040 | Ga0496106_0334040_333_1097 | 232 |
| 51 | 3300048913 | Ga0496110_0060603 | Ga0496110_0060603_2472_3236 | 232 |
| 52 | 3300053096 | Ga0500641_0026956 | Ga0500641_0026956_1415_2200 | 236 |
| 53 | 3300006847 | Ga0075431_100069140 | Ga0075431_1000691404 | 238 |
| 54 | 3300006880 | Ga0075429_100033426 | Ga0075429_1000334264 | 238 |
| 55 | 3300050508 | nmdc:mga09592_52342_c1 | nmdc:mga09592_52342_c1_1366_2139 | 238 |
| 56 | 3300005355 | Ga0070671_100087697 | Ga0070671_1000876971 | 240 |
| 57 | 3300002739 | JGI25158J39367_1002218 | JGI25158J39367_10022183 | 245 |
| 58 | 3300002987 | JGI25159J45721_1000001 | JGI25159J45721_1000001109 | 245 |
| 59 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_1000002202 | 245 |
| 60 | 3300003374 | JGI25161J50226_1002505 | JGI25161J50226_10025053 | 245 |
| 61 | 3300004625 | Ga0055543_1000010 | Ga0055543_1000010182 | 245 |
| 62 | 3300005262 | Ga0065165_1000004 | Ga0065165_1000004177 | 245 |
| 63 | 3300025208 | Ga0209436_100076 | Ga0209436_10007647 | 245 |
| 64 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008341 | 245 |
| 65 | 3300025302 | Ga0207426_1000016 | Ga0207426_1000016221 | 245 |
| 66 | 3300037418 | Ga0395900_0016004 | Ga0395900_0016004_2687_3451 | 245 |
| 67 | 3300037466 | Ga0395898_0006941 | Ga0395898_0006941_5301_6065 | 245 |
| 68 | 3300038443 | Ga0395901_0008586 | Ga0395901_0008586_5363_6127 | 245 |
| 69 | iso_pu_bacteria | 2515154189 | 2516017650 | 245 |
| 70 | iso_pu_bacteria | 3006978542 | 3006983057 | 245 |
| 71 | iso_pu_bacteria | 8004021418 | 8004023879 | 245 |
| 72 | 3300006173 | Ga0070716_100305982 | Ga0070716_1003059821 | 246 |
| 73 | 3300028563 | Ga0265319_1056914 | Ga0265319_10569142 | 246 |
| 74 | 3300028577 | Ga0265318_10002566 | Ga0265318_100025667 | 246 |
| 75 | 3300041492 | Ga0451835_0159614 | Ga0451835_0159614_202_996 | 246 |
| 76 | 3300041505 | Ga0451849_0460671 | Ga0451849_0460671_3386_4180 | 246 |
| 77 | 3300041512 | Ga0451853_0197269 | Ga0451853_0197269_6808_7602 | 246 |
| 78 | iso_pu_bacteria | 2919051321 | 2919053951 | 246 |
| 79 | 3300005356 | Ga0070674_100127923 | Ga0070674_1001279232 | 247 |
| 80 | 3300005364 | Ga0070673_100336251 | Ga0070673_1003362512 | 247 |
| 81 | 3300005459 | Ga0068867_100260392 | Ga0068867_1002603922 | 247 |
| 82 | 3300021384 | Ga0213876_10104246 | Ga0213876_101042462 | 247 |
| 83 | 3300026089 | Ga0207648_10199168 | Ga0207648_101991682 | 247 |
| 84 | 3300031824 | Ga0307413_10254179 | Ga0307413_102541791 | 247 |
| 85 | 3300036712 | Ga0316584_0362992 | Ga0316584_0362992_187_957 | 247 |
| 86 | 3300039437 | Ga0436365_1463057 | Ga0436365_1463057_2267_3031 | 247 |
| 87 | 3300046683 | Ga0495658_0220436 | Ga0495658_0220436_388_1152 | 247 |
| 88 | iso_pu_bacteria | 2920879853 | 2920880505 | 247 |
| 89 | 3300005327 | Ga0070658_10003541 | Ga0070658_100035419 | 248 |
| 90 | 3300005338 | Ga0068868_100216232 | Ga0068868_1002162321 | 248 |
| 91 | 3300005343 | Ga0070687_100289269 | Ga0070687_1002892691 | 248 |
| 92 | 3300005344 | Ga0070661_100161357 | Ga0070661_1001613571 | 248 |
| 93 | 3300005345 | Ga0070692_10000346 | Ga0070692_100003463 | 248 |
| 94 | 3300005354 | Ga0070675_100059478 | Ga0070675_1000594783 | 248 |
| 95 | 3300005356 | Ga0070674_100350332 | Ga0070674_1003503321 | 248 |
| 96 | 3300005444 | Ga0070694_100000117 | Ga0070694_10000011721 | 248 |
| 97 | 3300005444 | Ga0070694_100203760 | Ga0070694_1002037602 | 248 |
| 98 | 3300005445 | Ga0070708_100017079 | Ga0070708_1000170793 | 248 |
| 99 | 3300005445 | Ga0070708_100070754 | Ga0070708_1000707543 | 248 |
| 100 | 3300005445 | Ga0070708_100262095 | Ga0070708_1002620952 | 248 |
| 101 | 3300005456 | Ga0070678_100054293 | Ga0070678_1000542933 | 248 |
| 102 | 3300005456 | Ga0070678_100600170 | Ga0070678_1006001701 | 248 |
| 103 | 3300005457 | Ga0070662_100203518 | Ga0070662_1002035182 | 248 |
| 104 | 3300005458 | Ga0070681_10188930 | Ga0070681_101889303 | 248 |
| 105 | 3300005459 | Ga0068867_100096189 | Ga0068867_1000961892 | 248 |
| 106 | 3300005468 | Ga0070707_100313297 | Ga0070707_1003132972 | 248 |
| 107 | 3300005471 | Ga0070698_100063592 | Ga0070698_1000635922 | 248 |
| 108 | 3300005518 | Ga0070699_100244679 | Ga0070699_1002446791 | 248 |
| 109 | 3300005530 | Ga0070679_100161498 | Ga0070679_1001614981 | 248 |
| 110 | 3300005536 | Ga0070697_100006640 | Ga0070697_1000066408 | 248 |
| 111 | 3300005539 | Ga0068853_100047221 | Ga0068853_1000472213 | 248 |
| 112 | 3300005545 | Ga0070695_100219480 | Ga0070695_1002194802 | 248 |
| 113 | 3300005547 | Ga0070693_100012908 | Ga0070693_1000129084 | 248 |
| 114 | 3300005547 | Ga0070693_100166395 | Ga0070693_1001663952 | 248 |
| 115 | 3300005548 | Ga0070665_100609506 | Ga0070665_1006095062 | 248 |
| 116 | 3300005549 | Ga0070704_100004068 | Ga0070704_1000040685 | 248 |
| 117 | 3300005614 | Ga0068856_100719261 | Ga0068856_1007192612 | 248 |
| 118 | 3300005616 | Ga0068852_100004074 | Ga0068852_1000040742 | 248 |
| 119 | 3300006028 | Ga0070717_10049176 | Ga0070717_100491762 | 248 |
| 120 | 3300006028 | Ga0070717_10200199 | Ga0070717_102001992 | 248 |
| 121 | 3300006051 | Ga0075364_10008968 | Ga0075364_100089682 | 248 |
| 122 | 3300006195 | Ga0075366_10021721 | Ga0075366_100217212 | 248 |
| 123 | 3300006237 | Ga0097621_100032821 | Ga0097621_1000328215 | 248 |
| 124 | 3300006358 | Ga0068871_100064969 | Ga0068871_1000649692 | 248 |
| 125 | 3300006871 | Ga0075434_100092646 | Ga0075434_1000926462 | 248 |
| 126 | 3300006914 | Ga0075436_100061696 | Ga0075436_1000616962 | 248 |
| 127 | 3300007076 | Ga0075435_100293300 | Ga0075435_1002933002 | 248 |
| 128 | 3300007076 | Ga0075435_100368178 | Ga0075435_1003681782 | 248 |
| 129 | 3300007265 | Ga0099794_10005388 | Ga0099794_100053882 | 248 |
| 130 | 3300007265 | Ga0099794_10011070 | Ga0099794_100110703 | 248 |
| 131 | 3300007265 | Ga0099794_10029642 | Ga0099794_100296422 | 248 |
| 132 | 3300009093 | Ga0105240_10002741 | Ga0105240_1000274123 | 248 |
| 133 | 3300009176 | Ga0105242_10060441 | Ga0105242_100604412 | 248 |
| 134 | 3300009177 | Ga0105248_10101242 | Ga0105248_101012422 | 248 |
| 135 | 3300013104 | Ga0157370_10067625 | Ga0157370_100676252 | 248 |
| 136 | 3300013297 | Ga0157378_10536164 | Ga0157378_105361641 | 248 |
| 137 | 3300013306 | Ga0163162_10030910 | Ga0163162_100309102 | 248 |
| 138 | 3300013307 | Ga0157372_10287839 | Ga0157372_102878392 | 248 |
| 139 | 3300025321 | Ga0207656_10004501 | Ga0207656_100045012 | 248 |
| 140 | 3300025909 | Ga0207705_10233019 | Ga0207705_102330192 | 248 |
| 141 | 3300025912 | Ga0207707_10096556 | Ga0207707_100965562 | 248 |
| 142 | 3300025913 | Ga0207695_10001360 | Ga0207695_1000136034 | 248 |
| 143 | 3300025920 | Ga0207649_10096139 | Ga0207649_100961392 | 248 |
| 144 | 3300025922 | Ga0207646_10368900 | Ga0207646_103689002 | 248 |
| 145 | 3300025924 | Ga0207694_10305647 | Ga0207694_103056471 | 248 |
| 146 | 3300025927 | Ga0207687_10575766 | Ga0207687_105757661 | 248 |
| 147 | 3300025929 | Ga0207664_10134151 | Ga0207664_101341512 | 248 |
| 148 | 3300025937 | Ga0207669_10282195 | Ga0207669_102821952 | 248 |
| 149 | 3300025937 | Ga0207669_10402911 | Ga0207669_104029112 | 248 |
| 150 | 3300025944 | Ga0207661_10669856 | Ga0207661_106698562 | 248 |
| 151 | 3300025949 | Ga0207667_10005399 | Ga0207667_100053993 | 248 |
| 152 | 3300025960 | Ga0207651_10127807 | Ga0207651_101278072 | 248 |
| 153 | 3300025981 | Ga0207640_10423210 | Ga0207640_104232102 | 248 |
| 154 | 3300026035 | Ga0207703_10046150 | Ga0207703_100461503 | 248 |
| 155 | 3300026075 | Ga0207708_10259785 | Ga0207708_102597852 | 248 |
| 156 | 3300026078 | Ga0207702_10069233 | Ga0207702_100692333 | 248 |
| 157 | 3300026089 | Ga0207648_10036167 | Ga0207648_100361675 | 248 |
| 158 | 3300026121 | Ga0207683_10074997 | Ga0207683_100749973 | 248 |
| 159 | 3300026142 | Ga0207698_10013635 | Ga0207698_100136352 | 248 |
| 160 | 3300027671 | Ga0209588_1006100 | Ga0209588_10061002 | 248 |
| 161 | 3300028379 | Ga0268266_10121585 | Ga0268266_101215853 | 248 |
| 162 | 3300031616 | Ga0307508_10145289 | Ga0307508_101452891 | 248 |
| 163 | 3300031911 | Ga0307412_10063292 | Ga0307412_100632922 | 248 |
| 164 | 3300032002 | Ga0307416_100088997 | Ga0307416_1000889973 | 248 |
| 165 | 3300032002 | Ga0307416_100187266 | Ga0307416_1001872661 | 248 |
| 166 | 3300032002 | Ga0307416_100463334 | Ga0307416_1004633341 | 248 |
| 167 | 3300032126 | Ga0307415_100511869 | Ga0307415_1005118692 | 248 |
| 168 | 3300035691 | Ga0373931_0201463 | Ga0373931_0201463_76_843 | 248 |
| 169 | 3300036401 | Ga0373937_0176476 | Ga0373937_0176476_959_1726 | 248 |
| 170 | 3300037312 | Ga0395899_0073563 | Ga0395899_0073563_1514_2293 | 248 |
| 171 | 3300037418 | Ga0395900_0138864 | Ga0395900_0138864_58_837 | 248 |
| 172 | 3300037466 | Ga0395898_0094612 | Ga0395898_0094612_440_1219 | 248 |
| 173 | 3300038726 | Ga0400490_39147 | Ga0400490_39147_457_1221 | 248 |
| 174 | 3300038726 | Ga0400490_42507 | Ga0400490_42507_3181_3945 | 248 |
| 175 | 3300038741 | Ga0400488_33533 | Ga0400488_33533_287_1051 | 248 |
| 176 | 3300038741 | Ga0400488_46326 | Ga0400488_46326_525_1289 | 248 |
| 177 | 3300038742 | Ga0400486_05058 | Ga0400486_05058_2767_3531 | 248 |
| 178 | 3300039062 | Ga0400483_269206 | Ga0400483_269206_79418_80182 | 248 |
| 179 | 3300039110 | Ga0400487_15433 | Ga0400487_15433_1711_2475 | 248 |
| 180 | 3300042876 | Ga0451577_0042019 | Ga0451577_0042019_1498_2265 | 248 |
| 181 | 3300046616 | Ga0495668_0167437 | Ga0495668_0167437_149_919 | 248 |
| 182 | 3300048912 | Ga0496109_0061711 | Ga0496109_0061711_184_954 | 248 |
| 183 | 3300048913 | Ga0496110_0028547 | Ga0496110_0028547_1226_1993 | 248 |
| 184 | 3300048914 | Ga0496111_0155845 | Ga0496111_0155845_894_1667 | 248 |
| 185 | 3300049585 | Ga0501069_0005747 | Ga0501069_0005747_4855_5622 | 248 |
| 186 | 3300049586 | Ga0501070_0024274 | Ga0501070_0024274_651_1418 | 248 |
| 187 | 3300049589 | Ga0501073_0005128 | Ga0501073_0005128_4624_5391 | 248 |
