F490006

General Info

Members Datasets Scaffolds Average Seq Length
1097 492 1068 258

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0008933|Ga0496116_0008933_4666_5661
Length 312
Sequence MNRTAKSNKASQKVAQRKPVTAAKKAKVHTKVARRVVAKPTKLITNKRHFSTEAAPAEMMIASETKGRVGIVRLNRPKALNALCDQLITELTAQLKAYNEDPKIAAIIITGSDKAFAAGADIKEMADQTYMTAYKKNMLAFWHDFTHFQKPTIAAVNGYALGGGCELAMMCDIIIAGEKAKFGQPEVKIGTIPGCGGTQRLTRAVGKSKAMEWILTGDMFTAQQAESAGLVSRVVPVDKLMDEAMATAEKIAKNSIPIIALAKESVNAAYETTLQQGVVFERRLFHSTFAISDQKEGMGAFKDKREPSFKDE

Samples

Sample ID Description Type Environment
1 2511231021 Pseudomonas sp. GM78 Isolate Nodule
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
8 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
13 2773857759 Microbacterium sp. 1294 Isolate Unclassified
14 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
15 2818991436 Collimonas arenae 515 Isolate Unclassified
16 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
17 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
18 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
19 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
20 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
21 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
22 2920879853 Kocuria salina CV6 Isolate Unclassified
23 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
24 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
25 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
26 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
27 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
32 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
33 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
40 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
41 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
42 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
43 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
46 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
123 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
137 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
138 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
142 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
143 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
144 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
146 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
173 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
176 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
177 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
252 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
253 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
254 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
255 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
263 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
264 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
265 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
266 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
288 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
291 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
292 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
296 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
299 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
300 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
301 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
302 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
308 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
309 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
310 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
311 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
312 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
313 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
314 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
315 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
316 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
317 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
322 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
323 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
324 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
325 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
326 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
327 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
328 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
329 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
332 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
333 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
334 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
335 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
336 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
337 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
344 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
348 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
351 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
352 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
360 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
364 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
367 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
368 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
369 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
378 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
393 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
438 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
439 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
440 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
441 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
442 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
443 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
448 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
452 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
453 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
454 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
455 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
456 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
457 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
458 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
459 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
460 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
461 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
462 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
463 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
464 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
465 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
466 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
469 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
470 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
471 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
475 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
478 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
479 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
480 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
481 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
482 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
483 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
489 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
490 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
491 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
492 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0.64
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 7.93
Nodule 0.18
Rhizoplane 6.56
Rhizosphere 77.03
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1010763 3300000546 Bacteria 976
2 JGI24744J21845_10001840 3300002077 Bacteria 4258
3 JGI24742J22300_10003712 3300002244 Bacteria 2479
4 JGI25162J39368_1000598 3300002737 Bacteria 26161
5 JGI25158J39367_1002218 3300002739 Bacteria 3230
6 JGI25163J39215_1004202 3300002771 Bacteria 1041
7 JGI25159J45721_1000001 3300002987 Bacteria 303489
8 JGI25159J45721_1005684 3300002987 Bacteria 3868
9 JGI25151J46595_10000672 3300003187 Bacteria 28951
10 JGI25406J46586_10000563 3300003203 Bacteria 17507
11 JGI25165J46597_1000713 3300003214 Bacteria 26161
12 rootH1_10054217 3300003316 Bacteria 2159
13 JGI25160J50197_1000002 3300003354 Bacteria 561707
14 JGI25161J50226_1002505 3300003374 Bacteria 4672
15 Ga0055538_1000281 3300003751 Bacteria 26161
16 Ga0055539_1000305 3300003752 Bacteria 26161
17 Ga0055533_1000286 3300003756 Bacteria 26161
18 Ga0055525_1000405 3300003759 Bacteria 26891
19 Ga0055540_1000702 3300003792 Bacteria 23030
20 Ga0055540_1000980 3300003792 Bacteria 18425
21 Ga0055541_1000198 3300003841 Bacteria 26161
22 Ga0055543_1000010 3300004625 Bacteria 198371
23 Ga0065165_1000004 3300005262 Bacteria 377081
24 Ga0065165_1002857 3300005262 Bacteria 13394
25 Ga0070658_10003541 3300005327 Bacteria 12818
26 Ga0070658_10025550 3300005327 Bacteria 4735
27 Ga0070658_10040353 3300005327 Bacteria 3765
28 Ga0070676_10146297 3300005328 Bacteria 1509
29 Ga0070683_100110989 3300005329 Bacteria 2587
30 Ga0070670_100000020 3300005331 Bacteria 215458
31 Ga0070670_100045141 3300005331 Bacteria 3788
32 Ga0070666_10024729 3300005335 Bacteria 3915
33 Ga0070682_100022524 3300005337 Bacteria 3733
34 Ga0068868_100005133 3300005338 Bacteria 9196
35 Ga0068868_100116928 3300005338 Bacteria 2172
36 Ga0068868_100216232 3300005338 Bacteria 1603
37 Ga0070660_100022139 3300005339 Bacteria 4696
38 Ga0070660_100243003 3300005339 Bacteria 1467
39 Ga0070660_100382068 3300005339 Bacteria 1163
40 Ga0070689_100031249 3300005340 Bacteria 4046
41 Ga0070691_10043297 3300005341 Bacteria 2133
42 Ga0070687_100289269 3300005343 Bacteria 1035
43 Ga0070661_100025891 3300005344 Bacteria 4216
44 Ga0070661_100161357 3300005344 Bacteria 1698
45 Ga0070692_10000346 3300005345 Bacteria 13515
46 Ga0070692_10086494 3300005345 Bacteria 1697
47 Ga0070668_100002097 3300005347 Bacteria 14580
48 Ga0070668_100204665 3300005347 Bacteria 1621
49 Ga0070668_100467222 3300005347 Bacteria 1087
50 Ga0070669_100003646 3300005353 Bacteria 11103
51 Ga0070669_100006848 3300005353 Bacteria 8197
52 Ga0070669_100126647 3300005353 Bacteria 1955
53 Ga0070675_100059478 3300005354 Bacteria 3152
54 Ga0070675_100105956 3300005354 Bacteria 2373
55 Ga0070671_100003533 3300005355 Bacteria 12222
56 Ga0070671_100087697 3300005355 Bacteria 2604
57 Ga0070674_100122707 3300005356 Bacteria 1925
58 Ga0070674_100127923 3300005356 Bacteria 1890
59 Ga0070674_100170237 3300005356 Bacteria 1660
60 Ga0070674_100350332 3300005356 Bacteria 1192
61 Ga0070673_100336251 3300005364 Bacteria 1337
62 Ga0070688_100025163 3300005365 Bacteria 3522
63 Ga0070659_100001752 3300005366 Bacteria 15587
64 Ga0070659_100110797 3300005366 Bacteria 2216
65 Ga0070667_100000118 3300005367 Bacteria 100395
66 Ga0070667_100000190 3300005367 Bacteria 73682
67 Ga0070667_100000658 3300005367 Bacteria 33550
68 Ga0070667_100007906 3300005367 Bacteria 8819
69 Ga0070667_100015478 3300005367 Bacteria 6307
70 Ga0070709_10002573 3300005434 Bacteria 9812
71 Ga0070709_10055126 3300005434 Bacteria 2509
72 Ga0070714_100162127 3300005435 Bacteria 2024
73 Ga0070713_100013539 3300005436 Bacteria 6028
74 Ga0070713_100524489 3300005436 Bacteria 1119
75 Ga0070710_10017543 3300005437 Bacteria 3665
76 Ga0070710_10186310 3300005437 Bacteria 1303
77 Ga0070701_10008518 3300005438 Bacteria 4441
78 Ga0070711_100000220 3300005439 Bacteria 30189
79 Ga0070711_100146690 3300005439 Bacteria 1775
80 Ga0070705_100070313 3300005440 Bacteria 2114
81 Ga0070705_100094783 3300005440 Bacteria 1870
82 Ga0070700_100364968 3300005441 Bacteria 1075
83 Ga0070694_100000117 3300005444 Bacteria 38520
84 Ga0070694_100012696 3300005444 Bacteria 5244
85 Ga0070694_100203760 3300005444 Bacteria 1476
86 Ga0070694_100219954 3300005444 Bacteria 1424
87 Ga0070708_100002549 3300005445 Bacteria 14082
88 Ga0070708_100017079 3300005445 Bacteria 6043
89 Ga0070708_100070754 3300005445 Bacteria 3139
90 Ga0070708_100262095 3300005445 Bacteria 1625
91 Ga0070663_100195322 3300005455 Bacteria 1577
92 Ga0070678_100000231 3300005456 Bacteria 25410
93 Ga0070678_100054293 3300005456 Bacteria 2919
94 Ga0070678_100069019 3300005456 Bacteria 2638
95 Ga0070678_100138005 3300005456 Bacteria 1947
96 Ga0070678_100600170 3300005456 Bacteria 983
97 Ga0070662_100003854 3300005457 Bacteria 9404
98 Ga0070662_100203518 3300005457 Bacteria 1572
99 Ga0070662_100256533 3300005457 Bacteria 1407
100 Ga0070681_10156098 3300005458 Bacteria 2207
101 Ga0070681_10188930 3300005458 Bacteria 1980
102 Ga0070681_10535474 3300005458 Bacteria 1085
103 Ga0068867_100056402 3300005459 Bacteria 2907
104 Ga0068867_100096189 3300005459 Bacteria 2254
105 Ga0068867_100260392 3300005459 Bacteria 1414
106 Ga0070706_100000386 3300005467 Bacteria 52878
107 Ga0070706_100033105 3300005467 Bacteria 4770
108 Ga0070707_100086462 3300005468 Bacteria 3032
109 Ga0070707_100313297 3300005468 Bacteria 1525
110 Ga0070707_100344019 3300005468 Bacteria 1449
111 Ga0070698_100063592 3300005471 Bacteria 3721
112 Ga0070699_100016226 3300005518 Bacteria 6393
113 Ga0070699_100244679 3300005518 Bacteria 1602
114 Ga0070699_100262805 3300005518 Bacteria 1544
115 Ga0070679_100031622 3300005530 Bacteria 5230
116 Ga0070679_100045536 3300005530 Bacteria 4372
117 Ga0070679_100161498 3300005530 Bacteria 2215
118 Ga0070679_100356591 3300005530 Bacteria 1410
119 Ga0070684_100171621 3300005535 Bacteria 1970
120 Ga0070697_100004974 3300005536 Bacteria 10206
121 Ga0070697_100006640 3300005536 Bacteria 8970
122 Ga0068853_100002612 3300005539 Bacteria 13547
123 Ga0068853_100046750 3300005539 Bacteria 3712
124 Ga0068853_100047221 3300005539 Bacteria 3695
125 Ga0068853_100204631 3300005539 Bacteria 1797
126 Ga0068853_100653364 3300005539 Bacteria 1001
127 Ga0070695_100003240 3300005545 Bacteria 9499
128 Ga0070695_100075322 3300005545 Bacteria 2220
129 Ga0070695_100219480 3300005545 Bacteria 1369
130 Ga0070696_100000829 3300005546 Bacteria 19923
131 Ga0070696_100050408 3300005546 Bacteria 2894
132 Ga0070693_100012908 3300005547 Bacteria 4242
133 Ga0070693_100166395 3300005547 Bacteria 1409
134 Ga0070665_100000419 3300005548 Bacteria 62030
135 Ga0070665_100001988 3300005548 Bacteria 23002
136 Ga0070665_100609506 3300005548 Bacteria 1105
137 Ga0070704_100002414 3300005549 Bacteria 10494
138 Ga0070704_100004068 3300005549 Bacteria 8441
139 Ga0070704_100037402 3300005549 Bacteria 3316
140 Ga0068855_100047049 3300005563 Bacteria 5097
141 Ga0068855_100084417 3300005563 Bacteria 3677
142 Ga0068855_100630288 3300005563 Bacteria 1153
143 Ga0070664_100039694 3300005564 Bacteria 3967
144 Ga0068854_100000198 3300005578 Bacteria 40596
145 Ga0068854_100077559 3300005578 Bacteria 2446
