F488184

General Info

Members Datasets Scaffolds Average Seq Length
1012 452 2024 87

Family's Representative Sequence

Representative Sequence 3300059477|Ga0587084_056263|Ga0587084_056263_86_403
Length 105
Sequence MAHKKGASSSRNGRDSAAQRLGVKRYGGQLVNAGEILIRQRGTKFHPGEFVGRGGDDTLFALAKGNVQFGRSRGRKTVSIVPVPDTVSPGSPRRPKDQASVAGTA

Samples

Sample ID Description Type Environment
1 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
136 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
137 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
138 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
139 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
140 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
165 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
245 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
246 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
247 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
273 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
274 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
275 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
276 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
277 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
278 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
279 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
280 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
283 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
298 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
299 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
300 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
301 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
302 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
303 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
304 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
305 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
306 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
307 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
308 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
309 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
310 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
311 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
312 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
313 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
314 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
315 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
316 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
317 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
322 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
323 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
324 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
331 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
332 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
336 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
337 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
341 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
383 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
384 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
389 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
390 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
391 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
402 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
403 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
404 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
411 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
412 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
415 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
416 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
417 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
418 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
419 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
420 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
450 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
451 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
452 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.28
Metatranscriptomes 14.62
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 3.36
Rhizosphere 92
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587084_056263 3300059477 Bacteria 709
2 JGI24741J21665_1067789 3300001915 Bacteria 528
3 JGI24752J21851_1015166 3300001976 Bacteria 1004
4 JGI24746J21847_1043902 3300001977 Bacteria 624
5 JGI24747J21853_1009217 3300001978 Bacteria 973
6 JGI24740J21852_10049558 3300001979 Bacteria 1212
7 JGI24739J22299_10010241 3300001989 Bacteria 3481
8 JGI24739J22299_10104754 3300001989 Bacteria 852
9 JGI24739J22299_10109999 3300001989 Bacteria 827
10 JGI24739J22299_10127382 3300001989 Bacteria 758
11 JGI24737J22298_10039049 3300001990 Bacteria 1460
12 JGI24737J22298_10111496 3300001990 Bacteria 809
13 JGI24735J21928_10022810 3300002067 Bacteria 1902
14 JGI24735J21928_10053675 3300002067 Bacteria 1162
15 JGI24735J21928_10078454 3300002067 Bacteria 946
16 JGI24735J21928_10088130 3300002067 Bacteria 889
17 JGI24738J21930_10059523 3300002075 Bacteria 784
18 JGI24738J21930_10079176 3300002075 Bacteria 686
19 JGI24033J26618_1016950 3300002155 Bacteria 909
20 JGI24751J29686_10008749 3300002459 Bacteria 2075
21 Ga0006759J45824_1022434 3300003163 Bacteria 685
22 JGI25406J46586_10011374 3300003203 Bacteria 3906
23 JGI25406J46586_10189434 3300003203 Bacteria 600
24 Ga0006777J48905_1037349 3300003308 Bacteria 692
25 Ga0007417J51691_1024088 3300003544 Bacteria 696
26 Ga0006781J51513_1024176 3300003568 Bacteria 688
27 Ga0007410J51695_1021211 3300003574 Bacteria 688
28 Ga0007409J51694_1025611 3300003575 Bacteria 696
29 Ga0007416J51690_1019056 3300003577 Bacteria 680
30 Ga0007429J51699_1020599 3300003579 Bacteria 903
31 Ga0007411J51799_111587 3300003611 Bacteria 695
32 JGI25404J52841_10068869 3300003659 Bacteria 740
33 Ga0032354_1016987 3300003693 Bacteria 695
34 Ga0032354_1062121 3300003693 Bacteria 694
35 Ga0058859_11739610 3300004798 Bacteria 744
36 Ga0058863_10041619 3300004799 Bacteria 698
37 Ga0058861_10012375 3300004800 Bacteria 804
38 Ga0058862_10038154 3300004803 Bacteria 881
39 Ga0058862_10203940 3300004803 Bacteria 537
40 Ga0070658_10005407 3300005327 Bacteria 10364
41 Ga0070658_10236294 3300005327 Bacteria 1548
42 Ga0070658_11179303 3300005327 Bacteria 666
43 Ga0070676_10061366 3300005328 Bacteria 2235
44 Ga0070676_10545019 3300005328 Bacteria 829
45 Ga0070683_100064592 3300005329 Bacteria 3407
46 Ga0070683_100569290 3300005329 Bacteria 1083
47 Ga0070683_100826319 3300005329 Bacteria 888
48 Ga0070683_100933687 3300005329 Bacteria 833
49 Ga0070690_100311378 3300005330 Bacteria 1132
50 Ga0070670_100014709 3300005331 Bacteria 6720
51 Ga0070670_100952471 3300005331 Bacteria 779
52 Ga0070677_10642632 3300005333 Bacteria 592
53 Ga0068869_100014640 3300005334 Bacteria 5244
54 Ga0068869_100831345 3300005334 Bacteria 796
55 Ga0070666_10239457 3300005335 Bacteria 1283
56 Ga0070666_10366452 3300005335 Bacteria 1033
57 Ga0070666_10466760 3300005335 Bacteria 913
58 Ga0070680_100102565 3300005336 Bacteria 2376
59 Ga0070680_100451906 3300005336 Bacteria 1097
60 Ga0070680_100464388 3300005336 Bacteria 1082
61 Ga0070682_100009318 3300005337 Bacteria 5558
62 Ga0070682_100187009 3300005337 Bacteria 1451
63 Ga0068868_100474765 3300005338 Bacteria 1091
64 Ga0070660_100269470 3300005339 Bacteria 1391
65 Ga0070660_100272088 3300005339 Bacteria 1385
66 Ga0070660_100300284 3300005339 Bacteria 1316
67 Ga0070689_100302472 3300005340 Bacteria 1332
68 Ga0070691_10002288 3300005341 Bacteria 8483
69 Ga0070661_100052242 3300005344 Bacteria 2991
70 Ga0070661_100341267 3300005344 Bacteria 1173
71 Ga0070661_100370410 3300005344 Bacteria 1127
72 Ga0070661_100403001 3300005344 Bacteria 1082
73 Ga0070668_100000590 3300005347 Bacteria 24324
74 Ga0070668_100030120 3300005347 Bacteria 4125
75 Ga0070668_101836114 3300005347 Bacteria 558
76 Ga0070669_100592761 3300005353 Bacteria 928
77 Ga0070675_100426515 3300005354 Bacteria 1186
78 Ga0070671_100022196 3300005355 Bacteria 5185
79 Ga0070671_102112448 3300005355 Bacteria 502
80 Ga0070671_102122409 3300005355 Bacteria 501
81 Ga0070674_100414612 3300005356 Bacteria 1103
82 Ga0070674_100971678 3300005356 Bacteria 744
83 Ga0070673_100359723 3300005364 Bacteria 1293
84 Ga0070673_100753963 3300005364 Bacteria 897
85 Ga0070673_101548766 3300005364 Bacteria 626
86 Ga0070688_100124063 3300005365 Bacteria 1734
87 Ga0070688_100650417 3300005365 Bacteria 812
88 Ga0070659_100026603 3300005366 Bacteria 4453
89 Ga0070659_100471185 3300005366 Bacteria 1067
90 Ga0070659_100669936 3300005366 Bacteria 895
91 Ga0070659_100753799 3300005366 Bacteria 844
92 Ga0070659_102102180 3300005366 Bacteria 507
93 Ga0070667_100126394 3300005367 Bacteria 2228
94 Ga0070667_100432841 3300005367 Bacteria 1200
95 Ga0070667_100604365 3300005367 Bacteria 1011
96 Ga0070667_100605644 3300005367 Bacteria 1009
97 Ga0070667_102175495 3300005367 Bacteria 522
98 Ga0070709_10404720 3300005434 Bacteria 1020
99 Ga0070714_100039499 3300005435 Bacteria 3974
100 Ga0070714_100421898 3300005435 Bacteria 1264
101 Ga0070714_100440382 3300005435 Bacteria 1237
102 Ga0070714_102249163 3300005435 Bacteria 531
103 Ga0070713_100003681 3300005436 Bacteria 10146
104 Ga0070713_100113101 3300005436 Bacteria 2369
105 Ga0070713_101370933 3300005436 Bacteria 685
106 Ga0070710_10394898 3300005437 Bacteria 926
107 Ga0070701_10406859 3300005438 Bacteria 863
108 Ga0070711_100063662 3300005439 Bacteria 2575
109 Ga0070700_100010636 3300005441 Bacteria 5081
110 Ga0070700_100015218 3300005441 Bacteria 4359
111 Ga0070708_100137014 3300005445 Bacteria 2268
112 Ga0070663_100022899 3300005455 Bacteria 4181