| 188 | 3300049590 | Ga0501074_0036287 | Ga0501074_0036287_1965_2732 | 248 |
| 189 | 3300049744 | Ga0501083_0015161 | Ga0501083_0015161_88_855 | 248 |
| 190 | 3300049822 | Ga0501035_0546014 | Ga0501035_0546014_88_855 | 248 |
| 191 | 3300049823 | Ga0501044_0156297 | Ga0501044_0156297_970_1737 | 248 |
| 192 | 3300049823 | Ga0501044_0376558 | Ga0501044_0376558_290_1057 | 248 |
| 193 | 3300050491 | nmdc:mga00v17_78318_c1 | nmdc:mga00v17_78318_c1_392_1159 | 248 |
| 194 | 3300050493 | nmdc:mga0k408_21552_c1 | nmdc:mga0k408_21552_c1_2842_3609 | 248 |
| 195 | 3300050493 | nmdc:mga0k408_27049_c1 | nmdc:mga0k408_27049_c1_2126_2893 | 248 |
| 196 | 3300050512 | nmdc:mga0n895_92853_c1 | nmdc:mga0n895_92853_c1_586_1353 | 248 |
| 197 | 3300050513 | nmdc:mga0rr50_326208_c1 | nmdc:mga0rr50_326208_c1_239_1006 | 248 |
| 198 | 3300050514 | nmdc:mga08x19_55348_c1 | nmdc:mga08x19_55348_c1_212_979 | 248 |
| 199 | 3300060353 | Ga0501082_0203133 | Ga0501082_0203133_502_1269 | 248 |
| 200 | iso_pu_bacteria | 2582581314 | 2585318077 | 248 |
| 201 | iso_pu_bacteria | 2643221617 | 2644099794 | 248 |
| 202 | iso_pu_bacteria | 2643221620 | 2644117401 | 248 |
| 203 | 3300006173 | Ga0070716_100334580 | Ga0070716_1003345801 | 249 |
| 204 | 3300006914 | Ga0075436_100307460 | Ga0075436_1003074602 | 249 |
| 205 | 3300007265 | Ga0099794_10007960 | Ga0099794_100079602 | 249 |
| 206 | 3300007265 | Ga0099794_10012928 | Ga0099794_100129282 | 249 |
| 207 | 3300007788 | Ga0099795_10050943 | Ga0099795_100509432 | 249 |
| 208 | 3300009147 | Ga0114129_10005210 | Ga0114129_1000521013 | 249 |
| 209 | 3300027671 | Ga0209588_1009001 | Ga0209588_10090011 | 249 |
| 210 | 3300030521 | Ga0307511_10081677 | Ga0307511_100816772 | 249 |
| 211 | 3300031730 | Ga0307516_10003174 | Ga0307516_100031743 | 249 |
| 212 | 3300031730 | Ga0307516_10225540 | Ga0307516_102255402 | 249 |
| 213 | 3300031901 | Ga0307406_10321216 | Ga0307406_103212161 | 249 |
| 214 | 3300032126 | Ga0307415_100269863 | Ga0307415_1002698632 | 249 |
| 215 | 3300033180 | Ga0307510_10094351 | Ga0307510_100943512 | 249 |
| 216 | 3300042876 | Ga0451577_0029833 | Ga0451577_0029833_32_808 | 249 |
| 217 | 3300044673 | Ga0453683_0058594 | Ga0453683_0058594_266_1159 | 249 |
| 218 | 3300050510 | nmdc:mga06r32_84304_c1 | nmdc:mga06r32_84304_c1_1692_2483 | 249 |
| 219 | 3300050513 | nmdc:mga0rr50_269932_c1 | nmdc:mga0rr50_269932_c1_444_1220 | 249 |
| 220 | 3300050515 | nmdc:mga0a205_423009_c1 | nmdc:mga0a205_423009_c1_260_1036 | 249 |
| 221 | 3300005327 | Ga0070658_10025550 | Ga0070658_100255502 | 250 |
| 222 | 3300005327 | Ga0070658_10040353 | Ga0070658_100403531 | 250 |
| 223 | 3300005339 | Ga0070660_100243003 | Ga0070660_1002430032 | 250 |
| 224 | 3300005339 | Ga0070660_100382068 | Ga0070660_1003820682 | 250 |
| 225 | 3300005366 | Ga0070659_100110797 | Ga0070659_1001107972 | 250 |
| 226 | 3300005467 | Ga0070706_100000386 | Ga0070706_10000038626 | 250 |
| 227 | 3300005468 | Ga0070707_100086462 | Ga0070707_1000864623 | 250 |
| 228 | 3300005530 | Ga0070679_100031622 | Ga0070679_1000316224 | 250 |
| 229 | 3300005530 | Ga0070679_100356591 | Ga0070679_1003565911 | 250 |
| 230 | 3300005535 | Ga0070684_100171621 | Ga0070684_1001716212 | 250 |
| 231 | 3300005536 | Ga0070697_100004974 | Ga0070697_1000049747 | 250 |
| 232 | 3300005539 | Ga0068853_100204631 | Ga0068853_1002046312 | 250 |
| 233 | 3300005563 | Ga0068855_100047049 | Ga0068855_1000470492 | 250 |
| 234 | 3300006237 | Ga0097621_100062455 | Ga0097621_1000624553 | 250 |
| 235 | 3300006237 | Ga0097621_100370368 | Ga0097621_1003703682 | 250 |
| 236 | 3300006871 | Ga0075434_100056186 | Ga0075434_1000561864 | 250 |
| 237 | 3300009098 | Ga0105245_10288875 | Ga0105245_102888752 | 250 |
| 238 | 3300013307 | Ga0157372_10018790 | Ga0157372_100187904 | 250 |
| 239 | 3300013307 | Ga0157372_10053351 | Ga0157372_100533512 | 250 |
| 240 | 3300013307 | Ga0157372_10072158 | Ga0157372_100721582 | 250 |
| 241 | 3300014969 | Ga0157376_10408572 | Ga0157376_104085722 | 250 |
| 242 | 3300025909 | Ga0207705_10008048 | Ga0207705_100080488 | 250 |
| 243 | 3300025909 | Ga0207705_10011917 | Ga0207705_100119172 | 250 |
| 244 | 3300025910 | Ga0207684_10000062 | Ga0207684_1000006226 | 250 |
| 245 | 3300025915 | Ga0207693_10051634 | Ga0207693_100516344 | 250 |
| 246 | 3300025919 | Ga0207657_10003181 | Ga0207657_100031814 | 250 |
| 247 | 3300025919 | Ga0207657_10099109 | Ga0207657_100991092 | 250 |
| 248 | 3300025919 | Ga0207657_10196992 | Ga0207657_101969922 | 250 |
| 249 | 3300025922 | Ga0207646_10023510 | Ga0207646_100235107 | 250 |
| 250 | 3300025932 | Ga0207690_10135694 | Ga0207690_101356942 | 250 |
| 251 | 3300025944 | Ga0207661_10420557 | Ga0207661_104205572 | 250 |
| 252 | 3300025949 | Ga0207667_10106634 | Ga0207667_101066342 | 250 |
| 253 | 3300026041 | Ga0207639_10163353 | Ga0207639_101633532 | 250 |
| 254 | 3300026142 | Ga0207698_10001247 | Ga0207698_100012472 | 250 |
| 255 | 3300031548 | Ga0307408_100032136 | Ga0307408_1000321364 | 250 |
| 256 | 3300031548 | Ga0307408_100037695 | Ga0307408_1000376953 | 250 |
| 257 | 3300031548 | Ga0307408_100353809 | Ga0307408_1003538092 | 250 |
| 258 | 3300031731 | Ga0307405_10014640 | Ga0307405_100146404 | 250 |
| 259 | 3300031731 | Ga0307405_10023002 | Ga0307405_100230022 | 250 |
| 260 | 3300031824 | Ga0307413_10006334 | Ga0307413_100063346 | 250 |
| 261 | 3300031824 | Ga0307413_10154710 | Ga0307413_101547102 | 250 |
| 262 | 3300031852 | Ga0307410_10112920 | Ga0307410_101129202 | 250 |
| 263 | 3300031901 | Ga0307406_10013622 | Ga0307406_100136224 | 250 |
| 264 | 3300031901 | Ga0307406_10032595 | Ga0307406_100325952 | 250 |
| 265 | 3300031901 | Ga0307406_10049769 | Ga0307406_100497692 | 250 |
| 266 | 3300031903 | Ga0307407_10001217 | Ga0307407_1000121711 | 250 |
| 267 | 3300031911 | Ga0307412_10008185 | Ga0307412_100081853 | 250 |
| 268 | 3300031911 | Ga0307412_10125088 | Ga0307412_101250883 | 250 |
| 269 | 3300031995 | Ga0307409_100000151 | Ga0307409_1000001518 | 250 |
| 270 | 3300031995 | Ga0307409_100024592 | Ga0307409_1000245923 | 250 |
| 271 | 3300031995 | Ga0307409_100406015 | Ga0307409_1004060152 | 250 |
| 272 | 3300032002 | Ga0307416_100002868 | Ga0307416_1000028688 | 250 |
| 273 | 3300032002 | Ga0307416_100021376 | Ga0307416_1000213762 | 250 |
| 274 | 3300032004 | Ga0307414_10091971 | Ga0307414_100919713 | 250 |
| 275 | 3300032004 | Ga0307414_10180735 | Ga0307414_101807352 | 250 |
| 276 | 3300032005 | Ga0307411_10000531 | Ga0307411_100005318 | 250 |
| 277 | 3300032005 | Ga0307411_10121370 | Ga0307411_101213702 | 250 |
| 278 | 3300032126 | Ga0307415_100002128 | Ga0307415_10000212811 | 250 |
| 279 | 3300032126 | Ga0307415_100033141 | Ga0307415_1000331412 | 250 |
| 280 | 3300035120 | Ga0373957_0022072 | Ga0373957_0022072_342_1121 | 250 |
| 281 | 3300035692 | Ga0373935_0477490 | Ga0373935_0477490_63_842 | 250 |
| 282 | 3300035725 | Ga0373947_0180842 | Ga0373947_0180842_553_1332 | 250 |
| 283 | 3300036401 | Ga0373937_0022515 | Ga0373937_0022515_3096_3875 | 250 |
| 284 | 3300037471 | Ga0395905_0095371 | Ga0395905_0095371_129_908 | 250 |
| 285 | 3300038443 | Ga0395901_0127664 | Ga0395901_0127664_286_1083 | 250 |
| 286 | 3300046472 | Ga0495580_0002602 | Ga0495580_0002602_5586_6365 | 250 |
| 287 | 3300046473 | Ga0495582_0138772 | Ga0495582_0138772_559_1338 | 250 |
| 288 | 3300046475 | Ga0495639_0022709 | Ga0495639_0022709_1794_2573 | 250 |
| 289 | 3300046531 | Ga0495665_0010196 | Ga0495665_0010196_2765_3544 | 250 |
| 290 | 3300046559 | Ga0495667_0048852 | Ga0495667_0048852_869_1648 | 250 |
| 291 | 3300046675 | Ga0495657_0158375 | Ga0495657_0158375_180_959 | 250 |
| 292 | 3300046680 | Ga0495646_0086011 | Ga0495646_0086011_746_1525 | 250 |
| 293 | 3300047444 | Ga0495675_0046893 | Ga0495675_0046893_1208_1987 | 250 |
| 294 | 3300047471 | Ga0495684_0016220 | Ga0495684_0016220_1251_2030 | 250 |
| 295 | 3300048907 | Ga0496104_0279574 | Ga0496104_0279574_36_863 | 250 |
| 296 | 3300048908 | Ga0496105_0066343 | Ga0496105_0066343_2122_2949 | 250 |
| 297 | 3300048911 | Ga0496108_0016290 | Ga0496108_0016290_5060_5887 | 250 |
| 298 | 3300048913 | Ga0496110_0029709 | Ga0496110_0029709_3255_4082 | 250 |
| 299 | 3300048916 | Ga0496113_0039155 | Ga0496113_0039155_2409_3236 | 250 |
| 300 | 3300048917 | Ga0496114_0274679 | Ga0496114_0274679_277_1104 | 250 |
| 301 | 3300049581 | Ga0501047_0000707 | Ga0501047_0000707_6933_7712 | 250 |
| 302 | 3300049585 | Ga0501069_0165411 | Ga0501069_0165411_306_1085 | 250 |
| 303 | 3300050514 | nmdc:mga08x19_424352_c1 | nmdc:mga08x19_424352_c1_49_828 | 250 |
| 304 | 3300005331 | Ga0070670_100000020 | Ga0070670_10000002010 | 251 |
| 305 | 3300005331 | Ga0070670_100045141 | Ga0070670_1000451412 | 251 |
| 306 | 3300005347 | Ga0070668_100002097 | Ga0070668_1000020974 | 251 |
| 307 | 3300005347 | Ga0070668_100204665 | Ga0070668_1002046651 | 251 |
| 308 | 3300005353 | Ga0070669_100126647 | Ga0070669_1001266472 | 251 |
| 309 | 3300005356 | Ga0070674_100170237 | Ga0070674_1001702372 | 251 |
| 310 | 3300005367 | Ga0070667_100000118 | Ga0070667_100000118101 | 251 |
| 311 | 3300005367 | Ga0070667_100015478 | Ga0070667_1000154782 | 251 |
| 312 | 3300005445 | Ga0070708_100002549 | Ga0070708_1000025494 | 251 |
| 313 | 3300005518 | Ga0070699_100016226 | Ga0070699_1000162266 | 251 |
| 314 | 3300005548 | Ga0070665_100001988 | Ga0070665_10000198810 | 251 |
| 315 | 3300005617 | Ga0068859_100015720 | Ga0068859_1000157202 | 251 |
| 316 | 3300005617 | Ga0068859_100031870 | Ga0068859_1000318702 | 251 |
| 317 | 3300005618 | Ga0068864_100000206 | Ga0068864_10000020610 | 251 |
| 318 | 3300005618 | Ga0068864_100138140 | Ga0068864_1001381403 | 251 |
| 319 | 3300005719 | Ga0068861_100110753 | Ga0068861_1001107532 | 251 |
| 320 | 3300005719 | Ga0068861_100179360 | Ga0068861_1001793602 | 251 |
| 321 | 3300005841 | Ga0068863_100000071 | Ga0068863_100000071103 | 251 |