146 Ga0068854_100202328 3300005578 Bacteria 1562
147 Ga0068856_100252974 3300005614 Bacteria 1777
148 Ga0068856_100719261 3300005614 Bacteria 1019
149 Ga0070702_100000682 3300005615 Bacteria 12751
150 Ga0070702_100156436 3300005615 Bacteria 1468
151 Ga0068852_100004074 3300005616 Bacteria 10282
152 Ga0068852_100206654 3300005616 Bacteria 1860
153 Ga0068859_100001075 3300005617 Bacteria 27961
154 Ga0068859_100003525 3300005617 Bacteria 15932
155 Ga0068859_100015720 3300005617 Bacteria 7606
156 Ga0068859_100031870 3300005617 Bacteria 5295
157 Ga0068859_100046450 3300005617 Bacteria 4361
158 Ga0068864_100000206 3300005618 Bacteria 53509
159 Ga0068864_100138140 3300005618 Bacteria 2196
160 Ga0068866_10000535 3300005718 Bacteria 17395
161 Ga0068861_100000696 3300005719 Bacteria 20143
162 Ga0068861_100110753 3300005719 Bacteria 2199
163 Ga0068861_100179360 3300005719 Bacteria 1762
164 Ga0068863_100000071 3300005841 Bacteria 115525
165 Ga0068863_100001658 3300005841 Bacteria 22010
166 Ga0068863_100028731 3300005841 Bacteria 5309
167 Ga0068858_100013158 3300005842 Bacteria 7801
168 Ga0068858_100015779 3300005842 Bacteria 7105
169 Ga0068858_100019858 3300005842 Bacteria 6282
170 Ga0068860_100000099 3300005843 Bacteria 145436
171 Ga0068860_100000205 3300005843 Bacteria 93929
172 Ga0068860_100000954 3300005843 Bacteria 31985
173 Ga0068860_100003120 3300005843 Bacteria 17129
174 Ga0068862_100000057 3300005844 Bacteria 140795
175 Ga0068862_100000086 3300005844 Bacteria 110489
176 Ga0068862_100013447 3300005844 Bacteria 6774
177 Ga0068862_100144308 3300005844 Bacteria 2114
178 Ga0081455_10000453 3300005937 Bacteria 53921
179 Ga0081455_10005282 3300005937 Bacteria 14190
180 Ga0081455_10032235 3300005937 Bacteria 4725
181 Ga0081455_10084834 3300005937 Bacteria 2584
182 Ga0081455_10199039 3300005937 Bacteria 1502
183 Ga0081538_10025003 3300005981 Bacteria 4233
184 Ga0081540_1029206 3300005983 Bacteria 3077
185 Ga0081539_10050344 3300005985 Bacteria 2358
186 Ga0070717_10021477 3300006028 Bacteria 5087
187 Ga0070717_10049176 3300006028 Bacteria 3460
188 Ga0070717_10200199 3300006028 Bacteria 1749
189 Ga0070717_10255901 3300006028 Bacteria 1548
190 Ga0070717_10291271 3300006028 Bacteria 1450
191 Ga0075365_10031894 3300006038 Bacteria 3384
192 Ga0075368_10013438 3300006042 Bacteria 3007
193 Ga0075363_100065606 3300006048 Bacteria 1963
194 Ga0075364_10003638 3300006051 Bacteria 8794
195 Ga0075364_10008968 3300006051 Bacteria 5989
196 Ga0075364_10080880 3300006051 Bacteria 2148
197 Ga0075364_10374158 3300006051 Bacteria 972
198 Ga0075432_10000194 3300006058 Bacteria 15798
199 Ga0075432_10012711 3300006058 Bacteria 2860
200 Ga0075432_10015901 3300006058 Bacteria 2569
201 Ga0070715_10002296 3300006163 Bacteria 5830
202 Ga0070716_100305982 3300006173 Bacteria 1108
203 Ga0070716_100334580 3300006173 Bacteria 1066
204 Ga0070712_100000493 3300006175 Bacteria 22536
205 Ga0070712_100007822 3300006175 Bacteria 6693
206 Ga0070712_100197867 3300006175 Bacteria 1577
207 Ga0070712_100207337 3300006175 Bacteria 1544
208 Ga0075367_10009109 3300006178 Bacteria 5172
209 Ga0075367_10110737 3300006178 Bacteria 1685
210 Ga0075369_10000808 3300006186 Bacteria 10271
211 Ga0075369_10002242 3300006186 Bacteria 6854
212 Ga0075369_10187789 3300006186 Bacteria 952
213 Ga0075366_10003168 3300006195 Bacteria 8617
214 Ga0075366_10021721 3300006195 Bacteria 3731
215 Ga0075366_10376802 3300006195 Bacteria 872
216 Ga0097621_100032821 3300006237 Bacteria 4130
217 Ga0097621_100062455 3300006237 Bacteria 3058
218 Ga0097621_100370368 3300006237 Bacteria 1278
219 Ga0075370_10013728 3300006353 Bacteria 4311
220 Ga0075370_10035515 3300006353 Bacteria 2798
221 Ga0068871_100064969 3300006358 Bacteria 2988
222 Ga0068871_100176800 3300006358 Bacteria 1832
223 Ga0075428_100009454 3300006844 Bacteria 10823
224 Ga0075430_100000129 3300006846 Bacteria 47714
225 Ga0075431_100000948 3300006847 Bacteria 25623
226 Ga0075431_100005861 3300006847 Bacteria 12157
227 Ga0075431_100007219 3300006847 Bacteria 11055
228 Ga0075431_100069140 3300006847 Bacteria 3644
229 Ga0075431_100070913 3300006847 Bacteria 3595
230 Ga0075433_10000100 3300006852 Bacteria 41448
231 Ga0075433_10029228 3300006852 Bacteria 4694
232 Ga0075434_100001229 3300006871 Bacteria 21306
233 Ga0075434_100056186 3300006871 Bacteria 3912
234 Ga0075434_100092646 3300006871 Bacteria 3024
235 Ga0075434_100386342 3300006871 Bacteria 1421
236 Ga0075434_100606672 3300006871 Bacteria 1113
237 Ga0075429_100000278 3300006880 Bacteria 36057
238 Ga0075429_100033426 3300006880 Bacteria 4469
239 Ga0075429_100195689 3300006880 Bacteria 1771
240 Ga0068865_100004610 3300006881 Bacteria 8322
241 Ga0075436_100005498 3300006914 Bacteria 8713
242 Ga0075436_100061696 3300006914 Bacteria 2590
243 Ga0075436_100307460 3300006914 Bacteria 1137
244 Ga0097620_100001075 3300006931 Bacteria 27961
245 Ga0097620_100003525 3300006931 Bacteria 15932
246 Ga0097620_100015720 3300006931 Bacteria 7606
247 Ga0097620_100031871 3300006931 Bacteria 5295
248 Ga0097620_100046450 3300006931 Bacteria 4361
249 Ga0075435_100051450 3300007076 Bacteria 3318
250 Ga0075435_100293300 3300007076 Bacteria 1390
251 Ga0075435_100368178 3300007076 Bacteria 1233
252 Ga0099794_10005388 3300007265 Bacteria 5122
253 Ga0099794_10007960 3300007265 Bacteria 4382
254 Ga0099794_10011070 3300007265 Bacteria 3854
255 Ga0099794_10012928 3300007265 Bacteria 3620
256 Ga0099794_10029642 3300007265 Bacteria 2550
257 Ga0099795_10050943 3300007788 Bacteria 1508
258 Ga0105240_10002741 3300009093 Bacteria 27878
259 Ga0111539_10001748 3300009094 Bacteria 28854
260 Ga0111539_10010096 3300009094 Bacteria 11901
261 Ga0105245_10001366 3300009098 Bacteria 22092
262 Ga0105245_10006252 3300009098 Bacteria 10478
263 Ga0105245_10288875 3300009098 Bacteria 1606
264 Ga0105245_10299469 3300009098 Bacteria 1577
265 Ga0105245_10490037 3300009098 Bacteria 1244
266 Ga0105247_10000051 3300009101 Bacteria 145981
267 Ga0105247_10000094 3300009101 Bacteria 96396
268 Ga0105247_10000698 3300009101 Bacteria 26249
269 Ga0105247_10132205 3300009101 Bacteria 1627
270 Ga0114129_10002143 3300009147 Bacteria 27207
271 Ga0114129_10005210 3300009147 Bacteria 18321
272 Ga0114129_10017959 3300009147 Bacteria 10073
273 Ga0114129_10176827 3300009147 Bacteria 2907
274 Ga0114129_10182145 3300009147 Bacteria 2857
275 Ga0105243_10001379 3300009148 Bacteria 21532
276 Ga0105243_10344436 3300009148 Bacteria 1366
277 Ga0105242_10051642 3300009176 Bacteria 3351
278 Ga0105242_10060441 3300009176 Bacteria 3114
279 Ga0105248_10000281 3300009177 Bacteria 60208
280 Ga0105248_10017837 3300009177 Bacteria 7835
281 Ga0105248_10028311 3300009177 Bacteria 6242
282 Ga0105248_10030113 3300009177 Bacteria 6058
283 Ga0105248_10101242 3300009177 Bacteria 3247
284 Ga0105248_10352507 3300009177 Bacteria 1657
285 Ga0105248_10608605 3300009177 Bacteria 1233
286 Ga0105248_10722386 3300009177 Bacteria 1124
287 Ga0105248_11074248 3300009177 Bacteria 909
288 Ga0105237_10007876 3300009545 Bacteria 11613
289 Ga0105237_10048690 3300009545 Bacteria 4260
290 Ga0105237_10087058 3300009545 Bacteria 3113
291 Ga0105238_10000412 3300009551 Bacteria 45119
292 Ga0105238_10055286 3300009551 Bacteria 3985
293 Ga0105238_10266682 3300009551 Bacteria 1693
294 Ga0105249_10000020 3300009553 Bacteria 260634
295 Ga0105249_10008943 3300009553 Bacteria 8749
296 Ga0105249_10009971 3300009553 Bacteria 8332
297 Ga0105239_10066546 3300010375 Bacteria 3958
298 Ga0105239_10163162 3300010375 Bacteria 2490
299 Ga0105239_10305627 3300010375 Bacteria 1792
300 Ga0105239_10318804 3300010375 Bacteria 1752
301 Ga0105246_10035410 3300011119 Bacteria 3336
302 Ga0157370_10067625 3300013104 Bacteria 3377
303 Ga0157370_10219539 3300013104 Bacteria 1761
304 Ga0157374_10003582 3300013296 Bacteria 13075
305 Ga0157374_10038300 3300013296 Bacteria 4406
306 Ga0157378_10012499 3300013297 Bacteria 7431
307 Ga0157378_10536164 3300013297 Bacteria 1174
308 Ga0163162_10002550 3300013306 Bacteria 17237
309 Ga0163162_10030910 3300013306 Bacteria 5309
310 Ga0163162_10062258 3300013306 Bacteria 3772
311 Ga0163162_10226125 3300013306 Bacteria 2001
312 Ga0157372_10006318 3300013307 Bacteria 12605
313 Ga0157372_10018790 3300013307 Bacteria 7435
314 Ga0157372_10053351 3300013307 Bacteria 4506
315 Ga0157372_10072158 3300013307 Bacteria 3890
316 Ga0157372_10287839 3300013307 Bacteria 1911
317 Ga0157372_10576008 3300013307 Bacteria 1312
318 Ga0157375_10000478 3300013308 Bacteria 36449
319 Ga0163163_10136668 3300014325 Bacteria 2492
320 Ga0163163_10243197 3300014325 Bacteria 1849
321 Ga0157380_10000372 3300014326 Bacteria 26981
322 Ga0157377_10013849 3300014745 Bacteria 4089
323 Ga0157379_10000949 3300014968 Bacteria 23517
324 Ga0157379_10008683 3300014968 Bacteria 8849
325 Ga0157379_10019585 3300014968 Bacteria 5977
326 Ga0157379_10029929 3300014968 Bacteria 4842
327 Ga0157379_10908118 3300014968 Bacteria 836
328 Ga0157376_10408572 3300014969 Bacteria 1314
329 Ga0182005_1001434 3300015265 Bacteria 9601
330 Ga0163161_10000595 3300017792 Bacteria 28928
331 Ga0206350_10788292 3300020080 Eukaryota 1202
332 Ga0206354_11469071 3300020081 Eukaryota 1592
333 Ga0206353_10536454 3300020082 Eukaryota 2645
334 Ga0213872_10000430 3300021361 Bacteria 34377
335 Ga0213872_10004434 3300021361 Bacteria 7457
336 Ga0213874_10016992 3300021377 Bacteria 1945
337 Ga0213876_10000150 3300021384 Bacteria 74357
338 Ga0213876_10039528 3300021384 Bacteria 2493
339 Ga0213876_10104246 3300021384 Bacteria 1504
340 Ga0213876_10104480 3300021384 Bacteria 1502
341 Ga0213876_10248192 3300021384 Bacteria 946
342 Ga0224572_1029510 3300024225 Bacteria 1049
343 Ga0209436_100076 3300025208 Bacteria 50420
344 Ga0209784_100010 3300025224 Bacteria 683664
345 Ga0209566_100008 3300025225 Bacteria 683664
346 Ga0209674_100019 3300025226 Bacteria 683664
347 Ga0209672_103283 3300025228 Bacteria 3421
348 Ga0209563_100021 3300025230 Bacteria 683764
349 Ga0207427_100759 3300025231 Bacteria 14690
350 Ga0209437_100019 3300025233 Bacteria 683764
351 Ga0209026_1007808 3300025250 Bacteria 2332
352 Ga0209677_100011 3300025253 Bacteria 683664
353 Ga0209233_1000025 3300025261 Bacteria 683764
354 Ga0209673_1016009 3300025273 Bacteria 2821
355 Ga0209130_1000008 3300025284 Bacteria 581232
356 Ga0209130_1000169 3300025284 Bacteria 95167
357 Ga0209025_1000636 3300025294 Bacteria 62083
358 Ga0207426_1000016 3300025302 Bacteria 581232
359 Ga0209051_1000108 3300025303 Bacteria 155280
360 Ga0209051_1001757 3300025303 Bacteria 17214
361 Ga0209051_1006242 3300025303 Bacteria 6758
362 Ga0209051_1014327 3300025303 Bacteria 3707
363 Ga0207656_10004501 3300025321 Bacteria 4875
364 Ga0207692_10031885 3300025898 Bacteria 2527
365 Ga0207642_10012631 3300025899 Bacteria 3056
366 Ga0207710_10000010 3300025900 Bacteria 482087
367 Ga0207710_10000119 3300025900 Bacteria 97053
368 Ga0207710_10004339 3300025900 Bacteria 6204
369 Ga0207688_10011321 3300025901 Bacteria 4857
370 Ga0207680_10008954 3300025903 Bacteria 4938
371 Ga0207699_10022200 3300025906 Bacteria 3435
372 Ga0207699_10079399 3300025906 Bacteria 2030
373 Ga0207705_10008048 3300025909 Bacteria 7727
374 Ga0207705_10011917 3300025909 Bacteria 6283
375 Ga0207705_10233019 3300025909 Bacteria 1401
376 Ga0207684_10000062 3300025910 Bacteria 202863
377 Ga0207684_10188291 3300025910 Bacteria 1780
378 Ga0207684_10208174 3300025910 Bacteria 1687
379 Ga0207707_10083655 3300025912 Bacteria 2786
380 Ga0207707_10096556 3300025912 Bacteria 2583
381 Ga0207695_10001360 3300025913 Bacteria 41481
382 Ga0207695_10142162 3300025913 Bacteria 2347
383 Ga0207671_10025042 3300025914 Bacteria 4484
384 Ga0207671_10026071 3300025914 Bacteria 4385
385 Ga0207671_10061967 3300025914 Bacteria 2776
386 Ga0207693_10000430 3300025915 Bacteria 38189
387 Ga0207693_10051634 3300025915 Bacteria 3226
388 Ga0207663_10001439 3300025916 Bacteria 11063
389 Ga0207663_10042206 3300025916 Bacteria 2786
390 Ga0207662_10187750 3300025918 Bacteria 1332
391 Ga0207657_10003181 3300025919 Bacteria 17566
392 Ga0207657_10012688 3300025919 Bacteria 8304
393 Ga0207657_10099109 3300025919 Bacteria 2421
394 Ga0207657_10122545 3300025919 Bacteria 2138
395 Ga0207657_10196992 3300025919 Bacteria 1622
396 Ga0207649_10009529 3300025920 Bacteria 5316
397 Ga0207649_10096139 3300025920 Bacteria 1951
398 Ga0207652_10042590 3300025921 Bacteria 3865
399 Ga0207646_10023510 3300025922 Bacteria 5660
400 Ga0207646_10368900 3300025922 Bacteria 1297
401 Ga0207681_10010378 3300025923 Bacteria 5699
402 Ga0207681_10134276 3300025923 Bacteria 1834
403 Ga0207681_10241198 3300025923 Bacteria 1407
404 Ga0207694_10009212 3300025924 Bacteria 7449
405 Ga0207694_10305647 3300025924 Bacteria 1310
406 Ga0207694_10359904 3300025924 Bacteria 1206
407 Ga0207650_10000032 3300025925 Bacteria 229538
408 Ga0207650_10054123 3300025925 Bacteria 2976
409 Ga0207659_10058015 3300025926 Bacteria 2778
410 Ga0207659_10177343 3300025926 Bacteria 1685
411 Ga0207687_10000803 3300025927 Bacteria 21200
412 Ga0207687_10200019 3300025927 Bacteria 1561
413 Ga0207687_10575766 3300025927 Bacteria 947
414 Ga0207700_10060220 3300025928 Bacteria 2874
415 Ga0207700_10307821 3300025928 Bacteria 1370
416 Ga0207700_10351074 3300025928 Bacteria 1284
417 Ga0207700_10364193 3300025928 Bacteria 1261
418 Ga0207664_10030063 3300025929 Bacteria 4145
419 Ga0207664_10096640 3300025929 Bacteria 2432
420 Ga0207664_10122087 3300025929 Bacteria 2182
421 Ga0207664_10134151 3300025929 Bacteria 2087
422 Ga0207690_10000951 3300025932 Bacteria 18563
423 Ga0207690_10022582 3300025932 Bacteria 3916
424 Ga0207690_10135694 3300025932 Bacteria 1806
425 Ga0207686_10005781 3300025934 Bacteria 6636
426 Ga0207669_10001734 3300025937 Bacteria 9264
427 Ga0207669_10056934 3300025937 Bacteria 2377
428 Ga0207669_10147477 3300025937 Bacteria 1643
429 Ga0207669_10282195 3300025937 Bacteria 1253
430 Ga0207669_10402911 3300025937 Bacteria 1072
431 Ga0207704_10491074 3300025938 Bacteria 988
432 Ga0207665_10399111 3300025939 Bacteria 1047
433 Ga0207711_10000364 3300025941 Bacteria 48006
434 Ga0207711_10006457 3300025941 Bacteria 9870
435 Ga0207711_10020465 3300025941 Bacteria 5517
436 Ga0207711_10084930 3300025941 Bacteria 2772
437 Ga0207711_10459410 3300025941 Bacteria 1186
438 Ga0207689_10046184 3300025942 Bacteria 3600
439 Ga0207661_10066571 3300025944 Bacteria 2927
440 Ga0207661_10420557 3300025944 Bacteria 1214
441 Ga0207661_10669856 3300025944 Bacteria 954
442 Ga0207679_10010560 3300025945 Bacteria 5952
443 Ga0207667_10005399 3300025949 Bacteria 15585
444 Ga0207667_10057635 3300025949 Bacteria 4077
445 Ga0207667_10106634 3300025949 Bacteria 2890
446 Ga0207667_10808803 3300025949 Bacteria 934
447 Ga0207651_10127807 3300025960 Bacteria 1940
448 Ga0207712_10000010 3300025961 Bacteria 455972
449 Ga0207712_10001841 3300025961 Bacteria 13983
450 Ga0207712_10009907 3300025961 Bacteria 6039