113 Ga0070663_100044469 3300005455 Bacteria 3131
114 Ga0070663_100073119 3300005455 Bacteria 2500
115 Ga0070663_100684131 3300005455 Bacteria 870
116 Ga0070663_100716821 3300005455 Bacteria 851
117 Ga0070678_100036827 3300005456 Bacteria 3428
118 Ga0070678_100398905 3300005456 Bacteria 1194
119 Ga0070678_100779421 3300005456 Bacteria 867
120 Ga0070662_100006833 3300005457 Bacteria 7377
121 Ga0070662_100065187 3300005457 Bacteria 2670
122 Ga0070662_100473929 3300005457 Bacteria 1041
123 Ga0070681_10036758 3300005458 Bacteria 4917
124 Ga0070681_10066114 3300005458 Bacteria 3584
125 Ga0070681_10439495 3300005458 Bacteria 1216
126 Ga0068867_100084322 3300005459 Bacteria 2400
127 Ga0068867_100792016 3300005459 Bacteria 845
128 Ga0070685_10058492 3300005466 Bacteria 2247
129 Ga0070685_10071519 3300005466 Bacteria 2057
130 Ga0070706_100032514 3300005467 Bacteria 4812
131 Ga0070706_100101877 3300005467 Bacteria 2668
132 Ga0070706_100127440 3300005467 Bacteria 2374
133 Ga0070706_101069686 3300005467 Bacteria 743
134 Ga0070706_102113668 3300005467 Bacteria 509
135 Ga0070707_100689119 3300005468 Bacteria 984
136 Ga0070698_100279522 3300005471 Bacteria 1601
137 Ga0070698_100301632 3300005471 Bacteria 1532
138 Ga0070679_100016277 3300005530 Bacteria 7166
139 Ga0070679_100189316 3300005530 Bacteria 2027
140 Ga0070679_101186409 3300005530 Bacteria 708
141 Ga0070684_100010345 3300005535 Bacteria 7390
142 Ga0070684_100391672 3300005535 Bacteria 1280
143 Ga0070684_101115055 3300005535 Bacteria 741
144 Ga0070697_100697140 3300005536 Bacteria 896
145 Ga0068853_100063236 3300005539 Bacteria 3205
146 Ga0068853_100406738 3300005539 Bacteria 1275
147 Ga0068853_101051327 3300005539 Bacteria 784
148 Ga0070672_100507706 3300005543 Bacteria 1043
149 Ga0070686_100763274 3300005544 Bacteria 777
150 Ga0070696_100957475 3300005546 Bacteria 713
151 Ga0070696_101546918 3300005546 Bacteria 569
152 Ga0070693_100105172 3300005547 Bacteria 1727
153 Ga0070693_100652193 3300005547 Bacteria 766
154 Ga0070665_100055530 3300005548 Bacteria 3971
155 Ga0070665_100183400 3300005548 Bacteria 2093
156 Ga0070665_101257487 3300005548 Bacteria 750
157 Ga0070665_101754949 3300005548 Bacteria 627
158 Ga0070704_101306490 3300005549 Bacteria 664
159 Ga0068855_100061160 3300005563 Bacteria 4401
160 Ga0068855_100081540 3300005563 Bacteria 3749
161 Ga0068855_100136038 3300005563 Bacteria 2804
162 Ga0068855_100604971 3300005563 Bacteria 1182
163 Ga0068855_101027900 3300005563 Bacteria 864
164 Ga0070664_100064658 3300005564 Bacteria 3120
165 Ga0070664_100304490 3300005564 Bacteria 1441
166 Ga0070664_100436674 3300005564 Bacteria 1200
167 Ga0070664_100579399 3300005564 Bacteria 1039
168 Ga0070664_100585016 3300005564 Bacteria 1034
169 Ga0070664_100655678 3300005564 Bacteria 976
170 Ga0070664_101047315 3300005564 Bacteria 767
171 Ga0070664_102359465 3300005564 Bacteria 504
172 Ga0068857_100060357 3300005577 Bacteria 3368
173 Ga0068857_100201896 3300005577 Bacteria 1812
174 Ga0068857_101483532 3300005577 Bacteria 661
175 Ga0068857_101696392 3300005577 Bacteria 617
176 Ga0068857_102128347 3300005577 Bacteria 551
177 Ga0068857_102384435 3300005577 Bacteria 519
178 Ga0068854_100171464 3300005578 Bacteria 1689
179 Ga0068854_100190576 3300005578 Bacteria 1606
180 Ga0068854_100703324 3300005578 Bacteria 872
181 Ga0068856_100033803 3300005614 Bacteria 5007
182 Ga0068856_100101731 3300005614 Bacteria 2866
183 Ga0068856_100311867 3300005614 Bacteria 1591
184 Ga0068856_100420401 3300005614 Bacteria 1356
185 Ga0068856_100510156 3300005614 Bacteria 1224
186 Ga0068856_100771323 3300005614 Bacteria 981
187 Ga0068856_101306995 3300005614 Bacteria 740
188 Ga0070702_100000310 3300005615 Bacteria 16830
189 Ga0070702_100289858 3300005615 Bacteria 1127
190 Ga0068852_100007126 3300005616 Bacteria 8147
191 Ga0068852_100102701 3300005616 Bacteria 2584
192 Ga0068852_100300071 3300005616 Bacteria 1555
193 Ga0068852_101166949 3300005616 Bacteria 791
194 Ga0068852_101689753 3300005616 Bacteria 655
195 Ga0068859_100278093 3300005617 Bacteria 1766
196 Ga0068859_102056103 3300005617 Bacteria 631
197 Ga0068864_100830671 3300005618 Bacteria 909
198 Ga0068864_101076274 3300005618 Bacteria 799
199 Ga0068866_10004404 3300005718 Bacteria 5782
200 Ga0068866_10424985 3300005718 Bacteria 863
201 Ga0068861_100290548 3300005719 Bacteria 1411
202 Ga0068861_100552459 3300005719 Bacteria 1049
203 Ga0068861_101569439 3300005719 Bacteria 648
204 Ga0068851_10093763 3300005834 Bacteria 1585
205 Ga0068851_10416515 3300005834 Bacteria 793
206 Ga0068851_11088880 3300005834 Bacteria 507
207 Ga0068870_10031322 3300005840 Bacteria 2694
208 Ga0068870_11460093 3300005840 Bacteria 502
209 Ga0068863_100014469 3300005841 Bacteria 7598
210 Ga0068863_100074336 3300005841 Bacteria 3215
211 Ga0068863_100359361 3300005841 Bacteria 1419
212 Ga0068863_101726461 3300005841 Bacteria 636
213 Ga0068858_100061566 3300005842 Bacteria 3470
214 Ga0068858_100579055 3300005842 Bacteria 1088
215 Ga0068858_100947657 3300005842 Bacteria 842
216 Ga0068858_101514688 3300005842 Bacteria 661
217 Ga0068858_101873507 3300005842 Bacteria 593
218 Ga0068860_100145489 3300005843 Bacteria 2280
219 Ga0068860_100447135 3300005843 Bacteria 1285
220 Ga0068860_100454237 3300005843 Bacteria 1274
221 Ga0068860_100565315 3300005843 Bacteria 1140
222 Ga0068860_100634359 3300005843 Bacteria 1076
223 Ga0068862_100175192 3300005844 Bacteria 1922
224 Ga0068862_100351961 3300005844 Bacteria 1367
225 Ga0068862_101450893 3300005844 Bacteria 690
226 Ga0068862_102496482 3300005844 Bacteria 529
227 Ga0081455_10067796 3300005937 Bacteria 2972
228 Ga0081455_10438380 3300005937 Bacteria 896
229 Ga0081540_1003296 3300005983 Bacteria 12805
230 Ga0081540_1008757 3300005983 Bacteria 7036
231 Ga0081540_1057314 3300005983 Bacteria 1885
232 Ga0081540_1173069 3300005983 Bacteria 819
233 Ga0081539_10001171 3300005985 Bacteria 47476
234 Ga0081539_10002170 3300005985 Bacteria 28828
235 Ga0081539_10006340 3300005985 Bacteria 11401
236 Ga0081539_10020403 3300005985 Bacteria 4480
237 Ga0081539_10045692 3300005985 Bacteria 2516
238 Ga0081539_10476768 3300005985 Bacteria 517
239 Ga0070717_10127752 3300006028 Bacteria 2184
240 Ga0075368_10008846 3300006042 Bacteria 3607
241 Ga0075364_10639484 3300006051 Bacteria 727
242 Ga0075364_10688929 3300006051 Bacteria 697
243 Ga0075432_10124683 3300006058 Bacteria 970
244 Ga0070716_100194926 3300006173 Bacteria 1342
245 Ga0070712_100061815 3300006175 Bacteria 2647
246 Ga0070712_100970098 3300006175 Bacteria 735
247 Ga0075367_10003367 3300006178 Bacteria 7606
248 Ga0097621_100256560 3300006237 Bacteria 1533
249 Ga0097621_100727152 3300006237 Bacteria 915
250 Ga0097621_101741175 3300006237 Bacteria 594
251 Ga0097621_101765504 3300006237 Bacteria 589
252 Ga0097621_101783787 3300006237 Bacteria 586
253 Ga0068871_100314868 3300006358 Bacteria 1376
254 Ga0068871_100499128 3300006358 Bacteria 1096
255 Ga0075428_100001895 3300006844 Bacteria 22444
256 Ga0075428_100033085 3300006844 Bacteria 5709
257 Ga0075428_100193315 3300006844 Bacteria 2201
258 Ga0075428_101913976 3300006844 Bacteria 616
259 Ga0075430_100001244 3300006846 Bacteria 20493
260 Ga0075430_100007864 3300006846 Bacteria 9013
261 Ga0075431_100007084 3300006847 Bacteria 11141
262 Ga0075431_100009291 3300006847 Bacteria 9863
263 Ga0075431_100111461 3300006847 Bacteria 2824
264 Ga0075431_100165218 3300006847 Bacteria 2275
265 Ga0075431_100176806 3300006847 Bacteria 2192
266 Ga0075431_101615847 3300006847 Bacteria 606
267 Ga0075433_10038514 3300006852 Bacteria 4129
268 Ga0075434_100373316 3300006871 Bacteria 1447
269 Ga0075434_102558612 3300006871 Bacteria 511
270 Ga0075429_100019584 3300006880 Bacteria 5865
271 Ga0075429_100069055 3300006880 Bacteria 3076
272 Ga0075429_100075843 3300006880 Bacteria 2929
273 Ga0075429_100160507 3300006880 Bacteria 1969
274 Ga0075429_100196423 3300006880 Bacteria 1767
275 Ga0068865_100017976 3300006881 Bacteria 4555
276 Ga0068865_100737939 3300006881 Bacteria 845
277 Ga0075436_100175281 3300006914 Bacteria 1514
278 Ga0097620_100278078 3300006931 Bacteria 1766
279 Ga0097620_102055936 3300006931 Bacteria 631
280 Ga0097620_102748654 3300006931 Bacteria 541
281 Ga0075435_100083231 3300007076 Bacteria 2630
282 Ga0105251_10016185 3300009011 Bacteria 4040
283 Ga0105251_10225634 3300009011 Bacteria 844
284 Ga0105244_10218282 3300009036 Bacteria 895
285 Ga0105240_10334283 3300009093 Bacteria 1723
286 Ga0105240_10509793 3300009093 Bacteria 1336
287 Ga0105240_11487258 3300009093 Bacteria 710
288 Ga0105240_12220216 3300009093 Bacteria 569
289 Ga0105240_12686426 3300009093 Bacteria 514
290 Ga0111539_10042854 3300009094 Bacteria 5430
291 Ga0111539_11280935 3300009094 Bacteria 851
292 Ga0105245_10003794 3300009098 Bacteria 13443
293 Ga0105245_10058944 3300009098 Bacteria 3456
294 Ga0105245_10074465 3300009098 Bacteria 3090
295 Ga0105245_10173032 3300009098 Bacteria 2057
296 Ga0105245_10684631 3300009098 Bacteria 1058
297 Ga0105247_10828431 3300009101 Bacteria 708
298 Ga0114129_10001215 3300009147 Bacteria 34229
299 Ga0114129_10018977 3300009147 Bacteria 9796
300 Ga0114129_10335614 3300009147 Bacteria 2006
301 Ga0114129_10408251 3300009147 Bacteria 1789
302 Ga0114129_12221833 3300009147 Bacteria 660
303 Ga0114129_12531048 3300009147 Bacteria 613
304 Ga0114129_13198439 3300009147 Bacteria 533
305 Ga0105243_10015464 3300009148 Bacteria 5767
306 Ga0105243_10453684 3300009148 Bacteria 1204
307 Ga0105243_11204951 3300009148 Bacteria 770
308 Ga0105243_12545376 3300009148 Bacteria 551
309 Ga0105241_10101976 3300009174 Bacteria 2283
310 Ga0105241_10749806 3300009174 Bacteria 895
311 Ga0105241_11277855 3300009174 Bacteria 698
312 Ga0105242_10017255 3300009176 Bacteria 5622
313 Ga0105242_11736834 3300009176 Bacteria 661
314 Ga0105248_10369887 3300009177 Bacteria 1614