| 322 | 3300005841 | Ga0068863_100028731 | Ga0068863_1000287315 | 251 |
| 323 | 3300005842 | Ga0068858_100015779 | Ga0068858_1000157792 | 251 |
| 324 | 3300005843 | Ga0068860_100000205 | Ga0068860_10000020589 | 251 |
| 325 | 3300005843 | Ga0068860_100000954 | Ga0068860_1000009547 | 251 |
| 326 | 3300005844 | Ga0068862_100000057 | Ga0068862_100000057141 | 251 |
| 327 | 3300005844 | Ga0068862_100144308 | Ga0068862_1001443082 | 251 |
| 328 | 3300005937 | Ga0081455_10000453 | Ga0081455_1000045321 | 251 |
| 329 | 3300006195 | Ga0075366_10376802 | Ga0075366_103768021 | 251 |
| 330 | 3300006353 | Ga0075370_10013728 | Ga0075370_100137282 | 251 |
| 331 | 3300006931 | Ga0097620_100015720 | Ga0097620_1000157202 | 251 |
| 332 | 3300006931 | Ga0097620_100031871 | Ga0097620_1000318715 | 251 |
| 333 | 3300009101 | Ga0105247_10132205 | Ga0105247_101322052 | 251 |
| 334 | 3300009177 | Ga0105248_10030113 | Ga0105248_100301132 | 251 |
| 335 | 3300009177 | Ga0105248_10722386 | Ga0105248_107223861 | 251 |
| 336 | 3300009553 | Ga0105249_10009971 | Ga0105249_100099718 | 251 |
| 337 | 3300013306 | Ga0163162_10062258 | Ga0163162_100622583 | 251 |
| 338 | 3300014325 | Ga0163163_10136668 | Ga0163163_101366682 | 251 |
| 339 | 3300014968 | Ga0157379_10000949 | Ga0157379_100009494 | 251 |
| 340 | 3300014968 | Ga0157379_10019585 | Ga0157379_100195854 | 251 |
| 341 | 3300021377 | Ga0213874_10016992 | Ga0213874_100169922 | 251 |
| 342 | 3300021384 | Ga0213876_10000150 | Ga0213876_1000015014 | 251 |
| 343 | 3300021384 | Ga0213876_10039528 | Ga0213876_100395282 | 251 |
| 344 | 3300025923 | Ga0207681_10241198 | Ga0207681_102411982 | 251 |
| 345 | 3300025925 | Ga0207650_10000032 | Ga0207650_1000003298 | 251 |
| 346 | 3300025925 | Ga0207650_10054123 | Ga0207650_100541233 | 251 |
| 347 | 3300025937 | Ga0207669_10147477 | Ga0207669_101474772 | 251 |
| 348 | 3300025941 | Ga0207711_10084930 | Ga0207711_100849302 | 251 |
| 349 | 3300025961 | Ga0207712_10009907 | Ga0207712_100099076 | 251 |
| 350 | 3300025972 | Ga0207668_10001570 | Ga0207668_1000157013 | 251 |
| 351 | 3300025972 | Ga0207668_10196416 | Ga0207668_101964161 | 251 |
| 352 | 3300025986 | Ga0207658_10000116 | Ga0207658_100001165 | 251 |
| 353 | 3300025986 | Ga0207658_10018175 | Ga0207658_100181752 | 251 |
| 354 | 3300026035 | Ga0207703_10010789 | Ga0207703_100107897 | 251 |
| 355 | 3300026088 | Ga0207641_10002816 | Ga0207641_100028168 | 251 |
| 356 | 3300026088 | Ga0207641_10063518 | Ga0207641_100635182 | 251 |
| 357 | 3300026095 | Ga0207676_10000237 | Ga0207676_1000023737 | 251 |
| 358 | 3300026118 | Ga0207675_100067387 | Ga0207675_1000673872 | 251 |
| 359 | 3300028379 | Ga0268266_10001306 | Ga0268266_1000130625 | 251 |
| 360 | 3300028380 | Ga0268265_10001602 | Ga0268265_1000160218 | 251 |
| 361 | 3300028381 | Ga0268264_10000202 | Ga0268264_1000020225 | 251 |
| 362 | 3300028381 | Ga0268264_10022290 | Ga0268264_100222904 | 251 |
| 363 | 3300031727 | Ga0316576_10267092 | Ga0316576_102670921 | 251 |
| 364 | 3300035171 | Ga0373946_0065214 | Ga0373946_0065214_731_1510 | 251 |
| 365 | 3300035725 | Ga0373947_0034853 | Ga0373947_0034853_421_1200 | 251 |
| 366 | 3300037068 | Ga0373925_0015304 | Ga0373925_0015304_2677_3456 | 251 |
| 367 | 3300039437 | Ga0436365_1178839 | Ga0436365_1178839_3342_4151 | 251 |
| 368 | 3300039437 | Ga0436365_1247886 | Ga0436365_1247886_49045_49851 | 251 |
| 369 | 3300039450 | Ga0436363_1641698 | Ga0436363_1641698_1099_1905 | 251 |
| 370 | 3300044673 | Ga0453683_0003486 | Ga0453683_0003486_6828_7613 | 251 |
| 371 | 3300044712 | Ga0453684_0093446 | Ga0453684_0093446_1256_2041 | 251 |
| 372 | 3300045051 | Ga0451576_0271998 | Ga0451576_0271998_77_868 | 251 |
| 373 | 3300045051 | Ga0451576_0456792 | Ga0451576_0456792_538_1323 | 251 |
| 374 | 3300045051 | Ga0451576_0580614 | Ga0451576_0580614_34_819 | 251 |
| 375 | 3300046457 | Ga0495590_0102318 | Ga0495590_0102318_212_988 | 251 |
| 376 | 3300046472 | Ga0495580_0009043 | Ga0495580_0009043_3973_4752 | 251 |
| 377 | 3300046474 | Ga0495605_0004251 | Ga0495605_0004251_1022_1798 | 251 |
| 378 | 3300046491 | Ga0495584_0051818 | Ga0495584_0051818_386_1162 | 251 |
| 379 | 3300046501 | Ga0495607_0015975 | Ga0495607_0015975_2984_3760 | 251 |
| 380 | 3300046513 | Ga0495616_0000632 | Ga0495616_0000632_2992_3768 | 251 |
| 381 | 3300046522 | Ga0495643_0049663 | Ga0495643_0049663_383_1159 | 251 |
| 382 | 3300046538 | Ga0495609_0000676 | Ga0495609_0000676_22567_23343 | 251 |
| 383 | 3300046665 | Ga0495661_0000938 | Ga0495661_0000938_3180_3956 | 251 |
| 384 | 3300046794 | Ga0495589_0000532 | Ga0495589_0000532_22567_23343 | 251 |
| 385 | 3300047443 | Ga0495687_000132 | Ga0495687_000132_4784_5560 | 251 |
| 386 | 3300047445 | Ga0495677_0000191 | Ga0495677_0000191_22567_23343 | 251 |
| 387 | 3300048091 | Ga0495626_0004263 | Ga0495626_0004263_2807_3583 | 251 |
| 388 | 3300048905 | Ga0496102_0006452 | Ga0496102_0006452_5935_6741 | 251 |
| 389 | 3300049589 | Ga0501073_0056698 | Ga0501073_0056698_1699_2493 | 251 |
| 390 | 3300049592 | Ga0501076_0011669 | Ga0501076_0011669_5752_6525 | 251 |
| 391 | 3300049744 | Ga0501083_0022643 | Ga0501083_0022643_1114_1908 | 251 |
| 392 | 3300050493 | nmdc:mga0k408_292544_c1 | nmdc:mga0k408_292544_c1_122_904 | 251 |
| 393 | 3300050496 | nmdc:mga07m45_1217_c1 | nmdc:mga07m45_1217_c1_762_1544 | 251 |
| 394 | 3300054114 | Ga0501084_0109277 | Ga0501084_0109277_543_1316 | 251 |
| 395 | 3300005338 | Ga0068868_100116928 | Ga0068868_1001169282 | 252 |
| 396 | 3300005548 | Ga0070665_100000419 | Ga0070665_10000041921 | 252 |
| 397 | 3300005563 | Ga0068855_100630288 | Ga0068855_1006302882 | 252 |
| 398 | 3300006042 | Ga0075368_10013438 | Ga0075368_100134382 | 252 |
| 399 | 3300006178 | Ga0075367_10009109 | Ga0075367_100091095 | 252 |
| 400 | 3300006353 | Ga0075370_10035515 | Ga0075370_100355152 | 252 |
| 401 | 3300009177 | Ga0105248_10608605 | Ga0105248_106086052 | 252 |
| 402 | 3300009551 | Ga0105238_10000412 | Ga0105238_1000041228 | 252 |
| 403 | 3300009551 | Ga0105238_10055286 | Ga0105238_100552862 | 252 |
| 404 | 3300025913 | Ga0207695_10142162 | Ga0207695_101421622 | 252 |
| 405 | 3300025924 | Ga0207694_10009212 | Ga0207694_100092125 | 252 |
| 406 | 3300025941 | Ga0207711_10459410 | Ga0207711_104594102 | 252 |
| 407 | 3300025949 | Ga0207667_10808803 | Ga0207667_108088031 | 252 |
| 408 | 3300028379 | Ga0268266_10001716 | Ga0268266_100017164 | 252 |
| 409 | 3300031249 | Ga0265339_10108246 | Ga0265339_101082462 | 252 |
| 410 | 3300031251 | Ga0265327_10000200 | Ga0265327_100002004 | 252 |
| 411 | 3300031456 | Ga0307513_10116631 | Ga0307513_101166313 | 252 |
| 412 | 3300031711 | Ga0265314_10144503 | Ga0265314_101445032 | 252 |
| 413 | 3300031727 | Ga0316576_10007205 | Ga0316576_100072052 | 252 |
| 414 | 3300031728 | Ga0316578_10007808 | Ga0316578_100078084 | 252 |
| 415 | 3300035398 | Ga0316574_0014216 | Ga0316574_0014216_1012_1794 | 252 |
| 416 | 3300036647 | Ga0316582_0047849 | Ga0316582_0047849_505_1287 | 252 |
| 417 | 3300036712 | Ga0316584_0000425 | Ga0316584_0000425_7962_8744 | 252 |
| 418 | 3300037312 | Ga0395899_0017676 | Ga0395899_0017676_3177_3962 | 252 |
| 419 | 3300038443 | Ga0395901_0199617 | Ga0395901_0199617_991_1776 | 252 |
| 420 | 3300039447 | Ga0436361_0576744 | Ga0436361_0576744_298_1083 | 252 |
| 421 | 3300041413 | Ga0439465_0034013 | Ga0439465_0034013_433_1221 | 252 |
| 422 | 3300046507 | Ga0495606_0135680 | Ga0495606_0135680_460_1254 | 252 |
| 423 | 3300048929 | Ga0496126_0053450 | Ga0496126_0053450_137_922 | 252 |
| 424 | 3300050496 | nmdc:mga07m45_14092_c1 | nmdc:mga07m45_14092_c1_2678_3466 | 252 |
| 425 | 3300053091 | Ga0500647_0010299 | Ga0500647_0010299_1793_2578 | 252 |
| 426 | 3300053119 | Ga0500595_006795 | Ga0500595_006795_65_850 | 252 |
| 427 | 3300053119 | Ga0500595_018072 | Ga0500595_018072_1286_2071 | 252 |
| 428 | 3300053146 | Ga0500588_0006984 | Ga0500588_0006984_46_846 | 252 |
| 429 | iso_pu_bacteria | 2511231021 | 2511358058 | 252 |
| 430 | iso_pu_bacteria | 2511231221 | 2512034910 | 253 |
| 431 | iso_pu_bacteria | 2738541264 | 2738668432 | 253 |
| 432 | iso_pu_bacteria | 2738541356 | 2739147502 | 253 |
| 433 | iso_pu_bacteria | 2773857759 | 2774382208 | 253 |
| 434 | iso_pu_bacteria | 2816332139 | 2816503837 | 253 |
| 435 | iso_pu_bacteria | 2818991436 | 2819544508 | 253 |
| 436 | iso_pu_bacteria | 2842134933 | 2842139360 | 253 |
| 437 | iso_pu_bacteria | 2883291878 | 2883297329 | 253 |
| 438 | iso_pu_bacteria | 2897803580 | 2897808881 | 253 |
| 439 | iso_pu_bacteria | 2902792274 | 2902798837 | 253 |
| 440 | iso_pu_bacteria | 8054002106 | 8054005852 | 253 |
| 441 | 3300031665 | Ga0316575_10092024 | Ga0316575_100920242 | 254 |
| 442 | 3300036647 | Ga0316582_0010884 | Ga0316582_0010884_3091_3879 | 254 |
| 443 | 3300044683 | Ga0466965_0171766 | Ga0466965_0171766_155_943 | 254 |
| 444 | 3300044765 | Ga0466970_0126654 | Ga0466970_0126654_386_1180 | 254 |
| 445 | 3300045976 | Ga0466967_0316134 | Ga0466967_0316134_158_946 | 254 |
| 446 | 3300048908 | Ga0496105_0295665 | Ga0496105_0295665_411_1199 | 254 |
| 447 | iso_pu_bacteria | 2738543005 | 2739206799 | 254 |
| 448 | iso_pu_bacteria | 2929199973 | 2929206443 | 254 |
| 449 | iso_pu_bacteria | 8055909800 | 8055914936 | 254 |
| 450 | 3300050491 | nmdc:mga00v17_35825_c1 | nmdc:mga00v17_35825_c1_900_1667 | 255 |
| 451 | iso_pu_bacteria | 2939582691 | 2939584546 | 255 |
| 452 | 3300021384 | Ga0213876_10104480 | Ga0213876_101044802 | 256 |
| 453 | 3300025938 | Ga0207704_10491074 | Ga0207704_104910742 | 256 |
| 454 | 3300039437 | Ga0436365_1709394 | Ga0436365_1709394_40945_41724 | 256 |
| 455 | 3300039437 | Ga0436365_1830770 | Ga0436365_1830770_156_929 | 256 |
| 456 | 3300046460 | Ga0495638_0000806 | Ga0495638_0000806_28559_29335 | 256 |
| 457 | 3300046542 | Ga0495597_0000833 | Ga0495597_0000833_15377_16153 | 256 |
| 458 | 3300047443 | Ga0495687_000308 | Ga0495687_000308_39320_40096 | 256 |