451 Ga0207668_10001136 3300025972 Bacteria 15864
452 Ga0207668_10001570 3300025972 Bacteria 13369
453 Ga0207668_10005253 3300025972 Bacteria 7618
454 Ga0207668_10196416 3300025972 Bacteria 1603
455 Ga0207640_10055576 3300025981 Bacteria 2594
456 Ga0207640_10423210 3300025981 Bacteria 1090
457 Ga0207658_10000116 3300025986 Bacteria 88456
458 Ga0207658_10001232 3300025986 Bacteria 20240
459 Ga0207658_10011465 3300025986 Bacteria 6032
460 Ga0207658_10018175 3300025986 Bacteria 4850
461 Ga0207658_10027964 3300025986 Bacteria 3967
462 Ga0207677_10045702 3300026023 Bacteria 2925
463 Ga0207677_10102788 3300026023 Bacteria 2108
464 Ga0207703_10003382 3300026035 Bacteria 13397
465 Ga0207703_10010738 3300026035 Bacteria 7148
466 Ga0207703_10010789 3300026035 Bacteria 7128
467 Ga0207703_10046150 3300026035 Bacteria 3508
468 Ga0207639_10013486 3300026041 Bacteria 5721
469 Ga0207639_10033277 3300026041 Bacteria 3801
470 Ga0207639_10163353 3300026041 Bacteria 1879
471 Ga0207678_10045277 3300026067 Bacteria 3806
472 Ga0207678_10222501 3300026067 Bacteria 1616
473 Ga0207708_10259785 3300026075 Bacteria 1402
474 Ga0207702_10069233 3300026078 Bacteria 3033
475 Ga0207641_10001609 3300026088 Bacteria 22047
476 Ga0207641_10002816 3300026088 Bacteria 15822
477 Ga0207641_10063518 3300026088 Bacteria 3154
478 Ga0207641_10731733 3300026088 Bacteria 976
479 Ga0207648_10002033 3300026089 Bacteria 22080
480 Ga0207648_10036167 3300026089 Bacteria 4350
481 Ga0207648_10199168 3300026089 Bacteria 1776
482 Ga0207676_10000237 3300026095 Bacteria 48354
483 Ga0207675_100000192 3300026118 Bacteria 55745
484 Ga0207675_100067387 3300026118 Bacteria 3346
485 Ga0207683_10001366 3300026121 Bacteria 22060
486 Ga0207683_10011413 3300026121 Bacteria 7581
487 Ga0207683_10074997 3300026121 Bacteria 2994
488 Ga0207683_10503246 3300026121 Bacteria 1119
489 Ga0207698_10001247 3300026142 Bacteria 14877
490 Ga0207698_10013635 3300026142 Bacteria 5372
491 Ga0207698_10740524 3300026142 Bacteria 981
492 Ga0209588_1006100 3300027671 Bacteria 3484
493 Ga0209588_1009001 3300027671 Bacteria 2972
494 Ga0209974_10051148 3300027876 Bacteria 1389
495 Ga0207428_10000146 3300027907 Bacteria 95417
496 Ga0207428_10027306 3300027907 Bacteria 4753
497 Ga0268266_10001306 3300028379 Bacteria 30304
498 Ga0268266_10001716 3300028379 Bacteria 25097
499 Ga0268266_10049960 3300028379 Bacteria 3587
500 Ga0268266_10121585 3300028379 Bacteria 2324
501 Ga0268265_10000014 3300028380 Bacteria 330186
502 Ga0268265_10001602 3300028380 Bacteria 18690
503 Ga0268265_10008139 3300028380 Bacteria 7085
504 Ga0268264_10000137 3300028381 Bacteria 176081
505 Ga0268264_10000202 3300028381 Bacteria 121481
506 Ga0268264_10019775 3300028381 Bacteria 5500
507 Ga0268264_10022290 3300028381 Bacteria 5172
508 Ga0265319_1056914 3300028563 Bacteria 1276
509 Ga0265318_10002566 3300028577 Bacteria 9633
510 Ga0307511_10081677 3300030521 Bacteria 2266
511 Ga0265325_10000095 3300031241 Bacteria 62028
512 Ga0265325_10003702 3300031241 Bacteria 9895
513 Ga0265340_10074817 3300031247 Bacteria 1601
514 Ga0265339_10108246 3300031249 Bacteria 1441
515 Ga0265327_10000200 3300031251 Bacteria 125094
516 Ga0265327_10000662 3300031251 Bacteria 55374
517 Ga0307513_10116631 3300031456 Bacteria 2649
518 Ga0307408_100032136 3300031548 Bacteria 3659
519 Ga0307408_100037695 3300031548 Bacteria 3406
520 Ga0307408_100143962 3300031548 Bacteria 1874
521 Ga0307408_100353809 3300031548 Bacteria 1247
522 Ga0265313_10000175 3300031595 Bacteria 68104
523 Ga0265313_10010531 3300031595 Bacteria 5833
524 Ga0307508_10145289 3300031616 Bacteria 1976
525 Ga0316575_10092024 3300031665 Bacteria 1229
526 Ga0265314_10144503 3300031711 Bacteria 1467
527 Ga0316576_10007205 3300031727 Bacteria 6979
528 Ga0316576_10267092 3300031727 Bacteria 1283
529 Ga0316578_10007808 3300031728 Bacteria 5401
530 Ga0307516_10003174 3300031730 Bacteria 21384
531 Ga0307516_10225540 3300031730 Bacteria 1580
532 Ga0307405_10014640 3300031731 Bacteria 4224
533 Ga0307405_10023002 3300031731 Bacteria 3534
534 Ga0307413_10006334 3300031824 Bacteria 5390
535 Ga0307413_10019596 3300031824 Bacteria 3579
536 Ga0307413_10154710 3300031824 Bacteria 1602
537 Ga0307413_10254179 3300031824 Bacteria 1306
538 Ga0307410_10112920 3300031852 Bacteria 1968
539 Ga0307406_10013622 3300031901 Bacteria 4661
540 Ga0307406_10032595 3300031901 Bacteria 3182
541 Ga0307406_10049769 3300031901 Bacteria 2653
542 Ga0307406_10175227 3300031901 Bacteria 1556
543 Ga0307406_10321216 3300031901 Bacteria 1198
544 Ga0307407_10001217 3300031903 Bacteria 9127
545 Ga0307412_10008185 3300031911 Bacteria 5961
546 Ga0307412_10063292 3300031911 Bacteria 2495
547 Ga0307412_10125088 3300031911 Bacteria 1858
548 Ga0307409_100000151 3300031995 Bacteria 26404
549 Ga0307409_100024592 3300031995 Bacteria 4204
550 Ga0307409_100406015 3300031995 Bacteria 1303
551 Ga0307409_100767566 3300031995 Bacteria 969
552 Ga0307409_100830785 3300031995 Bacteria 933
553 Ga0307416_100002868 3300032002 Bacteria 10038
554 Ga0307416_100021376 3300032002 Bacteria 4644
555 Ga0307416_100088997 3300032002 Bacteria 2642
556 Ga0307416_100187266 3300032002 Bacteria 1947
557 Ga0307416_100417997 3300032002 Bacteria 1384
558 Ga0307416_100463334 3300032002 Bacteria 1323
559 Ga0307414_10091971 3300032004 Bacteria 2256
560 Ga0307414_10180735 3300032004 Bacteria 1696
561 Ga0307414_10380610 3300032004 Bacteria 1220
562 Ga0307411_10000531 3300032005 Bacteria 13452
563 Ga0307411_10121370 3300032005 Bacteria 1892
564 Ga0307415_100002128 3300032126 Bacteria 9811
565 Ga0307415_100033141 3300032126 Bacteria 3351
566 Ga0307415_100269863 3300032126 Bacteria 1393
567 Ga0307415_100511869 3300032126 Bacteria 1052
568 Ga0307510_10094351 3300033180 Bacteria 2818
569 Ga0373936_0178933 3300035113 Bacteria 930
570 Ga0373953_0004282 3300035117 Bacteria 4534
571 Ga0373957_0012598 3300035120 Bacteria 2851
572 Ga0373957_0022072 3300035120 Bacteria 2265
573 Ga0373946_0065214 3300035171 Bacteria 1559
574 Ga0373955_0008867 3300035172 Bacteria 4690
575 Ga0316574_0014216 3300035398 Bacteria 4593
576 Ga0373931_0201463 3300035691 Bacteria 1189
577 Ga0373935_0477490 3300035692 Bacteria 903
578 Ga0373933_0021746 3300035724 Bacteria 3647
579 Ga0373947_0034853 3300035725 Bacteria 2978
580 Ga0373947_0038147 3300035725 Bacteria 2853
581 Ga0373947_0180842 3300035725 Bacteria 1373
582 Ga0373937_0022515 3300036401 Bacteria 5666
583 Ga0373937_0029111 3300036401 Bacteria 5001
584 Ga0373937_0046708 3300036401 Bacteria 3960
585 Ga0373937_0176476 3300036401 Bacteria 2006
586 Ga0316582_0010884 3300036647 Bacteria 5005
587 Ga0316582_0047849 3300036647 Bacteria 2702
588 Ga0316584_0000425 3300036712 Bacteria 22007
589 Ga0316584_0362992 3300036712 Bacteria 1038
590 Ga0373925_0015304 3300037068 Bacteria 5547
591 Ga0395899_0002806 3300037312 Bacteria 14038
592 Ga0395899_0003641 3300037312 Bacteria 12200
593 Ga0395899_0003830 3300037312 Bacteria 11871
594 Ga0395899_0011850 3300037312 Bacteria 6675
595 Ga0395899_0017676 3300037312 Bacteria 5432
596 Ga0395899_0073563 3300037312 Bacteria 2498
597 Ga0395900_0014022 3300037418 Bacteria 8184
598 Ga0395900_0016004 3300037418 Bacteria 7642
599 Ga0395900_0028256 3300037418 Bacteria 5746
600 Ga0395900_0034856 3300037418 Bacteria 5185
601 Ga0395900_0056359 3300037418 Bacteria 4045
602 Ga0395900_0138864 3300037418 Bacteria 2489
603 Ga0395900_0319114 3300037418 Bacteria 1534
604 Ga0395900_0596007 3300037418 Bacteria 1046
605 Ga0395898_0004724 3300037466 Bacteria 14826
606 Ga0395898_0006941 3300037466 Bacteria 12036
607 Ga0395898_0020590 3300037466 Bacteria 6699
608 Ga0395898_0094612 3300037466 Bacteria 2871
609 Ga0395905_0010442 3300037471 Bacteria 9034
610 Ga0395905_0010661 3300037471 Bacteria 8915
611 Ga0395905_0013127 3300037471 Bacteria 7952
612 Ga0395905_0030081 3300037471 Bacteria 5118
613 Ga0395905_0047862 3300037471 Bacteria 4007
614 Ga0395905_0095371 3300037471 Bacteria 2792
615 Ga0395905_0242218 3300037471 Bacteria 1685
616 Ga0395901_0008586 3300038443 Bacteria 10326
617 Ga0395901_0091572 3300038443 Bacteria 3183
618 Ga0395901_0127664 3300038443 Bacteria 2673
619 Ga0395901_0199617 3300038443 Bacteria 2097
620 Ga0395901_0606202 3300038443 Bacteria 1104
621 Ga0400490_39147 3300038726 Bacteria 1505
622 Ga0400490_42507 3300038726 Bacteria 7064
623 Ga0400488_33533 3300038741 Bacteria 1399
624 Ga0400488_46326 3300038741 Unclassified 1686
625 Ga0400486_05058 3300038742 Bacteria 11068
626 Ga0400483_269206 3300039062 Bacteria 85448
627 Ga0400487_15433 3300039110 Bacteria 4403
628 Ga0436365_1083994 3300039437 Bacteria 225582
629 Ga0436365_1178839 3300039437 Bacteria 4209
630 Ga0436365_1247886 3300039437 Bacteria 61397
631 Ga0436365_1463057 3300039437 Bacteria 8209
632 Ga0436365_1709394 3300039437 Bacteria 51419
633 Ga0436365_1830770 3300039437 Bacteria 1032
634 Ga0436360_0382408 3300039438 Bacteria 2144
635 Ga0436360_0993747 3300039438 Bacteria 5104
636 Ga0436360_1007975 3300039438 Bacteria 1211
637 Ga0436361_0009051 3300039447 Bacteria 7525
638 Ga0436361_0013073 3300039447 Bacteria 17617
639 Ga0436361_0362627 3300039447 Bacteria 2784
640 Ga0436361_0576744 3300039447 Bacteria 2939
641 Ga0436363_1641698 3300039450 Bacteria 4115
642 Ga0436362_0979548 3300039453 Bacteria 1118
643 Ga0439453_0000704 3300041408 Bacteria 3846
644 Ga0439465_0002245 3300041413 Bacteria 6346
645 Ga0439465_0002436 3300041413 Bacteria 6088
646 Ga0439465_0034013 3300041413 Bacteria 1631
647 Ga0451807_1428362 3300041486 Bacteria 2064
648 Ga0451835_0159614 3300041492 Bacteria 1124
649 Ga0451849_0460671 3300041505 Bacteria 5861
650 Ga0451853_0197269 3300041512 Bacteria 27774
651 Ga0451853_2327740 3300041512 Bacteria 1213
652 Ga0439431_0002763 3300041997 Bacteria 3862
653 Ga0439443_005046 3300042003 Bacteria 1751
654 Ga0439448_0011129 3300042005 Bacteria 2677
655 Ga0439460_0006884 3300042461 Bacteria 2832
656 Ga0451577_0029833 3300042876 Bacteria 4928
657 Ga0451577_0042019 3300042876 Bacteria 4102
658 Ga0466969_0000361 3300044656 Bacteria 24953
659 Ga0466969_0112099 3300044656 Bacteria 1276
660 Ga0466972_0000420 3300044658 Bacteria 22023
661 Ga0466972_0039574 3300044658 Bacteria 2300
662 Ga0466972_0090765 3300044658 Bacteria 1449
663 Ga0466973_0035531 3300044659 Bacteria 4736
664 Ga0466982_0188692 3300044672 Bacteria 1242
665 Ga0453683_0003486 3300044673 Bacteria 11575
666 Ga0453683_0058594 3300044673 Bacteria 2409
667 Ga0466965_0007481 3300044683 Bacteria 5020
668 Ga0466965_0022045 3300044683 Bacteria 3070
669 Ga0466965_0171766 3300044683 Bacteria 1141
670 Ga0466966_0007793 3300044684 Bacteria 7091
671 Ga0466966_0013203 3300044684 Bacteria 5470
672 Ga0466966_0124291 3300044684 Bacteria 1583
673 Ga0466961_0006278 3300044693 Bacteria 7548
674 Ga0466961_0008364 3300044693 Bacteria 6589
675 Ga0466963_0004494 3300044694 Bacteria 8111
676 Ga0466963_0022728 3300044694 Bacteria 3975
677 Ga0466963_0048518 3300044694 Bacteria 2806
678 Ga0466963_0142438 3300044694 Bacteria 1661
679 Ga0466964_0007346 3300044706 Bacteria 4120
680 Ga0466964_0048901 3300044706 Bacteria 1730
681 Ga0453684_0093446 3300044712 Bacteria 3705
682 Ga0466971_0022214 3300044719 Bacteria 2826
683 Ga0466971_0044289 3300044719 Bacteria 1998
684 Ga0466971_0105567 3300044719 Bacteria 1297
685 Ga0466971_0136595 3300044719 Bacteria 1140
686 Ga0466968_0006767 3300044735 Bacteria 4335
687 Ga0466968_0037819 3300044735 Bacteria 2026
688 Ga0466968_0131601 3300044735 Bacteria 1139
689 Ga0466970_0006849 3300044765 Bacteria 5705
690 Ga0466970_0087619 3300044765 Bacteria 1688
691 Ga0466970_0115331 3300044765 Bacteria 1469
692 Ga0466970_0126654 3300044765 Bacteria 1401
693 Ga0466970_0149468 3300044765 Bacteria 1289
694 Ga0466957_0005590 3300044842 Bacteria 7064
695 Ga0466957_0014795 3300044842 Bacteria 4546
696 Ga0466957_0035342 3300044842 Bacteria 2999
697 Ga0466957_0078937 3300044842 Bacteria 2047
698 Ga0466960_0004284 3300044901 Bacteria 5560
699 Ga0466960_0018539 3300044901 Bacteria 3052
700 Ga0466960_0313706 3300044901 Bacteria 886
701 Ga0466959_0105705 3300045049 Bacteria 2013
702 Ga0451576_0271998 3300045051 Bacteria 1771
703 Ga0451576_0456792 3300045051 Bacteria 1341
704 Ga0451576_0580614 3300045051 Bacteria 1178
705 Ga0451576_0584523 3300045051 Bacteria 1174
706 Ga0466958_0012293 3300045836 Bacteria 4847
707 Ga0466958_0026343 3300045836 Bacteria 3436
708 Ga0466958_0052237 3300045836 Bacteria 2477
709 Ga0466958_0053315 3300045836 Bacteria 2451
710 Ga0466958_0105658 3300045836 Bacteria 1755
711 Ga0466967_0001683 3300045976 Bacteria 13124
712 Ga0466967_0034747 3300045976 Bacteria 4283
713 Ga0466967_0090115 3300045976 Bacteria 2786
714 Ga0466967_0150992 3300045976 Bacteria 2171
715 Ga0466967_0210863 3300045976 Bacteria 1842
716 Ga0466967_0316134 3300045976 Bacteria 1505
717 Ga0466967_0550476 3300045976 Bacteria 1136
718 Ga0495617_013481 3300046452 Bacteria 2782
719 Ga0495592_0002825 3300046454 Bacteria 12317
720 Ga0495592_0003233 3300046454 Bacteria 11679
721 Ga0495590_0102318 3300046457 Bacteria 1018
722 Ga0495629_0065721 3300046459 Bacteria 2531
723 Ga0495638_0000806 3300046460 Bacteria 33072
724 Ga0495638_0005942 3300046460 Bacteria 8959
725 Ga0495638_0023484 3300046460 Bacteria 4032
726 Ga0495641_0036978 3300046461 Bacteria 2291
727 Ga0495651_0240611 3300046462 Bacteria 1241
728 Ga0495653_0029750 3300046463 Bacteria 4355
729 Ga0495650_0001749 3300046471 Bacteria 19780
730 Ga0495580_0002602 3300046472 Bacteria 15676
731 Ga0495580_0009043 3300046472 Bacteria 7860
732 Ga0495582_0138772 3300046473 Bacteria 1377
733 Ga0495605_0004251 3300046474 Bacteria 8439
734 Ga0495639_0022709 3300046475 Bacteria 2753
735 Ga0495664_0033641 3300046477 Bacteria 3013
736 Ga0495584_0023449 3300046491 Bacteria 3128
737 Ga0495584_0051818 3300046491 Bacteria 2066
738 Ga0495584_0080751 3300046491 Bacteria 1636
739 Ga0495585_0039691 3300046492 Bacteria 2645
740 Ga0495607_0015975 3300046501 Bacteria 4852
741 Ga0495607_0024047 3300046501 Bacteria 3804
742 Ga0495606_0135680 3300046507 Bacteria 1458
743 Ga0495608_0012925 3300046511 Bacteria 5795
744 Ga0495608_0057345 3300046511 Bacteria 2570
745 Ga0495616_0000632 3300046513 Bacteria 26334
746 Ga0495616_0033528 3300046513 Bacteria 2674
747 Ga0495628_0000382 3300046516 Bacteria 40502
748 Ga0495628_0005505 3300046516 Bacteria 11083
749 Ga0495630_0323515 3300046517 Bacteria 1179
750 Ga0495630_0361060 3300046517 Bacteria 1112
751 Ga0495643_0049663 3300046522 Bacteria 2262
752 Ga0495652_0049004 3300046529 Bacteria 3617
753 Ga0495654_0161137 3300046530 Bacteria 985
754 Ga0495665_0010196 3300046531 Bacteria 5091
755 Ga0495587_0008211 3300046536 Bacteria 6726
756 Ga0495598_0000136 3300046537 Bacteria 12449
757 Ga0495609_0000676 3300046538 Bacteria 26334
758 Ga0495621_0058145 3300046539 Bacteria 1398
759 Ga0495597_0000833 3300046542 Bacteria 24241
760 Ga0495645_0016724 3300046543 Bacteria 5246
761 Ga0495645_0096766 3300046543 Bacteria 2103