315 Ga0105248_10502943 3300009177 Bacteria 1366
316 Ga0105237_10210685 3300009545 Bacteria 1943
317 Ga0105237_11264317 3300009545 Bacteria 744
318 Ga0105237_11626344 3300009545 Bacteria 653
319 Ga0105238_10268938 3300009551 Bacteria 1685
320 Ga0105238_10370038 3300009551 Bacteria 1423
321 Ga0105238_10479737 3300009551 Bacteria 1243
322 Ga0105238_11268223 3300009551 Bacteria 762
323 Ga0105238_12205203 3300009551 Bacteria 586
324 Ga0105238_13081169 3300009551 Bacteria 500
325 Ga0105249_10015258 3300009553 Bacteria 6799
326 Ga0105249_10369519 3300009553 Bacteria 1457
327 Ga0105249_10371869 3300009553 Bacteria 1453
328 Ga0105249_11095980 3300009553 Bacteria 866
329 Ga0105249_11292042 3300009553 Bacteria 801
330 Ga0105239_10040363 3300010375 Bacteria 5114
331 Ga0105239_10087959 3300010375 Bacteria 3425
332 Ga0105239_10089155 3300010375 Bacteria 3401
333 Ga0105239_10095138 3300010375 Bacteria 3291
334 Ga0105239_10128633 3300010375 Bacteria 2816
335 Ga0105239_10262054 3300010375 Bacteria 1943
336 Ga0105239_10830829 3300010375 Bacteria 1059
337 Ga0105239_11206072 3300010375 Bacteria 872
338 Ga0105246_10372057 3300011119 Bacteria 1178
339 Ga0105246_11462729 3300011119 Bacteria 640
340 Ga0157328_1009893 3300012478 Bacteria 650
341 Ga0157313_1037576 3300012503 Bacteria 580
342 Ga0157339_1007253 3300012505 Bacteria 926
343 Ga0157327_1018988 3300012512 Bacteria 755
344 Ga0157326_1030242 3300012513 Bacteria 713
345 Ga0157326_1072282 3300012513 Bacteria 549
346 Ga0154019_112352 3300013044 Bacteria 745
347 Ga0154014_115819 3300013052 Bacteria 632
348 Ga0154014_138820 3300013052 Bacteria 905
349 Ga0154012_121067 3300013059 Bacteria 732
350 Ga0154012_176035 3300013059 Bacteria 755
351 Ga0154010_157036 3300013062 Bacteria 703
352 Ga0157373_10064774 3300013100 Bacteria 2587
353 Ga0157373_11042895 3300013100 Bacteria 612
354 Ga0157373_11117275 3300013100 Bacteria 592
355 Ga0157371_10087013 3300013102 Bacteria 2213
356 Ga0157371_10416214 3300013102 Bacteria 985
357 Ga0157370_10243087 3300013104 Bacteria 1665
358 Ga0157369_10021627 3300013105 Bacteria 7193
359 Ga0157369_10092582 3300013105 Bacteria 3226
360 Ga0157369_10738288 3300013105 Bacteria 1013
361 Ga0157369_11556107 3300013105 Bacteria 672
362 Ga0157374_10085138 3300013296 Bacteria 3005
363 Ga0157374_10446574 3300013296 Bacteria 1294
364 Ga0157374_11589513 3300013296 Bacteria 678
365 Ga0157374_12873582 3300013296 Bacteria 509
366 Ga0157378_10148347 3300013297 Bacteria 2184
367 Ga0157378_10203628 3300013297 Bacteria 1873
368 Ga0157378_12599533 3300013297 Bacteria 559
369 Ga0163162_10006273 3300013306 Bacteria 11514
370 Ga0157372_10050297 3300013307 Bacteria 4636
371 Ga0157372_10209745 3300013307 Bacteria 2257
372 Ga0157372_10268887 3300013307 Bacteria 1980
373 Ga0157372_10476982 3300013307 Bacteria 1454
374 Ga0157372_10484559 3300013307 Bacteria 1442
375 Ga0157372_10662281 3300013307 Bacteria 1215
376 Ga0157372_12377448 3300013307 Bacteria 608
377 Ga0157372_12524777 3300013307 Bacteria 590
378 Ga0157372_13068145 3300013307 Bacteria 533
379 Ga0157375_10223085 3300013308 Bacteria 2044
380 Ga0157375_10703179 3300013308 Bacteria 1164
381 Ga0157375_11650290 3300013308 Bacteria 758
382 Ga0157375_12472943 3300013308 Bacteria 620
383 Ga0163163_10111596 3300014325 Bacteria 2763
384 Ga0163163_10213130 3300014325 Bacteria 1980
385 Ga0163163_12222721 3300014325 Bacteria 608
386 Ga0157380_10047854 3300014326 Bacteria 3365
387 Ga0157380_12733941 3300014326 Bacteria 560
388 Ga0182008_10150445 3300014497 Bacteria 1167
389 Ga0182008_10253483 3300014497 Bacteria 908
390 Ga0157377_10116951 3300014745 Bacteria 1611
391 Ga0157377_10242508 3300014745 Bacteria 1164
392 Ga0157377_10931627 3300014745 Bacteria 652
393 Ga0157377_11048637 3300014745 Bacteria 621
394 Ga0157379_10034232 3300014968 Bacteria 4528
395 Ga0157379_11309476 3300014968 Bacteria 700
396 Ga0157379_12214328 3300014968 Bacteria 546
397 Ga0157376_12071800 3300014969 Bacteria 607
398 Ga0182007_10078659 3300015262 Bacteria 1081
399 Ga0182007_10271364 3300015262 Bacteria 614
400 Ga0182007_10426005 3300015262 Bacteria 508
401 Ga0163161_10190082 3300017792 Bacteria 1578
402 Ga0163161_11152538 3300017792 Bacteria 668
403 Ga0163161_11297105 3300017792 Bacteria 633
404 Ga0197907_10007868 3300020069 Bacteria 827
405 Ga0197907_10830196 3300020069 Bacteria 697
406 Ga0197907_10907861 3300020069 Bacteria 721
407 Ga0197907_10931216 3300020069 Bacteria 750
408 Ga0206356_10854318 3300020070 Bacteria 676
409 Ga0206356_11087956 3300020070 Bacteria 678
410 Ga0206356_11293536 3300020070 Bacteria 980
411 Ga0206356_11308549 3300020070 Bacteria 1503
412 Ga0206356_11408244 3300020070 Bacteria 1833
413 Ga0206356_11485558 3300020070 Bacteria 799
414 Ga0206349_1039003 3300020075 Bacteria 1243
415 Ga0206349_1152193 3300020075 Bacteria 549
416 Ga0206349_1221287 3300020075 Bacteria 838
417 Ga0206349_1252883 3300020075 Bacteria 632
418 Ga0206349_1944466 3300020075 Bacteria 658
419 Ga0206355_1093080 3300020076 Bacteria 710
420 Ga0206355_1095009 3300020076 Bacteria 1590
421 Ga0206355_1488379 3300020076 Bacteria 994
422 Ga0206355_1560762 3300020076 Bacteria 575
423 Ga0206351_10059624 3300020077 Bacteria 1047
424 Ga0206351_10074041 3300020077 Bacteria 667
425 Ga0206351_10217685 3300020077 Bacteria 1612
426 Ga0206351_10810188 3300020077 Bacteria 656
427 Ga0206351_10996026 3300020077 Bacteria 834
428 Ga0206352_10191670 3300020078 Bacteria 512
429 Ga0206352_10339378 3300020078 Bacteria 732
430 Ga0206352_10453915 3300020078 Bacteria 655
431 Ga0206352_10583660 3300020078 Bacteria 630
432 Ga0206352_10831894 3300020078 Bacteria 792
433 Ga0206352_11223612 3300020078 Bacteria 638
434 Ga0206350_10011595 3300020080 Bacteria 662
435 Ga0206350_10026038 3300020080 Bacteria 899
436 Ga0206350_10471505 3300020080 Bacteria 786
437 Ga0206350_10955426 3300020080 Bacteria 1372
438 Ga0206350_10992796 3300020080 Bacteria 732
439 Ga0206350_11182790 3300020080 Bacteria 645
440 Ga0206350_11559656 3300020080 Bacteria 780
441 Ga0206350_11590323 3300020080 Bacteria 508
442 Ga0206354_10370725 3300020081 Bacteria 1470
443 Ga0206354_11011929 3300020081 Bacteria 652
444 Ga0206354_11060470 3300020081 Bacteria 778
445 Ga0206354_11393957 3300020081 Bacteria 772
446 Ga0206353_10483815 3300020082 Bacteria 1905
447 Ga0206353_10632978 3300020082 Bacteria 1189
448 Ga0206353_11106932 3300020082 Bacteria 784
449 Ga0206353_11154553 3300020082 Bacteria 681
450 Ga0206353_11522258 3300020082 Bacteria 666
451 Ga0206353_11945828 3300020082 Bacteria 1627
452 Ga0154015_1097088 3300020610 Bacteria 822
453 Ga0154015_1258986 3300020610 Bacteria 777
454 Ga0154015_1444314 3300020610 Bacteria 1809
455 Ga0154015_1445422 3300020610 Bacteria 1130
456 Ga0154015_1688056 3300020610 Bacteria 705
457 Ga0213876_10327404 3300021384 Bacteria 815
458 Ga0213875_10002057 3300021388 Bacteria 12345
459 Ga0224712_10095864 3300022467 Bacteria 1250
460 Ga0224712_10099262 3300022467 Bacteria 1232
461 Ga0224712_10180600 3300022467 Bacteria 951
462 Ga0224712_10183297 3300022467 Bacteria 944
463 Ga0224712_10197425 3300022467 Bacteria 913
464 Ga0224712_10277696 3300022467 Bacteria 779
465 Ga0224712_10357328 3300022467 Bacteria 691
466 Ga0224712_10672130 3300022467 Bacteria 508
467 Ga0207656_10152492 3300025321 Bacteria 1095
468 Ga0207656_10262660 3300025321 Bacteria 848
469 Ga0207713_1045258 3300025735 Bacteria 1799
470 Ga0207692_10077459 3300025898 Bacteria 1769
471 Ga0207710_10030049 3300025900 Bacteria 2368
472 Ga0207710_10773102 3300025900 Bacteria 505
473 Ga0207688_10008908 3300025901 Bacteria 5461
474 Ga0207688_10008950 3300025901 Bacteria 5448
475 Ga0207688_10219580 3300025901 Bacteria 1145
476 Ga0207680_10359498 3300025903 Bacteria 1024
477 Ga0207680_10723450 3300025903 Bacteria 713
478 Ga0207647_10202405 3300025904 Bacteria 1148
479 Ga0207647_10587212 3300025904 Bacteria 615
480 Ga0207699_10045697 3300025906 Bacteria 2557
481 Ga0207699_10741208 3300025906 Bacteria 720
482 Ga0207645_10060884 3300025907 Bacteria 2411
483 Ga0207643_10000645 3300025908 Bacteria 21787
484 Ga0207643_10120086 3300025908 Bacteria 1556
485 Ga0207705_10126859 3300025909 Bacteria 1897
486 Ga0207705_10286231 3300025909 Bacteria 1262
487 Ga0207705_10287143 3300025909 Bacteria 1260
488 Ga0207705_11234301 3300025909 Bacteria 573
489 Ga0207684_10119377 3300025910 Bacteria 2260
490 Ga0207684_10738910 3300025910 Bacteria 835
491 Ga0207654_10022308 3300025911 Bacteria 3376
492 Ga0207707_10050988 3300025912 Bacteria 3603
493 Ga0207707_10205767 3300025912 Bacteria 1715
494 Ga0207695_10023211 3300025913 Bacteria 7018
495 Ga0207695_10478025 3300025913 Bacteria 1128
496 Ga0207695_10506778 3300025913 Bacteria 1089
497 Ga0207671_10352690 3300025914 Bacteria 1167
498 Ga0207693_10014523 3300025915 Bacteria 6329
499 Ga0207663_10023659 3300025916 Bacteria 3529
500 Ga0207663_11383674 3300025916 Bacteria 567
501 Ga0207660_10018252 3300025917 Bacteria 4674
502 Ga0207660_10065813 3300025917 Bacteria 2620
503 Ga0207660_10442332 3300025917 Bacteria 1051
504 Ga0207660_10722146 3300025917 Bacteria 813
505 Ga0207662_10019315 3300025918 Bacteria 3876
506 Ga0207657_10020145 3300025919 Bacteria 6311
507 Ga0207657_10081814 3300025919 Bacteria 2712
508 Ga0207657_10145026 3300025919 Bacteria 1937
509 Ga0207657_10474784 3300025919 Bacteria 981
510 Ga0207649_10011169 3300025920 Bacteria 4944
511 Ga0207649_10211414 3300025920 Bacteria 1376
512 Ga0207649_10284089 3300025920 Bacteria 1204
513 Ga0207649_10786384 3300025920 Bacteria 742
514 Ga0207649_11494647 3300025920 Bacteria 535
515 Ga0207649_11572625 3300025920 Bacteria 520
516 Ga0207652_10098866 3300025921 Bacteria 2574
517 Ga0207652_10285232 3300025921 Bacteria 1490
518 Ga0207652_10636666 3300025921 Bacteria 954
519 Ga0207652_11091915 3300025921 Bacteria 698
520 Ga0207646_10429437 3300025922 Bacteria 1192
521 Ga0207646_11173066 3300025922 Bacteria 674
522 Ga0207681_10384645 3300025923 Bacteria 1130
523 Ga0207694_10057264 3300025924 Bacteria 3030
524 Ga0207694_10265262 3300025924 Bacteria 1408
525 Ga0207694_10299563 3300025924 Bacteria 1324
526 Ga0207694_10328421 3300025924 Bacteria 1263
527 Ga0207694_10916182 3300025924 Bacteria 741
528 Ga0207650_10011084 3300025925 Bacteria 6199
529 Ga0207650_10203676 3300025925 Bacteria 1586
530 Ga0207650_11773251 3300025925 Bacteria 522
531 Ga0207659_10029646 3300025926 Bacteria 3731
532 Ga0207659_10909991 3300025926 Bacteria 756
533 Ga0207687_10068897 3300025927 Bacteria 2521
534 Ga0207687_10080384 3300025927 Bacteria 2353
535 Ga0207687_10116963 3300025927 Bacteria 1988
536 Ga0207687_10156200 3300025927 Bacteria 1745
537 Ga0207687_10509448 3300025927 Bacteria 1005
538 Ga0207700_10122869 3300025928 Bacteria 2108
539 Ga0207700_10129871 3300025928 Bacteria 2056
540 Ga0207700_10759571 3300025928 Bacteria 866
541 Ga0207664_10030982 3300025929 Bacteria 4089
542 Ga0207664_10187663 3300025929 Bacteria 1778
543 Ga0207644_11403439 3300025931 Bacteria 587
544 Ga0207690_10074282 3300025932 Bacteria 2354
545 Ga0207690_10159704 3300025932 Bacteria 1679
546 Ga0207690_10287790 3300025932 Bacteria 1282
547 Ga0207690_10385680 3300025932 Bacteria 1114
548 Ga0207690_10457134 3300025932 Bacteria 1027
549 Ga0207690_10623686 3300025932 Bacteria 882
550 Ga0207706_10007573 3300025933 Bacteria 10042
551 Ga0207706_10239867 3300025933 Bacteria 1585
552 Ga0207706_11276360 3300025933 Bacteria 608
553 Ga0207686_10087392 3300025934 Bacteria 2050
554 Ga0207709_10150793 3300025935 Bacteria 1610
555 Ga0207709_10176661 3300025935 Bacteria 1504
556 Ga0207709_10374346 3300025935 Bacteria 1082
557 Ga0207709_10601618 3300025935 Bacteria 871
558 Ga0207669_10941347 3300025937 Bacteria 723
559 Ga0207704_10010135 3300025938 Bacteria 4579
560 Ga0207704_10597605 3300025938 Bacteria 903
561 Ga0207704_10910058 3300025938 Bacteria 740
562 Ga0207665_10162579 3300025939 Bacteria 1607
563 Ga0207691_10171271 3300025940 Bacteria 1901
564 Ga0207691_10423862 3300025940 Bacteria 1134
565 Ga0207691_10870579 3300025940 Bacteria 755
566 Ga0207691_11468708 3300025940 Bacteria 558
567 Ga0207711_10441140 3300025941 Bacteria 1211
568 Ga0207711_10545247 3300025941 Bacteria 1082
569 Ga0207711_11374608 3300025941 Bacteria 648
570 Ga0207689_10000247 3300025942 Bacteria 48421
571 Ga0207689_10040371 3300025942 Bacteria 3862
572 Ga0207689_10375744 3300025942 Bacteria 1183
573 Ga0207689_11083388 3300025942 Bacteria 675
574 Ga0207661_10008281 3300025944 Bacteria 7428
575 Ga0207661_10021957 3300025944 Bacteria 4794
576 Ga0207661_10104262 3300025944 Bacteria 2387
577 Ga0207679_10001936 3300025945 Bacteria 12852
578 Ga0207679_10020909 3300025945 Bacteria 4426
579 Ga0207679_10074565 3300025945 Bacteria 2571
580 Ga0207679_10582506 3300025945 Bacteria 1007
581 Ga0207679_10682289 3300025945 Bacteria 931
582 Ga0207679_11944275 3300025945 Bacteria 536
583 Ga0207667_10104230 3300025949 Bacteria 2925
584 Ga0207667_10130501 3300025949 Bacteria 2588
585 Ga0207667_10238184 3300025949 Bacteria 1863
586 Ga0207667_10547288 3300025949 Bacteria 1171
587 Ga0207651_10085745 3300025960 Bacteria 2286
588 Ga0207651_10705614 3300025960 Bacteria 889
589 Ga0207651_10736119 3300025960 Bacteria 871
590 Ga0207712_10022375 3300025961 Bacteria 4161
591 Ga0207712_10351461 3300025961 Bacteria 1226
592 Ga0207712_10617679 3300025961 Bacteria 939
593 Ga0207712_11846836 3300025961 Bacteria 541
594 Ga0207668_10006800 3300025972 Bacteria 6774
595 Ga0207668_10086405 3300025972 Bacteria 2291
596 Ga0207668_10954103 3300025972 Bacteria 765
597 Ga0207640_10019036 3300025981 Bacteria 4048
598 Ga0207640_10170899 3300025981 Bacteria 1620
599 Ga0207658_10213028 3300025986 Bacteria 1620
600 Ga0207658_10320699 3300025986 Bacteria 1341
601 Ga0207677_10316508 3300026023 Bacteria 1295
602 Ga0207703_10280387 3300026035 Bacteria 1513
603 Ga0207703_10395320 3300026035 Bacteria 1281
604 Ga0207703_10602496 3300026035 Bacteria 1039
605 Ga0207703_10642435 3300026035 Bacteria 1006
606 Ga0207639_10038216 3300026041 Bacteria 3569
607 Ga0207639_10366952 3300026041 Bacteria 1290
608 Ga0207678_10000642 3300026067 Bacteria 32117
609 Ga0207678_10045339 3300026067 Bacteria 3802
610 Ga0207678_10247919 3300026067 Bacteria 1525
611 Ga0207678_11102907 3300026067 Bacteria 703
612 Ga0207708_10060229 3300026075 Bacteria 2898
613 Ga0207708_10114677 3300026075 Bacteria 2094
614 Ga0207702_10002205 3300026078 Bacteria 18667
615 Ga0207702_10069481 3300026078 Bacteria 3028
616 Ga0207702_10239938 3300026078 Bacteria 1698
617 Ga0207702_10270944 3300026078 Bacteria 1601
618 Ga0207702_10387066 3300026078 Bacteria 1346
619 Ga0207702_10390241 3300026078 Bacteria 1340
620 Ga0207641_10018849 3300026088 Bacteria 5659
621 Ga0207641_10249185 3300026088 Bacteria 1658
622 Ga0207641_10761988 3300026088 Bacteria 956
623 Ga0207641_12535419 3300026088 Bacteria 511
624 Ga0207648_10085371 3300026089 Bacteria 2754
625 Ga0207676_10002528 3300026095 Bacteria 13044
626 Ga0207674_10022721 3300026116 Bacteria 6730
627 Ga0207674_10101881 3300026116 Bacteria 2852
628 Ga0207674_10112159 3300026116 Bacteria 2701
629 Ga0207674_10367153 3300026116 Bacteria 1391
630 Ga0207674_12006301 3300026116 Bacteria 543
631 Ga0207675_100023872 3300026118 Bacteria 5687
632 Ga0207675_100125041 3300026118 Bacteria 2436
633 Ga0207683_10055090 3300026121 Bacteria 3488
634 Ga0207683_10209105 3300026121 Bacteria 1775
635 Ga0207683_11110899 3300026121 Bacteria 733
636 Ga0207683_11404523 3300026121 Bacteria 645
637 Ga0207698_10037957 3300026142 Bacteria 3554
638 Ga0207698_10202369 3300026142 Bacteria 1779
639 Ga0207698_10451519 3300026142 Bacteria 1241
640 Ga0207698_10808693 3300026142 Bacteria 940
641 Ga0209813_10025819 3300027866 Bacteria 1693
642 Ga0207428_10107183 3300027907 Bacteria 2153
643 Ga0268266_10038076 3300028379 Bacteria 4095
644 Ga0268266_11501119 3300028379 Bacteria 649
645 Ga0268265_11110868 3300028380 Bacteria 785
646 Ga0268265_12255415 3300028380 Bacteria 551
647 Ga0268264_10025796 3300028381 Bacteria 4800
648 Ga0268264_10265083 3300028381 Bacteria 1602
649 Ga0268264_10706115 3300028381 Bacteria 1002
650 Ga0268264_12045995 3300028381 Bacteria 582
651 Ga0307517_10272101 3300028786 Bacteria 973
652 Ga0307515_10778274 3300028794 Bacteria 578
653 Ga0307512_10050742 3300030522 Bacteria 3328
654 Ga0307512_10138693 3300030522 Bacteria 1496
655 Ga0316176_1214649 3300030732 Bacteria 691
656 Ga0316181_1082057 3300030744 Bacteria 942
657 Ga0265769_119107 3300030888 Bacteria 534
658 Ga0265779_104622 3300031043 Bacteria 737
659 Ga0265328_10068246 3300031239 Bacteria 1306
660 Ga0265325_10063329 3300031241 Bacteria 1871
661 Ga0265340_10006963 3300031247 Bacteria 6172
662 Ga0265340_10032637 3300031247 Bacteria 2598
663 Ga0265339_10168656 3300031249 Bacteria 1097
664 Ga0307513_10409170 3300031456 Bacteria 1089
665 Ga0307513_10638642 3300031456 Bacteria 772
666 Ga0307513_10935019 3300031456 Bacteria 575
667 Ga0307513_10946321 3300031456 Bacteria 570
668 Ga0307513_11005906 3300031456 Bacteria 543
669 Ga0307509_10009471 3300031507 Bacteria 12168
670 Ga0307408_100724508 3300031548 Bacteria 896
671 Ga0307508_10007906 3300031616 Bacteria 9869
672 Ga0307508_10024389 3300031616 Bacteria 5489
673 Ga0307508_10462490 3300031616 Bacteria 862
674 Ga0265314_10162513 3300031711 Bacteria 1357
675 Ga0307516_10003585 3300031730 Bacteria 19795
676 Ga0307405_10095336 3300031731 Bacteria 1981
677 Ga0307405_10123841 3300031731 Bacteria 1774
678 Ga0307405_10143152 3300031731 Bacteria 1670
679 Ga0307405_11492199 3300031731 Bacteria 594
680 Ga0307413_11199877 3300031824 Bacteria 660
681 Ga0307413_11524730 3300031824 Bacteria 591
682 Ga0307518_10318726 3300031838 Bacteria 931
683 Ga0307410_10068505 3300031852 Bacteria 2451
684 Ga0307410_10401544 3300031852 Bacteria 1107
685 Ga0307410_12060727 3300031852 Bacteria 510
686 Ga0307406_10000856 3300031901 Bacteria 17128
687 Ga0307406_10096072 3300031901 Bacteria 2007
688 Ga0307406_10143416 3300031901 Bacteria 1694
689 Ga0307406_10516412 3300031901 Bacteria 971
690 Ga0307406_11087490 3300031901 Bacteria 690
691 Ga0307407_10049499 3300031903 Bacteria 2399
692 Ga0307407_10368341 3300031903 Bacteria 1022
693 Ga0307412_10121539 3300031911 Bacteria 1881
694 Ga0307409_100206054 3300031995 Bacteria 1763
695 Ga0307409_100824913 3300031995 Bacteria 936
696 Ga0307409_102900759 3300031995 Bacteria 506
697 Ga0307416_100102513 3300032002 Bacteria 2495
698 Ga0307416_100171696 3300032002 Bacteria 2019
699 Ga0307416_100882755 3300032002 Bacteria 993
700 Ga0307416_101811091 3300032002 Bacteria 714
701 Ga0307416_102305119 3300032002 Bacteria 639
702 Ga0307416_103307749 3300032002 Bacteria 539
703 Ga0307416_103738616 3300032002 Bacteria 509
704 Ga0307414_10255234 3300032004 Bacteria 1460
705 Ga0307414_11368258 3300032004 Bacteria 657
706 Ga0307411_10211468 3300032005 Bacteria 1498
707 Ga0307415_100067194 3300032126 Bacteria 2504
708 Ga0307415_100250416 3300032126 Bacteria 1439
709 Ga0307415_100426882 3300032126 Bacteria 1139
710 Ga0307415_100615632 3300032126 Bacteria 968
711 Ga0307415_101446873 3300032126 Bacteria 656
712 Ga0307415_101661323 3300032126 Bacteria 615
713 Ga0316593_10135718 3300032168 Bacteria 890
714 Ga0316593_10187531 3300032168 Bacteria 761
715 Ga0307507_10275880 3300033179 Bacteria 1056
716 Ga0316214_1039111 3300033545 Bacteria 680
717 Ga0373930_0198048 3300034816 Bacteria 522
718 Ga0373950_0132374 3300034818 Bacteria 559
719 Ga0373929_0126813 3300035085 Bacteria 666
720 Ga0373940_0139869 3300035088 Bacteria 764
721 Ga0373951_0000077 3300035091 Bacteria 38676
722 Ga0373932_0088562 3300035112 Bacteria 989
723 Ga0373941_0099891 3300035115 Bacteria 1008
724 Ga0373946_0470728 3300035171 Bacteria 642
725 Ga0373942_0003991 3300035207 Bacteria 3442
726 Ga0373942_0034816 3300035207 Bacteria 1349
727 Ga0373942_0083819 3300035207 Bacteria 951
728 Ga0373962_0001763 3300035242 Bacteria 5150
729 Ga0316574_0903444 3300035398 Bacteria 534
730 Ga0373931_0965326 3300035691 Bacteria 575
731 Ga0373935_0705979 3300035692 Bacteria 742
732 Ga0373947_0423107 3300035725 Bacteria 900
733 Ga0373937_0081155 3300036401 Bacteria 3000
734 Ga0373925_0164312 3300037068 Bacteria 1750
735 Ga0373925_0452932 3300037068 Bacteria 1051
736 Ga0373925_0841170 3300037068 Bacteria 756
737 Ga0395899_0238554 3300037312 Bacteria 1252
738 Ga0395900_0017058 3300037418 Bacteria 7413
739 Ga0395900_0034322 3300037418 Bacteria 5223
740 Ga0395900_0312507 3300037418 Bacteria 1554
741 Ga0395900_1782372 3300037418 Bacteria 526
742 Ga0395898_0017301 3300037466 Bacteria 7365
743 Ga0395898_0063355 3300037466 Bacteria 3588
744 Ga0395898_0799509 3300037466 Bacteria 883
745 Ga0395898_1201763 3300037466 Bacteria 689
746 Ga0395905_0025967 3300037471 Bacteria 5522
747 Ga0395905_0510998 3300037471 Bacteria 1102
748 Ga0395905_1911289 3300037471 Bacteria 500
749 Ga0436364_0358181 3300037853 Bacteria 17079
750 Ga0436364_0441673 3300037853 Bacteria 2482
751 Ga0436364_0777551 3300037853 Bacteria 7026
752 Ga0395901_0006306 3300038443 Bacteria 12014
753 Ga0395901_0010009 3300038443 Bacteria 9611
754 Ga0395901_0216316 3300038443 Bacteria 2004
755 Ga0395901_0527634 3300038443 Bacteria 1199
756 Ga0395901_0617866 3300038443 Bacteria 1091
757 Ga0436365_0521780 3300039437 Bacteria 2103
758 Ga0436365_1357707 3300039437 Bacteria 831
759 Ga0436362_0473765 3300039453 Bacteria 597
760 Ga0436362_1007526 3300039453 Bacteria 529
761 Ga0451790_29591 3300041444 Bacteria 529
762 Ga0451791_0908830 3300041451 Bacteria 649
763 Ga0451797_0420750 3300041453 Bacteria 712
764 Ga0451801_23546 3300041455 Bacteria 548
765 Ga0451795_0664292 3300041456 Bacteria 785
766 Ga0451837_1200754 3300041494 Bacteria 802
767 Ga0451839_0345606 3300041496 Bacteria 513
768 Ga0451839_1160533 3300041496 Bacteria 1028
769 Ga0451849_0955724 3300041505 Bacteria 596
770 Ga0451851_1076766 3300041507 Bacteria 577
771 Ga0451843_0869211 3300041509 Bacteria 848
772 Ga0439442_084424 3300042002 Bacteria 681
773 Ga0439448_0092466 3300042005 Bacteria 1023
774 Ga0439448_0151305 3300042005 Bacteria 805
775 Ga0439463_065896 3300042016 Bacteria 926
776 Ga0450914_018083 3300042118 Bacteria 762
777 Ga0450890_034518 3300042127 Bacteria 731
778 Ga0450900_039640 3300042136 Bacteria 702
779 Ga0439458_0109399 3300042157 Bacteria 722
780 Ga0439459_0002498 3300042438 Bacteria 2843
781 Ga0439459_0201993 3300042438 Bacteria 543
782 Ga0439464_0046065 3300042439 Bacteria 1253
783 Ga0439460_0157239 3300042461 Bacteria 761
784 Ga0451577_0000135 3300042876 Bacteria 164236
785 Ga0439440_0070316 3300042993 Bacteria 910
786 Ga0466972_0007903 3300044658 Bacteria 5334
787 Ga0466961_0074152 3300044693 Bacteria 2158
788 Ga0466963_0162751 3300044694 Bacteria 1553
789 Ga0466963_0728450 3300044694 Bacteria 700
790 Ga0466963_1173289 3300044694 Bacteria 540
791 Ga0466963_1315679 3300044694 Bacteria 507
792 Ga0466964_0027766 3300044706 Bacteria 2224
793 Ga0466964_0417594 3300044706 Bacteria 704
794 Ga0466964_0499007 3300044706 Bacteria 653
795 Ga0453684_0000038 3300044712 Bacteria 706970
796 Ga0466971_0013414 3300044719 Bacteria 3600
797 Ga0466971_0244541 3300044719 Bacteria 854
798 Ga0466971_0676513 3300044719 Bacteria 518
799 Ga0466968_0071748 3300044735 Bacteria 1509
800 Ga0466968_0138303 3300044735 Bacteria 1112
801 Ga0466968_0655163 3300044735 Bacteria 533
802 Ga0466970_0001515 3300044765 Bacteria 11180
803 Ga0466970_0007151 3300044765 Bacteria 5588
804 Ga0466970_0083582 3300044765 Bacteria 1728
805 Ga0466957_0011088 3300044842 Bacteria 5188
806 Ga0466957_0117962 3300044842 Bacteria 1690
807 Ga0466957_0165859 3300044842 Bacteria 1436
808 Ga0466957_0247383 3300044842 Bacteria 1185
809 Ga0466960_0380516 3300044901 Bacteria 810
810 Ga0466960_0396320 3300044901 Bacteria 794
811 Ga0466960_0542618 3300044901 Bacteria 685
812 Ga0466958_0045179 3300045836 Bacteria 2656
813 Ga0466958_0163106 3300045836 Bacteria 1409
814 Ga0466958_0282747 3300045836 Bacteria 1063
815 Ga0466967_0073632 3300045976 Bacteria 3065
816 Ga0466967_0128778 3300045976 Bacteria 2347
817 Ga0466967_0142225 3300045976 Bacteria 2236
818 Ga0466967_0161380 3300045976 Bacteria 2104
819 Ga0466967_0516790 3300045976 Bacteria 1173
820 Ga0466967_0598918 3300045976 Bacteria 1088
821 Ga0466967_0650158 3300045976 Bacteria 1042
822 Ga0466967_1059366 3300045976 Bacteria 808
823 Ga0466967_1793562 3300045976 Bacteria 611
824 Ga0495590_0200182 3300046457 Bacteria 734
825 Ga0495629_0669449 3300046459 Bacteria 691
826 Ga0495639_0249414 3300046475 Bacteria 877
827 Ga0495585_0368960 3300046492 Bacteria 695
828 Ga0495594_0037986 3300046499 Bacteria 2628
829 Ga0495618_0508860 3300046514 Bacteria 725
830 Ga0495632_0283580 3300046519 Bacteria 737
831 Ga0495640_0975879 3300046533 Bacteria 500
832 Ga0495634_0232786 3300046642 Bacteria 1133
833 Ga0495625_0360085 3300046660 Bacteria 917
834 Ga0495647_0301820 3300046681 Bacteria 722
835 Ga0495581_0345061 3300047315 Bacteria 869
836 Ga0495680_0368107 3300047322 Bacteria 998
837 Ga0495683_0298189 3300047323 Bacteria 693
838 Ga0496100_0013183 3300048903 Bacteria 4761
839 Ga0496100_1234160 3300048903 Bacteria 590
840 Ga0496102_0097385 3300048905 Bacteria 2728
841 Ga0496102_1710288 3300048905 Bacteria 547
842 Ga0496103_0112366 3300048906 Bacteria 1731
843 Ga0496104_0024974 3300048907 Bacteria 5504
844 Ga0496104_0311805 3300048907 Bacteria 1486
845 Ga0496105_0001319 3300048908 Bacteria 17352
846 Ga0496106_0016694 3300048909 Bacteria 5432
847 Ga0496107_0147572 3300048910 Bacteria 1739
848 Ga0496108_0000065 3300048911 Bacteria 117405
849 Ga0496108_0711956 3300048911 Bacteria 870
850 Ga0496108_1240293 3300048911 Bacteria 629
851 Ga0496109_0420491 3300048912 Bacteria 1262
852 Ga0496109_1511712 3300048912 Bacteria 606
853 Ga0496110_0018611 3300048913 Bacteria 5825
854 Ga0496110_0279940 3300048913 Bacteria 1519
855 Ga0496110_0485840 3300048913 Bacteria 1125
856 Ga0496111_0036953 3300048914 Bacteria 3493
857 Ga0496111_0972479 3300048914 Bacteria 609
858 Ga0496112_0042662 3300048915 Bacteria 4438
859 Ga0496112_0108157 3300048915 Bacteria 2751
860 Ga0496112_0108341 3300048915 Bacteria 2748
861 Ga0496113_0057834 3300048916 Bacteria 2915
862 Ga0496113_0067760 3300048916 Bacteria 2707
863 Ga0496113_0198151 3300048916 Bacteria 1596
864 Ga0496113_0955154 3300048916 Bacteria 676
865 Ga0496113_1183762 3300048916 Bacteria 597
866 Ga0496114_0139236 3300048917 Bacteria 2100
867 Ga0496119_0342329 3300048922 Bacteria 726
868 Ga0496123_0050527 3300048926 Bacteria 2777
869 Ga0501305_052305 3300049161 Bacteria 688
870 Ga0501317_016829 3300049533 Bacteria 953
871 Ga0501317_041696 3300049533 Bacteria 703
872 Ga0501318_013845 3300049534 Bacteria 944
873 Ga0501318_020380 3300049534 Bacteria 835
874 Ga0501318_037701 3300049534 Bacteria 680
875 Ga0501320_053540 3300049536 Bacteria 554
876 Ga0501321_040168 3300049537 Bacteria 656
877 Ga0501323_018419 3300049539 Bacteria 904
878 Ga0501325_014537 3300049541 Bacteria 767
879 Ga0501330_023128 3300049546 Bacteria 509
880 Ga0501031_0000702 3300049568 Bacteria 19964
881 Ga0501034_0012661 3300049571 Bacteria 8703
882 Ga0501036_0219306 3300049572 Bacteria 1597
883 Ga0501036_0618043 3300049572 Bacteria 898
884 Ga0501037_1083469 3300049573 Bacteria 519
885 Ga0501038_0233101 3300049574 Bacteria 1464
886 Ga0501038_0921600 3300049574 Bacteria 644
887 Ga0501039_0042765 3300049575 Bacteria 3500
888 Ga0501040_0025236 3300049576 Bacteria 3996
889 Ga0501041_0133984 3300049577 Bacteria 1543
890 Ga0501042_0014605 3300049578 Bacteria 5363
891 Ga0501042_0469930 3300049578 Bacteria 912
892 Ga0501043_0909736 3300049579 Bacteria 631
893 Ga0501043_1191314 3300049579 Bacteria 535
894 Ga0501046_0048822 3300049580 Bacteria 3350
895 Ga0501048_0000794 3300049582 Bacteria 23158
896 Ga0501067_0002126 3300049583 Bacteria 10903
897 Ga0501068_0217867 3300049584 Bacteria 1213
898 Ga0501068_0664629 3300049584 Bacteria 680
899 Ga0501069_0235072 3300049585 Bacteria 1067
900 Ga0501070_0009113 3300049586 Bacteria 8392
901 Ga0501070_0098321 3300049586 Bacteria 2421
902 Ga0501071_0012242 3300049587 Bacteria 5811
903 Ga0501071_0302598 3300049587 Bacteria 1212
904 Ga0501072_0041829 3300049588 Bacteria 3599
905 Ga0501074_0062808 3300049590 Bacteria 2675
906 Ga0501074_0649423 3300049590 Bacteria 745
907 Ga0501075_0002015 3300049591 Bacteria 13433
908 Ga0501076_0026012 3300049592 Bacteria 4529
909 Ga0501076_0579743 3300049592 Bacteria 925
910 Ga0501077_0215510 3300049593 Bacteria 1220
911 Ga0501077_0755128 3300049593 Bacteria 625
912 Ga0501077_0989082 3300049593 Bacteria 541
913 Ga0501080_0005076 3300049742 Bacteria 11727
914 Ga0501080_1637363 3300049742 Bacteria 544
915 Ga0501081_0429692 3300049743 Bacteria 980
916 Ga0501081_0476616 3300049743 Bacteria 929
917 Ga0501081_0894429 3300049743 Bacteria 669
918 Ga0501083_0046702 3300049744 Bacteria 2927
919 Ga0501035_0241015 3300049822 Bacteria 1538
920 Ga0501044_0363995 3300049823 Bacteria 1364
921 Ga0501044_1329804 3300049823 Bacteria 585
922 Ga0501045_0103190 3300049824 Bacteria 2111
923 nmdc:mga03n38_17262_c1 3300050490 Bacteria 2823
924 nmdc:mga00v17_745788_c1 3300050491 Bacteria 626
925 nmdc:mga06z11_2774_c1 3300050494 Bacteria 6714
926 nmdc:mga04h51_1226_c1 3300050495 Bacteria 5929
927 nmdc:mga07m45_279792_c1 3300050496 Bacteria 970
928 nmdc:mga05p37_384303_c1 3300050507 Bacteria 1644
929 nmdc:mga05p37_750_c1 3300050507 Bacteria 35974
930 nmdc:mga05p37_770669_c1 3300050507 Bacteria 1057
931 nmdc:mga05p37_93517_c1 3300050507 Bacteria 3705
932 nmdc:mga09592_198712_c1 3300050508 Bacteria 1736
933 nmdc:mga09592_348_c2 3300050508 Bacteria 19255
934 nmdc:mga09592_391546_c1 3300050508 Bacteria 1201
935 nmdc:mga09592_40835_c1 3300050508 Bacteria 3899
936 nmdc:mga0qj67_1850_c1 3300050509 Bacteria 14984
937 nmdc:mga0qj67_46_c1 3300050509 Bacteria 72974
938 nmdc:mga06r32_134951_c1 3300050510 Bacteria 2442
939 nmdc:mga06r32_1988017_c1 3300050510 Bacteria 515
940 nmdc:mga06r32_432224_c1 3300050510 Bacteria 1297
941 nmdc:mga06r32_5_c2 3300050510 Bacteria 61883
942 nmdc:mga06r32_63844_c1 3300050510 Bacteria 3551
943 nmdc:mga08y16_147144_c1 3300050511 Bacteria 2449
944 nmdc:mga08y16_934119_c1 3300050511 Bacteria 851
945 nmdc:mga0n895_157140_c1 3300050512 Bacteria 2305
946 nmdc:mga0rr50_4976_c1 3300050513 Bacteria 7870
947 nmdc:mga08x19_14945_c1 3300050514 Bacteria 4715
948 nmdc:mga0a205_3011_c1 3300050515 Bacteria 14933
949 Ga0495655_0004688 3300053083 Bacteria 2360
950 Ga0495619_0281078 3300053085 Unclassified 1153
951 Ga0500608_004801 3300053122 Unclassified 5282
952 Ga0500628_057696 3300053129 Bacteria 940
953 Ga0500559_0394748 3300053136 Bacteria 644
954 Ga0500633_0203585 3300053160 Bacteria 741
955 Ga0501084_0011550 3300054114 Bacteria 7312
956 Ga0590075_003570 3300059424 Bacteria 3691
957 Ga0587093_052412 3300059478 Bacteria 647
958 Ga0587070_097124 3300059491 Bacteria 672
959 Ga0587073_0068704 3300059492 Bacteria 850
960 Ga0587082_099379 3300059504 Bacteria 632
961 Ga0587082_105930 3300059504 Bacteria 619
962 Ga0587088_100208 3300059508 Bacteria 646
963 Ga0587089_110718 3300059509 Bacteria 507
964 Ga0587090_078077 3300059510 Bacteria 658
965 Ga0587090_111175 3300059510 Bacteria 584
966 Ga0587094_049988 3300059513 Bacteria 706
967 Ga0587095_007875 3300059514 Bacteria 855
968 Ga0587095_016715 3300059514 Bacteria 675
969 Ga0587106_023766 3300059605 Bacteria 932
970 Ga0587106_102071 3300059605 Bacteria 587
971 Ga0587125_033373 3300059607 Bacteria 667
972 Ga0587099_019322 3300059622 Bacteria 758
973 Ga0587109_107968 3300059624 Bacteria 647
974 Ga0587115_082292 3300059626 Bacteria 572
975 Ga0587128_042347 3300059630 Bacteria 802
976 Ga0587128_076890 3300059630 Bacteria 661
977 Ga0587062_070171 3300059639 Bacteria 632
978 Ga0587067_073522 3300059640 Bacteria 743
979 Ga0587067_114639 3300059640 Bacteria 640
980 Ga0587067_224370 3300059640 Bacteria 510
981 Ga0587068_040150 3300059641 Bacteria 844
982 Ga0587069_060010 3300059642 Bacteria 698
983 Ga0587075_068317 3300059644 Bacteria 655
984 Ga0587075_078247 3300059644 Bacteria 626
985 Ga0587078_024412 3300059646 Bacteria 783
986 Ga0587079_059450 3300059647 Bacteria 824
987 Ga0587079_069613 3300059647 Bacteria 782
988 Ga0587079_182958 3300059647 Bacteria 562
989 Ga0587079_212288 3300059647 Bacteria 534
990 Ga0587107_028914 3300059652 Bacteria 831
991 Ga0587107_079230 3300059652 Bacteria 614
992 Ga0587107_150918 3300059652 Bacteria 504
993 Ga0587110_026956 3300059654 Bacteria 683
994 Ga0587114_034041 3300059655 Bacteria 794
995 Ga0587114_036890 3300059655 Bacteria 775
996 Ga0587119_026366 3300059658 Bacteria 771
997 Ga0587120_010374 3300059659 Bacteria 788
998 Ga0587071_207684 3300060344 Bacteria 515
999 Ga0587111_0050724 3300060346 Bacteria 915
1000 Ga0587111_0080290 3300060346 Bacteria 778
1001 Ga0587111_0086613 3300060346 Bacteria 758
1002 Ga0587111_0200252 3300060346 Bacteria 566
1003 Ga0587111_0226022 3300060346 Bacteria 543
1004 Ga0501082_0055749 3300060353 Bacteria 3404
1005 Ga0501082_0322895 3300060353 Bacteria 1345
1006 Ga0501082_0643041 3300060353 Bacteria 928
1007 Ga0466962_0099884 3300061719 Bacteria 1393
1008 Ga0466962_0163285 3300061719 Bacteria 1083
1009 Ga0466962_0568988 3300061719 Bacteria 576
1010 Ga0466962_0636349 3300061719 Bacteria 545
1011 Ga0530510_0894358 3300061734 Bacteria 678
1012 2919449825 2919446982 Bacteria 3994487
1013 Ga0587084_056263
1014 JGI24741J21665_1067789
1015 JGI24752J21851_1015166
1016 JGI24746J21847_1043902
1017 JGI24747J21853_1009217
1018 JGI24740J21852_10049558
1019 JGI24739J22299_10010241
1020 JGI24739J22299_10104754
1021 JGI24739J22299_10109999
1022 JGI24739J22299_10127382
1023 JGI24737J22298_10039049
1024 JGI24737J22298_10111496
1025 JGI24735J21928_10022810
1026 JGI24735J21928_10053675
1027 JGI24735J21928_10078454
1028 JGI24735J21928_10088130
1029 JGI24738J21930_10059523
1030 JGI24738J21930_10079176
1031 JGI24033J26618_1016950
1032 JGI24751J29686_10008749
1033 Ga0006759J45824_1022434
1034 JGI25406J46586_10011374
1035 JGI25406J46586_10189434
1036 Ga0006777J48905_1037349
1037 Ga0007417J51691_1024088
1038 Ga0006781J51513_1024176
1039 Ga0007410J51695_1021211
1040 Ga0007409J51694_1025611
1041 Ga0007416J51690_1019056
1042 Ga0007429J51699_1020599
1043 Ga0007411J51799_111587
1044 JGI25404J52841_10068869
1045 Ga0032354_1016987
1046 Ga0032354_1062121
1047 Ga0058859_11739610
1048 Ga0058863_10041619
1049 Ga0058861_10012375
1050 Ga0058862_10038154
1051 Ga0058862_10203940
1052 Ga0070658_10005407
1053 Ga0070658_10236294
1054 Ga0070658_11179303
1055 Ga0070676_10061366
1056 Ga0070676_10545019
1057 Ga0070683_100064592
1058 Ga0070683_100569290
1059 Ga0070683_100826319
1060 Ga0070683_100933687
1061 Ga0070690_100311378
1062 Ga0070670_100014709
1063 Ga0070670_100952471
1064 Ga0070677_10642632
1065 Ga0068869_100014640
1066 Ga0068869_100831345
1067 Ga0070666_10239457
1068 Ga0070666_10366452
1069 Ga0070666_10466760
1070 Ga0070680_100102565
1071 Ga0070680_100451906
1072 Ga0070680_100464388
1073 Ga0070682_100009318
1074 Ga0070682_100187009
1075 Ga0068868_100474765
1076 Ga0070660_100269470
1077 Ga0070660_100272088
1078 Ga0070660_100300284
1079 Ga0070689_100302472
1080 Ga0070691_10002288
1081 Ga0070661_100052242
1082 Ga0070661_100341267
1083 Ga0070661_100370410
1084 Ga0070661_100403001
1085 Ga0070668_100000590
1086 Ga0070668_100030120
1087 Ga0070668_101836114
1088 Ga0070669_100592761
1089 Ga0070675_100426515
1090 Ga0070671_100022196
1091 Ga0070671_102112448
1092 Ga0070671_102122409
1093 Ga0070674_100414612
1094 Ga0070674_100971678
1095 Ga0070673_100359723
1096 Ga0070673_100753963
1097 Ga0070673_101548766
1098 Ga0070688_100124063
1099 Ga0070688_100650417
1100 Ga0070659_100026603
1101 Ga0070659_100471185
1102 Ga0070659_100669936
1103 Ga0070659_100753799
1104 Ga0070659_102102180
1105 Ga0070667_100126394
1106 Ga0070667_100432841
1107 Ga0070667_100604365
1108 Ga0070667_100605644
1109 Ga0070667_102175495
1110 Ga0070709_10404720
1111 Ga0070714_100039499
1112 Ga0070714_100421898
1113 Ga0070714_100440382
1114 Ga0070714_102249163
1115 Ga0070713_100003681
1116 Ga0070713_100113101
1117 Ga0070713_101370933
1118 Ga0070710_10394898
1119 Ga0070701_10406859
1120 Ga0070711_100063662
1121 Ga0070700_100010636
1122 Ga0070700_100015218
1123 Ga0070708_100137014
1124 Ga0070663_100022899
1125 Ga0070663_100044469
1126 Ga0070663_100073119
1127 Ga0070663_100684131
1128 Ga0070663_100716821
1129 Ga0070678_100036827
1130 Ga0070678_100398905
1131 Ga0070678_100779421
1132 Ga0070662_100006833
1133 Ga0070662_100065187
1134 Ga0070662_100473929
1135 Ga0070681_10036758
1136 Ga0070681_10066114
1137 Ga0070681_10439495
1138 Ga0068867_100084322
1139 Ga0068867_100792016
1140 Ga0070685_10058492
1141 Ga0070685_10071519
1142 Ga0070706_100032514
1143 Ga0070706_100101877
1144 Ga0070706_100127440
1145 Ga0070706_101069686
1146 Ga0070706_102113668
1147 Ga0070707_100689119
1148 Ga0070698_100279522
1149 Ga0070698_100301632
1150 Ga0070679_100016277
1151 Ga0070679_100189316
1152 Ga0070679_101186409
1153 Ga0070684_100010345
1154 Ga0070684_100391672
1155 Ga0070684_101115055
1156 Ga0070697_100697140
1157 Ga0068853_100063236
1158 Ga0068853_100406738
1159 Ga0068853_101051327
1160 Ga0070672_100507706
1161 Ga0070686_100763274
1162 Ga0070696_100957475
1163 Ga0070696_101546918
1164 Ga0070693_100105172
1165 Ga0070693_100652193
1166 Ga0070665_100055530
1167 Ga0070665_100183400
1168 Ga0070665_101257487
1169 Ga0070665_101754949
1170 Ga0070704_101306490
1171 Ga0068855_100061160
1172 Ga0068855_100081540
1173 Ga0068855_100136038
1174 Ga0068855_100604971
1175 Ga0068855_101027900
1176 Ga0070664_100064658
1177 Ga0070664_100304490
1178 Ga0070664_100436674
1179 Ga0070664_100579399
1180 Ga0070664_100585016
1181 Ga0070664_100655678
1182 Ga0070664_101047315
1183 Ga0070664_102359465
1184 Ga0068857_100060357
1185 Ga0068857_100201896
1186 Ga0068857_101483532
1187 Ga0068857_101696392
1188 Ga0068857_102128347
1189 Ga0068857_102384435
1190 Ga0068854_100171464
1191 Ga0068854_100190576
1192 Ga0068854_100703324
1193 Ga0068856_100033803
1194 Ga0068856_100101731
1195 Ga0068856_100311867
1196 Ga0068856_100420401
1197 Ga0068856_100510156
1198 Ga0068856_100771323
1199 Ga0068856_101306995
1200 Ga0070702_100000310
1201 Ga0070702_100289858
1202 Ga0068852_100007126
1203 Ga0068852_100102701
1204 Ga0068852_100300071
1205 Ga0068852_101166949
1206 Ga0068852_101689753
1207 Ga0068859_100278093
1208 Ga0068859_102056103
1209 Ga0068864_100830671
1210 Ga0068864_101076274
1211 Ga0068866_10004404
1212 Ga0068866_10424985
1213 Ga0068861_100290548
1214 Ga0068861_100552459
1215 Ga0068861_101569439
1216 Ga0068851_10093763
1217 Ga0068851_10416515
1218 Ga0068851_11088880
1219 Ga0068870_10031322
1220 Ga0068870_11460093
1221 Ga0068863_100014469
1222 Ga0068863_100074336
1223 Ga0068863_100359361
1224 Ga0068863_101726461
1225 Ga0068858_100061566
1226 Ga0068858_100579055
1227 Ga0068858_100947657
1228 Ga0068858_101514688
1229 Ga0068858_101873507
1230 Ga0068860_100145489
1231 Ga0068860_100447135
1232 Ga0068860_100454237
1233 Ga0068860_100565315
1234 Ga0068860_100634359
1235 Ga0068862_100175192
1236 Ga0068862_100351961
1237 Ga0068862_101450893
1238 Ga0068862_102496482
1239 Ga0081455_10067796
1240 Ga0081455_10438380
1241 Ga0081540_1003296
1242 Ga0081540_1008757
1243 Ga0081540_1057314
1244 Ga0081540_1173069
1245 Ga0081539_10001171
1246 Ga0081539_10002170
1247 Ga0081539_10006340
1248 Ga0081539_10020403
1249 Ga0081539_10045692
1250 Ga0081539_10476768
1251 Ga0070717_10127752
1252 Ga0075368_10008846
1253 Ga0075364_10639484
1254 Ga0075364_10688929
1255 Ga0075432_10124683
1256 Ga0070716_100194926
1257 Ga0070712_100061815
1258 Ga0070712_100970098
1259 Ga0075367_10003367
1260 Ga0097621_100256560
1261 Ga0097621_100727152
1262 Ga0097621_101741175
1263 Ga0097621_101765504
1264 Ga0097621_101783787
1265 Ga0068871_100314868
1266 Ga0068871_100499128
1267 Ga0075428_100001895
1268 Ga0075428_100033085
1269 Ga0075428_100193315
1270 Ga0075428_101913976
1271 Ga0075430_100001244
1272 Ga0075430_100007864
1273 Ga0075431_100007084
1274 Ga0075431_100009291
1275 Ga0075431_100111461
1276 Ga0075431_100165218
1277 Ga0075431_100176806
1278 Ga0075431_101615847
1279 Ga0075433_10038514
1280 Ga0075434_100373316
1281 Ga0075434_102558612
1282 Ga0075429_100019584
1283 Ga0075429_100069055
1284 Ga0075429_100075843
1285 Ga0075429_100160507
1286 Ga0075429_100196423
1287 Ga0068865_100017976
1288 Ga0068865_100737939
1289 Ga0075436_100175281
1290 Ga0097620_100278078
1291 Ga0097620_102055936
1292 Ga0097620_102748654
1293 Ga0075435_100083231
1294 Ga0105251_10016185
1295 Ga0105251_10225634
1296 Ga0105244_10218282
1297 Ga0105240_10334283
1298 Ga0105240_10509793
1299 Ga0105240_11487258
1300 Ga0105240_12220216
1301 Ga0105240_12686426
1302 Ga0111539_10042854
1303 Ga0111539_11280935
1304 Ga0105245_10003794
1305 Ga0105245_10058944
1306 Ga0105245_10074465
1307 Ga0105245_10173032
1308 Ga0105245_10684631
1309 Ga0105247_10828431
1310 Ga0114129_10001215
1311 Ga0114129_10018977
1312 Ga0114129_10335614
1313 Ga0114129_10408251
1314 Ga0114129_12221833
1315 Ga0114129_12531048
1316 Ga0114129_13198439
1317 Ga0105243_10015464
1318 Ga0105243_10453684
1319 Ga0105243_11204951
1320 Ga0105243_12545376
1321 Ga0105241_10101976
1322 Ga0105241_10749806
1323 Ga0105241_11277855
1324 Ga0105242_10017255
1325 Ga0105242_11736834
1326 Ga0105248_10369887
1327 Ga0105248_10502943
1328 Ga0105237_10210685
1329 Ga0105237_11264317
1330 Ga0105237_11626344
1331 Ga0105238_10268938
1332 Ga0105238_10370038
1333 Ga0105238_10479737
1334 Ga0105238_11268223
1335 Ga0105238_12205203
1336 Ga0105238_13081169
1337 Ga0105249_10015258
1338 Ga0105249_10369519
1339 Ga0105249_10371869
1340 Ga0105249_11095980
1341 Ga0105249_11292042
1342 Ga0105239_10040363
1343 Ga0105239_10087959
1344 Ga0105239_10089155
1345 Ga0105239_10095138
1346 Ga0105239_10128633
1347 Ga0105239_10262054
1348 Ga0105239_10830829
1349 Ga0105239_11206072
1350 Ga0105246_10372057
1351 Ga0105246_11462729
1352 Ga0157328_1009893
1353 Ga0157313_1037576
1354 Ga0157339_1007253
1355 Ga0157327_1018988
1356 Ga0157326_1030242
1357 Ga0157326_1072282
1358 Ga0154019_112352
1359 Ga0154014_115819
1360 Ga0154014_138820
1361 Ga0154012_121067
1362 Ga0154012_176035
1363 Ga0154010_157036
1364 Ga0157373_10064774
1365 Ga0157373_11042895
1366 Ga0157373_11117275
1367 Ga0157371_10087013
1368 Ga0157371_10416214
1369 Ga0157370_10243087
1370 Ga0157369_10021627
1371 Ga0157369_10092582
1372 Ga0157369_10738288
1373 Ga0157369_11556107
1374 Ga0157374_10085138
1375 Ga0157374_10446574
1376 Ga0157374_11589513
1377 Ga0157374_12873582
1378 Ga0157378_10148347
1379 Ga0157378_10203628
1380 Ga0157378_12599533
1381 Ga0163162_10006273
1382 Ga0157372_10050297
1383 Ga0157372_10209745
1384 Ga0157372_10268887
1385 Ga0157372_10476982
1386 Ga0157372_10484559
1387 Ga0157372_10662281
1388 Ga0157372_12377448
1389 Ga0157372_12524777
1390 Ga0157372_13068145
1391 Ga0157375_10223085
1392 Ga0157375_10703179
1393 Ga0157375_11650290
1394 Ga0157375_12472943
1395 Ga0163163_10111596
1396 Ga0163163_10213130
1397 Ga0163163_12222721
1398 Ga0157380_10047854
1399 Ga0157380_12733941
1400 Ga0182008_10150445
1401 Ga0182008_10253483
1402 Ga0157377_10116951
1403 Ga0157377_10242508
1404 Ga0157377_10931627
1405 Ga0157377_11048637
1406 Ga0157379_10034232
1407 Ga0157379_11309476
1408 Ga0157379_12214328
1409 Ga0157376_12071800
1410 Ga0182007_10078659
1411 Ga0182007_10271364
1412 Ga0182007_10426005
1413 Ga0163161_10190082
1414 Ga0163161_11152538
1415 Ga0163161_11297105
1416 Ga0197907_10007868
1417 Ga0197907_10830196
1418 Ga0197907_10907861
1419 Ga0197907_10931216
1420 Ga0206356_10854318
1421 Ga0206356_11087956
1422 Ga0206356_11293536
1423 Ga0206356_11308549
1424 Ga0206356_11408244
1425 Ga0206356_11485558
1426 Ga0206349_1039003
1427 Ga0206349_1152193
1428 Ga0206349_1221287
1429 Ga0206349_1252883
1430 Ga0206349_1944466
1431 Ga0206355_1093080
1432 Ga0206355_1095009
1433 Ga0206355_1488379
1434 Ga0206355_1560762
1435 Ga0206351_10059624
1436 Ga0206351_10074041
1437 Ga0206351_10217685
1438 Ga0206351_10810188
1439 Ga0206351_10996026
1440 Ga0206352_10191670
1441 Ga0206352_10339378
1442 Ga0206352_10453915
1443 Ga0206352_10583660
1444 Ga0206352_10831894
1445 Ga0206352_11223612
1446 Ga0206350_10011595
1447 Ga0206350_10026038
1448 Ga0206350_10471505
1449 Ga0206350_10955426
1450 Ga0206350_10992796
1451 Ga0206350_11182790
1452 Ga0206350_11559656
1453 Ga0206350_11590323
1454 Ga0206354_10370725
1455 Ga0206354_11011929
1456 Ga0206354_11060470
1457 Ga0206354_11393957
1458 Ga0206353_10483815
1459 Ga0206353_10632978
1460 Ga0206353_11106932
1461 Ga0206353_11154553
1462 Ga0206353_11522258
1463 Ga0206353_11945828
1464 Ga0154015_1097088
1465 Ga0154015_1258986
1466 Ga0154015_1444314
1467 Ga0154015_1445422
1468 Ga0154015_1688056
1469 Ga0213876_10327404
1470 Ga0213875_10002057
1471 Ga0224712_10095864
1472 Ga0224712_10099262
1473 Ga0224712_10180600
1474 Ga0224712_10183297
1475 Ga0224712_10197425
1476 Ga0224712_10277696
1477 Ga0224712_10357328
1478 Ga0224712_10672130
1479 Ga0207656_10152492
1480 Ga0207656_10262660
1481 Ga0207713_1045258
1482 Ga0207692_10077459
1483 Ga0207710_10030049
1484 Ga0207710_10773102
1485 Ga0207688_10008908
1486 Ga0207688_10008950
1487 Ga0207688_10219580
1488 Ga0207680_10359498
1489 Ga0207680_10723450
1490 Ga0207647_10202405
1491 Ga0207647_10587212
1492 Ga0207699_10045697
1493 Ga0207699_10741208
1494 Ga0207645_10060884
1495 Ga0207643_10000645
1496 Ga0207643_10120086
1497 Ga0207705_10126859
1498 Ga0207705_10286231
1499 Ga0207705_10287143
1500 Ga0207705_11234301
1501 Ga0207684_10119377
1502 Ga0207684_10738910
1503 Ga0207654_10022308
1504 Ga0207707_10050988
1505 Ga0207707_10205767
1506 Ga0207695_10023211
1507 Ga0207695_10478025
1508 Ga0207695_10506778
1509 Ga0207671_10352690
1510 Ga0207693_10014523
1511 Ga0207663_10023659
1512 Ga0207663_11383674
1513 Ga0207660_10018252
1514 Ga0207660_10065813
1515 Ga0207660_10442332
1516 Ga0207660_10722146
1517 Ga0207662_10019315
1518 Ga0207657_10020145
1519 Ga0207657_10081814
1520 Ga0207657_10145026
1521 Ga0207657_10474784
1522 Ga0207649_10011169
1523 Ga0207649_10211414
1524 Ga0207649_10284089
1525 Ga0207649_10786384
1526 Ga0207649_11494647
1527 Ga0207649_11572625
1528 Ga0207652_10098866
1529 Ga0207652_10285232
1530 Ga0207652_10636666
1531 Ga0207652_11091915
1532 Ga0207646_10429437
1533 Ga0207646_11173066
1534 Ga0207681_10384645
1535 Ga0207694_10057264
1536 Ga0207694_10265262
1537 Ga0207694_10299563
1538 Ga0207694_10328421
1539 Ga0207694_10916182
1540 Ga0207650_10011084
1541 Ga0207650_10203676
1542 Ga0207650_11773251
1543 Ga0207659_10029646
1544 Ga0207659_10909991
1545 Ga0207687_10068897
1546 Ga0207687_10080384
1547 Ga0207687_10116963
1548 Ga0207687_10156200
1549 Ga0207687_10509448
1550 Ga0207700_10122869
1551 Ga0207700_10129871
1552 Ga0207700_10759571
1553 Ga0207664_10030982
1554 Ga0207664_10187663
1555 Ga0207644_11403439
1556 Ga0207690_10074282
1557 Ga0207690_10159704
1558 Ga0207690_10287790
1559 Ga0207690_10385680
1560 Ga0207690_10457134
1561 Ga0207690_10623686
1562 Ga0207706_10007573
1563 Ga0207706_10239867
1564 Ga0207706_11276360
1565 Ga0207686_10087392
1566 Ga0207709_10150793
1567 Ga0207709_10176661
1568 Ga0207709_10374346
1569 Ga0207709_10601618
1570 Ga0207669_10941347
1571 Ga0207704_10010135
1572 Ga0207704_10597605
1573 Ga0207704_10910058
1574 Ga0207665_10162579
1575 Ga0207691_10171271
1576 Ga0207691_10423862
1577 Ga0207691_10870579
1578 Ga0207691_11468708
1579 Ga0207711_10441140
1580 Ga0207711_10545247
1581 Ga0207711_11374608
1582 Ga0207689_10000247
1583 Ga0207689_10040371
1584 Ga0207689_10375744
1585 Ga0207689_11083388
1586 Ga0207661_10008281
1587 Ga0207661_10021957
1588 Ga0207661_10104262
1589 Ga0207679_10001936
1590 Ga0207679_10020909
1591 Ga0207679_10074565
1592 Ga0207679_10582506
1593 Ga0207679_10682289
1594 Ga0207679_11944275
1595 Ga0207667_10104230
1596 Ga0207667_10130501
1597 Ga0207667_10238184
1598 Ga0207667_10547288
1599 Ga0207651_10085745
1600 Ga0207651_10705614
1601 Ga0207651_10736119
1602 Ga0207712_10022375
1603 Ga0207712_10351461
1604 Ga0207712_10617679
1605 Ga0207712_11846836
1606 Ga0207668_10006800
1607 Ga0207668_10086405
1608 Ga0207668_10954103
1609 Ga0207640_10019036
1610 Ga0207640_10170899
1611 Ga0207658_10213028
1612 Ga0207658_10320699
1613 Ga0207677_10316508
1614 Ga0207703_10280387
1615 Ga0207703_10395320
1616 Ga0207703_10602496
1617 Ga0207703_10642435
1618 Ga0207639_10038216
1619 Ga0207639_10366952
1620 Ga0207678_10000642
1621 Ga0207678_10045339
1622 Ga0207678_10247919
1623 Ga0207678_11102907
1624 Ga0207708_10060229
1625 Ga0207708_10114677
1626 Ga0207702_10002205
1627 Ga0207702_10069481
1628 Ga0207702_10239938
1629 Ga0207702_10270944
1630 Ga0207702_10387066
1631 Ga0207702_10390241
1632 Ga0207641_10018849
1633 Ga0207641_10249185
1634 Ga0207641_10761988
1635 Ga0207641_12535419
1636 Ga0207648_10085371
1637 Ga0207676_10002528
1638 Ga0207674_10022721
1639 Ga0207674_10101881
1640 Ga0207674_10112159
1641 Ga0207674_10367153
1642 Ga0207674_12006301
1643 Ga0207675_100023872
1644 Ga0207675_100125041
1645 Ga0207683_10055090
1646 Ga0207683_10209105
1647 Ga0207683_11110899
1648 Ga0207683_11404523
1649 Ga0207698_10037957
1650 Ga0207698_10202369
1651 Ga0207698_10451519
1652 Ga0207698_10808693
1653 Ga0209813_10025819
1654 Ga0207428_10107183
1655 Ga0268266_10038076
1656 Ga0268266_11501119
1657 Ga0268265_11110868
1658 Ga0268265_12255415
1659 Ga0268264_10025796
1660 Ga0268264_10265083
1661 Ga0268264_10706115
1662 Ga0268264_12045995
1663 Ga0307517_10272101
1664 Ga0307515_10778274
1665 Ga0307512_10050742
1666 Ga0307512_10138693
1667 Ga0316176_1214649
1668 Ga0316181_1082057
1669 Ga0265769_119107
1670 Ga0265779_104622
1671 Ga0265328_10068246
1672 Ga0265325_10063329
1673 Ga0265340_10006963
1674 Ga0265340_10032637
1675 Ga0265339_10168656
1676 Ga0307513_10409170
1677 Ga0307513_10638642
1678 Ga0307513_10935019
1679 Ga0307513_10946321
1680 Ga0307513_11005906
1681 Ga0307509_10009471
1682 Ga0307408_100724508
1683 Ga0307508_10007906
1684 Ga0307508_10024389
1685 Ga0307508_10462490
1686 Ga0265314_10162513
1687 Ga0307516_10003585
1688 Ga0307405_10095336
1689 Ga0307405_10123841
1690 Ga0307405_10143152
1691 Ga0307405_11492199
1692 Ga0307413_11199877
1693 Ga0307413_11524730
1694 Ga0307518_10318726
1695 Ga0307410_10068505
1696 Ga0307410_10401544
1697 Ga0307410_12060727
1698 Ga0307406_10000856
1699 Ga0307406_10096072
1700 Ga0307406_10143416
1701 Ga0307406_10516412
1702 Ga0307406_11087490
1703 Ga0307407_10049499
1704 Ga0307407_10368341
1705 Ga0307412_10121539
1706 Ga0307409_100206054
1707 Ga0307409_100824913
1708 Ga0307409_102900759
1709 Ga0307416_100102513
1710 Ga0307416_100171696
1711 Ga0307416_100882755
1712 Ga0307416_101811091
1713 Ga0307416_102305119
1714 Ga0307416_103307749
1715 Ga0307416_103738616
1716 Ga0307414_10255234
1717 Ga0307414_11368258
1718 Ga0307411_10211468
1719 Ga0307415_100067194
1720 Ga0307415_100250416
1721 Ga0307415_100426882
1722 Ga0307415_100615632
1723 Ga0307415_101446873
1724 Ga0307415_101661323
1725 Ga0316593_10135718
1726 Ga0316593_10187531
1727 Ga0307507_10275880
1728 Ga0316214_1039111
1729 Ga0373930_0198048
1730 Ga0373950_0132374
1731 Ga0373929_0126813
1732 Ga0373940_0139869
1733 Ga0373951_0000077
1734 Ga0373932_0088562
1735 Ga0373941_0099891
1736 Ga0373946_0470728
1737 Ga0373942_0003991
1738 Ga0373942_0034816
1739 Ga0373942_0083819
1740 Ga0373962_0001763
1741 Ga0316574_0903444
1742 Ga0373931_0965326
1743 Ga0373935_0705979
1744 Ga0373947_0423107
1745 Ga0373937_0081155
1746 Ga0373925_0164312
1747 Ga0373925_0452932
1748 Ga0373925_0841170
1749 Ga0395899_0238554
1750 Ga0395900_0017058
1751 Ga0395900_0034322
1752 Ga0395900_0312507
1753 Ga0395900_1782372
1754 Ga0395898_0017301
1755 Ga0395898_0063355
1756 Ga0395898_0799509
1757 Ga0395898_1201763
1758 Ga0395905_0025967
1759 Ga0395905_0510998
1760 Ga0395905_1911289
1761 Ga0436364_0358181
1762 Ga0436364_0441673
1763 Ga0436364_0777551
1764 Ga0395901_0006306
1765 Ga0395901_0010009
1766 Ga0395901_0216316
1767 Ga0395901_0527634
1768 Ga0395901_0617866
1769 Ga0436365_0521780
1770 Ga0436365_1357707
1771 Ga0436362_0473765
1772 Ga0436362_1007526
1773 Ga0451790_29591
1774 Ga0451791_0908830
1775 Ga0451797_0420750
1776 Ga0451801_23546
1777 Ga0451795_0664292
1778 Ga0451837_1200754
1779 Ga0451839_0345606
1780 Ga0451839_1160533
1781 Ga0451849_0955724
1782 Ga0451851_1076766
1783 Ga0451843_0869211
1784 Ga0439442_084424
1785 Ga0439448_0092466
1786 Ga0439448_0151305
1787 Ga0439463_065896
1788 Ga0450914_018083
1789 Ga0450890_034518
1790 Ga0450900_039640
1791 Ga0439458_0109399
1792 Ga0439459_0002498
1793 Ga0439459_0201993
1794 Ga0439464_0046065
1795 Ga0439460_0157239
1796 Ga0451577_0000135
1797 Ga0439440_0070316
1798 Ga0466972_0007903
1799 Ga0466961_0074152
1800 Ga0466963_0162751
1801 Ga0466963_0728450
1802 Ga0466963_1173289
1803 Ga0466963_1315679
1804 Ga0466964_0027766
1805 Ga0466964_0417594
1806 Ga0466964_0499007
1807 Ga0453684_0000038
1808 Ga0466971_0013414
1809 Ga0466971_0244541
1810 Ga0466971_0676513
1811 Ga0466968_0071748
1812 Ga0466968_0138303
1813 Ga0466968_0655163
1814 Ga0466970_0001515
1815 Ga0466970_0007151
1816 Ga0466970_0083582
1817 Ga0466957_0011088
1818 Ga0466957_0117962
1819 Ga0466957_0165859
1820 Ga0466957_0247383
1821 Ga0466960_0380516
1822 Ga0466960_0396320
1823 Ga0466960_0542618
1824 Ga0466958_0045179
1825 Ga0466958_0163106
1826 Ga0466958_0282747
1827 Ga0466967_0073632
1828 Ga0466967_0128778
1829 Ga0466967_0142225
1830 Ga0466967_0161380
1831 Ga0466967_0516790
1832 Ga0466967_0598918
1833 Ga0466967_0650158
1834 Ga0466967_1059366
1835 Ga0466967_1793562
1836 Ga0495590_0200182
1837 Ga0495629_0669449
1838 Ga0495639_0249414
1839 Ga0495585_0368960
1840 Ga0495594_0037986
1841 Ga0495618_0508860
1842 Ga0495632_0283580
1843 Ga0495640_0975879
1844 Ga0495634_0232786
1845 Ga0495625_0360085
1846 Ga0495647_0301820
1847 Ga0495581_0345061
1848 Ga0495680_0368107
1849 Ga0495683_0298189
1850 Ga0496100_0013183
1851 Ga0496100_1234160
1852 Ga0496102_0097385
1853 Ga0496102_1710288
1854 Ga0496103_0112366
1855 Ga0496104_0024974
1856 Ga0496104_0311805
1857 Ga0496105_0001319
1858 Ga0496106_0016694
1859 Ga0496107_0147572
1860 Ga0496108_0000065
1861 Ga0496108_0711956
1862 Ga0496108_1240293
1863 Ga0496109_0420491
1864 Ga0496109_1511712
1865 Ga0496110_0018611
1866 Ga0496110_0279940
1867 Ga0496110_0485840
1868 Ga0496111_0036953
1869 Ga0496111_0972479
1870 Ga0496112_0042662
1871 Ga0496112_0108157
1872 Ga0496112_0108341
1873 Ga0496113_0057834
1874 Ga0496113_0067760
1875 Ga0496113_0198151
1876 Ga0496113_0955154
1877 Ga0496113_1183762
1878 Ga0496114_0139236
1879 Ga0496119_0342329
1880 Ga0496123_0050527
1881 Ga0501305_052305
1882 Ga0501317_016829
1883 Ga0501317_041696
1884 Ga0501318_013845
1885 Ga0501318_020380
1886 Ga0501318_037701
1887 Ga0501320_053540
1888 Ga0501321_040168
1889 Ga0501323_018419
1890 Ga0501325_014537
1891 Ga0501330_023128
1892 Ga0501031_0000702
1893 Ga0501034_0012661
1894 Ga0501036_0219306
1895 Ga0501036_0618043
1896 Ga0501037_1083469
1897 Ga0501038_0233101
1898 Ga0501038_0921600
1899 Ga0501039_0042765
1900 Ga0501040_0025236
1901 Ga0501041_0133984
1902 Ga0501042_0014605
1903 Ga0501042_0469930
1904 Ga0501043_0909736
1905 Ga0501043_1191314
1906 Ga0501046_0048822
1907 Ga0501048_0000794
1908 Ga0501067_0002126
1909 Ga0501068_0217867
1910 Ga0501068_0664629
1911 Ga0501069_0235072
1912 Ga0501070_0009113
1913 Ga0501070_0098321
1914 Ga0501071_0012242
1915 Ga0501071_0302598
1916 Ga0501072_0041829
1917 Ga0501074_0062808
1918 Ga0501074_0649423
1919 Ga0501075_0002015
1920 Ga0501076_0026012
1921 Ga0501076_0579743
1922 Ga0501077_0215510
1923 Ga0501077_0755128
1924 Ga0501077_0989082
1925 Ga0501080_0005076
1926 Ga0501080_1637363
1927 Ga0501081_0429692
1928 Ga0501081_0476616
1929 Ga0501081_0894429
1930 Ga0501083_0046702
1931 Ga0501035_0241015
1932 Ga0501044_0363995
1933 Ga0501044_1329804
1934 Ga0501045_0103190
1935 nmdc:mga03n38_17262_c1
1936 nmdc:mga00v17_745788_c1
1937 nmdc:mga06z11_2774_c1
1938 nmdc:mga04h51_1226_c1
1939 nmdc:mga07m45_279792_c1
1940 nmdc:mga05p37_384303_c1
1941 nmdc:mga05p37_750_c1
1942 nmdc:mga05p37_770669_c1
1943 nmdc:mga05p37_93517_c1
1944 nmdc:mga09592_198712_c1
1945 nmdc:mga09592_348_c2
1946 nmdc:mga09592_391546_c1
1947 nmdc:mga09592_40835_c1
1948 nmdc:mga0qj67_1850_c1
1949 nmdc:mga0qj67_46_c1
1950 nmdc:mga06r32_134951_c1
1951 nmdc:mga06r32_1988017_c1
1952 nmdc:mga06r32_432224_c1
1953 nmdc:mga06r32_5_c2
1954 nmdc:mga06r32_63844_c1
1955 nmdc:mga08y16_147144_c1
1956 nmdc:mga08y16_934119_c1
1957 nmdc:mga0n895_157140_c1
1958 nmdc:mga0rr50_4976_c1
1959 nmdc:mga08x19_14945_c1
1960 nmdc:mga0a205_3011_c1
1961 Ga0495655_0004688
1962 Ga0495619_0281078
1963 Ga0500608_004801
1964 Ga0500628_057696
1965 Ga0500559_0394748
1966 Ga0500633_0203585
1967 Ga0501084_0011550
1968 Ga0590075_003570
1969 Ga0587093_052412
1970 Ga0587070_097124
1971 Ga0587073_0068704
1972 Ga0587082_099379
1973 Ga0587082_105930
1974 Ga0587088_100208
1975 Ga0587089_110718
1976 Ga0587090_078077
1977 Ga0587090_111175
1978 Ga0587094_049988
1979 Ga0587095_007875
1980 Ga0587095_016715
1981 Ga0587106_023766
1982 Ga0587106_102071
1983 Ga0587125_033373
1984 Ga0587099_019322
1985 Ga0587109_107968
1986 Ga0587115_082292
1987 Ga0587128_042347
1988 Ga0587128_076890
1989 Ga0587062_070171
1990 Ga0587067_073522
1991 Ga0587067_114639
1992 Ga0587067_224370
1993 Ga0587068_040150
1994 Ga0587069_060010
1995 Ga0587075_068317
1996 Ga0587075_078247
1997 Ga0587078_024412
1998 Ga0587079_059450
1999 Ga0587079_069613
2000 Ga0587079_182958
2001 Ga0587079_212288
2002 Ga0587107_028914
2003 Ga0587107_079230
2004 Ga0587107_150918
2005 Ga0587110_026956
2006 Ga0587114_034041
2007 Ga0587114_036890
2008 Ga0587119_026366
2009 Ga0587120_010374
2010 Ga0587071_207684
2011 Ga0587111_0050724
2012 Ga0587111_0080290
2013 Ga0587111_0086613
2014 Ga0587111_0200252
2015 Ga0587111_0226022
2016 Ga0501082_0055749
2017 Ga0501082_0322895
2018 Ga0501082_0643041
2019 Ga0466962_0099884
2020 Ga0466962_0163285
2021 Ga0466962_0568988
2022 Ga0466962_0636349
2023 Ga0530510_0894358
2024 2919449825

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

80

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9085 20 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9047 18 83
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9034 22 84
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8829 20 84
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8791 18 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9085 20 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8829 20 84 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8428 17 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8289 29 81 2.40.50.100
af_Q9XXD2_5_60_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8108 29 81 2.40.50.100
ID Description Score Start End GO Terms
AF-I0R0V1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9679 23 83 GO:0003735
GO:0006412
GO:0022625
AF-W4UE80-F1-model_v4 deleted 0.959 23 85
AF-I0R0V1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9526 23 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A7W7FST9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.951 23 85 GO:0003735
GO:0006412
GO:0022625
AF-V6UNU0-F1-model_v4 deleted 0.9488 23 85

Map