| 459 | 3300047469 | Ga0495673_0057964 | Ga0495673_0057964_574_1350 | 256 |
| 460 | 3300000546 | LJNas_1010763 | LJNas_10107632 | 257 |
| 461 | 3300002077 | JGI24744J21845_10001840 | JGI24744J21845_100018403 | 257 |
| 462 | 3300002244 | JGI24742J22300_10003712 | JGI24742J22300_100037122 | 257 |
| 463 | 3300002737 | JGI25162J39368_1000598 | JGI25162J39368_100059824 | 257 |
| 464 | 3300002771 | JGI25163J39215_1004202 | JGI25163J39215_10042021 | 257 |
| 465 | 3300002987 | JGI25159J45721_1005684 | JGI25159J45721_10056841 | 257 |
| 466 | 3300003187 | JGI25151J46595_10000672 | JGI25151J46595_100006728 | 257 |
| 467 | 3300003203 | JGI25406J46586_10000563 | JGI25406J46586_1000056310 | 257 |
| 468 | 3300003214 | JGI25165J46597_1000713 | JGI25165J46597_100071324 | 257 |
| 469 | 3300003316 | rootH1_10054217 | rootH1_100542173 | 257 |
| 470 | 3300003751 | Ga0055538_1000281 | Ga0055538_100028124 | 257 |
| 471 | 3300003752 | Ga0055539_1000305 | Ga0055539_100030524 | 257 |
| 472 | 3300003756 | Ga0055533_1000286 | Ga0055533_100028624 | 257 |
| 473 | 3300003759 | Ga0055525_1000405 | Ga0055525_10004052 | 257 |
| 474 | 3300003792 | Ga0055540_1000702 | Ga0055540_100070211 | 257 |
| 475 | 3300003792 | Ga0055540_1000980 | Ga0055540_100098018 | 257 |
| 476 | 3300003841 | Ga0055541_1000198 | Ga0055541_100019824 | 257 |
| 477 | 3300005262 | Ga0065165_1002857 | Ga0065165_100285714 | 257 |
| 478 | 3300005328 | Ga0070676_10146297 | Ga0070676_101462972 | 257 |
| 479 | 3300005329 | Ga0070683_100110989 | Ga0070683_1001109892 | 257 |
| 480 | 3300005335 | Ga0070666_10024729 | Ga0070666_100247293 | 257 |
| 481 | 3300005337 | Ga0070682_100022524 | Ga0070682_1000225242 | 257 |
| 482 | 3300005338 | Ga0068868_100005133 | Ga0068868_1000051339 | 257 |
| 483 | 3300005339 | Ga0070660_100022139 | Ga0070660_1000221396 | 257 |
| 484 | 3300005340 | Ga0070689_100031249 | Ga0070689_1000312493 | 257 |
| 485 | 3300005341 | Ga0070691_10043297 | Ga0070691_100432972 | 257 |
| 486 | 3300005344 | Ga0070661_100025891 | Ga0070661_1000258915 | 257 |
| 487 | 3300005345 | Ga0070692_10086494 | Ga0070692_100864942 | 257 |
| 488 | 3300005347 | Ga0070668_100467222 | Ga0070668_1004672221 | 257 |
| 489 | 3300005353 | Ga0070669_100003646 | Ga0070669_1000036464 | 257 |
| 490 | 3300005353 | Ga0070669_100006848 | Ga0070669_1000068484 | 257 |
| 491 | 3300005354 | Ga0070675_100105956 | Ga0070675_1001059562 | 257 |
| 492 | 3300005355 | Ga0070671_100003533 | Ga0070671_1000035332 | 257 |
| 493 | 3300005356 | Ga0070674_100122707 | Ga0070674_1001227072 | 257 |
| 494 | 3300005365 | Ga0070688_100025163 | Ga0070688_1000251633 | 257 |
| 495 | 3300005366 | Ga0070659_100001752 | Ga0070659_10000175219 | 257 |
| 496 | 3300005367 | Ga0070667_100000190 | Ga0070667_10000019039 | 257 |
| 497 | 3300005367 | Ga0070667_100000658 | Ga0070667_1000006583 | 257 |
| 498 | 3300005367 | Ga0070667_100007906 | Ga0070667_1000079062 | 257 |
| 499 | 3300005434 | Ga0070709_10002573 | Ga0070709_100025736 | 257 |
| 500 | 3300005434 | Ga0070709_10055126 | Ga0070709_100551262 | 257 |
| 501 | 3300005435 | Ga0070714_100162127 | Ga0070714_1001621272 | 257 |
| 502 | 3300005436 | Ga0070713_100013539 | Ga0070713_1000135392 | 257 |
| 503 | 3300005436 | Ga0070713_100524489 | Ga0070713_1005244891 | 257 |
| 504 | 3300005437 | Ga0070710_10017543 | Ga0070710_100175434 | 257 |
| 505 | 3300005437 | Ga0070710_10186310 | Ga0070710_101863102 | 257 |
| 506 | 3300005438 | Ga0070701_10008518 | Ga0070701_100085181 | 257 |
| 507 | 3300005439 | Ga0070711_100000220 | Ga0070711_10000022021 | 257 |
| 508 | 3300005439 | Ga0070711_100146690 | Ga0070711_1001466902 | 257 |
| 509 | 3300005440 | Ga0070705_100070313 | Ga0070705_1000703132 | 257 |
| 510 | 3300005440 | Ga0070705_100094783 | Ga0070705_1000947832 | 257 |
| 511 | 3300005441 | Ga0070700_100364968 | Ga0070700_1003649682 | 257 |
| 512 | 3300005444 | Ga0070694_100012696 | Ga0070694_1000126962 | 257 |
| 513 | 3300005444 | Ga0070694_100219954 | Ga0070694_1002199542 | 257 |
| 514 | 3300005455 | Ga0070663_100195322 | Ga0070663_1001953222 | 257 |
| 515 | 3300005456 | Ga0070678_100000231 | Ga0070678_1000002317 | 257 |
| 516 | 3300005456 | Ga0070678_100069019 | Ga0070678_1000690193 | 257 |
| 517 | 3300005456 | Ga0070678_100138005 | Ga0070678_1001380051 | 257 |
| 518 | 3300005457 | Ga0070662_100003854 | Ga0070662_1000038543 | 257 |
| 519 | 3300005457 | Ga0070662_100256533 | Ga0070662_1002565332 | 257 |
| 520 | 3300005458 | Ga0070681_10156098 | Ga0070681_101560982 | 257 |
| 521 | 3300005458 | Ga0070681_10535474 | Ga0070681_105354741 | 257 |
| 522 | 3300005459 | Ga0068867_100056402 | Ga0068867_1000564022 | 257 |
| 523 | 3300005467 | Ga0070706_100033105 | Ga0070706_1000331056 | 257 |
| 524 | 3300005468 | Ga0070707_100344019 | Ga0070707_1003440191 | 257 |
| 525 | 3300005530 | Ga0070679_100045536 | Ga0070679_1000455362 | 257 |
| 526 | 3300005539 | Ga0068853_100002612 | Ga0068853_10000261214 | 257 |
| 527 | 3300005539 | Ga0068853_100046750 | Ga0068853_1000467502 | 257 |
| 528 | 3300005539 | Ga0068853_100653364 | Ga0068853_1006533641 | 257 |
| 529 | 3300005545 | Ga0070695_100003240 | Ga0070695_1000032405 | 257 |
| 530 | 3300005545 | Ga0070695_100075322 | Ga0070695_1000753222 | 257 |
| 531 | 3300005546 | Ga0070696_100000829 | Ga0070696_10000082921 | 257 |
| 532 | 3300005546 | Ga0070696_100050408 | Ga0070696_1000504081 | 257 |
| 533 | 3300005549 | Ga0070704_100002414 | Ga0070704_1000024142 | 257 |
| 534 | 3300005549 | Ga0070704_100037402 | Ga0070704_1000374025 | 257 |
| 535 | 3300005563 | Ga0068855_100084417 | Ga0068855_1000844172 | 257 |
| 536 | 3300005564 | Ga0070664_100039694 | Ga0070664_1000396946 | 257 |
| 537 | 3300005578 | Ga0068854_100000198 | Ga0068854_10000019824 | 257 |
| 538 | 3300005578 | Ga0068854_100077559 | Ga0068854_1000775592 | 257 |
| 539 | 3300005578 | Ga0068854_100202328 | Ga0068854_1002023282 | 257 |
| 540 | 3300005614 | Ga0068856_100252974 | Ga0068856_1002529742 | 257 |
| 541 | 3300005615 | Ga0070702_100000682 | Ga0070702_1000006823 | 257 |
| 542 | 3300005615 | Ga0070702_100156436 | Ga0070702_1001564362 | 257 |
| 543 | 3300005616 | Ga0068852_100206654 | Ga0068852_1002066542 | 257 |
| 544 | 3300005617 | Ga0068859_100001075 | Ga0068859_1000010753 | 257 |
| 545 | 3300005617 | Ga0068859_100003525 | Ga0068859_1000035252 | 257 |
| 546 | 3300005617 | Ga0068859_100046450 | Ga0068859_1000464503 | 257 |
| 547 | 3300005718 | Ga0068866_10000535 | Ga0068866_100005352 | 257 |
| 548 | 3300005719 | Ga0068861_100000696 | Ga0068861_1000006963 | 257 |
| 549 | 3300005841 | Ga0068863_100001658 | Ga0068863_10000165815 | 257 |
| 550 | 3300005842 | Ga0068858_100013158 | Ga0068858_1000131587 | 257 |
| 551 | 3300005842 | Ga0068858_100019858 | Ga0068858_1000198583 | 257 |
| 552 | 3300005843 | Ga0068860_100000099 | Ga0068860_10000009966 | 257 |
| 553 | 3300005843 | Ga0068860_100003120 | Ga0068860_10000312019 | 257 |
| 554 | 3300005844 | Ga0068862_100000086 | Ga0068862_10000008666 | 257 |
| 555 | 3300005844 | Ga0068862_100013447 | Ga0068862_1000134473 | 257 |
| 556 | 3300005937 | Ga0081455_10005282 | Ga0081455_1000528214 | 257 |
| 557 | 3300005937 | Ga0081455_10032235 | Ga0081455_100322352 | 257 |
| 558 | 3300005937 | Ga0081455_10084834 | Ga0081455_100848342 | 257 |
| 559 | 3300005937 | Ga0081455_10199039 | Ga0081455_101990392 | 257 |
| 560 | 3300005981 | Ga0081538_10025003 | Ga0081538_100250034 | 257 |
| 561 | 3300005983 | Ga0081540_1029206 | Ga0081540_10292062 | 257 |
| 562 | 3300006028 | Ga0070717_10291271 | Ga0070717_102912712 | 257 |
| 563 | 3300006038 | Ga0075365_10031894 | Ga0075365_100318942 | 257 |
| 564 | 3300006048 | Ga0075363_100065606 | Ga0075363_1000656062 | 257 |
| 565 | 3300006051 | Ga0075364_10003638 | Ga0075364_100036386 | 257 |
| 566 | 3300006051 | Ga0075364_10080880 | Ga0075364_100808802 | 257 |
| 567 | 3300006051 | Ga0075364_10374158 | Ga0075364_103741582 | 257 |
| 568 | 3300006058 | Ga0075432_10000194 | Ga0075432_100001948 | 257 |
| 569 | 3300006058 | Ga0075432_10015901 | Ga0075432_100159013 | 257 |
| 570 | 3300006163 | Ga0070715_10002296 | Ga0070715_100022966 | 257 |
| 571 | 3300006175 | Ga0070712_100000493 | Ga0070712_1000004933 | 257 |
| 572 | 3300006175 | Ga0070712_100007822 | Ga0070712_1000078222 | 257 |
| 573 | 3300006175 | Ga0070712_100197867 | Ga0070712_1001978672 | 257 |
| 574 | 3300006175 | Ga0070712_100207337 | Ga0070712_1002073372 | 257 |
| 575 | 3300006186 | Ga0075369_10000808 | Ga0075369_100008085 | 257 |
| 576 | 3300006186 | Ga0075369_10002242 | Ga0075369_100022424 | 257 |
| 577 | 3300006186 | Ga0075369_10187789 | Ga0075369_101877892 | 257 |
| 578 | 3300006358 | Ga0068871_100176800 | Ga0068871_1001768002 | 257 |
| 579 | 3300006844 | Ga0075428_100009454 | Ga0075428_10000945413 | 257 |
| 580 | 3300006846 | Ga0075430_100000129 | Ga0075430_10000012924 | 257 |
| 581 | 3300006847 | Ga0075431_100000948 | Ga0075431_10000094823 | 257 |
| 582 | 3300006847 | Ga0075431_100070913 | Ga0075431_1000709134 | 257 |
| 583 | 3300006852 | Ga0075433_10000100 | Ga0075433_100001006 | 257 |
| 584 | 3300006871 | Ga0075434_100001229 | Ga0075434_10000122917 | 257 |
| 585 | 3300006871 | Ga0075434_100386342 | Ga0075434_1003863421 | 257 |
| 586 | 3300006871 | Ga0075434_100606672 | Ga0075434_1006066722 | 257 |
| 587 | 3300006880 | Ga0075429_100000278 | Ga0075429_10000027823 | 257 |
| 588 | 3300006881 | Ga0068865_100004610 | Ga0068865_1000046107 | 257 |
| 589 | 3300006931 | Ga0097620_100001075 | Ga0097620_10000107530 | 257 |
| 590 | 3300006931 | Ga0097620_100003525 | Ga0097620_10000352518 | 257 |
| 591 | 3300006931 | Ga0097620_100046450 | Ga0097620_1000464503 | 257 |
| 592 | 3300009094 | Ga0111539_10001748 | Ga0111539_100017486 | 257 |
| 593 | 3300009098 | Ga0105245_10001366 | Ga0105245_100013662 | 257 |
| 594 | 3300009098 | Ga0105245_10006252 | Ga0105245_100062524 | 257 |