762 Ga0495633_0015374 3300046558 Bacteria 3971
763 Ga0495633_0021245 3300046558 Bacteria 3249
764 Ga0495633_0125421 3300046558 Eukaryota 1188
765 Ga0495667_0003376 3300046559 Bacteria 10682
766 Ga0495667_0048852 3300046559 Bacteria 2793
767 Ga0495667_0135039 3300046559 Bacteria 1590
768 Ga0495668_0167437 3300046616 Bacteria 1204
769 Ga0495625_0011811 3300046660 Bacteria 7094
770 Ga0495635_0006033 3300046663 Bacteria 8450
771 Ga0495661_0000938 3300046665 Bacteria 26522
772 Ga0495661_0103364 3300046665 Bacteria 1599
773 Ga0495657_0048208 3300046675 Bacteria 2875
774 Ga0495657_0158375 3300046675 Bacteria 1402
775 Ga0495599_0002274 3300046678 Bacteria 11183
776 Ga0495599_0032804 3300046678 Bacteria 3260
777 Ga0495623_0059789 3300046679 Bacteria 2392
778 Ga0495646_0086011 3300046680 Bacteria 1824
779 Ga0495646_0109155 3300046680 Bacteria 1577
780 Ga0495658_0220436 3300046683 Bacteria 1187
781 Ga0495624_0032247 3300046690 Bacteria 3398
782 Ga0495670_0000859 3300046691 Bacteria 14714
783 Ga0495671_0123346 3300046692 Bacteria 1263
784 Ga0495589_0000532 3300046794 Bacteria 26669
785 Ga0495600_0008938 3300046809 Bacteria 6172
786 Ga0495600_0015355 3300046809 Bacteria 4841
787 Ga0495604_0006062 3300047317 Bacteria 9591
788 Ga0495604_0199964 3300047317 Bacteria 1387
789 Ga0495604_0408292 3300047317 Bacteria 893
790 Ga0495674_0040893 3300047319 Bacteria 4144
791 Ga0495680_0049405 3300047322 Bacteria 3294
792 Ga0495687_000132 3300047443 Bacteria 114685
793 Ga0495687_000308 3300047443 Bacteria 64153
794 Ga0495687_010094 3300047443 Bacteria 5206
795 Ga0495675_0046893 3300047444 Bacteria 2750
796 Ga0495675_0048115 3300047444 Bacteria 2713
797 Ga0495677_0000191 3300047445 Bacteria 28406
798 Ga0495673_0057964 3300047469 Bacteria 1671
799 Ga0495684_0016220 3300047471 Bacteria 5736
800 Ga0495684_0275400 3300047471 Bacteria 1216
801 Ga0495686_0002311 3300047472 Bacteria 18236
802 Ga0495686_0113726 3300047472 Bacteria 1620
803 Ga0495602_0002983 3300048088 Bacteria 17354
804 Ga0495602_0045260 3300048088 Bacteria 3983
805 Ga0495626_0004263 3300048091 Bacteria 8832
806 Ga0496100_0000110 3300048903 Bacteria 47145
807 Ga0496100_0000412 3300048903 Bacteria 20666
808 Ga0496100_0058186 3300048903 Bacteria 2535
809 Ga0496100_0586719 3300048903 Bacteria 864
810 Ga0496101_0000054 3300048904 Bacteria 137699
811 Ga0496101_0000073 3300048904 Bacteria 113870
812 Ga0496101_0009780 3300048904 Bacteria 6316
813 Ga0496101_0011053 3300048904 Bacteria 5980
814 Ga0496101_0036664 3300048904 Bacteria 3474
815 Ga0496101_0082532 3300048904 Bacteria 2379
816 Ga0496101_0136930 3300048904 Bacteria 1864
817 Ga0496102_0000006 3300048905 Bacteria 471494
818 Ga0496102_0000118 3300048905 Bacteria 113499
819 Ga0496102_0001687 3300048905 Bacteria 19374
820 Ga0496102_0006452 3300048905 Bacteria 10003
821 Ga0496102_0018330 3300048905 Bacteria 6149
822 Ga0496102_0019560 3300048905 Bacteria 5964
823 Ga0496102_0026398 3300048905 Bacteria 5180
824 Ga0496102_0056000 3300048905 Bacteria 3596
825 Ga0496102_0149145 3300048905 Bacteria 2196
826 Ga0496103_0000006 3300048906 Bacteria 470539
827 Ga0496103_0000129 3300048906 Bacteria 81081
828 Ga0496103_0000945 3300048906 Bacteria 20803
829 Ga0496103_0001200 3300048906 Bacteria 17782
830 Ga0496103_0014319 3300048906 Bacteria 4710
831 Ga0496104_0003117 3300048907 Bacteria 14295
832 Ga0496104_0235693 3300048907 Bacteria 1742
833 Ga0496104_0279574 3300048907 Bacteria 1582
834 Ga0496105_0000168 3300048908 Bacteria 43805
835 Ga0496105_0066343 3300048908 Bacteria 2979
836 Ga0496105_0283123 3300048908 Bacteria 1336
837 Ga0496105_0295665 3300048908 Bacteria 1303
838 Ga0496106_0000901 3300048909 Bacteria 21691
839 Ga0496106_0002231 3300048909 Bacteria 14449
840 Ga0496106_0020313 3300048909 Bacteria 4929
841 Ga0496106_0068643 3300048909 Bacteria 2704
842 Ga0496106_0334040 3300048909 Bacteria 1217
843 Ga0496107_0000261 3300048910 Bacteria 28034
844 Ga0496107_0000264 3300048910 Bacteria 27701
845 Ga0496107_0097149 3300048910 Bacteria 2156
846 Ga0496108_0014047 3300048911 Bacteria 6533
847 Ga0496108_0016290 3300048911 Bacteria 6062
848 Ga0496108_0020733 3300048911 Bacteria 5403
849 Ga0496108_0600533 3300048911 Bacteria 959
850 Ga0496109_0000152 3300048912 Bacteria 68036
851 Ga0496109_0019674 3300048912 Bacteria 5955
852 Ga0496109_0061711 3300048912 Bacteria 3428
853 Ga0496109_0352244 3300048912 Bacteria 1391
854 Ga0496109_0645810 3300048912 Bacteria 995
855 Ga0496110_0001576 3300048913 Bacteria 16638
856 Ga0496110_0028547 3300048913 Bacteria 4794
857 Ga0496110_0029709 3300048913 Bacteria 4707
858 Ga0496110_0060603 3300048913 Bacteria 3338
859 Ga0496111_0035267 3300048914 Bacteria 3574
860 Ga0496111_0099170 3300048914 Bacteria 2139
861 Ga0496111_0155845 3300048914 Bacteria 1695
862 Ga0496112_0002426 3300048915 Bacteria 15009
863 Ga0496112_0184279 3300048915 Bacteria 2051
864 Ga0496112_0264862 3300048915 Bacteria 1668
865 Ga0496113_0039155 3300048916 Bacteria 3489
866 Ga0496114_0000047 3300048917 Bacteria 119106
867 Ga0496114_0002699 3300048917 Bacteria 13559
868 Ga0496114_0038083 3300048917 Bacteria 3978
869 Ga0496114_0067999 3300048917 Bacteria 2990
870 Ga0496114_0274679 3300048917 Bacteria 1485
871 Ga0496114_0663166 3300048917 Bacteria 917
872 Ga0496115_0006427 3300048918 Bacteria 8611
873 Ga0496115_0021228 3300048918 Bacteria 5014
874 Ga0496115_0047070 3300048918 Bacteria 3448
875 Ga0496115_0129077 3300048918 Bacteria 2083
876 Ga0496115_0508164 3300048918 Bacteria 968
877 Ga0496116_0000025 3300048919 Bacteria 470539
878 Ga0496116_0000968 3300048919 Bacteria 35439
879 Ga0496116_0003154 3300048919 Bacteria 16511
880 Ga0496116_0005030 3300048919 Bacteria 12443
881 Ga0496116_0008933 3300048919 Unclassified 8617
882 Ga0496117_0000006 3300048920 Bacteria 758420
883 Ga0496117_0001082 3300048920 Bacteria 41248
884 Ga0496117_0027062 3300048920 Bacteria 4475
885 Ga0496118_0000004 3300048921 Bacteria 758420
886 Ga0496118_0001016 3300048921 Bacteria 43635
887 Ga0496118_0001424 3300048921 Bacteria 36051
888 Ga0496119_0000041 3300048922 Bacteria 203687
889 Ga0496119_0000514 3300048922 Bacteria 52716
890 Ga0496119_0001956 3300048922 Bacteria 23443
891 Ga0496119_0012066 3300048922 Bacteria 7062
892 Ga0496120_0000027 3300048923 Bacteria 231507
893 Ga0496120_0000224 3300048923 Bacteria 97511
894 Ga0496120_0014259 3300048923 Bacteria 5304
895 Ga0496121_0000004 3300048924 Bacteria 1139011
896 Ga0496121_0002353 3300048924 Bacteria 29156
897 Ga0496121_0002460 3300048924 Bacteria 28275
898 Ga0496122_0000313 3300048925 Bacteria 107106
899 Ga0496122_0035029 3300048925 Bacteria 4095
900 Ga0496122_0035956 3300048925 Eukaryota 4017
901 Ga0496123_0006622 3300048926 Bacteria 11185
902 Ga0496123_0020859 3300048926 Bacteria 5110
903 Ga0496124_0000117 3300048927 Bacteria 164439
904 Ga0496125_0000003 3300048928 Bacteria 1189767
905 Ga0496125_0000368 3300048928 Bacteria 84924
906 Ga0496125_0024119 3300048928 Bacteria 5600
907 Ga0496125_0159015 3300048928 Eukaryota 1538
908 Ga0496126_0000001 3300048929 Bacteria 1139011
909 Ga0496126_0001241 3300048929 Bacteria 41382
910 Ga0496126_0001576 3300048929 Bacteria 34867
911 Ga0496126_0005051 3300048929 Bacteria 15319
912 Ga0496126_0053450 3300048929 Bacteria 3665
913 Ga0496126_0291949 3300048929 Bacteria 1348
914 Ga0501032_0001371 3300049569 Bacteria 19327
915 Ga0501032_0003212 3300049569 Bacteria 12566
916 Ga0501032_0034563 3300049569 Bacteria 3460
917 Ga0501032_0087365 3300049569 Bacteria 2071
918 Ga0501032_0097164 3300049569 Bacteria 1952
919 Ga0501033_0072360 3300049570 Bacteria 2531
920 Ga0501033_0145944 3300049570 Bacteria 1709
921 Ga0501033_0185289 3300049570 Bacteria 1491
922 Ga0501034_0003796 3300049571 Bacteria 17047
923 Ga0501034_0013153 3300049571 Bacteria 8527
924 Ga0501034_0055948 3300049571 Bacteria 3970
925 Ga0501034_0229872 3300049571 Bacteria 1804
926 Ga0501034_0241354 3300049571 Bacteria 1753
927 Ga0501036_0034199 3300049572 Bacteria 4299
928 Ga0501036_0059121 3300049572 Bacteria 3248
929 Ga0501037_0001970 3300049573 Bacteria 14855
930 Ga0501037_0031564 3300049573 Bacteria 3911
931 Ga0501037_0147918 3300049573 Bacteria 1680
932 Ga0501038_0004393 3300049574 Bacteria 13119
933 Ga0501038_0071518 3300049574 Bacteria 2942
934 Ga0501039_0003456 3300049575 Bacteria 11798
935 Ga0501039_0380556 3300049575 Bacteria 1109
936 Ga0501039_0615209 3300049575 Bacteria 851
937 Ga0501042_0092040 3300049578 Bacteria 2177
938 Ga0501043_0002321 3300049579 Bacteria 16107
939 Ga0501043_0003123 3300049579 Bacteria 13737
940 Ga0501046_0005675 3300049580 Bacteria 11140
941 Ga0501047_0000707 3300049581 Bacteria 34754
942 Ga0501047_0027950 3300049581 Bacteria 5437
943 Ga0501047_0038850 3300049581 Bacteria 4604
944 Ga0501047_0044212 3300049581 Bacteria 4303
945 Ga0501047_0243678 3300049581 Bacteria 1647
946 Ga0501047_0243871 3300049581 Bacteria 1646
947 Ga0501048_0023055 3300049582 Bacteria 4550
948 Ga0501069_0005747 3300049585 Bacteria 6465
949 Ga0501069_0014362 3300049585 Bacteria 4233
950 Ga0501069_0066502 3300049585 Bacteria 2016
951 Ga0501069_0165411 3300049585 Bacteria 1275
952 Ga0501070_0000288 3300049586 Bacteria 47185
953 Ga0501070_0002522 3300049586 Bacteria 16054
954 Ga0501070_0024274 3300049586 Bacteria 5084
955 Ga0501071_0008824 3300049587 Bacteria 6683
956 Ga0501073_0005128 3300049589 Bacteria 9830
957 Ga0501073_0021631 3300049589 Bacteria 4635
958 Ga0501073_0044334 3300049589 Bacteria 3135
959 Ga0501073_0056698 3300049589 Bacteria 2740
960 Ga0501074_0036287 3300049590 Bacteria 3571
961 Ga0501075_0075742 3300049591 Bacteria 2544
962 Ga0501075_0303622 3300049591 Bacteria 1216
963 Ga0501076_0003829 3300049592 Bacteria 10597
964 Ga0501076_0011669 3300049592 Bacteria 6558
965 Ga0501076_0069712 3300049592 Bacteria 2810
966 Ga0501077_0003493 3300049593 Bacteria 9437
967 Ga0501077_0158856 3300049593 Bacteria 1435
968 Ga0501079_0168591 3300049741 Bacteria 1707
969 Ga0501080_0020331 3300049742 Bacteria 6144
970 Ga0501080_0101408 3300049742 Bacteria 2670
971 Ga0501081_0002149 3300049743 Bacteria 12350
972 Ga0501083_0015161 3300049744 Bacteria 5396
973 Ga0501083_0022643 3300049744 Bacteria 4360
974 Ga0501083_0134476 3300049744 Bacteria 1620
975 Ga0501035_0001318 3300049822 Bacteria 25624
976 Ga0501035_0001771 3300049822 Bacteria 21793
977 Ga0501035_0033079 3300049822 Bacteria 4702
978 Ga0501035_0328769 3300049822 Bacteria 1283
979 Ga0501035_0546014 3300049822 Bacteria 950
980 Ga0501035_0633865 3300049822 Bacteria 868
981 Ga0501044_0000554 3300049823 Bacteria 45441
982 Ga0501044_0002733 3300049823 Bacteria 20064
983 Ga0501044_0032103 3300049823 Bacteria 5521
984 Ga0501044_0068070 3300049823 Bacteria 3627
985 Ga0501044_0156297 3300049823 Bacteria 2260
986 Ga0501044_0159904 3300049823 Bacteria 2230
987 Ga0501044_0376558 3300049823 Bacteria 1335
988 Ga0501044_0455494 3300049823 Bacteria 1185
989 nmdc:mga03n38_21264_c1 3300050490 Bacteria 2608
990 nmdc:mga00v17_31853_c1 3300050491 Bacteria 3112
991 nmdc:mga00v17_344296_c1 3300050491 Bacteria 969
992 nmdc:mga00v17_35825_c1 3300050491 Bacteria 2955
993 nmdc:mga00v17_78318_c1 3300050491 Bacteria 2059
994 nmdc:mga0yw44_18995_c1 3300050492 Bacteria 3780
995 nmdc:mga0yw44_29042_c1 3300050492 Bacteria 3188
996 nmdc:mga0k408_21552_c1 3300050493 Bacteria 3620
997 nmdc:mga0k408_27049_c1 3300050493 Bacteria 3255
998 nmdc:mga0k408_292544_c1 3300050493 Bacteria 972
999 nmdc:mga0k408_69753_c1 3300050493 Bacteria 2052
1000 nmdc:mga06z11_336241_c1 3300050494 Bacteria 902
1001 nmdc:mga06z11_41715_c1 3300050494 Bacteria 2297
1002 nmdc:mga07m45_1217_c1 3300050496 Bacteria 11669
1003 nmdc:mga07m45_14092_c1 3300050496 Bacteria 4253
1004 nmdc:mga07m45_27607_c1 3300050496 Bacteria 3128
1005 nmdc:mga05p37_111_c2 3300050507 Bacteria 41438
1006 nmdc:mga05p37_39065_c1 3300050507 Bacteria 5823
1007 nmdc:mga05p37_52524_c1 3300050507 Bacteria 5012
1008 nmdc:mga09592_137_c1 3300050508 Bacteria 48140
1009 nmdc:mga09592_453402_c1 3300050508 Bacteria 1106
1010 nmdc:mga09592_52342_c1 3300050508 Bacteria 3446
1011 nmdc:mga0qj67_2255_c1 3300050509 Bacteria 13705
1012 nmdc:mga06r32_526_c1 3300050510 Bacteria 33031
1013 nmdc:mga06r32_84304_c1 3300050510 Bacteria 3097
1014 nmdc:mga08y16_1030_c1 3300050511 Bacteria 27341
1015 nmdc:mga08y16_99425_c1 3300050511 Bacteria 3029
1016 nmdc:mga0n895_113213_c1 3300050512 Bacteria 2731
1017 nmdc:mga0n895_331_c1 3300050512 Bacteria 31576
1018 nmdc:mga0n895_92853_c1 3300050512 Bacteria 3021
1019 nmdc:mga0rr50_115322_c1 3300050513 Bacteria 2132
1020 nmdc:mga0rr50_269932_c1 3300050513 Bacteria 1417
1021 nmdc:mga0rr50_326208_c1 3300050513 Bacteria 1288
1022 nmdc:mga0rr50_5720_c1 3300050513 Bacteria 7453
1023 nmdc:mga0rr50_60211_c1 3300050513 Bacteria 2193
1024 nmdc:mga08x19_19120_c1 3300050514 Bacteria 4202
1025 nmdc:mga08x19_424352_c1 3300050514 Bacteria 934
1026 nmdc:mga08x19_55348_c1 3300050514 Bacteria 2557
1027 nmdc:mga0a205_423009_c1 3300050515 Bacteria 1194
1028 nmdc:mga0a205_50_c1 3300050515 Bacteria 64126
1029 nmdc:mga0a205_96288_c1 3300050515 Bacteria 2859
1030 nmdc:mga0sz30_3889_c1 3300050516 Bacteria 5385
1031 nmdc:mga0sz30_8058_c1 3300050516 Bacteria 3969
1032 Ga0495601_0017212 3300053077 Bacteria 4387
1033 Ga0495612_0006121 3300053078 Bacteria 4952
1034 Ga0500610_0005980 3300053079 Bacteria 5051
1035 Ga0500635_0072227 3300053080 Bacteria 1226
1036 Ga0495595_0002756 3300053084 Bacteria 6903
1037 Ga0495595_0095490 3300053084 Bacteria 1430
1038 Ga0495619_0000461 3300053085 Bacteria 27459
1039 Ga0495619_0029565 3300053085 Bacteria 3541
1040 Ga0495619_0178295 3300053085 Bacteria 1470
1041 Ga0500643_007238 3300053087 Bacteria 4516
1042 Ga0500643_014858 3300053087 Bacteria 2688
1043 Ga0500647_0010299 3300053091 Bacteria 4132
1044 Ga0500651_0029835 3300053093 Bacteria 3431
1045 Ga0500641_0026956 3300053096 Bacteria 2235
1046 Ga0500556_0021621 3300053104 Bacteria 2077
1047 Ga0500595_002529 3300053119 Bacteria 8976
1048 Ga0500595_006795 3300053119 Bacteria 4818
1049 Ga0500595_018072 3300053119 Bacteria 2586
1050 Ga0500574_003599 3300053141 Bacteria 2770
1051 Ga0500588_0006984 3300053146 Bacteria 2585
1052 Ga0500645_000046 3300053730 Bacteria 106127
1053 Ga0501084_0003046 3300054114 Bacteria 13583
1054 Ga0501084_0109277 3300054114 Bacteria 2323
1055 Ga0501084_0390617 3300054114 Bacteria 1176
1056 Ga0587090_000758 3300059510 Bacteria 2920
1057 Ga0587109_032831 3300059624 Eukaryota 994
1058 Ga0587114_016201 3300059655 Eukaryota 996
1059 Ga0587118_04109 3300059657 Eukaryota 999
1060 Ga0501082_0013704 3300060353 Bacteria 6969
1061 Ga0501082_0203133 3300060353 Bacteria 1724
1062 Ga0501082_0368015 3300060353 Bacteria 1254
1063 Ga0501082_0606004 3300060353 Bacteria 958
1064 Ga0466962_0013821 3300061719 Bacteria 3886
1065 Ga0466962_0024354 3300061719 Bacteria 2907
1066 Ga0466962_0099574 3300061719 Bacteria 1396
1067 Ga0466962_0247926 3300061719 Bacteria 875
1068 Ga0530510_0355470 3300061734 Bacteria 1101