| 595 | 3300009098 | Ga0105245_10299469 | Ga0105245_102994691 | 257 |
| 596 | 3300009098 | Ga0105245_10490037 | Ga0105245_104900372 | 257 |
| 597 | 3300009101 | Ga0105247_10000051 | Ga0105247_1000005163 | 257 |
| 598 | 3300009101 | Ga0105247_10000698 | Ga0105247_100006983 | 257 |
| 599 | 3300009147 | Ga0114129_10002143 | Ga0114129_100021437 | 257 |
| 600 | 3300009148 | Ga0105243_10001379 | Ga0105243_100013793 | 257 |
| 601 | 3300009148 | Ga0105243_10344436 | Ga0105243_103444362 | 257 |
| 602 | 3300009176 | Ga0105242_10051642 | Ga0105242_100516423 | 257 |
| 603 | 3300009177 | Ga0105248_10000281 | Ga0105248_1000028136 | 257 |
| 604 | 3300009177 | Ga0105248_10017837 | Ga0105248_100178373 | 257 |
| 605 | 3300009177 | Ga0105248_10352507 | Ga0105248_103525072 | 257 |
| 606 | 3300009177 | Ga0105248_11074248 | Ga0105248_110742482 | 257 |
| 607 | 3300009545 | Ga0105237_10007876 | Ga0105237_100078763 | 257 |
| 608 | 3300009545 | Ga0105237_10048690 | Ga0105237_100486905 | 257 |
| 609 | 3300009545 | Ga0105237_10087058 | Ga0105237_100870583 | 257 |
| 610 | 3300009551 | Ga0105238_10266682 | Ga0105238_102666822 | 257 |
| 611 | 3300009553 | Ga0105249_10000020 | Ga0105249_1000002074 | 257 |
| 612 | 3300009553 | Ga0105249_10008943 | Ga0105249_1000894310 | 257 |
| 613 | 3300010375 | Ga0105239_10066546 | Ga0105239_100665464 | 257 |
| 614 | 3300010375 | Ga0105239_10163162 | Ga0105239_101631622 | 257 |
| 615 | 3300010375 | Ga0105239_10305627 | Ga0105239_103056272 | 257 |
| 616 | 3300010375 | Ga0105239_10318804 | Ga0105239_103188042 | 257 |
| 617 | 3300011119 | Ga0105246_10035410 | Ga0105246_100354103 | 257 |
| 618 | 3300013104 | Ga0157370_10219539 | Ga0157370_102195392 | 257 |
| 619 | 3300013296 | Ga0157374_10003582 | Ga0157374_100035826 | 257 |
| 620 | 3300013296 | Ga0157374_10038300 | Ga0157374_100383004 | 257 |
| 621 | 3300013297 | Ga0157378_10012499 | Ga0157378_100124997 | 257 |
| 622 | 3300013306 | Ga0163162_10002550 | Ga0163162_100025502 | 257 |
| 623 | 3300013306 | Ga0163162_10226125 | Ga0163162_102261252 | 257 |
| 624 | 3300013307 | Ga0157372_10006318 | Ga0157372_1000631813 | 257 |
| 625 | 3300013307 | Ga0157372_10576008 | Ga0157372_105760081 | 257 |
| 626 | 3300013308 | Ga0157375_10000478 | Ga0157375_1000047831 | 257 |
| 627 | 3300014325 | Ga0163163_10243197 | Ga0163163_102431972 | 257 |
| 628 | 3300014326 | Ga0157380_10000372 | Ga0157380_100003723 | 257 |
| 629 | 3300014745 | Ga0157377_10013849 | Ga0157377_100138494 | 257 |
| 630 | 3300014968 | Ga0157379_10008683 | Ga0157379_100086839 | 257 |
| 631 | 3300014968 | Ga0157379_10908118 | Ga0157379_109081181 | 257 |
| 632 | 3300015265 | Ga0182005_1001434 | Ga0182005_100143412 | 257 |
| 633 | 3300017792 | Ga0163161_10000595 | Ga0163161_1000059529 | 257 |
| 634 | 3300020080 | Ga0206350_10788292 | Ga0206350_107882921 | 257 |
| 635 | 3300020081 | Ga0206354_11469071 | Ga0206354_114690712 | 257 |
| 636 | 3300020082 | Ga0206353_10536454 | Ga0206353_105364542 | 257 |
| 637 | 3300021361 | Ga0213872_10000430 | Ga0213872_1000043039 | 257 |
| 638 | 3300021361 | Ga0213872_10004434 | Ga0213872_100044349 | 257 |
| 639 | 3300021384 | Ga0213876_10248192 | Ga0213876_102481922 | 257 |
| 640 | 3300024225 | Ga0224572_1029510 | Ga0224572_10295102 | 257 |
| 641 | 3300025224 | Ga0209784_100010 | Ga0209784_100010635 | 257 |
| 642 | 3300025225 | Ga0209566_100008 | Ga0209566_100008635 | 257 |
| 643 | 3300025226 | Ga0209674_100019 | Ga0209674_100019635 | 257 |
| 644 | 3300025228 | Ga0209672_103283 | Ga0209672_1032835 | 257 |
| 645 | 3300025230 | Ga0209563_100021 | Ga0209563_100021635 | 257 |
| 646 | 3300025231 | Ga0207427_100759 | Ga0207427_10075916 | 257 |
| 647 | 3300025233 | Ga0209437_100019 | Ga0209437_100019635 | 257 |
| 648 | 3300025250 | Ga0209026_1007808 | Ga0209026_10078083 | 257 |
| 649 | 3300025253 | Ga0209677_100011 | Ga0209677_100011635 | 257 |
| 650 | 3300025261 | Ga0209233_1000025 | Ga0209233_1000025635 | 257 |
| 651 | 3300025273 | Ga0209673_1016009 | Ga0209673_10160092 | 257 |
| 652 | 3300025284 | Ga0209130_1000169 | Ga0209130_100016992 | 257 |
| 653 | 3300025294 | Ga0209025_1000636 | Ga0209025_100063635 | 257 |
| 654 | 3300025303 | Ga0209051_1000108 | Ga0209051_100010871 | 257 |
| 655 | 3300025303 | Ga0209051_1001757 | Ga0209051_10017573 | 257 |
| 656 | 3300025303 | Ga0209051_1006242 | Ga0209051_10062426 | 257 |
| 657 | 3300025303 | Ga0209051_1014327 | Ga0209051_10143273 | 257 |
| 658 | 3300025898 | Ga0207692_10031885 | Ga0207692_100318852 | 257 |
| 659 | 3300025899 | Ga0207642_10012631 | Ga0207642_100126312 | 257 |
| 660 | 3300025900 | Ga0207710_10000010 | Ga0207710_10000010204 | 257 |
| 661 | 3300025900 | Ga0207710_10004339 | Ga0207710_100043393 | 257 |
| 662 | 3300025901 | Ga0207688_10011321 | Ga0207688_100113212 | 257 |
| 663 | 3300025903 | Ga0207680_10008954 | Ga0207680_100089543 | 257 |
| 664 | 3300025906 | Ga0207699_10022200 | Ga0207699_100222004 | 257 |
| 665 | 3300025906 | Ga0207699_10079399 | Ga0207699_100793992 | 257 |
| 666 | 3300025910 | Ga0207684_10188291 | Ga0207684_101882913 | 257 |
| 667 | 3300025910 | Ga0207684_10208174 | Ga0207684_102081741 | 257 |
| 668 | 3300025912 | Ga0207707_10083655 | Ga0207707_100836552 | 257 |
| 669 | 3300025914 | Ga0207671_10025042 | Ga0207671_100250422 | 257 |
| 670 | 3300025914 | Ga0207671_10026071 | Ga0207671_100260712 | 257 |
| 671 | 3300025914 | Ga0207671_10061967 | Ga0207671_100619672 | 257 |
| 672 | 3300025915 | Ga0207693_10000430 | Ga0207693_1000043029 | 257 |
| 673 | 3300025916 | Ga0207663_10001439 | Ga0207663_1000143911 | 257 |
| 674 | 3300025916 | Ga0207663_10042206 | Ga0207663_100422064 | 257 |
| 675 | 3300025918 | Ga0207662_10187750 | Ga0207662_101877501 | 257 |
| 676 | 3300025919 | Ga0207657_10012688 | Ga0207657_100126881 | 257 |
| 677 | 3300025919 | Ga0207657_10122545 | Ga0207657_101225451 | 257 |
| 678 | 3300025920 | Ga0207649_10009529 | Ga0207649_100095291 | 257 |
| 679 | 3300025921 | Ga0207652_10042590 | Ga0207652_100425904 | 257 |
| 680 | 3300025923 | Ga0207681_10010378 | Ga0207681_100103784 | 257 |
| 681 | 3300025923 | Ga0207681_10134276 | Ga0207681_101342762 | 257 |
| 682 | 3300025924 | Ga0207694_10359904 | Ga0207694_103599042 | 257 |
| 683 | 3300025926 | Ga0207659_10058015 | Ga0207659_100580152 | 257 |
| 684 | 3300025926 | Ga0207659_10177343 | Ga0207659_101773432 | 257 |
| 685 | 3300025927 | Ga0207687_10000803 | Ga0207687_100008033 | 257 |
| 686 | 3300025927 | Ga0207687_10200019 | Ga0207687_102000192 | 257 |
| 687 | 3300025928 | Ga0207700_10060220 | Ga0207700_100602202 | 257 |
| 688 | 3300025928 | Ga0207700_10307821 | Ga0207700_103078212 | 257 |
| 689 | 3300025928 | Ga0207700_10364193 | Ga0207700_103641932 | 257 |
| 690 | 3300025929 | Ga0207664_10030063 | Ga0207664_100300632 | 257 |
| 691 | 3300025929 | Ga0207664_10096640 | Ga0207664_100966402 | 257 |
| 692 | 3300025929 | Ga0207664_10122087 | Ga0207664_101220872 | 257 |
| 693 | 3300025932 | Ga0207690_10000951 | Ga0207690_1000095122 | 257 |
| 694 | 3300025932 | Ga0207690_10022582 | Ga0207690_100225823 | 257 |
| 695 | 3300025934 | Ga0207686_10005781 | Ga0207686_100057817 | 257 |
| 696 | 3300025937 | Ga0207669_10001734 | Ga0207669_1000173411 | 257 |
| 697 | 3300025937 | Ga0207669_10056934 | Ga0207669_100569342 | 257 |
| 698 | 3300025939 | Ga0207665_10399111 | Ga0207665_103991112 | 257 |
| 699 | 3300025941 | Ga0207711_10000364 | Ga0207711_1000036436 | 257 |
| 700 | 3300025941 | Ga0207711_10006457 | Ga0207711_1000645710 | 257 |
| 701 | 3300025942 | Ga0207689_10046184 | Ga0207689_100461842 | 257 |
| 702 | 3300025944 | Ga0207661_10066571 | Ga0207661_100665712 | 257 |
| 703 | 3300025945 | Ga0207679_10010560 | Ga0207679_100105603 | 257 |
| 704 | 3300025949 | Ga0207667_10057635 | Ga0207667_100576352 | 257 |
| 705 | 3300025961 | Ga0207712_10000010 | Ga0207712_10000010190 | 257 |
| 706 | 3300025961 | Ga0207712_10001841 | Ga0207712_100018416 | 257 |
| 707 | 3300025972 | Ga0207668_10001136 | Ga0207668_1000113612 | 257 |
| 708 | 3300025972 | Ga0207668_10005253 | Ga0207668_100052533 | 257 |
| 709 | 3300025981 | Ga0207640_10055576 | Ga0207640_100555763 | 257 |
| 710 | 3300025986 | Ga0207658_10001232 | Ga0207658_1000123221 | 257 |
| 711 | 3300025986 | Ga0207658_10011465 | Ga0207658_100114652 | 257 |
| 712 | 3300025986 | Ga0207658_10027964 | Ga0207658_100279643 | 257 |
| 713 | 3300026023 | Ga0207677_10045702 | Ga0207677_100457022 | 257 |
| 714 | 3300026023 | Ga0207677_10102788 | Ga0207677_101027882 | 257 |
| 715 | 3300026035 | Ga0207703_10003382 | Ga0207703_1000338214 | 257 |
| 716 | 3300026035 | Ga0207703_10010738 | Ga0207703_100107387 | 257 |
| 717 | 3300026041 | Ga0207639_10013486 | Ga0207639_100134863 | 257 |
| 718 | 3300026041 | Ga0207639_10033277 | Ga0207639_100332772 | 257 |
| 719 | 3300026067 | Ga0207678_10045277 | Ga0207678_100452773 | 257 |
| 720 | 3300026067 | Ga0207678_10222501 | Ga0207678_102225013 | 257 |
| 721 | 3300026088 | Ga0207641_10001609 | Ga0207641_100016098 | 257 |
| 722 | 3300026088 | Ga0207641_10731733 | Ga0207641_107317332 | 257 |
| 723 | 3300026089 | Ga0207648_10002033 | Ga0207648_100020332 | 257 |
| 724 | 3300026118 | Ga0207675_100000192 | Ga0207675_10000019263 | 257 |
| 725 | 3300026121 | Ga0207683_10001366 | Ga0207683_100013662 | 257 |
| 726 | 3300026121 | Ga0207683_10011413 | Ga0207683_100114132 | 257 |
| 727 | 3300026121 | Ga0207683_10503246 | Ga0207683_105032461 | 257 |
| 728 | 3300026142 | Ga0207698_10740524 | Ga0207698_107405242 | 257 |
| 729 | 3300027876 | Ga0209974_10051148 | Ga0209974_100511482 | 257 |
| 730 | 3300027907 | Ga0207428_10000146 | Ga0207428_1000014636 | 257 |
| 731 | 3300028379 | Ga0268266_10049960 | Ga0268266_100499602 | 257 |
| 732 | 3300028380 | Ga0268265_10000014 | Ga0268265_10000014252 | 257 |
| 733 | 3300028380 | Ga0268265_10008139 | Ga0268265_100081395 | 257 |
| 734 | 3300028381 | Ga0268264_10000137 | Ga0268264_10000137100 | 257 |
| 735 | 3300028381 | Ga0268264_10019775 | Ga0268264_100197754 | 257 |
| 736 | 3300031241 | Ga0265325_10000095 | Ga0265325_1000009557 | 257 |
| 737 | 3300031241 | Ga0265325_10003702 | Ga0265325_100037029 | 257 |
| 738 | 3300031247 | Ga0265340_10074817 | Ga0265340_100748172 | 257 |
| 739 | 3300031251 | Ga0265327_10000662 | Ga0265327_1000066221 | 257 |
| 740 | 3300031548 | Ga0307408_100143962 | Ga0307408_1001439623 | 257 |
| 741 | 3300031595 | Ga0265313_10000175 | Ga0265313_1000017517 | 257 |
| 742 | 3300031595 | Ga0265313_10010531 | Ga0265313_100105314 | 257 |
| 743 | 3300031824 | Ga0307413_10019596 | Ga0307413_100195964 | 257 |
| 744 | 3300031901 | Ga0307406_10175227 | Ga0307406_101752272 | 257 |
| 745 | 3300031995 | Ga0307409_100767566 | Ga0307409_1007675662 | 257 |
| 746 | 3300031995 | Ga0307409_100830785 | Ga0307409_1008307851 | 257 |
| 747 | 3300032002 | Ga0307416_100417997 | Ga0307416_1004179971 | 257 |
| 748 | 3300032004 | Ga0307414_10380610 | Ga0307414_103806102 | 257 |
| 749 | 3300035117 | Ga0373953_0004282 | Ga0373953_0004282_2230_3003 | 257 |
| 750 | 3300035120 | Ga0373957_0012598 | Ga0373957_0012598_1922_2695 | 257 |
| 751 | 3300035172 | Ga0373955_0008867 | Ga0373955_0008867_2455_3228 | 257 |
| 752 | 3300035724 | Ga0373933_0021746 | Ga0373933_0021746_1413_2186 | 257 |
| 753 | 3300035725 | Ga0373947_0038147 | Ga0373947_0038147_900_1673 | 257 |
| 754 | 3300036401 | Ga0373937_0029111 | Ga0373937_0029111_1780_2553 | 257 |
| 755 | 3300036401 | Ga0373937_0046708 | Ga0373937_0046708_2718_3494 | 257 |
| 756 | 3300037312 | Ga0395899_0002806 | Ga0395899_0002806_13058_13834 | 257 |
| 757 | 3300037312 | Ga0395899_0003641 | Ga0395899_0003641_5267_6043 | 257 |
| 758 | 3300037312 | Ga0395899_0003830 | Ga0395899_0003830_10872_11648 | 257 |
| 759 | 3300037312 | Ga0395899_0011850 | Ga0395899_0011850_4664_5515 | 257 |
| 760 | 3300037418 | Ga0395900_0014022 | Ga0395900_0014022_7164_7940 | 257 |
| 761 | 3300037418 | Ga0395900_0028256 | Ga0395900_0028256_954_1730 | 257 |
| 762 | 3300037418 | Ga0395900_0034856 | Ga0395900_0034856_1405_2181 | 257 |
| 763 | 3300037418 | Ga0395900_0056359 | Ga0395900_0056359_1376_2227 | 257 |
| 764 | 3300037418 | Ga0395900_0319114 | Ga0395900_0319114_77_853 | 257 |
| 765 | 3300037418 | Ga0395900_0596007 | Ga0395900_0596007_21_797 | 257 |
| 766 | 3300037466 | Ga0395898_0004724 | Ga0395898_0004724_13038_13811 | 257 |
| 767 | 3300037466 | Ga0395898_0020590 | Ga0395898_0020590_5679_6455 | 257 |
| 768 | 3300037471 | Ga0395905_0010442 | Ga0395905_0010442_7913_8689 | 257 |
| 769 | 3300037471 | Ga0395905_0010661 | Ga0395905_0010661_4465_5241 | 257 |
| 770 | 3300037471 | Ga0395905_0013127 | Ga0395905_0013127_6167_7018 | 257 |
| 771 | 3300037471 | Ga0395905_0030081 | Ga0395905_0030081_404_1180 | 257 |
| 772 | 3300037471 | Ga0395905_0047862 | Ga0395905_0047862_309_1085 | 257 |
| 773 | 3300037471 | Ga0395905_0242218 | Ga0395905_0242218_72_848 | 257 |
| 774 | 3300038443 | Ga0395901_0091572 | Ga0395901_0091572_1123_1899 | 257 |
| 775 | 3300038443 | Ga0395901_0606202 | Ga0395901_0606202_310_1086 | 257 |
| 776 | 3300039437 | Ga0436365_1083994 | Ga0436365_1083994_195397_196170 | 257 |
| 777 | 3300039438 | Ga0436360_0382408 | Ga0436360_0382408_21_809 | 257 |
| 778 | 3300039438 | Ga0436360_0993747 | Ga0436360_0993747_559_1338 | 257 |
| 779 | 3300039438 | Ga0436360_1007975 | Ga0436360_1007975_341_1129 | 257 |
| 780 | 3300039447 | Ga0436361_0009051 | Ga0436361_0009051_1303_2079 | 257 |
| 781 | 3300039447 | Ga0436361_0013073 | Ga0436361_0013073_16138_16914 | 257 |
| 782 | 3300039447 | Ga0436361_0362627 | Ga0436361_0362627_229_1005 | 257 |
| 783 | 3300039453 | Ga0436362_0979548 | Ga0436362_0979548_99_887 | 257 |
| 784 | 3300041408 | Ga0439453_0000704 | Ga0439453_0000704_1414_2187 | 257 |
| 785 | 3300041413 | Ga0439465_0002245 | Ga0439465_0002245_2565_3347 | 257 |
| 786 | 3300041413 | Ga0439465_0002436 | Ga0439465_0002436_5004_5789 | 257 |
| 787 | 3300041486 | Ga0451807_1428362 | Ga0451807_1428362_547_1320 | 257 |
| 788 | 3300041512 | Ga0451853_2327740 | Ga0451853_2327740_351_1136 | 257 |
| 789 | 3300041997 | Ga0439431_0002763 | Ga0439431_0002763_1968_2753 | 257 |
| 790 | 3300042003 | Ga0439443_005046 | Ga0439443_005046_227_1000 | 257 |
| 791 | 3300042005 | Ga0439448_0011129 | Ga0439448_0011129_955_1737 | 257 |
| 792 | 3300042461 | Ga0439460_0006884 | Ga0439460_0006884_1276_2049 | 257 |
| 793 | 3300044656 | Ga0466969_0000361 | Ga0466969_0000361_153_929 | 257 |
| 794 | 3300044656 | Ga0466969_0112099 | Ga0466969_0112099_55_831 | 257 |
| 795 | 3300044658 | Ga0466972_0000420 | Ga0466972_0000420_314_1090 | 257 |
| 796 | 3300044658 | Ga0466972_0039574 | Ga0466972_0039574_883_1659 | 257 |
| 797 | 3300044658 | Ga0466972_0090765 | Ga0466972_0090765_300_1076 | 257 |
| 798 | 3300044659 | Ga0466973_0035531 | Ga0466973_0035531_3836_4612 | 257 |
| 799 | 3300044672 | Ga0466982_0188692 | Ga0466982_0188692_154_930 | 257 |
| 800 | 3300044683 | Ga0466965_0007481 | Ga0466965_0007481_1317_2093 | 257 |
| 801 | 3300044683 | Ga0466965_0022045 | Ga0466965_0022045_1472_2254 | 257 |
| 802 | 3300044684 | Ga0466966_0007793 | Ga0466966_0007793_1754_2536 | 257 |
| 803 | 3300044684 | Ga0466966_0013203 | Ga0466966_0013203_4034_4810 | 257 |
| 804 | 3300044684 | Ga0466966_0124291 | Ga0466966_0124291_699_1475 | 257 |
| 805 | 3300044693 | Ga0466961_0006278 | Ga0466961_0006278_3619_4401 | 257 |
| 806 | 3300044693 | Ga0466961_0008364 | Ga0466961_0008364_5250_6026 | 257 |
| 807 | 3300044694 | Ga0466963_0004494 | Ga0466963_0004494_7057_7833 | 257 |
| 808 | 3300044694 | Ga0466963_0022728 | Ga0466963_0022728_1967_2746 | 257 |
| 809 | 3300044694 | Ga0466963_0048518 | Ga0466963_0048518_699_1481 | 257 |
| 810 | 3300044694 | Ga0466963_0142438 | Ga0466963_0142438_34_810 | 257 |
| 811 | 3300044706 | Ga0466964_0007346 | Ga0466964_0007346_105_881 | 257 |
| 812 | 3300044706 | Ga0466964_0048901 | Ga0466964_0048901_148_924 | 257 |
| 813 | 3300044719 | Ga0466971_0022214 | Ga0466971_0022214_314_1096 | 257 |
| 814 | 3300044719 | Ga0466971_0044289 | Ga0466971_0044289_559_1335 | 257 |
| 815 | 3300044719 | Ga0466971_0105567 | Ga0466971_0105567_243_1019 | 257 |
| 816 | 3300044719 | Ga0466971_0136595 | Ga0466971_0136595_276_1052 | 257 |
| 817 | 3300044735 | Ga0466968_0006767 | Ga0466968_0006767_877_1653 | 257 |
| 818 | 3300044735 | Ga0466968_0037819 | Ga0466968_0037819_945_1721 | 257 |
| 819 | 3300044735 | Ga0466968_0131601 | Ga0466968_0131601_257_1033 | 257 |
| 820 | 3300044765 | Ga0466970_0006849 | Ga0466970_0006849_1665_2447 | 257 |
| 821 | 3300044765 | Ga0466970_0087619 | Ga0466970_0087619_373_1149 | 257 |
| 822 | 3300044765 | Ga0466970_0115331 | Ga0466970_0115331_655_1431 | 257 |
| 823 | 3300044765 | Ga0466970_0149468 | Ga0466970_0149468_464_1240 | 257 |
| 824 | 3300044842 | Ga0466957_0005590 | Ga0466957_0005590_157_933 | 257 |
| 825 | 3300044842 | Ga0466957_0014795 | Ga0466957_0014795_3328_4110 | 257 |
| 826 | 3300044842 | Ga0466957_0035342 | Ga0466957_0035342_1285_2061 | 257 |
| 827 | 3300044842 | Ga0466957_0078937 | Ga0466957_0078937_915_1691 | 257 |
| 828 | 3300044901 | Ga0466960_0004284 | Ga0466960_0004284_831_1607 | 257 |
| 829 | 3300044901 | Ga0466960_0018539 | Ga0466960_0018539_597_1379 | 257 |
| 830 | 3300044901 | Ga0466960_0313706 | Ga0466960_0313706_65_841 | 257 |
| 831 | 3300045049 | Ga0466959_0105705 | Ga0466959_0105705_663_1439 | 257 |
| 832 | 3300045051 | Ga0451576_0584523 | Ga0451576_0584523_212_988 | 257 |
| 833 | 3300045836 | Ga0466958_0012293 | Ga0466958_0012293_391_1167 | 257 |
| 834 | 3300045836 | Ga0466958_0026343 | Ga0466958_0026343_628_1404 | 257 |
| 835 | 3300045836 | Ga0466958_0052237 | Ga0466958_0052237_190_972 | 257 |
| 836 | 3300045836 | Ga0466958_0053315 | Ga0466958_0053315_140_922 | 257 |
| 837 | 3300045836 | Ga0466958_0105658 | Ga0466958_0105658_86_862 | 257 |
| 838 | 3300045976 | Ga0466967_0001683 | Ga0466967_0001683_7744_8526 | 257 |
| 839 | 3300045976 | Ga0466967_0034747 | Ga0466967_0034747_2790_3569 | 257 |
| 840 | 3300045976 | Ga0466967_0090115 | Ga0466967_0090115_80_853 | 257 |
| 841 | 3300045976 | Ga0466967_0150992 | Ga0466967_0150992_218_1003 | 257 |
| 842 | 3300045976 | Ga0466967_0210863 | Ga0466967_0210863_917_1693 | 257 |
| 843 | 3300045976 | Ga0466967_0550476 | Ga0466967_0550476_315_1088 | 257 |
| 844 | 3300046452 | Ga0495617_013481 | Ga0495617_013481_1708_2484 | 257 |
| 845 | 3300046454 | Ga0495592_0002825 | Ga0495592_0002825_8801_9577 | 257 |
| 846 | 3300046454 | Ga0495592_0003233 | Ga0495592_0003233_650_1423 | 257 |
| 847 | 3300046459 | Ga0495629_0065721 | Ga0495629_0065721_515_1288 | 257 |
| 848 | 3300046460 | Ga0495638_0005942 | Ga0495638_0005942_3069_3842 | 257 |
| 849 | 3300046460 | Ga0495638_0023484 | Ga0495638_0023484_24_797 | 257 |
| 850 | 3300046461 | Ga0495641_0036978 | Ga0495641_0036978_1485_2258 | 257 |
| 851 | 3300046462 | Ga0495651_0240611 | Ga0495651_0240611_310_1086 | 257 |
| 852 | 3300046463 | Ga0495653_0029750 | Ga0495653_0029750_1359_2135 | 257 |
| 853 | 3300046471 | Ga0495650_0001749 | Ga0495650_0001749_18718_19494 | 257 |
| 854 | 3300046477 | Ga0495664_0033641 | Ga0495664_0033641_1250_2023 | 257 |
| 855 | 3300046491 | Ga0495584_0023449 | Ga0495584_0023449_197_973 | 257 |
| 856 | 3300046491 | Ga0495584_0080751 | Ga0495584_0080751_596_1372 | 257 |
| 857 | 3300046492 | Ga0495585_0039691 | Ga0495585_0039691_198_974 | 257 |
| 858 | 3300046501 | Ga0495607_0024047 | Ga0495607_0024047_324_1100 | 257 |
| 859 | 3300046511 | Ga0495608_0012925 | Ga0495608_0012925_4376_5149 | 257 |
| 860 | 3300046511 | Ga0495608_0057345 | Ga0495608_0057345_45_821 | 257 |
| 861 | 3300046513 | Ga0495616_0033528 | Ga0495616_0033528_215_991 | 257 |
| 862 | 3300046516 | Ga0495628_0000382 | Ga0495628_0000382_39183_39959 | 257 |
| 863 | 3300046516 | Ga0495628_0005505 | Ga0495628_0005505_4154_4927 | 257 |
| 864 | 3300046517 | Ga0495630_0323515 | Ga0495630_0323515_254_1027 | 257 |