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006058 Ga0075432_10012711 Ga0075432_100127113 201
2 3300006847 Ga0075431_100005861 Ga0075431_10000586110 201
3 3300006852 Ga0075433_10029228 Ga0075433_100292286 201
4 3300006914 Ga0075436_100005498 Ga0075436_1000054983 201
5 3300007076 Ga0075435_100051450 Ga0075435_1000514504 201
6 3300027907 Ga0207428_10027306 Ga0207428_100273065 201
7 3300006028 Ga0070717_10255901 Ga0070717_102559012 203
8 3300006880 Ga0075429_100195689 Ga0075429_1001956892 203
9 3300009094 Ga0111539_10010096 Ga0111539_1001009611 203
10 3300009147 Ga0114129_10182145 Ga0114129_101821452 203
11 3300025928 Ga0207700_10351074 Ga0207700_103510742 203
12 3300046559 Ga0495667_0135039 Ga0495667_0135039_507_1145 203
13 3300047471 Ga0495684_0275400 Ga0495684_0275400_331_969 203
14 3300050507 nmdc:mga05p37_52524_c1 nmdc:mga05p37_52524_c1_1827_2465 203
15 3300050511 nmdc:mga08y16_99425_c1 nmdc:mga08y16_99425_c1_1303_1941 203
16 3300050512 nmdc:mga0n895_113213_c1 nmdc:mga0n895_113213_c1_1827_2465 203
17 3300050513 nmdc:mga0rr50_115322_c1 nmdc:mga0rr50_115322_c1_1170_1808 203
18 3300050514 nmdc:mga08x19_19120_c1 nmdc:mga08x19_19120_c1_1008_1646 203
19 3300050515 nmdc:mga0a205_96288_c1 nmdc:mga0a205_96288_c1_395_1033 203
20 3300053085 Ga0495619_0178295 Ga0495619_0178295_399_1037 203
21 3300035113 Ga0373936_0178933 Ga0373936_0178933_222_917 222
22 3300006028 Ga0070717_10021477 Ga0070717_100214774 224
23 3300005518 Ga0070699_100262805 Ga0070699_1002628051 225
24 3300006178 Ga0075367_10110737 Ga0075367_101107372 225
25 3300006195 Ga0075366_10003168 Ga0075366_100031687 225
26 3300048911 Ga0496108_0600533 Ga0496108_0600533_11_691 225
27 3300048912 Ga0496109_0645810 Ga0496109_0645810_11_691 225
28 3300050493 nmdc:mga0k408_69753_c1 nmdc:mga0k408_69753_c1_70_873 225
29 3300050494 nmdc:mga06z11_41715_c1 nmdc:mga06z11_41715_c1_690_1475 225
30 3300009101 Ga0105247_10000094 Ga0105247_1000009474 227
31 3300009177 Ga0105248_10028311 Ga0105248_100283113 227
32 3300014968 Ga0157379_10029929 Ga0157379_100299299 227
33 3300025900 Ga0207710_10000119 Ga0207710_1000011975 227
34 3300025941 Ga0207711_10020465 Ga0207711_100204652 227
35 3300048922 Ga0496119_0000514 Ga0496119_0000514_24047_24880 227
36 3300048923 Ga0496120_0000224 Ga0496120_0000224_68857_69690 227
37 3300006847 Ga0075431_100007219 Ga0075431_1000072195 230
38 3300009147 Ga0114129_10017959 Ga0114129_100179596 230
39 3300009147 Ga0114129_10176827 Ga0114129_101768274 230
40 3300049578 Ga0501042_0092040 Ga0501042_0092040_180_971 230
41 3300049587 Ga0501071_0008824 Ga0501071_0008824_3150_3941 230
42 3300049591 Ga0501075_0303622 Ga0501075_0303622_301_1092 230
43 3300049592 Ga0501076_0069712 Ga0501076_0069712_411_1202 230
44 3300049742 Ga0501080_0020331 Ga0501080_0020331_3573_4364 230
45 3300050507 nmdc:mga05p37_39065_c1 nmdc:mga05p37_39065_c1_2496_3260 230
46 3300005985 Ga0081539_10050344 Ga0081539_100503442 231
47 3300048904 Ga0496101_0082532 Ga0496101_0082532_1060_1824 232
48 3300048905 Ga0496102_0001687 Ga0496102_0001687_8024_8857 232
49 3300048906 Ga0496103_0014319 Ga0496103_0014319_2985_3818 232
50 3300048909 Ga0496106_0334040 Ga0496106_0334040_333_1097 232
51 3300048913 Ga0496110_0060603 Ga0496110_0060603_2472_3236 232
52 3300053096 Ga0500641_0026956 Ga0500641_0026956_1415_2200 236
53 3300006847 Ga0075431_100069140 Ga0075431_1000691404 238
54 3300006880 Ga0075429_100033426 Ga0075429_1000334264 238
55 3300050508 nmdc:mga09592_52342_c1 nmdc:mga09592_52342_c1_1366_2139 238
56 3300005355 Ga0070671_100087697 Ga0070671_1000876971 240
57 3300002739 JGI25158J39367_1002218 JGI25158J39367_10022183 245
58 3300002987 JGI25159J45721_1000001 JGI25159J45721_1000001109 245
59 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002202 245
60 3300003374 JGI25161J50226_1002505 JGI25161J50226_10025053 245
61 3300004625 Ga0055543_1000010 Ga0055543_1000010182 245
62 3300005262 Ga0065165_1000004 Ga0065165_1000004177 245
63 3300025208 Ga0209436_100076 Ga0209436_10007647 245
64 3300025284 Ga0209130_1000008 Ga0209130_1000008341 245
65 3300025302 Ga0207426_1000016 Ga0207426_1000016221 245
66 3300037418 Ga0395900_0016004 Ga0395900_0016004_2687_3451 245
67 3300037466 Ga0395898_0006941 Ga0395898_0006941_5301_6065 245
68 3300038443 Ga0395901_0008586 Ga0395901_0008586_5363_6127 245
69 iso_pu_bacteria 2515154189 2516017650 245
70 iso_pu_bacteria 3006978542 3006983057 245
71 iso_pu_bacteria 8004021418 8004023879 245
72 3300006173 Ga0070716_100305982 Ga0070716_1003059821 246
73 3300028563 Ga0265319_1056914 Ga0265319_10569142 246
74 3300028577 Ga0265318_10002566 Ga0265318_100025667 246
75 3300041492 Ga0451835_0159614 Ga0451835_0159614_202_996 246
76 3300041505 Ga0451849_0460671 Ga0451849_0460671_3386_4180 246
77 3300041512 Ga0451853_0197269 Ga0451853_0197269_6808_7602 246
78 iso_pu_bacteria 2919051321 2919053951 246
79 3300005356 Ga0070674_100127923 Ga0070674_1001279232 247
80 3300005364 Ga0070673_100336251 Ga0070673_1003362512 247
81 3300005459 Ga0068867_100260392 Ga0068867_1002603922 247
82 3300021384 Ga0213876_10104246 Ga0213876_101042462 247
83 3300026089 Ga0207648_10199168 Ga0207648_101991682 247
84 3300031824 Ga0307413_10254179 Ga0307413_102541791 247
85 3300036712 Ga0316584_0362992 Ga0316584_0362992_187_957 247
86 3300039437 Ga0436365_1463057 Ga0436365_1463057_2267_3031 247
87 3300046683 Ga0495658_0220436 Ga0495658_0220436_388_1152 247
88 iso_pu_bacteria 2920879853 2920880505 247
89 3300005327 Ga0070658_10003541 Ga0070658_100035419 248
90 3300005338 Ga0068868_100216232 Ga0068868_1002162321 248
91 3300005343 Ga0070687_100289269 Ga0070687_1002892691 248
92 3300005344 Ga0070661_100161357 Ga0070661_1001613571 248
93 3300005345 Ga0070692_10000346 Ga0070692_100003463 248
94 3300005354 Ga0070675_100059478 Ga0070675_1000594783 248
95 3300005356 Ga0070674_100350332 Ga0070674_1003503321 248
96 3300005444 Ga0070694_100000117 Ga0070694_10000011721 248
97 3300005444 Ga0070694_100203760 Ga0070694_1002037602 248
98 3300005445 Ga0070708_100017079 Ga0070708_1000170793 248
99 3300005445 Ga0070708_100070754 Ga0070708_1000707543 248
100 3300005445 Ga0070708_100262095 Ga0070708_1002620952 248
101 3300005456 Ga0070678_100054293 Ga0070678_1000542933 248
102 3300005456 Ga0070678_100600170 Ga0070678_1006001701 248
103 3300005457 Ga0070662_100203518 Ga0070662_1002035182 248
104 3300005458 Ga0070681_10188930 Ga0070681_101889303 248
105 3300005459 Ga0068867_100096189 Ga0068867_1000961892 248
106 3300005468 Ga0070707_100313297 Ga0070707_1003132972 248
107 3300005471 Ga0070698_100063592 Ga0070698_1000635922 248
108 3300005518 Ga0070699_100244679 Ga0070699_1002446791 248
109 3300005530 Ga0070679_100161498 Ga0070679_1001614981 248
110 3300005536 Ga0070697_100006640 Ga0070697_1000066408 248
111 3300005539 Ga0068853_100047221 Ga0068853_1000472213 248
112 3300005545 Ga0070695_100219480 Ga0070695_1002194802 248
113 3300005547 Ga0070693_100012908 Ga0070693_1000129084 248
114 3300005547 Ga0070693_100166395 Ga0070693_1001663952 248
115 3300005548 Ga0070665_100609506 Ga0070665_1006095062 248
116 3300005549 Ga0070704_100004068 Ga0070704_1000040685 248
117 3300005614 Ga0068856_100719261 Ga0068856_1007192612 248
118 3300005616 Ga0068852_100004074 Ga0068852_1000040742 248
119 3300006028 Ga0070717_10049176 Ga0070717_100491762 248
120 3300006028 Ga0070717_10200199 Ga0070717_102001992 248
121 3300006051 Ga0075364_10008968 Ga0075364_100089682 248
122 3300006195 Ga0075366_10021721 Ga0075366_100217212 248
123 3300006237 Ga0097621_100032821 Ga0097621_1000328215 248
124 3300006358 Ga0068871_100064969 Ga0068871_1000649692 248
125 3300006871 Ga0075434_100092646 Ga0075434_1000926462 248
126 3300006914 Ga0075436_100061696 Ga0075436_1000616962 248
127 3300007076 Ga0075435_100293300 Ga0075435_1002933002 248
128 3300007076 Ga0075435_100368178 Ga0075435_1003681782 248
129 3300007265 Ga0099794_10005388 Ga0099794_100053882 248
130 3300007265 Ga0099794_10011070 Ga0099794_100110703 248
131 3300007265 Ga0099794_10029642 Ga0099794_100296422 248
132 3300009093 Ga0105240_10002741 Ga0105240_1000274123 248
133 3300009176 Ga0105242_10060441 Ga0105242_100604412 248
134 3300009177 Ga0105248_10101242 Ga0105248_101012422 248
135 3300013104 Ga0157370_10067625 Ga0157370_100676252 248
136 3300013297 Ga0157378_10536164 Ga0157378_105361641 248
137 3300013306 Ga0163162_10030910 Ga0163162_100309102 248
138 3300013307 Ga0157372_10287839 Ga0157372_102878392 248
139 3300025321 Ga0207656_10004501 Ga0207656_100045012 248
140 3300025909 Ga0207705_10233019 Ga0207705_102330192 248
141 3300025912 Ga0207707_10096556 Ga0207707_100965562 248
142 3300025913 Ga0207695_10001360 Ga0207695_1000136034 248
143 3300025920 Ga0207649_10096139 Ga0207649_100961392 248
144 3300025922 Ga0207646_10368900 Ga0207646_103689002 248
145 3300025924 Ga0207694_10305647 Ga0207694_103056471 248
146 3300025927 Ga0207687_10575766 Ga0207687_105757661 248
147 3300025929 Ga0207664_10134151 Ga0207664_101341512 248
148 3300025937 Ga0207669_10282195 Ga0207669_102821952 248
149 3300025937 Ga0207669_10402911 Ga0207669_104029112 248
150 3300025944 Ga0207661_10669856 Ga0207661_106698562 248
151 3300025949 Ga0207667_10005399 Ga0207667_100053993 248
152 3300025960 Ga0207651_10127807 Ga0207651_101278072 248
153 3300025981 Ga0207640_10423210 Ga0207640_104232102 248
154 3300026035 Ga0207703_10046150 Ga0207703_100461503 248
155 3300026075 Ga0207708_10259785 Ga0207708_102597852 248
156 3300026078 Ga0207702_10069233 Ga0207702_100692333 248
157 3300026089 Ga0207648_10036167 Ga0207648_100361675 248
158 3300026121 Ga0207683_10074997 Ga0207683_100749973 248
159 3300026142 Ga0207698_10013635 Ga0207698_100136352 248
160 3300027671 Ga0209588_1006100 Ga0209588_10061002 248
161 3300028379 Ga0268266_10121585 Ga0268266_101215853 248
162 3300031616 Ga0307508_10145289 Ga0307508_101452891 248
163 3300031911 Ga0307412_10063292 Ga0307412_100632922 248
164 3300032002 Ga0307416_100088997 Ga0307416_1000889973 248
165 3300032002 Ga0307416_100187266 Ga0307416_1001872661 248
166 3300032002 Ga0307416_100463334 Ga0307416_1004633341 248
167 3300032126 Ga0307415_100511869 Ga0307415_1005118692 248
168 3300035691 Ga0373931_0201463 Ga0373931_0201463_76_843 248
169 3300036401 Ga0373937_0176476 Ga0373937_0176476_959_1726 248
170 3300037312 Ga0395899_0073563 Ga0395899_0073563_1514_2293 248
171 3300037418 Ga0395900_0138864 Ga0395900_0138864_58_837 248
172 3300037466 Ga0395898_0094612 Ga0395898_0094612_440_1219 248
173 3300038726 Ga0400490_39147 Ga0400490_39147_457_1221 248
174 3300038726 Ga0400490_42507 Ga0400490_42507_3181_3945 248
175 3300038741 Ga0400488_33533 Ga0400488_33533_287_1051 248
176 3300038741 Ga0400488_46326 Ga0400488_46326_525_1289 248
177 3300038742 Ga0400486_05058 Ga0400486_05058_2767_3531 248
178 3300039062 Ga0400483_269206 Ga0400483_269206_79418_80182 248
179 3300039110 Ga0400487_15433 Ga0400487_15433_1711_2475 248
180 3300042876 Ga0451577_0042019 Ga0451577_0042019_1498_2265 248
181 3300046616 Ga0495668_0167437 Ga0495668_0167437_149_919 248
182 3300048912 Ga0496109_0061711 Ga0496109_0061711_184_954 248
183 3300048913 Ga0496110_0028547 Ga0496110_0028547_1226_1993 248
184 3300048914 Ga0496111_0155845 Ga0496111_0155845_894_1667 248
185 3300049585 Ga0501069_0005747 Ga0501069_0005747_4855_5622 248
186 3300049586 Ga0501070_0024274 Ga0501070_0024274_651_1418 248
187 3300049589 Ga0501073_0005128 Ga0501073_0005128_4624_5391 248
188 3300049590 Ga0501074_0036287 Ga0501074_0036287_1965_2732 248
189 3300049744 Ga0501083_0015161 Ga0501083_0015161_88_855 248
190 3300049822 Ga0501035_0546014 Ga0501035_0546014_88_855 248
191 3300049823 Ga0501044_0156297 Ga0501044_0156297_970_1737 248
192 3300049823 Ga0501044_0376558 Ga0501044_0376558_290_1057 248
193 3300050491 nmdc:mga00v17_78318_c1 nmdc:mga00v17_78318_c1_392_1159 248
194 3300050493 nmdc:mga0k408_21552_c1 nmdc:mga0k408_21552_c1_2842_3609 248
195 3300050493 nmdc:mga0k408_27049_c1 nmdc:mga0k408_27049_c1_2126_2893 248
196 3300050512 nmdc:mga0n895_92853_c1 nmdc:mga0n895_92853_c1_586_1353 248
197 3300050513 nmdc:mga0rr50_326208_c1 nmdc:mga0rr50_326208_c1_239_1006 248
198 3300050514 nmdc:mga08x19_55348_c1 nmdc:mga08x19_55348_c1_212_979 248
199 3300060353 Ga0501082_0203133 Ga0501082_0203133_502_1269 248
200 iso_pu_bacteria 2582581314 2585318077 248
201 iso_pu_bacteria 2643221617 2644099794 248
202 iso_pu_bacteria 2643221620 2644117401 248
203 3300006173 Ga0070716_100334580 Ga0070716_1003345801 249
204 3300006914 Ga0075436_100307460 Ga0075436_1003074602 249
205 3300007265 Ga0099794_10007960 Ga0099794_100079602 249
206 3300007265 Ga0099794_10012928 Ga0099794_100129282 249
207 3300007788 Ga0099795_10050943 Ga0099795_100509432 249
208 3300009147 Ga0114129_10005210 Ga0114129_1000521013 249
209 3300027671 Ga0209588_1009001 Ga0209588_10090011 249
210 3300030521 Ga0307511_10081677 Ga0307511_100816772 249
211 3300031730 Ga0307516_10003174 Ga0307516_100031743 249
212 3300031730 Ga0307516_10225540 Ga0307516_102255402 249
213 3300031901 Ga0307406_10321216 Ga0307406_103212161 249
214 3300032126 Ga0307415_100269863 Ga0307415_1002698632 249
215 3300033180 Ga0307510_10094351 Ga0307510_100943512 249
216 3300042876 Ga0451577_0029833 Ga0451577_0029833_32_808 249
217 3300044673 Ga0453683_0058594 Ga0453683_0058594_266_1159 249
218 3300050510 nmdc:mga06r32_84304_c1 nmdc:mga06r32_84304_c1_1692_2483 249
219 3300050513 nmdc:mga0rr50_269932_c1 nmdc:mga0rr50_269932_c1_444_1220 249
220 3300050515 nmdc:mga0a205_423009_c1 nmdc:mga0a205_423009_c1_260_1036 249
221 3300005327 Ga0070658_10025550 Ga0070658_100255502 250
222 3300005327 Ga0070658_10040353 Ga0070658_100403531 250
223 3300005339 Ga0070660_100243003 Ga0070660_1002430032 250
224 3300005339 Ga0070660_100382068 Ga0070660_1003820682 250
225 3300005366 Ga0070659_100110797 Ga0070659_1001107972 250
226 3300005467 Ga0070706_100000386 Ga0070706_10000038626 250
227 3300005468 Ga0070707_100086462 Ga0070707_1000864623 250
228 3300005530 Ga0070679_100031622 Ga0070679_1000316224 250
229 3300005530 Ga0070679_100356591 Ga0070679_1003565911 250
230 3300005535 Ga0070684_100171621 Ga0070684_1001716212 250
231 3300005536 Ga0070697_100004974 Ga0070697_1000049747 250
232 3300005539 Ga0068853_100204631 Ga0068853_1002046312 250
233 3300005563 Ga0068855_100047049 Ga0068855_1000470492 250
234 3300006237 Ga0097621_100062455 Ga0097621_1000624553 250
235 3300006237 Ga0097621_100370368 Ga0097621_1003703682 250
236 3300006871 Ga0075434_100056186 Ga0075434_1000561864 250
237 3300009098 Ga0105245_10288875 Ga0105245_102888752 250
238 3300013307 Ga0157372_10018790 Ga0157372_100187904 250
239 3300013307 Ga0157372_10053351 Ga0157372_100533512 250
240 3300013307 Ga0157372_10072158 Ga0157372_100721582 250
241 3300014969 Ga0157376_10408572 Ga0157376_104085722 250
242 3300025909 Ga0207705_10008048 Ga0207705_100080488 250
243 3300025909 Ga0207705_10011917 Ga0207705_100119172 250
244 3300025910 Ga0207684_10000062 Ga0207684_1000006226 250
245 3300025915 Ga0207693_10051634 Ga0207693_100516344 250
246 3300025919 Ga0207657_10003181 Ga0207657_100031814 250
247 3300025919 Ga0207657_10099109 Ga0207657_100991092 250
248 3300025919 Ga0207657_10196992 Ga0207657_101969922 250
249 3300025922 Ga0207646_10023510 Ga0207646_100235107 250
250 3300025932 Ga0207690_10135694 Ga0207690_101356942 250
251 3300025944 Ga0207661_10420557 Ga0207661_104205572 250
252 3300025949 Ga0207667_10106634 Ga0207667_101066342 250
253 3300026041 Ga0207639_10163353 Ga0207639_101633532 250
254 3300026142 Ga0207698_10001247 Ga0207698_100012472 250
255 3300031548 Ga0307408_100032136 Ga0307408_1000321364 250
256 3300031548 Ga0307408_100037695 Ga0307408_1000376953 250
257 3300031548 Ga0307408_100353809 Ga0307408_1003538092 250
258 3300031731 Ga0307405_10014640 Ga0307405_100146404 250
259 3300031731 Ga0307405_10023002 Ga0307405_100230022 250
260 3300031824 Ga0307413_10006334 Ga0307413_100063346 250
261 3300031824 Ga0307413_10154710 Ga0307413_101547102 250
262 3300031852 Ga0307410_10112920 Ga0307410_101129202 250
263 3300031901 Ga0307406_10013622 Ga0307406_100136224 250
264 3300031901 Ga0307406_10032595 Ga0307406_100325952 250
265 3300031901 Ga0307406_10049769 Ga0307406_100497692 250
266 3300031903 Ga0307407_10001217 Ga0307407_1000121711 250
267 3300031911 Ga0307412_10008185 Ga0307412_100081853 250
268 3300031911 Ga0307412_10125088 Ga0307412_101250883 250
269 3300031995 Ga0307409_100000151 Ga0307409_1000001518 250
270 3300031995 Ga0307409_100024592 Ga0307409_1000245923 250
271 3300031995 Ga0307409_100406015 Ga0307409_1004060152 250
272 3300032002 Ga0307416_100002868 Ga0307416_1000028688 250
273 3300032002 Ga0307416_100021376 Ga0307416_1000213762 250
274 3300032004 Ga0307414_10091971 Ga0307414_100919713 250
275 3300032004 Ga0307414_10180735 Ga0307414_101807352 250
276 3300032005 Ga0307411_10000531 Ga0307411_100005318 250
277 3300032005 Ga0307411_10121370 Ga0307411_101213702 250
278 3300032126 Ga0307415_100002128 Ga0307415_10000212811 250
279 3300032126 Ga0307415_100033141 Ga0307415_1000331412 250
280 3300035120 Ga0373957_0022072 Ga0373957_0022072_342_1121 250
281 3300035692 Ga0373935_0477490 Ga0373935_0477490_63_842 250
282 3300035725 Ga0373947_0180842 Ga0373947_0180842_553_1332 250
283 3300036401 Ga0373937_0022515 Ga0373937_0022515_3096_3875 250
284 3300037471 Ga0395905_0095371 Ga0395905_0095371_129_908 250
285 3300038443 Ga0395901_0127664 Ga0395901_0127664_286_1083 250
286 3300046472 Ga0495580_0002602 Ga0495580_0002602_5586_6365 250
287 3300046473 Ga0495582_0138772 Ga0495582_0138772_559_1338 250
288 3300046475 Ga0495639_0022709 Ga0495639_0022709_1794_2573 250
289 3300046531 Ga0495665_0010196 Ga0495665_0010196_2765_3544 250
290 3300046559 Ga0495667_0048852 Ga0495667_0048852_869_1648 250
291 3300046675 Ga0495657_0158375 Ga0495657_0158375_180_959 250
292 3300046680 Ga0495646_0086011 Ga0495646_0086011_746_1525 250
293 3300047444 Ga0495675_0046893 Ga0495675_0046893_1208_1987 250
294 3300047471 Ga0495684_0016220 Ga0495684_0016220_1251_2030 250
295 3300048907 Ga0496104_0279574 Ga0496104_0279574_36_863 250
296 3300048908 Ga0496105_0066343 Ga0496105_0066343_2122_2949 250
297 3300048911 Ga0496108_0016290 Ga0496108_0016290_5060_5887 250
298 3300048913 Ga0496110_0029709 Ga0496110_0029709_3255_4082 250
299 3300048916 Ga0496113_0039155 Ga0496113_0039155_2409_3236 250
300 3300048917 Ga0496114_0274679 Ga0496114_0274679_277_1104 250
301 3300049581 Ga0501047_0000707 Ga0501047_0000707_6933_7712 250
302 3300049585 Ga0501069_0165411 Ga0501069_0165411_306_1085 250
303 3300050514 nmdc:mga08x19_424352_c1 nmdc:mga08x19_424352_c1_49_828 250
304 3300005331 Ga0070670_100000020 Ga0070670_10000002010 251
305 3300005331 Ga0070670_100045141 Ga0070670_1000451412 251
306 3300005347 Ga0070668_100002097 Ga0070668_1000020974 251
307 3300005347 Ga0070668_100204665 Ga0070668_1002046651 251
308 3300005353 Ga0070669_100126647 Ga0070669_1001266472 251
309 3300005356 Ga0070674_100170237 Ga0070674_1001702372 251
310 3300005367 Ga0070667_100000118 Ga0070667_100000118101 251
311 3300005367 Ga0070667_100015478 Ga0070667_1000154782 251
312 3300005445 Ga0070708_100002549 Ga0070708_1000025494 251
313 3300005518 Ga0070699_100016226 Ga0070699_1000162266 251
314 3300005548 Ga0070665_100001988 Ga0070665_10000198810 251
315 3300005617 Ga0068859_100015720 Ga0068859_1000157202 251
316 3300005617 Ga0068859_100031870 Ga0068859_1000318702 251
317 3300005618 Ga0068864_100000206 Ga0068864_10000020610 251
318 3300005618 Ga0068864_100138140 Ga0068864_1001381403 251
319 3300005719 Ga0068861_100110753 Ga0068861_1001107532 251
320 3300005719 Ga0068861_100179360 Ga0068861_1001793602 251
321 3300005841 Ga0068863_100000071 Ga0068863_100000071103 251
322 3300005841 Ga0068863_100028731 Ga0068863_1000287315 251
323 3300005842 Ga0068858_100015779 Ga0068858_1000157792 251
324 3300005843 Ga0068860_100000205 Ga0068860_10000020589 251
325 3300005843 Ga0068860_100000954 Ga0068860_1000009547 251
326 3300005844 Ga0068862_100000057 Ga0068862_100000057141 251
327 3300005844 Ga0068862_100144308 Ga0068862_1001443082 251
328 3300005937 Ga0081455_10000453 Ga0081455_1000045321 251
329 3300006195 Ga0075366_10376802 Ga0075366_103768021 251
330 3300006353 Ga0075370_10013728 Ga0075370_100137282 251
331 3300006931 Ga0097620_100015720 Ga0097620_1000157202 251
332 3300006931 Ga0097620_100031871 Ga0097620_1000318715 251
333 3300009101 Ga0105247_10132205 Ga0105247_101322052 251
334 3300009177 Ga0105248_10030113 Ga0105248_100301132 251
335 3300009177 Ga0105248_10722386 Ga0105248_107223861 251
336 3300009553 Ga0105249_10009971 Ga0105249_100099718 251
337 3300013306 Ga0163162_10062258 Ga0163162_100622583 251
338 3300014325 Ga0163163_10136668 Ga0163163_101366682 251
339 3300014968 Ga0157379_10000949 Ga0157379_100009494 251
340 3300014968 Ga0157379_10019585 Ga0157379_100195854 251
341 3300021377 Ga0213874_10016992 Ga0213874_100169922 251
342 3300021384 Ga0213876_10000150 Ga0213876_1000015014 251
343 3300021384 Ga0213876_10039528 Ga0213876_100395282 251
344 3300025923 Ga0207681_10241198 Ga0207681_102411982 251
345 3300025925 Ga0207650_10000032 Ga0207650_1000003298 251
346 3300025925 Ga0207650_10054123 Ga0207650_100541233 251
347 3300025937 Ga0207669_10147477 Ga0207669_101474772 251
348 3300025941 Ga0207711_10084930 Ga0207711_100849302 251
349 3300025961 Ga0207712_10009907 Ga0207712_100099076 251
350 3300025972 Ga0207668_10001570 Ga0207668_1000157013 251
351 3300025972 Ga0207668_10196416 Ga0207668_101964161 251
352 3300025986 Ga0207658_10000116 Ga0207658_100001165 251
353 3300025986 Ga0207658_10018175 Ga0207658_100181752 251
354 3300026035 Ga0207703_10010789 Ga0207703_100107897 251
355 3300026088 Ga0207641_10002816 Ga0207641_100028168 251
356 3300026088 Ga0207641_10063518 Ga0207641_100635182 251
357 3300026095 Ga0207676_10000237 Ga0207676_1000023737 251
358 3300026118 Ga0207675_100067387 Ga0207675_1000673872 251
359 3300028379 Ga0268266_10001306 Ga0268266_1000130625 251
360 3300028380 Ga0268265_10001602 Ga0268265_1000160218 251
361 3300028381 Ga0268264_10000202 Ga0268264_1000020225 251
362 3300028381 Ga0268264_10022290 Ga0268264_100222904 251
363 3300031727 Ga0316576_10267092 Ga0316576_102670921 251
364 3300035171 Ga0373946_0065214 Ga0373946_0065214_731_1510 251
365 3300035725 Ga0373947_0034853 Ga0373947_0034853_421_1200 251
366 3300037068 Ga0373925_0015304 Ga0373925_0015304_2677_3456 251
367 3300039437 Ga0436365_1178839 Ga0436365_1178839_3342_4151 251
368 3300039437 Ga0436365_1247886 Ga0436365_1247886_49045_49851 251
369 3300039450 Ga0436363_1641698 Ga0436363_1641698_1099_1905 251
370 3300044673 Ga0453683_0003486 Ga0453683_0003486_6828_7613 251
371 3300044712 Ga0453684_0093446 Ga0453684_0093446_1256_2041 251
372 3300045051 Ga0451576_0271998 Ga0451576_0271998_77_868 251
373 3300045051 Ga0451576_0456792 Ga0451576_0456792_538_1323 251
374 3300045051 Ga0451576_0580614 Ga0451576_0580614_34_819 251
375 3300046457 Ga0495590_0102318 Ga0495590_0102318_212_988 251
376 3300046472 Ga0495580_0009043 Ga0495580_0009043_3973_4752 251
377 3300046474 Ga0495605_0004251 Ga0495605_0004251_1022_1798 251
378 3300046491 Ga0495584_0051818 Ga0495584_0051818_386_1162 251
379 3300046501 Ga0495607_0015975 Ga0495607_0015975_2984_3760 251
380 3300046513 Ga0495616_0000632 Ga0495616_0000632_2992_3768 251
381 3300046522 Ga0495643_0049663 Ga0495643_0049663_383_1159 251
382 3300046538 Ga0495609_0000676 Ga0495609_0000676_22567_23343 251
383 3300046665 Ga0495661_0000938 Ga0495661_0000938_3180_3956 251
384 3300046794 Ga0495589_0000532 Ga0495589_0000532_22567_23343 251
385 3300047443 Ga0495687_000132 Ga0495687_000132_4784_5560 251
386 3300047445 Ga0495677_0000191 Ga0495677_0000191_22567_23343 251
387 3300048091 Ga0495626_0004263 Ga0495626_0004263_2807_3583 251
388 3300048905 Ga0496102_0006452 Ga0496102_0006452_5935_6741 251
389 3300049589 Ga0501073_0056698 Ga0501073_0056698_1699_2493 251
390 3300049592 Ga0501076_0011669 Ga0501076_0011669_5752_6525 251
391 3300049744 Ga0501083_0022643 Ga0501083_0022643_1114_1908 251
392 3300050493 nmdc:mga0k408_292544_c1 nmdc:mga0k408_292544_c1_122_904 251
393 3300050496 nmdc:mga07m45_1217_c1 nmdc:mga07m45_1217_c1_762_1544 251
394 3300054114 Ga0501084_0109277 Ga0501084_0109277_543_1316 251
395 3300005338 Ga0068868_100116928 Ga0068868_1001169282 252
396 3300005548 Ga0070665_100000419 Ga0070665_10000041921 252
397 3300005563 Ga0068855_100630288 Ga0068855_1006302882 252
398 3300006042 Ga0075368_10013438 Ga0075368_100134382 252
399 3300006178 Ga0075367_10009109 Ga0075367_100091095 252
400 3300006353 Ga0075370_10035515 Ga0075370_100355152 252
401 3300009177 Ga0105248_10608605 Ga0105248_106086052 252
402 3300009551 Ga0105238_10000412 Ga0105238_1000041228 252
403 3300009551 Ga0105238_10055286 Ga0105238_100552862 252
404 3300025913 Ga0207695_10142162 Ga0207695_101421622 252
405 3300025924 Ga0207694_10009212 Ga0207694_100092125 252
406 3300025941 Ga0207711_10459410 Ga0207711_104594102 252
407 3300025949 Ga0207667_10808803 Ga0207667_108088031 252
408 3300028379 Ga0268266_10001716 Ga0268266_100017164 252
409 3300031249 Ga0265339_10108246 Ga0265339_101082462 252
410 3300031251 Ga0265327_10000200 Ga0265327_100002004 252
411 3300031456 Ga0307513_10116631 Ga0307513_101166313 252
412 3300031711 Ga0265314_10144503 Ga0265314_101445032 252
413 3300031727 Ga0316576_10007205 Ga0316576_100072052 252
414 3300031728 Ga0316578_10007808 Ga0316578_100078084 252
415 3300035398 Ga0316574_0014216 Ga0316574_0014216_1012_1794 252
416 3300036647 Ga0316582_0047849 Ga0316582_0047849_505_1287 252
417 3300036712 Ga0316584_0000425 Ga0316584_0000425_7962_8744 252
418 3300037312 Ga0395899_0017676 Ga0395899_0017676_3177_3962 252
419 3300038443 Ga0395901_0199617 Ga0395901_0199617_991_1776 252
420 3300039447 Ga0436361_0576744 Ga0436361_0576744_298_1083 252
421 3300041413 Ga0439465_0034013 Ga0439465_0034013_433_1221 252
422 3300046507 Ga0495606_0135680 Ga0495606_0135680_460_1254 252
423 3300048929 Ga0496126_0053450 Ga0496126_0053450_137_922 252
424 3300050496 nmdc:mga07m45_14092_c1 nmdc:mga07m45_14092_c1_2678_3466 252
425 3300053091 Ga0500647_0010299 Ga0500647_0010299_1793_2578 252
426 3300053119 Ga0500595_006795 Ga0500595_006795_65_850 252
427 3300053119 Ga0500595_018072 Ga0500595_018072_1286_2071 252
428 3300053146 Ga0500588_0006984 Ga0500588_0006984_46_846 252
429 iso_pu_bacteria 2511231021 2511358058 252
430 iso_pu_bacteria 2511231221 2512034910 253
431 iso_pu_bacteria 2738541264 2738668432 253
432 iso_pu_bacteria 2738541356 2739147502 253
433 iso_pu_bacteria 2773857759 2774382208 253
434 iso_pu_bacteria 2816332139 2816503837 253
435 iso_pu_bacteria 2818991436 2819544508 253
436 iso_pu_bacteria 2842134933 2842139360 253
437 iso_pu_bacteria 2883291878 2883297329 253
438 iso_pu_bacteria 2897803580 2897808881 253
439 iso_pu_bacteria 2902792274 2902798837 253
440 iso_pu_bacteria 8054002106 8054005852 253
441 3300031665 Ga0316575_10092024 Ga0316575_100920242 254
442 3300036647 Ga0316582_0010884 Ga0316582_0010884_3091_3879 254
443 3300044683 Ga0466965_0171766 Ga0466965_0171766_155_943 254
444 3300044765 Ga0466970_0126654 Ga0466970_0126654_386_1180 254
445 3300045976 Ga0466967_0316134 Ga0466967_0316134_158_946 254
446 3300048908 Ga0496105_0295665 Ga0496105_0295665_411_1199 254
447 iso_pu_bacteria 2738543005 2739206799 254
448 iso_pu_bacteria 2929199973 2929206443 254
449 iso_pu_bacteria 8055909800 8055914936 254
450 3300050491 nmdc:mga00v17_35825_c1 nmdc:mga00v17_35825_c1_900_1667 255
451 iso_pu_bacteria 2939582691 2939584546 255
452 3300021384 Ga0213876_10104480 Ga0213876_101044802 256
453 3300025938 Ga0207704_10491074 Ga0207704_104910742 256
454 3300039437 Ga0436365_1709394 Ga0436365_1709394_40945_41724 256
455 3300039437 Ga0436365_1830770 Ga0436365_1830770_156_929 256
456 3300046460 Ga0495638_0000806 Ga0495638_0000806_28559_29335 256
457 3300046542 Ga0495597_0000833 Ga0495597_0000833_15377_16153 256
458 3300047443 Ga0495687_000308 Ga0495687_000308_39320_40096 256
459 3300047469 Ga0495673_0057964 Ga0495673_0057964_574_1350 256
460 3300000546 LJNas_1010763 LJNas_10107632 257
461 3300002077 JGI24744J21845_10001840 JGI24744J21845_100018403 257
462 3300002244 JGI24742J22300_10003712 JGI24742J22300_100037122 257
463 3300002737 JGI25162J39368_1000598 JGI25162J39368_100059824 257
464 3300002771 JGI25163J39215_1004202 JGI25163J39215_10042021 257
465 3300002987 JGI25159J45721_1005684 JGI25159J45721_10056841 257
466 3300003187 JGI25151J46595_10000672 JGI25151J46595_100006728 257
467 3300003203 JGI25406J46586_10000563 JGI25406J46586_1000056310 257
468 3300003214 JGI25165J46597_1000713 JGI25165J46597_100071324 257
469 3300003316 rootH1_10054217 rootH1_100542173 257
470 3300003751 Ga0055538_1000281 Ga0055538_100028124 257
471 3300003752 Ga0055539_1000305 Ga0055539_100030524 257
472 3300003756 Ga0055533_1000286 Ga0055533_100028624 257
473 3300003759 Ga0055525_1000405 Ga0055525_10004052 257
474 3300003792 Ga0055540_1000702 Ga0055540_100070211 257
475 3300003792 Ga0055540_1000980 Ga0055540_100098018 257
476 3300003841 Ga0055541_1000198 Ga0055541_100019824 257
477 3300005262 Ga0065165_1002857 Ga0065165_100285714 257
478 3300005328 Ga0070676_10146297 Ga0070676_101462972 257
479 3300005329 Ga0070683_100110989 Ga0070683_1001109892 257
480 3300005335 Ga0070666_10024729 Ga0070666_100247293 257
481 3300005337 Ga0070682_100022524 Ga0070682_1000225242 257
482 3300005338 Ga0068868_100005133 Ga0068868_1000051339 257
483 3300005339 Ga0070660_100022139 Ga0070660_1000221396 257
484 3300005340 Ga0070689_100031249 Ga0070689_1000312493 257
485 3300005341 Ga0070691_10043297 Ga0070691_100432972 257
486 3300005344 Ga0070661_100025891 Ga0070661_1000258915 257
487 3300005345 Ga0070692_10086494 Ga0070692_100864942 257
488 3300005347 Ga0070668_100467222 Ga0070668_1004672221 257
489 3300005353 Ga0070669_100003646 Ga0070669_1000036464 257
490 3300005353 Ga0070669_100006848 Ga0070669_1000068484 257
491 3300005354 Ga0070675_100105956 Ga0070675_1001059562 257
492 3300005355 Ga0070671_100003533 Ga0070671_1000035332 257
493 3300005356 Ga0070674_100122707 Ga0070674_1001227072 257
494 3300005365 Ga0070688_100025163 Ga0070688_1000251633 257
495 3300005366 Ga0070659_100001752 Ga0070659_10000175219 257
496 3300005367 Ga0070667_100000190 Ga0070667_10000019039 257
497 3300005367 Ga0070667_100000658 Ga0070667_1000006583 257
498 3300005367 Ga0070667_100007906 Ga0070667_1000079062 257
499 3300005434 Ga0070709_10002573 Ga0070709_100025736 257
500 3300005434 Ga0070709_10055126 Ga0070709_100551262 257
501 3300005435 Ga0070714_100162127 Ga0070714_1001621272 257
502 3300005436 Ga0070713_100013539 Ga0070713_1000135392 257
503 3300005436 Ga0070713_100524489 Ga0070713_1005244891 257
504 3300005437 Ga0070710_10017543 Ga0070710_100175434 257
505 3300005437 Ga0070710_10186310 Ga0070710_101863102 257
506 3300005438 Ga0070701_10008518 Ga0070701_100085181 257
507 3300005439 Ga0070711_100000220 Ga0070711_10000022021 257
508 3300005439 Ga0070711_100146690 Ga0070711_1001466902 257
509 3300005440 Ga0070705_100070313 Ga0070705_1000703132 257
510 3300005440 Ga0070705_100094783 Ga0070705_1000947832 257
511 3300005441 Ga0070700_100364968 Ga0070700_1003649682 257
512 3300005444 Ga0070694_100012696 Ga0070694_1000126962 257
513 3300005444 Ga0070694_100219954 Ga0070694_1002199542 257
514 3300005455 Ga0070663_100195322 Ga0070663_1001953222 257
515 3300005456 Ga0070678_100000231 Ga0070678_1000002317 257
516 3300005456 Ga0070678_100069019 Ga0070678_1000690193 257
517 3300005456 Ga0070678_100138005 Ga0070678_1001380051 257
518 3300005457 Ga0070662_100003854 Ga0070662_1000038543 257
519 3300005457 Ga0070662_100256533 Ga0070662_1002565332 257
520 3300005458 Ga0070681_10156098 Ga0070681_101560982 257
521 3300005458 Ga0070681_10535474 Ga0070681_105354741 257
522 3300005459 Ga0068867_100056402 Ga0068867_1000564022 257
523 3300005467 Ga0070706_100033105 Ga0070706_1000331056 257
524 3300005468 Ga0070707_100344019 Ga0070707_1003440191 257
525 3300005530 Ga0070679_100045536 Ga0070679_1000455362 257
526 3300005539 Ga0068853_100002612 Ga0068853_10000261214 257
527 3300005539 Ga0068853_100046750 Ga0068853_1000467502 257
528 3300005539 Ga0068853_100653364 Ga0068853_1006533641 257
529 3300005545 Ga0070695_100003240 Ga0070695_1000032405 257
530 3300005545 Ga0070695_100075322 Ga0070695_1000753222 257
531 3300005546 Ga0070696_100000829 Ga0070696_10000082921 257
532 3300005546 Ga0070696_100050408 Ga0070696_1000504081 257
533 3300005549 Ga0070704_100002414 Ga0070704_1000024142 257
534 3300005549 Ga0070704_100037402 Ga0070704_1000374025 257
535 3300005563 Ga0068855_100084417 Ga0068855_1000844172 257
536 3300005564 Ga0070664_100039694 Ga0070664_1000396946 257
537 3300005578 Ga0068854_100000198 Ga0068854_10000019824 257
538 3300005578 Ga0068854_100077559 Ga0068854_1000775592 257
539 3300005578 Ga0068854_100202328 Ga0068854_1002023282 257
540 3300005614 Ga0068856_100252974 Ga0068856_1002529742 257
541 3300005615 Ga0070702_100000682 Ga0070702_1000006823 257
542 3300005615 Ga0070702_100156436 Ga0070702_1001564362 257
543 3300005616 Ga0068852_100206654 Ga0068852_1002066542 257
544 3300005617 Ga0068859_100001075 Ga0068859_1000010753 257
545 3300005617 Ga0068859_100003525 Ga0068859_1000035252 257
546 3300005617 Ga0068859_100046450 Ga0068859_1000464503 257
547 3300005718 Ga0068866_10000535 Ga0068866_100005352 257
548 3300005719 Ga0068861_100000696 Ga0068861_1000006963 257
549 3300005841 Ga0068863_100001658 Ga0068863_10000165815 257
550 3300005842 Ga0068858_100013158 Ga0068858_1000131587 257
551 3300005842 Ga0068858_100019858 Ga0068858_1000198583 257
552 3300005843 Ga0068860_100000099 Ga0068860_10000009966 257
553 3300005843 Ga0068860_100003120 Ga0068860_10000312019 257
554 3300005844 Ga0068862_100000086 Ga0068862_10000008666 257
555 3300005844 Ga0068862_100013447 Ga0068862_1000134473 257
556 3300005937 Ga0081455_10005282 Ga0081455_1000528214 257
557 3300005937 Ga0081455_10032235 Ga0081455_100322352 257
558 3300005937 Ga0081455_10084834 Ga0081455_100848342 257
559 3300005937 Ga0081455_10199039 Ga0081455_101990392 257
560 3300005981 Ga0081538_10025003 Ga0081538_100250034 257
561 3300005983 Ga0081540_1029206 Ga0081540_10292062 257
562 3300006028 Ga0070717_10291271 Ga0070717_102912712 257
563 3300006038 Ga0075365_10031894 Ga0075365_100318942 257
564 3300006048 Ga0075363_100065606 Ga0075363_1000656062 257
565 3300006051 Ga0075364_10003638 Ga0075364_100036386 257
566 3300006051 Ga0075364_10080880 Ga0075364_100808802 257
567 3300006051 Ga0075364_10374158 Ga0075364_103741582 257
568 3300006058 Ga0075432_10000194 Ga0075432_100001948 257
569 3300006058 Ga0075432_10015901 Ga0075432_100159013 257
570 3300006163 Ga0070715_10002296 Ga0070715_100022966 257
571 3300006175 Ga0070712_100000493 Ga0070712_1000004933 257
572 3300006175 Ga0070712_100007822 Ga0070712_1000078222 257
573 3300006175 Ga0070712_100197867 Ga0070712_1001978672 257
574 3300006175 Ga0070712_100207337 Ga0070712_1002073372 257
575 3300006186 Ga0075369_10000808 Ga0075369_100008085 257
576 3300006186 Ga0075369_10002242 Ga0075369_100022424 257
577 3300006186 Ga0075369_10187789 Ga0075369_101877892 257
578 3300006358 Ga0068871_100176800 Ga0068871_1001768002 257
579 3300006844 Ga0075428_100009454 Ga0075428_10000945413 257
580 3300006846 Ga0075430_100000129 Ga0075430_10000012924 257
581 3300006847 Ga0075431_100000948 Ga0075431_10000094823 257
582 3300006847 Ga0075431_100070913 Ga0075431_1000709134 257
583 3300006852 Ga0075433_10000100 Ga0075433_100001006 257
584 3300006871 Ga0075434_100001229 Ga0075434_10000122917 257
585 3300006871 Ga0075434_100386342 Ga0075434_1003863421 257
586 3300006871 Ga0075434_100606672 Ga0075434_1006066722 257
587 3300006880 Ga0075429_100000278 Ga0075429_10000027823 257
588 3300006881 Ga0068865_100004610 Ga0068865_1000046107 257
589 3300006931 Ga0097620_100001075 Ga0097620_10000107530 257
590 3300006931 Ga0097620_100003525 Ga0097620_10000352518 257
591 3300006931 Ga0097620_100046450 Ga0097620_1000464503 257
592 3300009094 Ga0111539_10001748 Ga0111539_100017486 257
593 3300009098 Ga0105245_10001366 Ga0105245_100013662 257
594 3300009098 Ga0105245_10006252 Ga0105245_100062524 257
595 3300009098 Ga0105245_10299469 Ga0105245_102994691 257
596 3300009098 Ga0105245_10490037 Ga0105245_104900372 257
597 3300009101 Ga0105247_10000051 Ga0105247_1000005163 257
598 3300009101 Ga0105247_10000698 Ga0105247_100006983 257
599 3300009147 Ga0114129_10002143 Ga0114129_100021437 257
600 3300009148 Ga0105243_10001379 Ga0105243_100013793 257
601 3300009148 Ga0105243_10344436 Ga0105243_103444362 257
602 3300009176 Ga0105242_10051642 Ga0105242_100516423 257
603 3300009177 Ga0105248_10000281 Ga0105248_1000028136 257
604 3300009177 Ga0105248_10017837 Ga0105248_100178373 257
605 3300009177 Ga0105248_10352507 Ga0105248_103525072 257
606 3300009177 Ga0105248_11074248 Ga0105248_110742482 257
607 3300009545 Ga0105237_10007876 Ga0105237_100078763 257
608 3300009545 Ga0105237_10048690 Ga0105237_100486905 257
609 3300009545 Ga0105237_10087058 Ga0105237_100870583 257
610 3300009551 Ga0105238_10266682 Ga0105238_102666822 257
611 3300009553 Ga0105249_10000020 Ga0105249_1000002074 257
612 3300009553 Ga0105249_10008943 Ga0105249_1000894310 257
613 3300010375 Ga0105239_10066546 Ga0105239_100665464 257
614 3300010375 Ga0105239_10163162 Ga0105239_101631622 257
615 3300010375 Ga0105239_10305627 Ga0105239_103056272 257
616 3300010375 Ga0105239_10318804 Ga0105239_103188042 257
617 3300011119 Ga0105246_10035410 Ga0105246_100354103 257
618 3300013104 Ga0157370_10219539 Ga0157370_102195392 257
619 3300013296 Ga0157374_10003582 Ga0157374_100035826 257
620 3300013296 Ga0157374_10038300 Ga0157374_100383004 257
621 3300013297 Ga0157378_10012499 Ga0157378_100124997 257
622 3300013306 Ga0163162_10002550 Ga0163162_100025502 257
623 3300013306 Ga0163162_10226125 Ga0163162_102261252 257
624 3300013307 Ga0157372_10006318 Ga0157372_1000631813 257
625 3300013307 Ga0157372_10576008 Ga0157372_105760081 257
626 3300013308 Ga0157375_10000478 Ga0157375_1000047831 257
627 3300014325 Ga0163163_10243197 Ga0163163_102431972 257
628 3300014326 Ga0157380_10000372 Ga0157380_100003723 257
629 3300014745 Ga0157377_10013849 Ga0157377_100138494 257
630 3300014968 Ga0157379_10008683 Ga0157379_100086839 257
631 3300014968 Ga0157379_10908118 Ga0157379_109081181 257
632 3300015265 Ga0182005_1001434 Ga0182005_100143412 257
633 3300017792 Ga0163161_10000595 Ga0163161_1000059529 257
634 3300020080 Ga0206350_10788292 Ga0206350_107882921 257
635 3300020081 Ga0206354_11469071 Ga0206354_114690712 257
636 3300020082 Ga0206353_10536454 Ga0206353_105364542 257
637 3300021361 Ga0213872_10000430 Ga0213872_1000043039 257
638 3300021361 Ga0213872_10004434 Ga0213872_100044349 257
639 3300021384 Ga0213876_10248192 Ga0213876_102481922 257
640 3300024225 Ga0224572_1029510 Ga0224572_10295102 257
641 3300025224 Ga0209784_100010 Ga0209784_100010635 257
642 3300025225 Ga0209566_100008 Ga0209566_100008635 257
643 3300025226 Ga0209674_100019 Ga0209674_100019635 257
644 3300025228 Ga0209672_103283 Ga0209672_1032835 257
645 3300025230 Ga0209563_100021 Ga0209563_100021635 257
646 3300025231 Ga0207427_100759 Ga0207427_10075916 257
647 3300025233 Ga0209437_100019 Ga0209437_100019635 257
648 3300025250 Ga0209026_1007808 Ga0209026_10078083 257
649 3300025253 Ga0209677_100011 Ga0209677_100011635 257
650 3300025261 Ga0209233_1000025 Ga0209233_1000025635 257
651 3300025273 Ga0209673_1016009 Ga0209673_10160092 257
652 3300025284 Ga0209130_1000169 Ga0209130_100016992 257
653 3300025294 Ga0209025_1000636 Ga0209025_100063635 257
654 3300025303 Ga0209051_1000108 Ga0209051_100010871 257
655 3300025303 Ga0209051_1001757 Ga0209051_10017573 257
656 3300025303 Ga0209051_1006242 Ga0209051_10062426 257
657 3300025303 Ga0209051_1014327 Ga0209051_10143273 257
658 3300025898 Ga0207692_10031885 Ga0207692_100318852 257
659 3300025899 Ga0207642_10012631 Ga0207642_100126312 257
660 3300025900 Ga0207710_10000010 Ga0207710_10000010204 257
661 3300025900 Ga0207710_10004339 Ga0207710_100043393 257
662 3300025901 Ga0207688_10011321 Ga0207688_100113212 257
663 3300025903 Ga0207680_10008954 Ga0207680_100089543 257
664 3300025906 Ga0207699_10022200 Ga0207699_100222004 257
665 3300025906 Ga0207699_10079399 Ga0207699_100793992 257
666 3300025910 Ga0207684_10188291 Ga0207684_101882913 257
667 3300025910 Ga0207684_10208174 Ga0207684_102081741 257
668 3300025912 Ga0207707_10083655 Ga0207707_100836552 257
669 3300025914 Ga0207671_10025042 Ga0207671_100250422 257
670 3300025914 Ga0207671_10026071 Ga0207671_100260712 257
671 3300025914 Ga0207671_10061967 Ga0207671_100619672 257
672 3300025915 Ga0207693_10000430 Ga0207693_1000043029 257
673 3300025916 Ga0207663_10001439 Ga0207663_1000143911 257
674 3300025916 Ga0207663_10042206 Ga0207663_100422064 257
675 3300025918 Ga0207662_10187750 Ga0207662_101877501 257
676 3300025919 Ga0207657_10012688 Ga0207657_100126881 257
677 3300025919 Ga0207657_10122545 Ga0207657_101225451 257
678 3300025920 Ga0207649_10009529 Ga0207649_100095291 257
679 3300025921 Ga0207652_10042590 Ga0207652_100425904 257
680 3300025923 Ga0207681_10010378 Ga0207681_100103784 257
681 3300025923 Ga0207681_10134276 Ga0207681_101342762 257
682 3300025924 Ga0207694_10359904 Ga0207694_103599042 257
683 3300025926 Ga0207659_10058015 Ga0207659_100580152 257
684 3300025926 Ga0207659_10177343 Ga0207659_101773432 257
685 3300025927 Ga0207687_10000803 Ga0207687_100008033 257
686 3300025927 Ga0207687_10200019 Ga0207687_102000192 257
687 3300025928 Ga0207700_10060220 Ga0207700_100602202 257
688 3300025928 Ga0207700_10307821 Ga0207700_103078212 257
689 3300025928 Ga0207700_10364193 Ga0207700_103641932 257
690 3300025929 Ga0207664_10030063 Ga0207664_100300632 257
691 3300025929 Ga0207664_10096640 Ga0207664_100966402 257
692 3300025929 Ga0207664_10122087 Ga0207664_101220872 257
693 3300025932 Ga0207690_10000951 Ga0207690_1000095122 257
694 3300025932 Ga0207690_10022582 Ga0207690_100225823 257
695 3300025934 Ga0207686_10005781 Ga0207686_100057817 257
696 3300025937 Ga0207669_10001734 Ga0207669_1000173411 257
697 3300025937 Ga0207669_10056934 Ga0207669_100569342 257
698 3300025939 Ga0207665_10399111 Ga0207665_103991112 257
699 3300025941 Ga0207711_10000364 Ga0207711_1000036436 257
700 3300025941 Ga0207711_10006457 Ga0207711_1000645710 257
701 3300025942 Ga0207689_10046184 Ga0207689_100461842 257
702 3300025944 Ga0207661_10066571 Ga0207661_100665712 257
703 3300025945 Ga0207679_10010560 Ga0207679_100105603 257
704 3300025949 Ga0207667_10057635 Ga0207667_100576352 257
705 3300025961 Ga0207712_10000010 Ga0207712_10000010190 257
706 3300025961 Ga0207712_10001841 Ga0207712_100018416 257
707 3300025972 Ga0207668_10001136 Ga0207668_1000113612 257
708 3300025972 Ga0207668_10005253 Ga0207668_100052533 257
709 3300025981 Ga0207640_10055576 Ga0207640_100555763 257
710 3300025986 Ga0207658_10001232 Ga0207658_1000123221 257
711 3300025986 Ga0207658_10011465 Ga0207658_100114652 257
712 3300025986 Ga0207658_10027964 Ga0207658_100279643 257
713 3300026023 Ga0207677_10045702 Ga0207677_100457022 257
714 3300026023 Ga0207677_10102788 Ga0207677_101027882 257
715 3300026035 Ga0207703_10003382 Ga0207703_1000338214 257
716 3300026035 Ga0207703_10010738 Ga0207703_100107387 257
717 3300026041 Ga0207639_10013486 Ga0207639_100134863 257
718 3300026041 Ga0207639_10033277 Ga0207639_100332772 257
719 3300026067 Ga0207678_10045277 Ga0207678_100452773 257
720 3300026067 Ga0207678_10222501 Ga0207678_102225013 257
721 3300026088 Ga0207641_10001609 Ga0207641_100016098 257
722 3300026088 Ga0207641_10731733 Ga0207641_107317332 257
723 3300026089 Ga0207648_10002033 Ga0207648_100020332 257
724 3300026118 Ga0207675_100000192 Ga0207675_10000019263 257
725 3300026121 Ga0207683_10001366 Ga0207683_100013662 257
726 3300026121 Ga0207683_10011413 Ga0207683_100114132 257
727 3300026121 Ga0207683_10503246 Ga0207683_105032461 257
728 3300026142 Ga0207698_10740524 Ga0207698_107405242 257
729 3300027876 Ga0209974_10051148 Ga0209974_100511482 257
730 3300027907 Ga0207428_10000146 Ga0207428_1000014636 257
731 3300028379 Ga0268266_10049960 Ga0268266_100499602 257
732 3300028380 Ga0268265_10000014 Ga0268265_10000014252 257
733 3300028380 Ga0268265_10008139 Ga0268265_100081395 257
734 3300028381 Ga0268264_10000137 Ga0268264_10000137100 257
735 3300028381 Ga0268264_10019775 Ga0268264_100197754 257
736 3300031241 Ga0265325_10000095 Ga0265325_1000009557 257
737 3300031241 Ga0265325_10003702 Ga0265325_100037029 257
738 3300031247 Ga0265340_10074817 Ga0265340_100748172 257
739 3300031251 Ga0265327_10000662 Ga0265327_1000066221 257
740 3300031548 Ga0307408_100143962 Ga0307408_1001439623 257
741 3300031595 Ga0265313_10000175 Ga0265313_1000017517 257
742 3300031595 Ga0265313_10010531 Ga0265313_100105314 257
743 3300031824 Ga0307413_10019596 Ga0307413_100195964 257
744 3300031901 Ga0307406_10175227 Ga0307406_101752272 257
745 3300031995 Ga0307409_100767566 Ga0307409_1007675662 257
746 3300031995 Ga0307409_100830785 Ga0307409_1008307851 257
747 3300032002 Ga0307416_100417997 Ga0307416_1004179971 257
748 3300032004 Ga0307414_10380610 Ga0307414_103806102 257
749 3300035117 Ga0373953_0004282 Ga0373953_0004282_2230_3003 257
750 3300035120 Ga0373957_0012598 Ga0373957_0012598_1922_2695 257
751 3300035172 Ga0373955_0008867 Ga0373955_0008867_2455_3228 257
752 3300035724 Ga0373933_0021746 Ga0373933_0021746_1413_2186 257
753 3300035725 Ga0373947_0038147 Ga0373947_0038147_900_1673 257
754 3300036401 Ga0373937_0029111 Ga0373937_0029111_1780_2553 257
755 3300036401 Ga0373937_0046708 Ga0373937_0046708_2718_3494 257
756 3300037312 Ga0395899_0002806 Ga0395899_0002806_13058_13834 257
757 3300037312 Ga0395899_0003641 Ga0395899_0003641_5267_6043 257
758 3300037312 Ga0395899_0003830 Ga0395899_0003830_10872_11648 257
759 3300037312 Ga0395899_0011850 Ga0395899_0011850_4664_5515 257
760 3300037418 Ga0395900_0014022 Ga0395900_0014022_7164_7940 257
761 3300037418 Ga0395900_0028256 Ga0395900_0028256_954_1730 257
762 3300037418 Ga0395900_0034856 Ga0395900_0034856_1405_2181 257
763 3300037418 Ga0395900_0056359 Ga0395900_0056359_1376_2227 257
764 3300037418 Ga0395900_0319114 Ga0395900_0319114_77_853 257
765 3300037418 Ga0395900_0596007 Ga0395900_0596007_21_797 257
766 3300037466 Ga0395898_0004724 Ga0395898_0004724_13038_13811 257
767 3300037466 Ga0395898_0020590 Ga0395898_0020590_5679_6455 257
768 3300037471 Ga0395905_0010442 Ga0395905_0010442_7913_8689 257
769 3300037471 Ga0395905_0010661 Ga0395905_0010661_4465_5241 257
770 3300037471 Ga0395905_0013127 Ga0395905_0013127_6167_7018 257
771 3300037471 Ga0395905_0030081 Ga0395905_0030081_404_1180 257
772 3300037471 Ga0395905_0047862 Ga0395905_0047862_309_1085 257
773 3300037471 Ga0395905_0242218 Ga0395905_0242218_72_848 257
774 3300038443 Ga0395901_0091572 Ga0395901_0091572_1123_1899 257
775 3300038443 Ga0395901_0606202 Ga0395901_0606202_310_1086 257
776 3300039437 Ga0436365_1083994 Ga0436365_1083994_195397_196170 257
777 3300039438 Ga0436360_0382408 Ga0436360_0382408_21_809 257
778 3300039438 Ga0436360_0993747 Ga0436360_0993747_559_1338 257
779 3300039438 Ga0436360_1007975 Ga0436360_1007975_341_1129 257
780 3300039447 Ga0436361_0009051 Ga0436361_0009051_1303_2079 257
781 3300039447 Ga0436361_0013073 Ga0436361_0013073_16138_16914 257
782 3300039447 Ga0436361_0362627 Ga0436361_0362627_229_1005 257
783 3300039453 Ga0436362_0979548 Ga0436362_0979548_99_887 257
784 3300041408 Ga0439453_0000704 Ga0439453_0000704_1414_2187 257
785 3300041413 Ga0439465_0002245 Ga0439465_0002245_2565_3347 257
786 3300041413 Ga0439465_0002436 Ga0439465_0002436_5004_5789 257
787 3300041486 Ga0451807_1428362 Ga0451807_1428362_547_1320 257
788 3300041512 Ga0451853_2327740 Ga0451853_2327740_351_1136 257
789 3300041997 Ga0439431_0002763 Ga0439431_0002763_1968_2753 257
790 3300042003 Ga0439443_005046 Ga0439443_005046_227_1000 257
791 3300042005 Ga0439448_0011129 Ga0439448_0011129_955_1737 257
792 3300042461 Ga0439460_0006884 Ga0439460_0006884_1276_2049 257
793 3300044656 Ga0466969_0000361 Ga0466969_0000361_153_929 257
794 3300044656 Ga0466969_0112099 Ga0466969_0112099_55_831 257
795 3300044658 Ga0466972_0000420 Ga0466972_0000420_314_1090 257
796 3300044658 Ga0466972_0039574 Ga0466972_0039574_883_1659 257
797 3300044658 Ga0466972_0090765 Ga0466972_0090765_300_1076 257
798 3300044659 Ga0466973_0035531 Ga0466973_0035531_3836_4612 257
799 3300044672 Ga0466982_0188692 Ga0466982_0188692_154_930 257
800 3300044683 Ga0466965_0007481 Ga0466965_0007481_1317_2093 257
801 3300044683 Ga0466965_0022045 Ga0466965_0022045_1472_2254 257
802 3300044684 Ga0466966_0007793 Ga0466966_0007793_1754_2536 257
803 3300044684 Ga0466966_0013203 Ga0466966_0013203_4034_4810 257
804 3300044684 Ga0466966_0124291 Ga0466966_0124291_699_1475 257
805 3300044693 Ga0466961_0006278 Ga0466961_0006278_3619_4401 257
806 3300044693 Ga0466961_0008364 Ga0466961_0008364_5250_6026 257
807 3300044694 Ga0466963_0004494 Ga0466963_0004494_7057_7833 257
808 3300044694 Ga0466963_0022728 Ga0466963_0022728_1967_2746 257
809 3300044694 Ga0466963_0048518 Ga0466963_0048518_699_1481 257
810 3300044694 Ga0466963_0142438 Ga0466963_0142438_34_810 257
811 3300044706 Ga0466964_0007346 Ga0466964_0007346_105_881 257
812 3300044706 Ga0466964_0048901 Ga0466964_0048901_148_924 257
813 3300044719 Ga0466971_0022214 Ga0466971_0022214_314_1096 257
814 3300044719 Ga0466971_0044289 Ga0466971_0044289_559_1335 257
815 3300044719 Ga0466971_0105567 Ga0466971_0105567_243_1019 257
816 3300044719 Ga0466971_0136595 Ga0466971_0136595_276_1052 257
817 3300044735 Ga0466968_0006767 Ga0466968_0006767_877_1653 257
818 3300044735 Ga0466968_0037819 Ga0466968_0037819_945_1721 257
819 3300044735 Ga0466968_0131601 Ga0466968_0131601_257_1033 257
820 3300044765 Ga0466970_0006849 Ga0466970_0006849_1665_2447 257
821 3300044765 Ga0466970_0087619 Ga0466970_0087619_373_1149 257
822 3300044765 Ga0466970_0115331 Ga0466970_0115331_655_1431 257
823 3300044765 Ga0466970_0149468 Ga0466970_0149468_464_1240 257
824 3300044842 Ga0466957_0005590 Ga0466957_0005590_157_933 257
825 3300044842 Ga0466957_0014795 Ga0466957_0014795_3328_4110 257
826 3300044842 Ga0466957_0035342 Ga0466957_0035342_1285_2061 257
827 3300044842 Ga0466957_0078937 Ga0466957_0078937_915_1691 257
828 3300044901 Ga0466960_0004284 Ga0466960_0004284_831_1607 257
829 3300044901 Ga0466960_0018539 Ga0466960_0018539_597_1379 257
830 3300044901 Ga0466960_0313706 Ga0466960_0313706_65_841 257
831 3300045049 Ga0466959_0105705 Ga0466959_0105705_663_1439 257
832 3300045051 Ga0451576_0584523 Ga0451576_0584523_212_988 257
833 3300045836 Ga0466958_0012293 Ga0466958_0012293_391_1167 257
834 3300045836 Ga0466958_0026343 Ga0466958_0026343_628_1404 257
835 3300045836 Ga0466958_0052237 Ga0466958_0052237_190_972 257
836 3300045836 Ga0466958_0053315 Ga0466958_0053315_140_922 257
837 3300045836 Ga0466958_0105658 Ga0466958_0105658_86_862 257
838 3300045976 Ga0466967_0001683 Ga0466967_0001683_7744_8526 257
839 3300045976 Ga0466967_0034747 Ga0466967_0034747_2790_3569 257
840 3300045976 Ga0466967_0090115 Ga0466967_0090115_80_853 257
841 3300045976 Ga0466967_0150992 Ga0466967_0150992_218_1003 257
842 3300045976 Ga0466967_0210863 Ga0466967_0210863_917_1693 257
843 3300045976 Ga0466967_0550476 Ga0466967_0550476_315_1088 257
844 3300046452 Ga0495617_013481 Ga0495617_013481_1708_2484 257
845 3300046454 Ga0495592_0002825 Ga0495592_0002825_8801_9577 257
846 3300046454 Ga0495592_0003233 Ga0495592_0003233_650_1423 257
847 3300046459 Ga0495629_0065721 Ga0495629_0065721_515_1288 257
848 3300046460 Ga0495638_0005942 Ga0495638_0005942_3069_3842 257
849 3300046460 Ga0495638_0023484 Ga0495638_0023484_24_797 257
850 3300046461 Ga0495641_0036978 Ga0495641_0036978_1485_2258 257
851 3300046462 Ga0495651_0240611 Ga0495651_0240611_310_1086 257
852 3300046463 Ga0495653_0029750 Ga0495653_0029750_1359_2135 257
853 3300046471 Ga0495650_0001749 Ga0495650_0001749_18718_19494 257
854 3300046477 Ga0495664_0033641 Ga0495664_0033641_1250_2023 257
855 3300046491 Ga0495584_0023449 Ga0495584_0023449_197_973 257
856 3300046491 Ga0495584_0080751 Ga0495584_0080751_596_1372 257
857 3300046492 Ga0495585_0039691 Ga0495585_0039691_198_974 257
858 3300046501 Ga0495607_0024047 Ga0495607_0024047_324_1100 257
859 3300046511 Ga0495608_0012925 Ga0495608_0012925_4376_5149 257
860 3300046511 Ga0495608_0057345 Ga0495608_0057345_45_821 257
861 3300046513 Ga0495616_0033528 Ga0495616_0033528_215_991 257
862 3300046516 Ga0495628_0000382 Ga0495628_0000382_39183_39959 257
863 3300046516 Ga0495628_0005505 Ga0495628_0005505_4154_4927 257
864 3300046517 Ga0495630_0323515 Ga0495630_0323515_254_1027 257
865 3300046517 Ga0495630_0361060 Ga0495630_0361060_298_1071 257
866 3300046529 Ga0495652_0049004 Ga0495652_0049004_508_1284 257
867 3300046530 Ga0495654_0161137 Ga0495654_0161137_27_800 257
868 3300046536 Ga0495587_0008211 Ga0495587_0008211_4038_4811 257
869 3300046537 Ga0495598_0000136 Ga0495598_0000136_1881_2654 257
870 3300046539 Ga0495621_0058145 Ga0495621_0058145_15_791 257
871 3300046543 Ga0495645_0016724 Ga0495645_0016724_4406_5179 257
872 3300046543 Ga0495645_0096766 Ga0495645_0096766_174_950 257
873 3300046558 Ga0495633_0015374 Ga0495633_0015374_362_1138 257
874 3300046558 Ga0495633_0021245 Ga0495633_0021245_196_972 257
875 3300046558 Ga0495633_0125421 Ga0495633_0125421_50_1054 257
876 3300046559 Ga0495667_0003376 Ga0495667_0003376_9550_10323 257
877 3300046660 Ga0495625_0011811 Ga0495625_0011811_268_1044 257
878 3300046663 Ga0495635_0006033 Ga0495635_0006033_2749_3522 257
879 3300046665 Ga0495661_0103364 Ga0495661_0103364_78_854 257
880 3300046675 Ga0495657_0048208 Ga0495657_0048208_1893_2666 257
881 3300046678 Ga0495599_0002274 Ga0495599_0002274_2410_3183 257
882 3300046678 Ga0495599_0032804 Ga0495599_0032804_110_886 257
883 3300046679 Ga0495623_0059789 Ga0495623_0059789_1068_1841 257
884 3300046680 Ga0495646_0109155 Ga0495646_0109155_712_1485 257
885 3300046690 Ga0495624_0032247 Ga0495624_0032247_1036_1809 257
886 3300046691 Ga0495670_0000859 Ga0495670_0000859_13724_14500 257
887 3300046692 Ga0495671_0123346 Ga0495671_0123346_361_1137 257
888 3300046809 Ga0495600_0008938 Ga0495600_0008938_3028_3801 257
889 3300046809 Ga0495600_0015355 Ga0495600_0015355_195_971 257
890 3300047317 Ga0495604_0006062 Ga0495604_0006062_4175_4948 257
891 3300047317 Ga0495604_0199964 Ga0495604_0199964_388_1161 257
892 3300047317 Ga0495604_0408292 Ga0495604_0408292_84_860 257
893 3300047319 Ga0495674_0040893 Ga0495674_0040893_1986_2759 257
894 3300047322 Ga0495680_0049405 Ga0495680_0049405_2412_3185 257
895 3300047443 Ga0495687_010094 Ga0495687_010094_4418_5194 257
896 3300047444 Ga0495675_0048115 Ga0495675_0048115_473_1246 257
897 3300047472 Ga0495686_0002311 Ga0495686_0002311_16142_16915 257
898 3300047472 Ga0495686_0113726 Ga0495686_0113726_814_1590 257
899 3300048088 Ga0495602_0002983 Ga0495602_0002983_8701_9474 257
900 3300048088 Ga0495602_0045260 Ga0495602_0045260_2829_3605 257
901 3300048903 Ga0496100_0000110 Ga0496100_0000110_5408_6181 257
902 3300048903 Ga0496100_0000412 Ga0496100_0000412_13709_14482 257
903 3300048903 Ga0496100_0058186 Ga0496100_0058186_315_1088 257
904 3300048903 Ga0496100_0586719 Ga0496100_0586719_41_814 257
905 3300048904 Ga0496101_0000054 Ga0496101_0000054_37720_38493 257
906 3300048904 Ga0496101_0000073 Ga0496101_0000073_71385_72158 257
907 3300048904 Ga0496101_0009780 Ga0496101_0009780_2246_3019 257
908 3300048904 Ga0496101_0011053 Ga0496101_0011053_3746_4528 257
909 3300048904 Ga0496101_0036664 Ga0496101_0036664_467_1243 257
910 3300048904 Ga0496101_0136930 Ga0496101_0136930_141_923 257
911 3300048905 Ga0496102_0000006 Ga0496102_0000006_179170_179943 257
912 3300048905 Ga0496102_0000118 Ga0496102_0000118_50228_51001 257
913 3300048905 Ga0496102_0018330 Ga0496102_0018330_5021_5800 257
914 3300048905 Ga0496102_0019560 Ga0496102_0019560_3692_4465 257
915 3300048905 Ga0496102_0026398 Ga0496102_0026398_2361_3143 257
916 3300048905 Ga0496102_0056000 Ga0496102_0056000_2559_3341 257
917 3300048905 Ga0496102_0149145 Ga0496102_0149145_461_1237 257
918 3300048906 Ga0496103_0000006 Ga0496103_0000006_178968_179741 257
919 3300048906 Ga0496103_0000129 Ga0496103_0000129_74047_74820 257
920 3300048906 Ga0496103_0000945 Ga0496103_0000945_18475_19257 257
921 3300048906 Ga0496103_0001200 Ga0496103_0001200_12041_12814 257
922 3300048907 Ga0496104_0003117 Ga0496104_0003117_11571_12344 257
923 3300048907 Ga0496104_0235693 Ga0496104_0235693_634_1407 257
924 3300048908 Ga0496105_0000168 Ga0496105_0000168_35800_36573 257
925 3300048908 Ga0496105_0283123 Ga0496105_0283123_444_1226 257
926 3300048909 Ga0496106_0000901 Ga0496106_0000901_18632_19414 257
927 3300048909 Ga0496106_0002231 Ga0496106_0002231_8281_9054 257
928 3300048909 Ga0496106_0020313 Ga0496106_0020313_3085_3858 257
929 3300048909 Ga0496106_0068643 Ga0496106_0068643_1561_2343 257
930 3300048910 Ga0496107_0000261 Ga0496107_0000261_9486_10259 257
931 3300048910 Ga0496107_0000264 Ga0496107_0000264_1316_2098 257
932 3300048910 Ga0496107_0097149 Ga0496107_0097149_675_1448 257
933 3300048911 Ga0496108_0014047 Ga0496108_0014047_2310_3083 257
934 3300048911 Ga0496108_0020733 Ga0496108_0020733_4024_4806 257
935 3300048912 Ga0496109_0000152 Ga0496109_0000152_26336_27109 257
936 3300048912 Ga0496109_0019674 Ga0496109_0019674_4389_5171 257
937 3300048912 Ga0496109_0352244 Ga0496109_0352244_349_1122 257
938 3300048913 Ga0496110_0001576 Ga0496110_0001576_9970_10743 257
939 3300048914 Ga0496111_0035267 Ga0496111_0035267_433_1206 257
940 3300048914 Ga0496111_0099170 Ga0496111_0099170_309_1091 257
941 3300048915 Ga0496112_0002426 Ga0496112_0002426_10516_11298 257
942 3300048915 Ga0496112_0184279 Ga0496112_0184279_955_1731 257
943 3300048915 Ga0496112_0264862 Ga0496112_0264862_631_1404 257
944 3300048917 Ga0496114_0000047 Ga0496114_0000047_45752_46525 257
945 3300048917 Ga0496114_0002699 Ga0496114_0002699_11078_11860 257
946 3300048917 Ga0496114_0038083 Ga0496114_0038083_1507_2283 257
947 3300048917 Ga0496114_0067999 Ga0496114_0067999_1661_2434 257
948 3300048917 Ga0496114_0663166 Ga0496114_0663166_28_810 257
949 3300048918 Ga0496115_0006427 Ga0496115_0006427_1605_2387 257
950 3300048918 Ga0496115_0021228 Ga0496115_0021228_1824_2597 257
951 3300048918 Ga0496115_0047070 Ga0496115_0047070_2000_2773 257
952 3300048918 Ga0496115_0129077 Ga0496115_0129077_150_923 257
953 3300048918 Ga0496115_0508164 Ga0496115_0508164_138_914 257
954 3300048919 Ga0496116_0000025 Ga0496116_0000025_290799_291572 257
955 3300048919 Ga0496116_0000968 Ga0496116_0000968_23740_24513 257
956 3300048919 Ga0496116_0003154 Ga0496116_0003154_2050_2823 257
957 3300048919 Ga0496116_0005030 Ga0496116_0005030_315_1091 257
958 3300048919 Ga0496116_0008933 Ga0496116_0008933_4666_5661 257
959 3300048920 Ga0496117_0000006 Ga0496117_0000006_290799_291572 257
960 3300048920 Ga0496117_0001082 Ga0496117_0001082_22534_23307 257
961 3300048920 Ga0496117_0027062 Ga0496117_0027062_699_1478 257
962 3300048921 Ga0496118_0000004 Ga0496118_0000004_290799_291572 257
963 3300048921 Ga0496118_0001016 Ga0496118_0001016_3289_4068 257
964 3300048921 Ga0496118_0001424 Ga0496118_0001424_33972_34745 257
965 3300048922 Ga0496119_0000041 Ga0496119_0000041_178228_179001 257
966 3300048922 Ga0496119_0001956 Ga0496119_0001956_20385_21158 257
967 3300048922 Ga0496119_0012066 Ga0496119_0012066_6065_6838 257
968 3300048923 Ga0496120_0000027 Ga0496120_0000027_22004_22777 257
969 3300048923 Ga0496120_0014259 Ga0496120_0014259_977_1750 257
970 3300048924 Ga0496121_0000004 Ga0496121_0000004_125578_126351 257
971 3300048924 Ga0496121_0002353 Ga0496121_0002353_20234_21007 257
972 3300048924 Ga0496121_0002460 Ga0496121_0002460_16531_17304 257
973 3300048925 Ga0496122_0000313 Ga0496122_0000313_88081_88854 257
974 3300048925 Ga0496122_0035029 Ga0496122_0035029_645_1421 257
975 3300048925 Ga0496122_0035956 Ga0496122_0035956_2938_3933 257
976 3300048926 Ga0496123_0006622 Ga0496123_0006622_9263_10036 257
977 3300048926 Ga0496123_0020859 Ga0496123_0020859_1714_2490 257
978 3300048927 Ga0496124_0000117 Ga0496124_0000117_125578_126351 257
979 3300048928 Ga0496125_0000003 Ga0496125_0000003_1063417_1064190 257
980 3300048928 Ga0496125_0000368 Ga0496125_0000368_83215_83991 257
981 3300048928 Ga0496125_0024119 Ga0496125_0024119_4641_5414 257
982 3300048928 Ga0496125_0159015 Ga0496125_0159015_75_1070 257
983 3300048929 Ga0496126_0000001 Ga0496126_0000001_125578_126351 257
984 3300048929 Ga0496126_0001241 Ga0496126_0001241_352_1125 257
985 3300048929 Ga0496126_0001576 Ga0496126_0001576_23639_24415 257
986 3300048929 Ga0496126_0005051 Ga0496126_0005051_11690_12463 257
987 3300048929 Ga0496126_0291949 Ga0496126_0291949_505_1287 257
988 3300049569 Ga0501032_0001371 Ga0501032_0001371_7979_8752 257
989 3300049569 Ga0501032_0003212 Ga0501032_0003212_8402_9184 257
990 3300049569 Ga0501032_0034563 Ga0501032_0034563_552_1334 257
991 3300049569 Ga0501032_0087365 Ga0501032_0087365_35_808 257
992 3300049569 Ga0501032_0097164 Ga0501032_0097164_895_1668 257
993 3300049570 Ga0501033_0072360 Ga0501033_0072360_867_1649 257
994 3300049570 Ga0501033_0145944 Ga0501033_0145944_359_1132 257
995 3300049570 Ga0501033_0185289 Ga0501033_0185289_73_855 257
996 3300049571 Ga0501034_0003796 Ga0501034_0003796_13212_13985 257
997 3300049571 Ga0501034_0013153 Ga0501034_0013153_2963_3745 257
998 3300049571 Ga0501034_0055948 Ga0501034_0055948_1668_2450 257
999 3300049571 Ga0501034_0229872 Ga0501034_0229872_334_1107 257
1000 3300049571 Ga0501034_0241354 Ga0501034_0241354_631_1404 257
1001 3300049572 Ga0501036_0034199 Ga0501036_0034199_2017_2790 257
1002 3300049572 Ga0501036_0059121 Ga0501036_0059121_921_1703 257
1003 3300049573 Ga0501037_0001970 Ga0501037_0001970_3257_4030 257
1004 3300049573 Ga0501037_0031564 Ga0501037_0031564_540_1322 257
1005 3300049573 Ga0501037_0147918 Ga0501037_0147918_136_909 257
1006 3300049574 Ga0501038_0004393 Ga0501038_0004393_4002_4775 257
1007 3300049574 Ga0501038_0071518 Ga0501038_0071518_2121_2894 257
1008 3300049575 Ga0501039_0003456 Ga0501039_0003456_8497_9270 257
1009 3300049575 Ga0501039_0380556 Ga0501039_0380556_18_791 257
1010 3300049575 Ga0501039_0615209 Ga0501039_0615209_51_827 257
1011 3300049579 Ga0501043_0002321 Ga0501043_0002321_7851_8624 257
1012 3300049579 Ga0501043_0003123 Ga0501043_0003123_8528_9310 257
1013 3300049580 Ga0501046_0005675 Ga0501046_0005675_7396_8178 257
1014 3300049581 Ga0501047_0027950 Ga0501047_0027950_2343_3116 257
1015 3300049581 Ga0501047_0038850 Ga0501047_0038850_2783_3565 257
1016 3300049581 Ga0501047_0044212 Ga0501047_0044212_732_1505 257
1017 3300049581 Ga0501047_0243678 Ga0501047_0243678_28_801 257
1018 3300049581 Ga0501047_0243871 Ga0501047_0243871_656_1438 257
1019 3300049582 Ga0501048_0023055 Ga0501048_0023055_171_953 257
1020 3300049585 Ga0501069_0014362 Ga0501069_0014362_1353_2135 257
1021 3300049585 Ga0501069_0066502 Ga0501069_0066502_315_1088 257
1022 3300049586 Ga0501070_0000288 Ga0501070_0000288_19898_20680 257
1023 3300049586 Ga0501070_0002522 Ga0501070_0002522_2331_3104 257
1024 3300049589 Ga0501073_0021631 Ga0501073_0021631_2112_2885 257
1025 3300049589 Ga0501073_0044334 Ga0501073_0044334_1497_2279 257
1026 3300049591 Ga0501075_0075742 Ga0501075_0075742_929_1708 257
1027 3300049592 Ga0501076_0003829 Ga0501076_0003829_3568_4347 257
1028 3300049593 Ga0501077_0003493 Ga0501077_0003493_1976_2755 257
1029 3300049593 Ga0501077_0158856 Ga0501077_0158856_147_920 257
1030 3300049741 Ga0501079_0168591 Ga0501079_0168591_626_1405 257
1031 3300049742 Ga0501080_0101408 Ga0501080_0101408_1415_2197 257
1032 3300049743 Ga0501081_0002149 Ga0501081_0002149_7193_7972 257
1033 3300049744 Ga0501083_0134476 Ga0501083_0134476_822_1595 257
1034 3300049822 Ga0501035_0001318 Ga0501035_0001318_4490_5272 257
1035 3300049822 Ga0501035_0001771 Ga0501035_0001771_11846_12628 257
1036 3300049822 Ga0501035_0033079 Ga0501035_0033079_2388_3161 257
1037 3300049822 Ga0501035_0328769 Ga0501035_0328769_443_1219 257
1038 3300049822 Ga0501035_0633865 Ga0501035_0633865_10_783 257
1039 3300049823 Ga0501044_0000554 Ga0501044_0000554_10371_11153 257
1040 3300049823 Ga0501044_0002733 Ga0501044_0002733_1090_1872 257
1041 3300049823 Ga0501044_0032103 Ga0501044_0032103_2628_3401 257
1042 3300049823 Ga0501044_0068070 Ga0501044_0068070_1280_2053 257
1043 3300049823 Ga0501044_0159904 Ga0501044_0159904_821_1612 257
1044 3300049823 Ga0501044_0455494 Ga0501044_0455494_26_799 257
1045 3300050490 nmdc:mga03n38_21264_c1 nmdc:mga03n38_21264_c1_874_1647 257
1046 3300050491 nmdc:mga00v17_31853_c1 nmdc:mga00v17_31853_c1_312_1094 257
1047 3300050491 nmdc:mga00v17_344296_c1 nmdc:mga00v17_344296_c1_106_879 257
1048 3300050492 nmdc:mga0yw44_18995_c1 nmdc:mga0yw44_18995_c1_181_954 257
1049 3300050492 nmdc:mga0yw44_29042_c1 nmdc:mga0yw44_29042_c1_155_928 257
1050 3300050494 nmdc:mga06z11_336241_c1 nmdc:mga06z11_336241_c1_72_854 257
1051 3300050496 nmdc:mga07m45_27607_c1 nmdc:mga07m45_27607_c1_2262_3044 257
1052 3300050507 nmdc:mga05p37_111_c2 nmdc:mga05p37_111_c2_4815_5588 257
1053 3300050508 nmdc:mga09592_137_c1 nmdc:mga09592_137_c1_16280_17053 257
1054 3300050508 nmdc:mga09592_453402_c1 nmdc:mga09592_453402_c1_139_939 257
1055 3300050509 nmdc:mga0qj67_2255_c1 nmdc:mga0qj67_2255_c1_9904_10677 257
1056 3300050510 nmdc:mga06r32_526_c1 nmdc:mga06r32_526_c1_4695_5468 257
1057 3300050511 nmdc:mga08y16_1030_c1 nmdc:mga08y16_1030_c1_4829_5602 257
1058 3300050512 nmdc:mga0n895_331_c1 nmdc:mga0n895_331_c1_25982_26755 257
1059 3300050513 nmdc:mga0rr50_5720_c1 nmdc:mga0rr50_5720_c1_1388_2161 257
1060 3300050513 nmdc:mga0rr50_60211_c1 nmdc:mga0rr50_60211_c1_464_1240 257
1061 3300050515 nmdc:mga0a205_50_c1 nmdc:mga0a205_50_c1_20223_20996 257
1062 3300050516 nmdc:mga0sz30_3889_c1 nmdc:mga0sz30_3889_c1_2821_3594 257
1063 3300050516 nmdc:mga0sz30_8058_c1 nmdc:mga0sz30_8058_c1_3130_3906 257
1064 3300053077 Ga0495601_0017212 Ga0495601_0017212_1569_2342 257
1065 3300053078 Ga0495612_0006121 Ga0495612_0006121_2573_3346 257
1066 3300053079 Ga0500610_0005980 Ga0500610_0005980_833_1606 257
1067 3300053080 Ga0500635_0072227 Ga0500635_0072227_219_1004 257
1068 3300053084 Ga0495595_0002756 Ga0495595_0002756_3007_3780 257
1069 3300053084 Ga0495595_0095490 Ga0495595_0095490_497_1270 257
1070 3300053085 Ga0495619_0000461 Ga0495619_0000461_18078_18851 257
1071 3300053085 Ga0495619_0029565 Ga0495619_0029565_1387_2160 257
1072 3300053087 Ga0500643_007238 Ga0500643_007238_3194_3979 257
1073 3300053087 Ga0500643_014858 Ga0500643_014858_45_818 257
1074 3300053093 Ga0500651_0029835 Ga0500651_0029835_37_813 257
1075 3300053104 Ga0500556_0021621 Ga0500556_0021621_352_1125 257
1076 3300053119 Ga0500595_002529 Ga0500595_002529_5594_6370 257
1077 3300053141 Ga0500574_003599 Ga0500574_003599_368_1144 257
1078 3300053730 Ga0500645_000046 Ga0500645_000046_3864_4649 257
1079 3300054114 Ga0501084_0003046 Ga0501084_0003046_3628_4407 257
1080 3300054114 Ga0501084_0390617 Ga0501084_0390617_33_815 257
1081 3300059510 Ga0587090_000758 Ga0587090_000758_1747_2523 257
1082 3300059624 Ga0587109_032831 Ga0587109_032831_65_946 257
1083 3300059655 Ga0587114_016201 Ga0587114_016201_45_926 257
1084 3300059657 Ga0587118_04109 Ga0587118_04109_48_929 257
1085 3300060353 Ga0501082_0013704 Ga0501082_0013704_3636_4415 257
1086 3300060353 Ga0501082_0368015 Ga0501082_0368015_387_1160 257
1087 3300060353 Ga0501082_0606004 Ga0501082_0606004_131_904 257
1088 3300061719 Ga0466962_0013821 Ga0466962_0013821_2542_3318 257
1089 3300061719 Ga0466962_0024354 Ga0466962_0024354_1930_2712 257
1090 3300061719 Ga0466962_0099574 Ga0466962_0099574_150_926 257
1091 3300061719 Ga0466962_0247926 Ga0466962_0247926_25_807 257
1092 3300061734 Ga0530510_0355470 Ga0530510_0355470_86_865 257
1093 iso_pu_bacteria 2738541274 2738704898 257
1094 iso_pu_bacteria 2738543028 2739330068 257
1095 iso_pu_bacteria 2738543034 2739367112 257
1096 iso_pu_bacteria 2902799365 2902803416 257
1097 iso_pu_bacteria 2984523437 2984524758 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

64

312

0.98

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

69

242

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pzk-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase in apo form 0.9958 2 255
4fjw-assembly1.cif.gz_D crystal structure of the apo form of the e131q mtb crotonase 0.9944 1 256
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.993 2 257
3q0g-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa 0.9924 2 256
3pzk-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase in apo form 0.9917 2 255
ID Description Score Start End Superfamily
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.003 202 257 1.10.12.10
3q0gD02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.003 202 255 1.10.12.10
3h81A02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.002 202 257 1.10.12.10
af_P30084_233_289_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.002 206 255 1.10.12.10
3q0gA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.002 202 256 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A2S8M4F8-F1-model_v4 deleted 0.9999 1 209
AF-A0A354TYN4-F1-model_v4 deleted 0.9999 65 255
AF-A0A445NIZ9-F1-model_v4 deleted 0.9997 1 257
AF-A0A5C7MZ08-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9996 73 257 GO:0004300
GO:0006635
AF-X8FJU2-F1-model_v4 deleted 0.9987 1 257

Feature Viewer

pLDDT pTM Quality
97.45 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map