| 865 | 3300046517 | Ga0495630_0361060 | Ga0495630_0361060_298_1071 | 257 |
| 866 | 3300046529 | Ga0495652_0049004 | Ga0495652_0049004_508_1284 | 257 |
| 867 | 3300046530 | Ga0495654_0161137 | Ga0495654_0161137_27_800 | 257 |
| 868 | 3300046536 | Ga0495587_0008211 | Ga0495587_0008211_4038_4811 | 257 |
| 869 | 3300046537 | Ga0495598_0000136 | Ga0495598_0000136_1881_2654 | 257 |
| 870 | 3300046539 | Ga0495621_0058145 | Ga0495621_0058145_15_791 | 257 |
| 871 | 3300046543 | Ga0495645_0016724 | Ga0495645_0016724_4406_5179 | 257 |
| 872 | 3300046543 | Ga0495645_0096766 | Ga0495645_0096766_174_950 | 257 |
| 873 | 3300046558 | Ga0495633_0015374 | Ga0495633_0015374_362_1138 | 257 |
| 874 | 3300046558 | Ga0495633_0021245 | Ga0495633_0021245_196_972 | 257 |
| 875 | 3300046558 | Ga0495633_0125421 | Ga0495633_0125421_50_1054 | 257 |
| 876 | 3300046559 | Ga0495667_0003376 | Ga0495667_0003376_9550_10323 | 257 |
| 877 | 3300046660 | Ga0495625_0011811 | Ga0495625_0011811_268_1044 | 257 |
| 878 | 3300046663 | Ga0495635_0006033 | Ga0495635_0006033_2749_3522 | 257 |
| 879 | 3300046665 | Ga0495661_0103364 | Ga0495661_0103364_78_854 | 257 |
| 880 | 3300046675 | Ga0495657_0048208 | Ga0495657_0048208_1893_2666 | 257 |
| 881 | 3300046678 | Ga0495599_0002274 | Ga0495599_0002274_2410_3183 | 257 |
| 882 | 3300046678 | Ga0495599_0032804 | Ga0495599_0032804_110_886 | 257 |
| 883 | 3300046679 | Ga0495623_0059789 | Ga0495623_0059789_1068_1841 | 257 |
| 884 | 3300046680 | Ga0495646_0109155 | Ga0495646_0109155_712_1485 | 257 |
| 885 | 3300046690 | Ga0495624_0032247 | Ga0495624_0032247_1036_1809 | 257 |
| 886 | 3300046691 | Ga0495670_0000859 | Ga0495670_0000859_13724_14500 | 257 |
| 887 | 3300046692 | Ga0495671_0123346 | Ga0495671_0123346_361_1137 | 257 |
| 888 | 3300046809 | Ga0495600_0008938 | Ga0495600_0008938_3028_3801 | 257 |
| 889 | 3300046809 | Ga0495600_0015355 | Ga0495600_0015355_195_971 | 257 |
| 890 | 3300047317 | Ga0495604_0006062 | Ga0495604_0006062_4175_4948 | 257 |
| 891 | 3300047317 | Ga0495604_0199964 | Ga0495604_0199964_388_1161 | 257 |
| 892 | 3300047317 | Ga0495604_0408292 | Ga0495604_0408292_84_860 | 257 |
| 893 | 3300047319 | Ga0495674_0040893 | Ga0495674_0040893_1986_2759 | 257 |
| 894 | 3300047322 | Ga0495680_0049405 | Ga0495680_0049405_2412_3185 | 257 |
| 895 | 3300047443 | Ga0495687_010094 | Ga0495687_010094_4418_5194 | 257 |
| 896 | 3300047444 | Ga0495675_0048115 | Ga0495675_0048115_473_1246 | 257 |
| 897 | 3300047472 | Ga0495686_0002311 | Ga0495686_0002311_16142_16915 | 257 |
| 898 | 3300047472 | Ga0495686_0113726 | Ga0495686_0113726_814_1590 | 257 |
| 899 | 3300048088 | Ga0495602_0002983 | Ga0495602_0002983_8701_9474 | 257 |
| 900 | 3300048088 | Ga0495602_0045260 | Ga0495602_0045260_2829_3605 | 257 |
| 901 | 3300048903 | Ga0496100_0000110 | Ga0496100_0000110_5408_6181 | 257 |
| 902 | 3300048903 | Ga0496100_0000412 | Ga0496100_0000412_13709_14482 | 257 |
| 903 | 3300048903 | Ga0496100_0058186 | Ga0496100_0058186_315_1088 | 257 |
| 904 | 3300048903 | Ga0496100_0586719 | Ga0496100_0586719_41_814 | 257 |
| 905 | 3300048904 | Ga0496101_0000054 | Ga0496101_0000054_37720_38493 | 257 |
| 906 | 3300048904 | Ga0496101_0000073 | Ga0496101_0000073_71385_72158 | 257 |
| 907 | 3300048904 | Ga0496101_0009780 | Ga0496101_0009780_2246_3019 | 257 |
| 908 | 3300048904 | Ga0496101_0011053 | Ga0496101_0011053_3746_4528 | 257 |
| 909 | 3300048904 | Ga0496101_0036664 | Ga0496101_0036664_467_1243 | 257 |
| 910 | 3300048904 | Ga0496101_0136930 | Ga0496101_0136930_141_923 | 257 |
| 911 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_179170_179943 | 257 |
| 912 | 3300048905 | Ga0496102_0000118 | Ga0496102_0000118_50228_51001 | 257 |
| 913 | 3300048905 | Ga0496102_0018330 | Ga0496102_0018330_5021_5800 | 257 |
| 914 | 3300048905 | Ga0496102_0019560 | Ga0496102_0019560_3692_4465 | 257 |
| 915 | 3300048905 | Ga0496102_0026398 | Ga0496102_0026398_2361_3143 | 257 |
| 916 | 3300048905 | Ga0496102_0056000 | Ga0496102_0056000_2559_3341 | 257 |
| 917 | 3300048905 | Ga0496102_0149145 | Ga0496102_0149145_461_1237 | 257 |
| 918 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_178968_179741 | 257 |
| 919 | 3300048906 | Ga0496103_0000129 | Ga0496103_0000129_74047_74820 | 257 |
| 920 | 3300048906 | Ga0496103_0000945 | Ga0496103_0000945_18475_19257 | 257 |
| 921 | 3300048906 | Ga0496103_0001200 | Ga0496103_0001200_12041_12814 | 257 |
| 922 | 3300048907 | Ga0496104_0003117 | Ga0496104_0003117_11571_12344 | 257 |
| 923 | 3300048907 | Ga0496104_0235693 | Ga0496104_0235693_634_1407 | 257 |
| 924 | 3300048908 | Ga0496105_0000168 | Ga0496105_0000168_35800_36573 | 257 |
| 925 | 3300048908 | Ga0496105_0283123 | Ga0496105_0283123_444_1226 | 257 |
| 926 | 3300048909 | Ga0496106_0000901 | Ga0496106_0000901_18632_19414 | 257 |
| 927 | 3300048909 | Ga0496106_0002231 | Ga0496106_0002231_8281_9054 | 257 |
| 928 | 3300048909 | Ga0496106_0020313 | Ga0496106_0020313_3085_3858 | 257 |
| 929 | 3300048909 | Ga0496106_0068643 | Ga0496106_0068643_1561_2343 | 257 |
| 930 | 3300048910 | Ga0496107_0000261 | Ga0496107_0000261_9486_10259 | 257 |
| 931 | 3300048910 | Ga0496107_0000264 | Ga0496107_0000264_1316_2098 | 257 |
| 932 | 3300048910 | Ga0496107_0097149 | Ga0496107_0097149_675_1448 | 257 |
| 933 | 3300048911 | Ga0496108_0014047 | Ga0496108_0014047_2310_3083 | 257 |
| 934 | 3300048911 | Ga0496108_0020733 | Ga0496108_0020733_4024_4806 | 257 |
| 935 | 3300048912 | Ga0496109_0000152 | Ga0496109_0000152_26336_27109 | 257 |
| 936 | 3300048912 | Ga0496109_0019674 | Ga0496109_0019674_4389_5171 | 257 |
| 937 | 3300048912 | Ga0496109_0352244 | Ga0496109_0352244_349_1122 | 257 |
| 938 | 3300048913 | Ga0496110_0001576 | Ga0496110_0001576_9970_10743 | 257 |
| 939 | 3300048914 | Ga0496111_0035267 | Ga0496111_0035267_433_1206 | 257 |
| 940 | 3300048914 | Ga0496111_0099170 | Ga0496111_0099170_309_1091 | 257 |
| 941 | 3300048915 | Ga0496112_0002426 | Ga0496112_0002426_10516_11298 | 257 |
| 942 | 3300048915 | Ga0496112_0184279 | Ga0496112_0184279_955_1731 | 257 |
| 943 | 3300048915 | Ga0496112_0264862 | Ga0496112_0264862_631_1404 | 257 |
| 944 | 3300048917 | Ga0496114_0000047 | Ga0496114_0000047_45752_46525 | 257 |
| 945 | 3300048917 | Ga0496114_0002699 | Ga0496114_0002699_11078_11860 | 257 |
| 946 | 3300048917 | Ga0496114_0038083 | Ga0496114_0038083_1507_2283 | 257 |
| 947 | 3300048917 | Ga0496114_0067999 | Ga0496114_0067999_1661_2434 | 257 |
| 948 | 3300048917 | Ga0496114_0663166 | Ga0496114_0663166_28_810 | 257 |
| 949 | 3300048918 | Ga0496115_0006427 | Ga0496115_0006427_1605_2387 | 257 |
| 950 | 3300048918 | Ga0496115_0021228 | Ga0496115_0021228_1824_2597 | 257 |
| 951 | 3300048918 | Ga0496115_0047070 | Ga0496115_0047070_2000_2773 | 257 |
| 952 | 3300048918 | Ga0496115_0129077 | Ga0496115_0129077_150_923 | 257 |
| 953 | 3300048918 | Ga0496115_0508164 | Ga0496115_0508164_138_914 | 257 |
| 954 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_290799_291572 | 257 |
| 955 | 3300048919 | Ga0496116_0000968 | Ga0496116_0000968_23740_24513 | 257 |
| 956 | 3300048919 | Ga0496116_0003154 | Ga0496116_0003154_2050_2823 | 257 |
| 957 | 3300048919 | Ga0496116_0005030 | Ga0496116_0005030_315_1091 | 257 |
| 958 | 3300048919 | Ga0496116_0008933 | Ga0496116_0008933_4666_5661 | 257 |
| 959 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_290799_291572 | 257 |
| 960 | 3300048920 | Ga0496117_0001082 | Ga0496117_0001082_22534_23307 | 257 |
| 961 | 3300048920 | Ga0496117_0027062 | Ga0496117_0027062_699_1478 | 257 |
| 962 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_290799_291572 | 257 |
| 963 | 3300048921 | Ga0496118_0001016 | Ga0496118_0001016_3289_4068 | 257 |
| 964 | 3300048921 | Ga0496118_0001424 | Ga0496118_0001424_33972_34745 | 257 |
| 965 | 3300048922 | Ga0496119_0000041 | Ga0496119_0000041_178228_179001 | 257 |
| 966 | 3300048922 | Ga0496119_0001956 | Ga0496119_0001956_20385_21158 | 257 |
| 967 | 3300048922 | Ga0496119_0012066 | Ga0496119_0012066_6065_6838 | 257 |
| 968 | 3300048923 | Ga0496120_0000027 | Ga0496120_0000027_22004_22777 | 257 |
| 969 | 3300048923 | Ga0496120_0014259 | Ga0496120_0014259_977_1750 | 257 |
| 970 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_125578_126351 | 257 |
| 971 | 3300048924 | Ga0496121_0002353 | Ga0496121_0002353_20234_21007 | 257 |
| 972 | 3300048924 | Ga0496121_0002460 | Ga0496121_0002460_16531_17304 | 257 |
| 973 | 3300048925 | Ga0496122_0000313 | Ga0496122_0000313_88081_88854 | 257 |
| 974 | 3300048925 | Ga0496122_0035029 | Ga0496122_0035029_645_1421 | 257 |
| 975 | 3300048925 | Ga0496122_0035956 | Ga0496122_0035956_2938_3933 | 257 |
| 976 | 3300048926 | Ga0496123_0006622 | Ga0496123_0006622_9263_10036 | 257 |
| 977 | 3300048926 | Ga0496123_0020859 | Ga0496123_0020859_1714_2490 | 257 |
| 978 | 3300048927 | Ga0496124_0000117 | Ga0496124_0000117_125578_126351 | 257 |
| 979 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_1063417_1064190 | 257 |
| 980 | 3300048928 | Ga0496125_0000368 | Ga0496125_0000368_83215_83991 | 257 |
| 981 | 3300048928 | Ga0496125_0024119 | Ga0496125_0024119_4641_5414 | 257 |
| 982 | 3300048928 | Ga0496125_0159015 | Ga0496125_0159015_75_1070 | 257 |
| 983 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_125578_126351 | 257 |
| 984 | 3300048929 | Ga0496126_0001241 | Ga0496126_0001241_352_1125 | 257 |
| 985 | 3300048929 | Ga0496126_0001576 | Ga0496126_0001576_23639_24415 | 257 |
| 986 | 3300048929 | Ga0496126_0005051 | Ga0496126_0005051_11690_12463 | 257 |
| 987 | 3300048929 | Ga0496126_0291949 | Ga0496126_0291949_505_1287 | 257 |
| 988 | 3300049569 | Ga0501032_0001371 | Ga0501032_0001371_7979_8752 | 257 |
| 989 | 3300049569 | Ga0501032_0003212 | Ga0501032_0003212_8402_9184 | 257 |
| 990 | 3300049569 | Ga0501032_0034563 | Ga0501032_0034563_552_1334 | 257 |
| 991 | 3300049569 | Ga0501032_0087365 | Ga0501032_0087365_35_808 | 257 |
| 992 | 3300049569 | Ga0501032_0097164 | Ga0501032_0097164_895_1668 | 257 |
| 993 | 3300049570 | Ga0501033_0072360 | Ga0501033_0072360_867_1649 | 257 |
| 994 | 3300049570 | Ga0501033_0145944 | Ga0501033_0145944_359_1132 | 257 |
| 995 | 3300049570 | Ga0501033_0185289 | Ga0501033_0185289_73_855 | 257 |
| 996 | 3300049571 | Ga0501034_0003796 | Ga0501034_0003796_13212_13985 | 257 |
| 997 | 3300049571 | Ga0501034_0013153 | Ga0501034_0013153_2963_3745 | 257 |
| 998 | 3300049571 | Ga0501034_0055948 | Ga0501034_0055948_1668_2450 | 257 |
| 999 | 3300049571 | Ga0501034_0229872 | Ga0501034_0229872_334_1107 | 257 |
| 1000 | 3300049571 | Ga0501034_0241354 | Ga0501034_0241354_631_1404 | 257 |
| 1001 | 3300049572 | Ga0501036_0034199 | Ga0501036_0034199_2017_2790 | 257 |
| 1002 | 3300049572 | Ga0501036_0059121 | Ga0501036_0059121_921_1703 | 257 |
| 1003 | 3300049573 | Ga0501037_0001970 | Ga0501037_0001970_3257_4030 | 257 |
| 1004 | 3300049573 | Ga0501037_0031564 | Ga0501037_0031564_540_1322 | 257 |
| 1005 | 3300049573 | Ga0501037_0147918 | Ga0501037_0147918_136_909 | 257 |
| 1006 | 3300049574 | Ga0501038_0004393 | Ga0501038_0004393_4002_4775 | 257 |
| 1007 | 3300049574 | Ga0501038_0071518 | Ga0501038_0071518_2121_2894 | 257 |
| 1008 | 3300049575 | Ga0501039_0003456 | Ga0501039_0003456_8497_9270 | 257 |
| 1009 | 3300049575 | Ga0501039_0380556 | Ga0501039_0380556_18_791 | 257 |
| 1010 | 3300049575 | Ga0501039_0615209 | Ga0501039_0615209_51_827 | 257 |
| 1011 | 3300049579 | Ga0501043_0002321 | Ga0501043_0002321_7851_8624 | 257 |
| 1012 | 3300049579 | Ga0501043_0003123 | Ga0501043_0003123_8528_9310 | 257 |
| 1013 | 3300049580 | Ga0501046_0005675 | Ga0501046_0005675_7396_8178 | 257 |
| 1014 | 3300049581 | Ga0501047_0027950 | Ga0501047_0027950_2343_3116 | 257 |
| 1015 | 3300049581 | Ga0501047_0038850 | Ga0501047_0038850_2783_3565 | 257 |
| 1016 | 3300049581 | Ga0501047_0044212 | Ga0501047_0044212_732_1505 | 257 |
| 1017 | 3300049581 | Ga0501047_0243678 | Ga0501047_0243678_28_801 | 257 |
| 1018 | 3300049581 | Ga0501047_0243871 | Ga0501047_0243871_656_1438 | 257 |
| 1019 | 3300049582 | Ga0501048_0023055 | Ga0501048_0023055_171_953 | 257 |
| 1020 | 3300049585 | Ga0501069_0014362 | Ga0501069_0014362_1353_2135 | 257 |
| 1021 | 3300049585 | Ga0501069_0066502 | Ga0501069_0066502_315_1088 | 257 |
| 1022 | 3300049586 | Ga0501070_0000288 | Ga0501070_0000288_19898_20680 | 257 |
| 1023 | 3300049586 | Ga0501070_0002522 | Ga0501070_0002522_2331_3104 | 257 |
| 1024 | 3300049589 | Ga0501073_0021631 | Ga0501073_0021631_2112_2885 | 257 |
| 1025 | 3300049589 | Ga0501073_0044334 | Ga0501073_0044334_1497_2279 | 257 |
| 1026 | 3300049591 | Ga0501075_0075742 | Ga0501075_0075742_929_1708 | 257 |
| 1027 | 3300049592 | Ga0501076_0003829 | Ga0501076_0003829_3568_4347 | 257 |
| 1028 | 3300049593 | Ga0501077_0003493 | Ga0501077_0003493_1976_2755 | 257 |
| 1029 | 3300049593 | Ga0501077_0158856 | Ga0501077_0158856_147_920 | 257 |
| 1030 | 3300049741 | Ga0501079_0168591 | Ga0501079_0168591_626_1405 | 257 |
| 1031 | 3300049742 | Ga0501080_0101408 | Ga0501080_0101408_1415_2197 | 257 |
| 1032 | 3300049743 | Ga0501081_0002149 | Ga0501081_0002149_7193_7972 | 257 |
| 1033 | 3300049744 | Ga0501083_0134476 | Ga0501083_0134476_822_1595 | 257 |
| 1034 | 3300049822 | Ga0501035_0001318 | Ga0501035_0001318_4490_5272 | 257 |
| 1035 | 3300049822 | Ga0501035_0001771 | Ga0501035_0001771_11846_12628 | 257 |
| 1036 | 3300049822 | Ga0501035_0033079 | Ga0501035_0033079_2388_3161 | 257 |
| 1037 | 3300049822 | Ga0501035_0328769 | Ga0501035_0328769_443_1219 | 257 |
| 1038 | 3300049822 | Ga0501035_0633865 | Ga0501035_0633865_10_783 | 257 |
| 1039 | 3300049823 | Ga0501044_0000554 | Ga0501044_0000554_10371_11153 | 257 |
| 1040 | 3300049823 | Ga0501044_0002733 | Ga0501044_0002733_1090_1872 | 257 |
| 1041 | 3300049823 | Ga0501044_0032103 | Ga0501044_0032103_2628_3401 | 257 |
| 1042 | 3300049823 | Ga0501044_0068070 | Ga0501044_0068070_1280_2053 | 257 |
| 1043 | 3300049823 | Ga0501044_0159904 | Ga0501044_0159904_821_1612 | 257 |
| 1044 | 3300049823 | Ga0501044_0455494 | Ga0501044_0455494_26_799 | 257 |
| 1045 | 3300050490 | nmdc:mga03n38_21264_c1 | nmdc:mga03n38_21264_c1_874_1647 | 257 |
| 1046 | 3300050491 | nmdc:mga00v17_31853_c1 | nmdc:mga00v17_31853_c1_312_1094 | 257 |
| 1047 | 3300050491 | nmdc:mga00v17_344296_c1 | nmdc:mga00v17_344296_c1_106_879 | 257 |
| 1048 | 3300050492 | nmdc:mga0yw44_18995_c1 | nmdc:mga0yw44_18995_c1_181_954 | 257 |
| 1049 | 3300050492 | nmdc:mga0yw44_29042_c1 | nmdc:mga0yw44_29042_c1_155_928 | 257 |
| 1050 | 3300050494 | nmdc:mga06z11_336241_c1 | nmdc:mga06z11_336241_c1_72_854 | 257 |
| 1051 | 3300050496 | nmdc:mga07m45_27607_c1 | nmdc:mga07m45_27607_c1_2262_3044 | 257 |
| 1052 | 3300050507 | nmdc:mga05p37_111_c2 | nmdc:mga05p37_111_c2_4815_5588 | 257 |
| 1053 | 3300050508 | nmdc:mga09592_137_c1 | nmdc:mga09592_137_c1_16280_17053 | 257 |
| 1054 | 3300050508 | nmdc:mga09592_453402_c1 | nmdc:mga09592_453402_c1_139_939 | 257 |
| 1055 | 3300050509 | nmdc:mga0qj67_2255_c1 | nmdc:mga0qj67_2255_c1_9904_10677 | 257 |
| 1056 | 3300050510 | nmdc:mga06r32_526_c1 | nmdc:mga06r32_526_c1_4695_5468 | 257 |
| 1057 | 3300050511 | nmdc:mga08y16_1030_c1 | nmdc:mga08y16_1030_c1_4829_5602 | 257 |
| 1058 | 3300050512 | nmdc:mga0n895_331_c1 | nmdc:mga0n895_331_c1_25982_26755 | 257 |
| 1059 | 3300050513 | nmdc:mga0rr50_5720_c1 | nmdc:mga0rr50_5720_c1_1388_2161 | 257 |
| 1060 | 3300050513 | nmdc:mga0rr50_60211_c1 | nmdc:mga0rr50_60211_c1_464_1240 | 257 |
| 1061 | 3300050515 | nmdc:mga0a205_50_c1 | nmdc:mga0a205_50_c1_20223_20996 | 257 |
| 1062 | 3300050516 | nmdc:mga0sz30_3889_c1 | nmdc:mga0sz30_3889_c1_2821_3594 | 257 |
| 1063 | 3300050516 | nmdc:mga0sz30_8058_c1 | nmdc:mga0sz30_8058_c1_3130_3906 | 257 |
| 1064 | 3300053077 | Ga0495601_0017212 | Ga0495601_0017212_1569_2342 | 257 |
| 1065 | 3300053078 | Ga0495612_0006121 | Ga0495612_0006121_2573_3346 | 257 |
| 1066 | 3300053079 | Ga0500610_0005980 | Ga0500610_0005980_833_1606 | 257 |
| 1067 | 3300053080 | Ga0500635_0072227 | Ga0500635_0072227_219_1004 | 257 |
| 1068 | 3300053084 | Ga0495595_0002756 | Ga0495595_0002756_3007_3780 | 257 |
| 1069 | 3300053084 | Ga0495595_0095490 | Ga0495595_0095490_497_1270 | 257 |
| 1070 | 3300053085 | Ga0495619_0000461 | Ga0495619_0000461_18078_18851 | 257 |
| 1071 | 3300053085 | Ga0495619_0029565 | Ga0495619_0029565_1387_2160 | 257 |
| 1072 | 3300053087 | Ga0500643_007238 | Ga0500643_007238_3194_3979 | 257 |
| 1073 | 3300053087 | Ga0500643_014858 | Ga0500643_014858_45_818 | 257 |
| 1074 | 3300053093 | Ga0500651_0029835 | Ga0500651_0029835_37_813 | 257 |
| 1075 | 3300053104 | Ga0500556_0021621 | Ga0500556_0021621_352_1125 | 257 |
| 1076 | 3300053119 | Ga0500595_002529 | Ga0500595_002529_5594_6370 | 257 |
| 1077 | 3300053141 | Ga0500574_003599 | Ga0500574_003599_368_1144 | 257 |
| 1078 | 3300053730 | Ga0500645_000046 | Ga0500645_000046_3864_4649 | 257 |
| 1079 | 3300054114 | Ga0501084_0003046 | Ga0501084_0003046_3628_4407 | 257 |
| 1080 | 3300054114 | Ga0501084_0390617 | Ga0501084_0390617_33_815 | 257 |
| 1081 | 3300059510 | Ga0587090_000758 | Ga0587090_000758_1747_2523 | 257 |
| 1082 | 3300059624 | Ga0587109_032831 | Ga0587109_032831_65_946 | 257 |
| 1083 | 3300059655 | Ga0587114_016201 | Ga0587114_016201_45_926 | 257 |
| 1084 | 3300059657 | Ga0587118_04109 | Ga0587118_04109_48_929 | 257 |
| 1085 | 3300060353 | Ga0501082_0013704 | Ga0501082_0013704_3636_4415 | 257 |
| 1086 | 3300060353 | Ga0501082_0368015 | Ga0501082_0368015_387_1160 | 257 |
| 1087 | 3300060353 | Ga0501082_0606004 | Ga0501082_0606004_131_904 | 257 |
| 1088 | 3300061719 | Ga0466962_0013821 | Ga0466962_0013821_2542_3318 | 257 |
| 1089 | 3300061719 | Ga0466962_0024354 | Ga0466962_0024354_1930_2712 | 257 |
| 1090 | 3300061719 | Ga0466962_0099574 | Ga0466962_0099574_150_926 | 257 |
| 1091 | 3300061719 | Ga0466962_0247926 | Ga0466962_0247926_25_807 | 257 |
| 1092 | 3300061734 | Ga0530510_0355470 | Ga0530510_0355470_86_865 | 257 |
| 1093 | iso_pu_bacteria | 2738541274 | 2738704898 | 257 |
| 1094 | iso_pu_bacteria | 2738543028 | 2739330068 | 257 |
| 1095 | iso_pu_bacteria | 2738543034 | 2739367112 | 257 |
| 1096 | iso_pu_bacteria | 2902799365 | 2902803416 | 257 |
| 1097 | iso_pu_bacteria | 2984523437 | 2984524758 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pzk-assembly1.cif.gz_A | crystal structure of the mycobacterium tuberculosis crotonase in apo form | 0.9958 | 2 | 255 |
| 4fjw-assembly1.cif.gz_D | crystal structure of the apo form of the e131q mtb crotonase | 0.9944 | 1 | 256 |
| 3h81-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis | 0.993 | 2 | 257 |
| 3q0g-assembly1.cif.gz_A | crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa | 0.9924 | 2 | 256 |
| 3pzk-assembly1.cif.gz_A | crystal structure of the mycobacterium tuberculosis crotonase in apo form | 0.9917 | 2 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76082_198_255_1.10.12.10 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 1.003 | 202 | 257 | 1.10.12.10 |
| 3q0gD02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 1.003 | 202 | 255 | 1.10.12.10 |
| 3h81A02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 1.002 | 202 | 257 | 1.10.12.10 |
| af_P30084_233_289_1.10.12.10 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 1.002 | 206 | 255 | 1.10.12.10 |
| 3q0gA02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 1.002 | 202 | 256 | 1.10.12.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8M4F8-F1-model_v4 | deleted | 0.9999 | 1 | 209 |
|
| AF-A0A354TYN4-F1-model_v4 | deleted | 0.9999 | 65 | 255 |
|
| AF-A0A445NIZ9-F1-model_v4 | deleted | 0.9997 | 1 | 257 |
|
| AF-A0A5C7MZ08-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9996 | 73 | 257 |
GO:0004300
GO:0006635 |
| AF-X8FJU2-F1-model_v4 | deleted | 0.9987 | 1 | 257 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar