F483686

General Info

Members Datasets Scaffolds Average Seq Length
857 486 1714 86

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10939638|Ga0111539_109396382
Length 80
Sequence MSKKKGAASSRNGRDSAAQRLGVKVHSIVRQRGTKFHPGKNVGRGNDDTLFALVAGIVKFEPKDKKRQKISVYPADAGDA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
100 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
101 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
124 3300023668 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
170 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
171 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
175 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
244 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
245 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
246 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
247 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
248 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
249 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
250 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
251 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
252 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
253 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
254 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
255 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
258 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
386 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
387 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
388 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
389 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
390 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
391 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
394 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
395 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
398 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
399 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
419 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
420 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
421 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
422 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
423 2643221548 Streptomyces sp. Root55 Isolate Unclassified
424 2643221549 Agromyces sp. Root1464 Isolate Unclassified
425 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
426 2643221604 Nocardioides sp. Root190 Isolate Unclassified
427 2643221617 Nocardioides sp. Root79 Isolate Unclassified
428 2643221619 Agromyces sp. Root81 Isolate Unclassified
429 2643221620 Nocardioides sp. Root240 Isolate Unclassified
430 2643221641 Nocardioides sp. Root122 Isolate Unclassified
431 2643221647 Streptomyces sp. Root369 Isolate Unclassified
432 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
433 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
434 2643221714 Streptomyces sp. Root264 Isolate Unclassified
435 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
436 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
437 2738541305 Nocardioides sp. CF167 Isolate Unclassified
438 2739367898 Nocardioides sp. CF479 Isolate Unclassified
439 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
440 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
441 2808606372 Agromyces sp. 23-23 Isolate Unclassified
442 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
443 2808606448 Streptomyces sp. 193411 Isolate Unclassified
444 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
445 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
446 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
447 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
448 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
449 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
450 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
451 2862574272 Streptomyces sp. AcE210 Isolate Nodule
452 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
453 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
454 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
455 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
456 2867369537 Streptomyces sp. Z26 Isolate Unclassified
457 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
458 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
459 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
460 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
461 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
462 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
463 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
464 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
465 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
466 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
467 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
468 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
469 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
470 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
471 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
472 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
473 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
474 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
475 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
476 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
477 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
478 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
479 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
480 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
481 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
482 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
483 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
484 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
485 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
486 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.08
Metatranscriptomes 15.99
Isolates 7.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0.35
Rhizoplane 4.2
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10939638 3300009094 Bacteria 1005
2 LJNas_1022272 3300000546 Bacteria 676
3 JGI24739J22299_10080331 3300001989 Bacteria 1002
4 JGI24743J22301_10015968 3300001991 Bacteria 1396
5 JGI24749J21850_1018395 3300002076 Bacteria 986
6 JGI24744J21845_10005638 3300002077 Bacteria 2594
7 JGI24742J22300_10073995 3300002244 Bacteria 638
8 Ga0006778J45830_1018265 3300003162 Bacteria 735
9 Ga0006778J45830_1020392 3300003162 Bacteria 631
10 Ga0006759J45824_1015951 3300003163 Bacteria 717
11 Ga0006759J45824_1023826 3300003163 Bacteria 694
12 Ga0006759J45824_1036218 3300003163 Bacteria 558
13 Ga0006777J48905_1023427 3300003308 Bacteria 723
14 Ga0007417J51691_1019609 3300003544 Bacteria 726
15 Ga0007427J51700_113809 3300003559 Bacteria 642
16 Ga0007427J51700_114899 3300003559 Bacteria 581
17 Ga0006781J51513_1014045 3300003568 Bacteria 727
18 Ga0006781J51513_1016819 3300003568 Bacteria 738
19 Ga0006781J51513_1020798 3300003568 Bacteria 645
20 Ga0007410J51695_1017596 3300003574 Bacteria 737
21 Ga0007410J51695_1019037 3300003574 Bacteria 654
22 Ga0007410J51695_1035339 3300003574 Bacteria 724
23 Ga0007409J51694_1026545 3300003575 Bacteria 657
24 Ga0007416J51690_1014631 3300003577 Bacteria 655
25 Ga0007416J51690_1020621 3300003577 Bacteria 686
26 Ga0007416J51690_1032371 3300003577 Bacteria 741
27 Ga0007429J51699_1030546 3300003579 Bacteria 638
28 Ga0007429J51699_1030653 3300003579 Bacteria 593
29 Ga0007429J51699_1062306 3300003579 Bacteria 702
30 Ga0007411J51799_113730 3300003611 Bacteria 730
31 Ga0032354_1016877 3300003693 Bacteria 709
32 Ga0032354_1025855 3300003693 Bacteria 727
33 Ga0006780_1010384 3300003735 Bacteria 676
34 JGI25405J52794_10022894 3300003911 Bacteria 1269
35 Ga0058859_10043592 3300004798 Bacteria 637
36 Ga0058859_10073273 3300004798 Bacteria 748
37 Ga0058861_10189803 3300004800 Bacteria 630
38 Ga0058860_12181988 3300004801 Bacteria 504
39 Ga0070676_10999377 3300005328 Bacteria 628
40 Ga0070683_100589444 3300005329 Bacteria 1064
41 Ga0070683_102353903 3300005329 Bacteria 511
42 Ga0070690_100439835 3300005330 Bacteria 965
43 Ga0070670_100143399 3300005331 Bacteria 2066
44 Ga0068869_100486752 3300005334 Bacteria 1028
45 Ga0070680_100715629 3300005336 Bacteria 862
46 Ga0070680_100852140 3300005336 Bacteria 786
47 Ga0070682_100043086 3300005337 Bacteria 2789
48 Ga0070682_100892715 3300005337 Bacteria 730
49 Ga0070682_101173651 3300005337 Bacteria 646
50 Ga0070660_100248311 3300005339 Bacteria 1451
51 Ga0070660_100340074 3300005339 Bacteria 1235
52 Ga0070660_100885242 3300005339 Bacteria 752
53 Ga0070689_100138643 3300005340 Bacteria 1955
54 Ga0070689_100696527 3300005340 Bacteria 887
55 Ga0070691_10706932 3300005341 Bacteria 606
56 Ga0070687_100136198 3300005343 Bacteria 1424
57 Ga0070687_100204453 3300005343 Bacteria 1199
58 Ga0070661_100448082 3300005344 Bacteria 1027
59 Ga0070692_10031106 3300005345 Bacteria 2673
60 Ga0070668_100004599 3300005347 Bacteria 10220
61 Ga0070668_100047826 3300005347 Bacteria 3289
62 Ga0070668_100228974 3300005347 Bacteria 1536
63 Ga0070668_101347081 3300005347 Bacteria 650
64 Ga0070668_101403532 3300005347 Bacteria 637
65 Ga0070669_100218024 3300005353 Bacteria 1508
66 Ga0070669_100641499 3300005353 Bacteria 893
67 Ga0070669_100676686 3300005353 Bacteria 870
68 Ga0070675_100013757 3300005354 Bacteria 6368
69 Ga0070675_101170109 3300005354 Bacteria 708
70 Ga0070674_100720271 3300005356 Bacteria 855
71 Ga0070674_100919961 3300005356 Bacteria 763
72 Ga0070673_100157320 3300005364 Bacteria 1930
73 Ga0070688_100588015 3300005365 Bacteria 851
74 Ga0070703_10235413 3300005406 Bacteria 736
75 Ga0070709_10010163 3300005434 Bacteria 5201
76 Ga0070709_10267953 3300005434 Bacteria 1236
77 Ga0070709_10773837 3300005434 Bacteria 751
78 Ga0070714_100146697 3300005435 Bacteria 2123
79 Ga0070714_100579236 3300005435 Bacteria 1076
80 Ga0070714_101139606 3300005435 Bacteria 760
81 Ga0070713_100077998 3300005436 Bacteria 2819
82 Ga0070713_100114480 3300005436 Bacteria 2356
83 Ga0070713_100150891 3300005436 Bacteria 2067
84 Ga0070713_100347033 3300005436 Bacteria 1376
85 Ga0070713_100648289 3300005436 Bacteria 1005
86 Ga0070713_101398349 3300005436 Bacteria 679
87 Ga0070710_10007895 3300005437 Bacteria 5169
88 Ga0070710_10045918 3300005437 Bacteria 2430
89 Ga0070710_10896809 3300005437 Bacteria 640
90 Ga0070701_10127169 3300005438 Bacteria 1443
91 Ga0070711_100012615 3300005439 Bacteria 5284
92 Ga0070711_100028374 3300005439 Bacteria 3683
93 Ga0070711_100033920 3300005439 Bacteria 3401
94 Ga0070700_100002680 3300005441 Bacteria 9097
95 Ga0070700_100218280 3300005441 Bacteria 1349
96 Ga0070700_100564037 3300005441 Bacteria 887
97 Ga0070708_100219439 3300005445 Bacteria 1783
98 Ga0070663_100017492 3300005455 Bacteria 4680
99 Ga0070662_101183912 3300005457 Bacteria 657
100 Ga0070662_101544633 3300005457 Bacteria 573
101 Ga0070681_10258947 3300005458 Bacteria 1652
102 Ga0068867_100028590 3300005459 Bacteria 4015
103 Ga0068867_100793556 3300005459 Bacteria 844
104 Ga0068867_102211423 3300005459 Bacteria 522
105 Ga0070706_100074872 3300005467 Bacteria 3133
106 Ga0070707_100155245 3300005468 Bacteria 2230
107 Ga0070698_100010328 3300005471 Bacteria 9968
108 Ga0070698_100019873 3300005471 Bacteria 7045
109 Ga0070699_101979038 3300005518 Bacteria 533
110 Ga0070679_100070729 3300005530 Bacteria 3480
111 Ga0070679_100152808 3300005530 Bacteria 2284
112 Ga0070684_101153546 3300005535 Bacteria 728
113 Ga0070684_102066870 3300005535 Bacteria 538
114 Ga0070665_101199189 3300005548 Bacteria 770
115 Ga0070665_102539765 3300005548 Bacteria 513
116 Ga0068857_100326556 3300005577 Bacteria 1417
117 Ga0068857_100331933 3300005577 Bacteria 1406
118 Ga0068854_100123509 3300005578 Bacteria 1969
119 Ga0068854_100698775 3300005578 Bacteria 875
120 Ga0068854_101343022 3300005578 Bacteria 645
121 Ga0070702_100027149 3300005615 Bacteria 3085
122 Ga0070702_100206611 3300005615 Bacteria 1304
123 Ga0070702_100745168 3300005615 Bacteria 752
124 Ga0068864_100597151 3300005618 Bacteria 1071
125 Ga0068866_10024414 3300005718 Bacteria 2827
126 Ga0068866_10489240 3300005718 Bacteria 812
127 Ga0068861_100049241 3300005719 Bacteria 3189
128 Ga0068870_10157487 3300005840 Bacteria 1344
129 Ga0068863_100204715 3300005841 Unclassified 1899
130 Ga0081455_10000265 3300005937 Bacteria 68995
131 Ga0070717_10019007 3300006028 Bacteria 5380
132 Ga0070717_10049256 3300006028 Bacteria 3458
133 Ga0070717_10079305 3300006028 Bacteria 2753
134 Ga0070717_10282871 3300006028 Bacteria 1471
135 Ga0070717_10352794 3300006028 Bacteria 1315
136 Ga0070717_10946358 3300006028 Bacteria 784
137 Ga0070717_11270400 3300006028 Bacteria 669
138 Ga0075365_10155186 3300006038 Bacteria 1593
139 Ga0075365_10449884 3300006038 Bacteria 909
140 Ga0075363_100729460 3300006048 Bacteria 600
141 Ga0075364_11239036 3300006051 Bacteria 505
142 Ga0070715_10029242 3300006163 Bacteria 2218
143 Ga0070715_10034360 3300006163 Bacteria 2078
144 Ga0070715_10047983 3300006163 Bacteria 1823
145 Ga0070716_100001600 3300006173 Bacteria 10191
146 Ga0070716_100005302 3300006173 Bacteria 6233
147 Ga0070716_100011149 3300006173 Bacteria 4524
148 Ga0070716_101556895 3300006173 Bacteria 542
149 Ga0070712_100002852 3300006175 Bacteria 10700
150 Ga0070712_100106522 3300006175 Bacteria 2084
151 Ga0070712_100790590 3300006175 Bacteria 814
152 Ga0070712_101954231 3300006175 Bacteria 514
153 Ga0097621_100798618 3300006237 Bacteria 874
154 Ga0075428_100005329 3300006844 Bacteria 14297
155 Ga0075430_100012185 3300006846 Bacteria 7322
156 Ga0075431_100010203 3300006847 Bacteria 9443
157 Ga0075434_100766287 3300006871 Bacteria 982
158 Ga0075429_100006028 3300006880 Bacteria 10480
159 Ga0075435_100483640 3300007076 Bacteria 1069
160 Ga0099795_10170894 3300007788 Bacteria 903
161 Ga0105240_10057388 3300009093 Bacteria 4864
162 Ga0111539_11407616 3300009094 Bacteria 809
163 Ga0111539_11943941 3300009094 Bacteria 682
164 Ga0105245_11482852 3300009098 Bacteria 729
165 Ga0114129_10009476 3300009147 Bacteria 13880
166 Ga0114129_12240621 3300009147 Bacteria 657
167 Ga0105243_10007573 3300009148 Bacteria 8342
168 Ga0105243_12191475 3300009148 Bacteria 589
169 Ga0105243_12204454 3300009148 Bacteria 588
170 Ga0105242_10473167 3300009176 Bacteria 1186
171 Ga0105248_10051414 3300009177 Bacteria 4623
172 Ga0105248_10768926 3300009177 Bacteria 1087
173 Ga0105248_12556089 3300009177 Bacteria 582
174 Ga0105237_10015942 3300009545 Bacteria 7813
175 Ga0105237_10842732 3300009545 Bacteria 923
176 Ga0105238_10775918 3300009551 Bacteria 973
177 Ga0105238_10835635 3300009551 Bacteria 938
178 Ga0105238_11016878 3300009551 Bacteria 850
179 Ga0105238_12615956 3300009551 Bacteria 541
180 Ga0105249_10622017 3300009553 Bacteria 1136
181 Ga0105249_11484142 3300009553 Bacteria 750
182 Ga0105249_11898512 3300009553 Bacteria 668
183 Ga0105239_10626720 3300010375 Bacteria 1227
184 Ga0105246_10740309 3300011119 Bacteria 866
185 Ga0157319_1055919 3300012497 Bacteria 502
186 Ga0157326_1039684 3300012513 Bacteria 656
187 Ga0154016_110258 3300013045 Bacteria 802
188 Ga0154012_122270 3300013059 Bacteria 622
189 Ga0154010_156824 3300013062 Bacteria 727
190 Ga0157369_10448910 3300013105 Bacteria 1335
191 Ga0157369_12203893 3300013105 Bacteria 559
192 Ga0157374_11105710 3300013296 Bacteria 813
193 Ga0157372_10164221 3300013307 Bacteria 2567
194 Ga0157372_11313083 3300013307 Bacteria 835
195 Ga0157372_12880682 3300013307 Bacteria 551
196 Ga0157375_10970590 3300013308 Bacteria 991
197 Ga0157380_10088956 3300014326 Bacteria 2542
198 Ga0157380_11430486 3300014326 Bacteria 743
199 Ga0157380_11985446 3300014326 Bacteria 643
200 Ga0157380_12004527 3300014326 Bacteria 641
201 Ga0157377_10011946 3300014745 Bacteria 4352
202 Ga0163161_10757275 3300017792 Bacteria 813
203 Ga0163161_11096243 3300017792 Bacteria 684
204 Ga0184603_130492 3300019192 Bacteria 563
205 Ga0197907_10568407 3300020069 Bacteria 708
206 Ga0197907_10572481 3300020069 Bacteria 939
207 Ga0197907_10694247 3300020069 Bacteria 977
208 Ga0197907_11394387 3300020069 Bacteria 1046
209 Ga0206356_10277914 3300020070 Bacteria 656
210 Ga0206356_10389405 3300020070 Bacteria 501
211 Ga0206356_11200626 3300020070 Bacteria 1047
212 Ga0206356_11428661 3300020070 Bacteria 755
213 Ga0206356_11480230 3300020070 Bacteria 906
214 Ga0206356_11856534 3300020070 Bacteria 656
215 Ga0206356_11868628 3300020070 Bacteria 1442
216 Ga0206355_1519922 3300020076 Bacteria 728
217 Ga0206355_1520700 3300020076 Bacteria 608
218 Ga0206351_10118108 3300020077 Bacteria 878
219 Ga0206351_10394707 3300020077 Bacteria 1036
220 Ga0206351_10803575 3300020077 Bacteria 870
221 Ga0206352_10043045 3300020078 Bacteria 624
222 Ga0206352_10146681 3300020078 Bacteria 795
223 Ga0206352_10577646 3300020078 Bacteria 750
224 Ga0206352_11000860 3300020078 Bacteria 716
225 Ga0206352_11359334 3300020078 Bacteria 539
226 Ga0206350_10905434 3300020080 Bacteria 1144
227 Ga0206350_11053269 3300020080 Bacteria 697
228 Ga0206354_10246573 3300020081 Bacteria 1420
229 Ga0206354_10411107 3300020081 Bacteria 652
230 Ga0206354_10655668 3300020081 Bacteria 723
231 Ga0206354_10932283 3300020081 Bacteria 817
232 Ga0206354_11131545 3300020081 Bacteria 612
233 Ga0206354_11187521 3300020081 Bacteria 902
234 Ga0206354_11249330 3300020081 Bacteria 610
235 Ga0206354_11251534 3300020081 Bacteria 709
236 Ga0206353_10233523 3300020082 Bacteria 684
237 Ga0206353_10367492 3300020082 Bacteria 639
238 Ga0206353_10783395 3300020082 Bacteria 697
239 Ga0206353_11549377 3300020082 Bacteria 1034
240 Ga0154015_1062931 3300020610 Bacteria 634
241 Ga0154015_1335319 3300020610 Bacteria 518
242 Ga0154015_1575133 3300020610 Bacteria 591
243 Ga0213875_10032580 3300021388 Bacteria 2462
244 Ga0224712_10200121 3300022467 Bacteria 908
245 Ga0224712_10304929 3300022467 Bacteria 745
246 Ga0224712_10374403 3300022467 Bacteria 676
247 Ga0224712_10417473 3300022467 Bacteria 641
248 Ga0247530_109342 3300023563 Bacteria 793
249 Ga0247525_117656 3300023668 Bacteria 539
250 Ga0207697_10144315 3300025315 Bacteria 1034
251 Ga0207682_10186304 3300025893 Bacteria 950
252 Ga0207692_10003732 3300025898 Bacteria 5983
253 Ga0207642_10120760 3300025899 Bacteria 1351
254 Ga0207642_10496207 3300025899 Bacteria 747
255 Ga0207647_10652997 3300025904 Bacteria 577
256 Ga0207685_10026795 3300025905 Bacteria 2009
257 Ga0207685_10157332 3300025905 Bacteria 1034
258 Ga0207699_10002082 3300025906 Bacteria 9452
259 Ga0207699_10003711 3300025906 Bacteria 7292
260 Ga0207699_10270561 3300025906 Bacteria 1177
261 Ga0207645_10921969 3300025907 Bacteria 593
262 Ga0207643_10005670 3300025908 Bacteria 6679
263 Ga0207643_10103732 3300025908 Bacteria 1669
264 Ga0207643_10161524 3300025908 Bacteria 1348
265 Ga0207705_10957234 3300025909 Bacteria 662
266 Ga0207684_10002608 3300025910 Bacteria 18029
267 Ga0207684_10071279 3300025910 Bacteria 2953
268 Ga0207684_10543962 3300025910 Bacteria 994
269 Ga0207695_10098937 3300025913 Bacteria 2915
270 Ga0207695_11261825 3300025913 Bacteria 619
271 Ga0207693_10006593 3300025915 Bacteria 9600
272 Ga0207693_10075654 3300025915 Bacteria 2637
273 Ga0207693_10096788 3300025915 Bacteria 2314
274 Ga0207693_10952831 3300025915 Bacteria 657
275 Ga0207663_10004640 3300025916 Bacteria 6853
276 Ga0207663_10105924 3300025916 Bacteria 1899
277 Ga0207663_10132053 3300025916 Bacteria 1727
278 Ga0207662_10112943 3300025918 Bacteria 1696
279 Ga0207662_10428888 3300025918 Bacteria 901
280 Ga0207657_10340810 3300025919 Bacteria 1183
281 Ga0207657_10799731 3300025919 Bacteria 729
282 Ga0207649_10091185 3300025920 Bacteria 1996
283 Ga0207652_10038138 3300025921 Bacteria 4071
284 Ga0207652_10312713 3300025921 Bacteria 1418
285 Ga0207652_10531136 3300025921 Bacteria 1058
286 Ga0207646_10171049 3300025922 Bacteria 1962
287 Ga0207646_11071107 3300025922 Bacteria 710
288 Ga0207681_10124643 3300025923 Bacteria 1895
289 Ga0207681_10625263 3300025923 Bacteria 891
290 Ga0207681_10670929 3300025923 Bacteria 860
291 Ga0207694_10634590 3300025924 Bacteria 899
292 Ga0207659_10112118 3300025926 Bacteria 2075
293 Ga0207659_10843135 3300025926 Bacteria 788
294 Ga0207700_10000909 3300025928 Bacteria 16980
295 Ga0207700_10029664 3300025928 Bacteria 3863
296 Ga0207700_10096904 3300025928 Bacteria 2343
297 Ga0207700_10112744 3300025928 Bacteria 2191
298 Ga0207700_10281305 3300025928 Bacteria 1431
299 Ga0207700_10397382 3300025928 Bacteria 1207
300 Ga0207700_10668111 3300025928 Bacteria 927
301 Ga0207664_10000622 3300025929 Bacteria 24554
302 Ga0207664_10000671 3300025929 Bacteria 23504
303 Ga0207664_10012086 3300025929 Bacteria 6165
304 Ga0207664_10020262 3300025929 Bacteria 4926
305 Ga0207664_10053975 3300025929 Bacteria 3183
306 Ga0207664_10328067 3300025929 Bacteria 1351
307 Ga0207686_10436054 3300025934 Bacteria 1005
308 Ga0207686_11555667 3300025934 Bacteria 546
309 Ga0207709_10025971 3300025935 Bacteria 3359
310 Ga0207709_10101340 3300025935 Bacteria 1904
311 Ga0207709_10251118 3300025935 Bacteria 1292
312 Ga0207709_10924824 3300025935 Bacteria 710
313 Ga0207669_10469336 3300025937 Bacteria 1001
314 Ga0207665_10000232 3300025939 Bacteria 37974
315 Ga0207665_10008290 3300025939 Bacteria 6860
316 Ga0207665_10065399 3300025939 Bacteria 2473
317 Ga0207691_11158212 3300025940 Bacteria 642
318 Ga0207689_10108803 3300025942 Bacteria 2278
319 Ga0207689_10543183 3300025942 Bacteria 976
320 Ga0207651_10138952 3300025960 Bacteria 1873
321 Ga0207712_10439754 3300025961 Bacteria 1104
322 Ga0207668_10021076 3300025972 Bacteria 4152
323 Ga0207668_10099374 3300025972 Bacteria 2159
324 Ga0207668_10490260 3300025972 Bacteria 1055
325 Ga0207640_10978167 3300025981 Bacteria 743
326 Ga0207677_10412110 3300026023 Bacteria 1149
327 Ga0207678_10006707 3300026067 Bacteria 10211
328 Ga0207708_10004020 3300026075 Bacteria 10818
329 Ga0207708_10027251 3300026075 Bacteria 4326
330 Ga0207708_10576171 3300026075 Bacteria 951
331 Ga0207708_10717183 3300026075 Bacteria 856
332 Ga0207702_10015640 3300026078 Bacteria 6281
333 Ga0207641_10115185 3300026088 Unclassified 2390
334 Ga0207648_10001192 3300026089 Bacteria 29118
335 Ga0207674_10188721 3300026116 Bacteria 2011
336 Ga0207674_10213466 3300026116 Bacteria 1878
337 Ga0207674_10582889 3300026116 Bacteria 1080
338 Ga0207675_100012420 3300026118 Bacteria 7957
339 Ga0207675_100215500 3300026118 Bacteria 1848
340 Ga0207683_11756488 3300026121 Bacteria 569
341 Ga0268266_11088506 3300028379 Bacteria 773
342 Ga0265337_1001546 3300028556 Bacteria 11291
343 Ga0265326_10002216 3300028558 Bacteria 6584
344 Ga0265319_1009142 3300028563 Bacteria 4251
345 Ga0265334_10000780 3300028573 Bacteria 15904
346 Ga0265318_10022733 3300028577 Bacteria 2504
347 Ga0265323_10002253 3300028653 Bacteria 8966
348 Ga0265322_10010699 3300028654 Bacteria 2664
349 Ga0265336_10022867 3300028666 Bacteria 1987
350 Ga0307515_10120537 3300028794 Bacteria 2975
351 Ga0265338_10009988 3300028800 Bacteria 11222
352 Ga0265338_10075656 3300028800 Bacteria 2856
353 Ga0265324_10001086 3300029957 Bacteria 16372
354 Ga0265762_1036640 3300030760 Bacteria 948
355 Ga0265775_104224 3300030762 Bacteria 802
356 Ga0265763_1004177 3300030763 Bacteria 1174
357 Ga0265766_1006307 3300030863 Bacteria 774
358 Ga0265764_102320 3300030882 Bacteria 924
359 Ga0265332_10045591 3300031238 Bacteria 1889
360 Ga0265320_10087493 3300031240 Bacteria 1446
361 Ga0265325_10166133 3300031241 Bacteria 1035
362 Ga0265329_10346953 3300031242 Bacteria 508
363 Ga0265340_10165087 3300031247 Bacteria 1004
364 Ga0265339_10110382 3300031249 Bacteria 1423
365 Ga0265316_10121768 3300031344 Bacteria 1970
366 Ga0307509_10134180 3300031507 Bacteria 2425
367 Ga0265313_10015626 3300031595 Bacteria 4407
368 Ga0307514_10283075 3300031649 Bacteria 947
369 Ga0307514_10520198 3300031649 Bacteria 559
370 Ga0265314_10003310 3300031711 Bacteria 15719
371 Ga0265342_10006114 3300031712 Bacteria 9020
372 Ga0316576_10560432 3300031727 Bacteria 837
373 Ga0307405_10561358 3300031731 Bacteria 925
374 Ga0307405_11258705 3300031731 Bacteria 642
375 Ga0307405_12149548 3300031731 Bacteria 502
376 Ga0307413_10039727 3300031824 Bacteria 2739
377 Ga0307413_10089243 3300031824 Bacteria 2002
378 Ga0307413_10159390 3300031824 Bacteria 1583
379 Ga0307413_10192110 3300031824 Bacteria 1467
380 Ga0307518_10302563 3300031838 Bacteria 971
381 Ga0307410_10233530 3300031852 Bacteria 1421
382 Ga0307410_10330293 3300031852 Bacteria 1212
383 Ga0326468_10070179 3300031889 Bacteria 580
384 Ga0307406_10477228 3300031901 Bacteria 1006
385 Ga0307407_11617555 3300031903 Bacteria 514
386 Ga0307412_10012620 3300031911 Bacteria 4930
387 Ga0307412_10263817 3300031911 Bacteria 1344
388 Ga0307412_11401593 3300031911 Bacteria 632
389 Ga0307409_100021674 3300031995 Bacteria 4411
390 Ga0307409_100172825 3300031995 Bacteria 1904
391 Ga0307409_100469367 3300031995 Bacteria 1218
392 Ga0307409_100505213 3300031995 Bacteria 1178
393 Ga0307409_100831266 3300031995 Bacteria 933
394 Ga0307409_101842264 3300031995 Bacteria 634
395 Ga0307409_102665968 3300031995 Bacteria 528
396 Ga0307416_100344642 3300032002 Bacteria 1505
397 Ga0307416_100435134 3300032002 Bacteria 1360
398 Ga0307414_10168544 3300032004 Bacteria 1748
399 Ga0307411_10085296 3300032005 Bacteria 2187
400 Ga0307411_10169423 3300032005 Bacteria 1645
401 Ga0307411_10665834 3300032005 Bacteria 903
402 Ga0307411_10835803 3300032005 Bacteria 814
403 Ga0307415_100166867 3300032126 Bacteria 1713
404 Ga0307415_100462776 3300032126 Bacteria 1099
405 Ga0373938_0147656 3300034957 Bacteria 624
406 Ga0373926_0266629 3300035083 Bacteria 665
407 Ga0373934_0007152 3300035086 Bacteria 4139
408 Ga0373934_0040361 3300035086 Bacteria 1840
409 Ga0373923_0006371 3300035111 Bacteria 4074
410 Ga0373923_0016194 3300035111 Bacteria 2827
411 Ga0373932_0232309 3300035112 Bacteria 667
412 Ga0373936_0065388 3300035113 Bacteria 1491
413 Ga0373936_0343779 3300035113 Bacteria 679
414 Ga0373945_0177378 3300035116 Bacteria 876
415 Ga0373953_0003409 3300035117 Bacteria 4943
416 Ga0373953_0104066 3300035117 Bacteria 1196
417 Ga0373954_0049831 3300035118 Bacteria 1964
418 Ga0373954_0138722 3300035118 Bacteria 1185
419 Ga0373956_0010222 3300035119 Bacteria 3839
420 Ga0373956_0217595 3300035119 Bacteria 906
421 Ga0373957_0001643 3300035120 Bacteria 6121
422 Ga0373957_0030212 3300035120 Bacteria 1984
423 Ga0373943_0395216 3300035170 Bacteria 798
424 Ga0373946_0435539 3300035171 Bacteria 666
425 Ga0373955_0016008 3300035172 Bacteria 3683
426 Ga0373955_0021208 3300035172 Bacteria 3275
427 Ga0373955_0142953 3300035172 Bacteria 1404
428 Ga0373924_0001917 3300035410 Bacteria 6919
429 Ga0373924_0287092 3300035410 Bacteria 730
430 Ga0373924_0374250 3300035410 Bacteria 636
431 Ga0373931_0466987 3300035691 Bacteria 809
432 Ga0373935_0036624 3300035692 Bacteria 3068
433 Ga0373935_0916151 3300035692 Bacteria 649
434 Ga0373927_0556356 3300035695 Bacteria 758
435 Ga0373927_0659665 3300035695 Bacteria 691
436 Ga0373933_0016313 3300035724 Bacteria 4150
437 Ga0373933_0078117 3300035724 Bacteria 2024
438 Ga0373933_0579531 3300035724 Bacteria 736
439 Ga0373937_0180417 3300036401 Bacteria 1982
440 Ga0373937_0223270 3300036401 Bacteria 1773
441 Ga0265778_054023 3300036457 Bacteria 554
442 Ga0373925_0018032 3300037068 Bacteria 5126
443 Ga0373925_0149335 3300037068 Bacteria 1834
444 Ga0373925_0208714 3300037068 Bacteria 1555
445 Ga0373925_0285353 3300037068 Bacteria 1330
446 Ga0373925_0399252 3300037068 Bacteria 1121
447 Ga0395900_0057814 3300037418 Bacteria 3993
448 Ga0395900_0069154 3300037418 Bacteria 3629
449 Ga0395900_0103132 3300037418 Bacteria 2930
450 Ga0395900_1419785 3300037418 Bacteria 607
451 Ga0395900_1736200 3300037418 Bacteria 535
452 Ga0395898_1552188 3300037466 Bacteria 587
453 Ga0436364_0472656 3300037853 Bacteria 3801
454 Ga0436364_0475919 3300037853 Bacteria 1150
455 Ga0436364_1546886 3300037853 Bacteria 5866
456 Ga0395901_0687687 3300038443 Bacteria 1022
457 Ga0395901_1064334 3300038443 Bacteria 781
458 Ga0395901_1575921 3300038443 Bacteria 611
459 Ga0436365_1010234 3300039437 Bacteria 720
460 Ga0436363_1376266 3300039450 Bacteria 569
461 Ga0436362_0022211 3300039453 Bacteria 1862
462 Ga0439436_0102990 3300041404 Bacteria 796
463 Ga0439466_0240473 3300041411 Bacteria 549
464 Ga0439465_0183148 3300041413 Bacteria 758
465 Ga0451789_0497625 3300041443 Bacteria 584
466 Ga0451793_0975200 3300041452 Bacteria 1702
467 Ga0451797_0322045 3300041453 Bacteria 534
468 Ga0451795_0841048 3300041456 Bacteria 1183
469 Ga0451798_0873055 3300041458 Bacteria 576
470 Ga0451800_0077019 3300041459 Bacteria 1418
471 Ga0451805_118500 3300041461 Bacteria 701
472 Ga0451839_0776345 3300041496 Bacteria 838
473 Ga0451841_0571275 3300041498 Bacteria 577
474 Ga0451845_0382547 3300041501 Bacteria 997
475 Ga0451846_30455 3300041502 Bacteria 586
476 Ga0451849_0761349 3300041505 Bacteria 752
477 Ga0451851_0000350 3300041507 Bacteria 559
478 Ga0439431_0078321 3300041997 Bacteria 888
479 Ga0439448_0142939 3300042005 Bacteria 829
480 Ga0450906_063596 3300042145 Bacteria 657
481 Ga0439434_0151695 3300042435 Bacteria 768
482 Ga0450918_015071 3300042531 Bacteria 1344
483 Ga0466965_0007730 3300044683 Bacteria 4947
484 Ga0466965_0126787 3300044683 Bacteria 1321
485 Ga0466965_0129361 3300044683 Bacteria 1308
486 Ga0466965_0419968 3300044683 Bacteria 741
487 Ga0466966_0014281 3300044684 Bacteria 5258
488 Ga0466961_0798662 3300044693 Bacteria 563
489 Ga0466963_0080016 3300044694 Bacteria 2211
490 Ga0466963_0415800 3300044694 Bacteria 948
491 Ga0466964_0591319 3300044706 Bacteria 607
492 Ga0453684_2004899 3300044712 Bacteria 583
493 Ga0466971_0058607 3300044719 Bacteria 1738
494 Ga0466968_0057957 3300044735 Bacteria 1666
495 Ga0466957_0488252 3300044842 Bacteria 853
496 Ga0466960_0066402 3300044901 Bacteria 1784
497 Ga0466960_0218205 3300044901 Bacteria 1048
498 Ga0466960_0348359 3300044901 Bacteria 844
499 Ga0466959_0064431 3300045049 Bacteria 2661
500 Ga0466959_0603190 3300045049 Bacteria 738
501 Ga0466958_0193746 3300045836 Bacteria 1292
502 Ga0466967_0097675 3300045976 Bacteria 2681
503 Ga0466967_0159656 3300045976 Bacteria 2115
504 Ga0466967_0446780 3300045976 Bacteria 1263
505 Ga0466967_0560204 3300045976 Bacteria 1125
506 Ga0495592_0014265 3300046454 Bacteria 6035
507 Ga0495592_0099594 3300046454 Bacteria 2073
508 Ga0495592_0264389 3300046454 Bacteria 1131
509 Ga0495629_0035983 3300046459 Bacteria 3497
510 Ga0495641_0213129 3300046461 Bacteria 866
511 Ga0495651_0071547 3300046462 Bacteria 2636
512 Ga0495651_0165882 3300046462 Bacteria 1577
513 Ga0495653_0033404 3300046463 Bacteria 4076
514 Ga0495653_0117253 3300046463 Bacteria 1902
515 Ga0495582_0010638 3300046473 Bacteria 5060
516 Ga0495639_0014207 3300046475 Bacteria 3446
517 Ga0495662_0018564 3300046476 Bacteria 3366
518 Ga0495664_0086662 3300046477 Bacteria 1881
519 Ga0495664_0186152 3300046477 Bacteria 1258
520 Ga0495664_0228035 3300046477 Bacteria 1127
521 Ga0495594_0283656 3300046499 Bacteria 944
522 Ga0495608_0031517 3300046511 Bacteria 3585
523 Ga0495608_0186575 3300046511 Bacteria 1310
524 Ga0495608_0905353 3300046511 Bacteria 516
525 Ga0495618_0023400 3300046514 Bacteria 3819
526 Ga0495618_0084700 3300046514 Bacteria 2025
527 Ga0495618_0312456 3300046514 Bacteria 975
528 Ga0495618_0344111 3300046514 Bacteria 920
529 Ga0495628_0043079 3300046516 Bacteria 3597
530 Ga0495628_0204869 3300046516 Bacteria 1485
531 Ga0495628_0553700 3300046516 Bacteria 825
532 Ga0495630_0105898 3300046517 Bacteria 2129
533 Ga0495630_0154289 3300046517 Bacteria 1748
534 Ga0495652_0064640 3300046529 Bacteria 3076
535 Ga0495652_0081261 3300046529 Bacteria 2673
536 Ga0495652_0118245 3300046529 Bacteria 2118
537 Ga0495652_0218915 3300046529 Bacteria 1432
538 Ga0495665_0002498 3300046531 Bacteria 9931
539 Ga0495640_0035860 3300046533 Bacteria 3508
540 Ga0495640_0056941 3300046533 Bacteria 2669
541 Ga0495586_0016308 3300046535 Bacteria 3951
542 Ga0495586_0338545 3300046535 Bacteria 863
543 Ga0495587_0017039 3300046536 Bacteria 4518
544 Ga0495587_0018416 3300046536 Bacteria 4330
545 Ga0495645_0016012 3300046543 Bacteria 5345
546 Ga0495645_0032269 3300046543 Bacteria 3819
547 Ga0495645_0262589 3300046543 Bacteria 1142
548 Ga0495645_0309807 3300046543 Bacteria 1028
549 Ga0495667_0085388 3300046559 Bacteria 2048
550 Ga0495667_0100396 3300046559 Bacteria 1872
551 Ga0495667_0734107 3300046559 Bacteria 611
552 Ga0495634_0023065 3300046642 Bacteria 4380
553 Ga0495634_0032828 3300046642 Bacteria 3567
554 Ga0495634_0408637 3300046642 Bacteria 805
555 Ga0495635_0109034 3300046663 Bacteria 1891
556 Ga0495635_0109883 3300046663 Bacteria 1883
557 Ga0495635_0339409 3300046663 Bacteria 1003
558 Ga0495657_0077376 3300046675 Bacteria 2158
559 Ga0495657_0277550 3300046675 Bacteria 1003
560 Ga0495599_0020613 3300046678 Bacteria 4106
561 Ga0495599_0100198 3300046678 Bacteria 1806
562 Ga0495599_0188802 3300046678 Bacteria 1268
563 Ga0495623_0026198 3300046679 Bacteria 3754
564 Ga0495623_0263934 3300046679 Bacteria 963
565 Ga0495623_0690379 3300046679 Bacteria 523
566 Ga0495646_0032300 3300046680 Bacteria 3257
567 Ga0495646_0059914 3300046680 Bacteria 2272
568 Ga0495646_0070040 3300046680 Bacteria 2067
569 Ga0495647_0228445 3300046681 Bacteria 823
570 Ga0495658_0228531 3300046683 Bacteria 1166
571 Ga0495613_0036340 3300046689 Bacteria 3652
572 Ga0495613_0270757 3300046689 Bacteria 1181
573 Ga0495613_0896495 3300046689 Bacteria 574
574 Ga0495624_0012809 3300046690 Bacteria 5726
575 Ga0495624_0159314 3300046690 Bacteria 1379
576 Ga0495600_0025933 3300046809 Bacteria 3780
577 Ga0495600_0099213 3300046809 Bacteria 1898
578 Ga0495581_0238045 3300047315 Bacteria 1064
579 Ga0495604_0035140 3300047317 Bacteria 3959
580 Ga0495604_0112960 3300047317 Bacteria 1978
581 Ga0495674_0004732 3300047319 Bacteria 13086
582 Ga0495674_0081255 3300047319 Bacteria 2780
583 Ga0495674_0261645 3300047319 Bacteria 1421
584 Ga0495674_0351469 3300047319 Bacteria 1196
585 Ga0495676_0669287 3300047321 Bacteria 673
586 Ga0495680_0041303 3300047322 Bacteria 3669
587 Ga0495680_0110029 3300047322 Bacteria 2042
588 Ga0495675_0006997 3300047444 Bacteria 6937
589 Ga0495675_0197701 3300047444 Bacteria 1225
590 Ga0495684_0012576 3300047471 Bacteria 6525
591 Ga0495684_0135854 3300047471 Bacteria 1845
592 Ga0495684_0834891 3300047471 Bacteria 599
593 Ga0495593_0003359 3300047673 Bacteria 9588
594 Ga0495602_0051535 3300048088 Bacteria 3664
595 Ga0495602_0083088 3300048088 Bacteria 2684
596 Ga0495614_0055607 3300048089 Bacteria 1697
597 Ga0495626_0326509 3300048091 Bacteria 602
598 Ga0496100_0145161 3300048903 Bacteria 1686
599 Ga0496100_1363518 3300048903 Bacteria 560
600 Ga0496101_0651592 3300048904 Bacteria 832
601 Ga0496102_0343276 3300048905 Bacteria 1406
602 Ga0496102_0688843 3300048905 Bacteria 945
603 Ga0496102_0837918 3300048905 Bacteria 842
604 Ga0496102_1310117 3300048905 Bacteria 643
605 Ga0496103_0374319 3300048906 Bacteria 915
606 Ga0496103_0521266 3300048906 Bacteria 760
607 Ga0496104_0650210 3300048907 Bacteria 963
608 Ga0496105_0324973 3300048908 Bacteria 1232
609 Ga0496105_1176060 3300048908 Bacteria 566
610 Ga0496105_1334430 3300048908 Bacteria 522
611 Ga0496106_0187119 3300048909 Bacteria 1645
612 Ga0496106_0213495 3300048909 Bacteria 1538
613 Ga0496107_0689378 3300048910 Bacteria 752
614 Ga0496108_0551728 3300048911 Bacteria 1005
615 Ga0496110_0121482 3300048913 Bacteria 2354
616 Ga0496110_0134485 3300048913 Bacteria 2234
617 Ga0496110_0206423 3300048913 Bacteria 1786
618 Ga0496110_0340265 3300048913 Bacteria 1367
619 Ga0496110_0885067 3300048913 Bacteria 799
620 Ga0496111_0070579 3300048914 Bacteria 2541
621 Ga0496111_0174698 3300048914 Bacteria 1597
622 Ga0496111_1000147 3300048914 Bacteria 599
623 Ga0496113_0107905 3300048916 Bacteria 2164
624 Ga0496113_0716443 3300048916 Bacteria 798
625 Ga0496114_0618380 3300048917 Bacteria 954
626 Ga0496114_1009257 3300048917 Bacteria 715
627 Ga0496117_0001213 3300048920 Bacteria 38688
628 Ga0496118_0053715 3300048921 Bacteria 3059
629 Ga0496122_0209595 3300048925 Bacteria 1130
630 Ga0496125_0087520 3300048928 Bacteria 2352
631 Ga0496125_0127555 3300048928 Bacteria 1799
632 Ga0496126_0920867 3300048929 Bacteria 661
633 Ga0501306_052741 3300049127 Bacteria 655
634 Ga0501308_010519 3300049128 Bacteria 1029
635 Ga0501308_030298 3300049128 Bacteria 723
636 Ga0501309_017765 3300049129 Bacteria 978
637 Ga0501309_047415 3300049129 Bacteria 669
638 Ga0501310_026801 3300049130 Bacteria 748
639 Ga0501304_015101 3300049160 Bacteria 721
640 Ga0501304_018274 3300049160 Bacteria 676
641 Ga0501305_014124 3300049161 Bacteria 1114
642 Ga0501305_072459 3300049161 Bacteria 608
643 Ga0501307_014251 3300049162 Bacteria 969
644 Ga0501307_021101 3300049162 Bacteria 848
645 Ga0501307_043302 3300049162 Bacteria 659
646 Ga0501311_004883 3300049527 Bacteria 1445
647 Ga0501311_063751 3300049527 Bacteria 600
648 Ga0501312_050537 3300049528 Bacteria 700
649 Ga0501314_010936 3300049530 Bacteria 851
650 Ga0501315_092919 3300049531 Bacteria 525
651 Ga0501316_019558 3300049532 Bacteria 844
652 Ga0501316_044260 3300049532 Bacteria 628
653 Ga0501316_052415 3300049532 Bacteria 590
654 Ga0501317_001780 3300049533 Bacteria 1929
655 Ga0501317_016421 3300049533 Bacteria 960
656 Ga0501317_023313 3300049533 Bacteria 854
657 Ga0501317_083741 3300049533 Bacteria 555
658 Ga0501317_108746 3300049533 Bacteria 507
659 Ga0501318_003688 3300049534 Bacteria 1422
660 Ga0501318_008212 3300049534 Bacteria 1110
661 Ga0501318_020851 3300049534 Bacteria 828
662 Ga0501319_006313 3300049535 Bacteria 871
663 Ga0501321_034590 3300049537 Bacteria 689
664 Ga0501321_059952 3300049537 Bacteria 573
665 Ga0501031_0013583 3300049568 Bacteria 5306
666 Ga0501031_0707695 3300049568 Bacteria 647
667 Ga0501031_0766955 3300049568 Bacteria 619
668 Ga0501032_0034305 3300049569 Bacteria 3474
669 Ga0501032_0948106 3300049569 Bacteria 541
670 Ga0501034_0007846 3300049571 Bacteria 11350
671 Ga0501034_0024571 3300049571 Bacteria 6129
672 Ga0501034_0221645 3300049571 Bacteria 1843
673 Ga0501036_0005719 3300049572 Bacteria 10083
674 Ga0501036_0024426 3300049572 Bacteria 5095
675 Ga0501036_0082908 3300049572 Bacteria 2710
676 Ga0501036_0194341 3300049572 Bacteria 1707
677 Ga0501036_0217929 3300049572 Bacteria 1603
678 Ga0501036_0900257 3300049572 Bacteria 726
679 Ga0501037_0073148 3300049573 Bacteria 2492
680 Ga0501037_0886580 3300049573 Bacteria 585
681 Ga0501037_1090038 3300049573 Bacteria 517
682 Ga0501038_0108982 3300049574 Bacteria 2295
683 Ga0501038_0306943 3300049574 Bacteria 1244
684 Ga0501038_0974891 3300049574 Bacteria 623
685 Ga0501039_0157934 3300049575 Bacteria 1782
686 Ga0501039_0267353 3300049575 Bacteria 1344
687 Ga0501039_0269446 3300049575 Bacteria 1338
688 Ga0501039_0478550 3300049575 Bacteria 978
689 Ga0501039_0844877 3300049575 Bacteria 713
690 Ga0501039_0965891 3300049575 Bacteria 662
691 Ga0501040_0255926 3300049576 Bacteria 1249
692 Ga0501041_0270546 3300049577 Bacteria 1069
693 Ga0501042_0017142 3300049578 Bacteria 4991
694 Ga0501042_0121019 3300049578 Bacteria 1884
695 Ga0501043_0001003 3300049579 Bacteria 24826
696 Ga0501043_0063653 3300049579 Bacteria 2896
697 Ga0501046_0036030 3300049580 Bacteria 3983
698 Ga0501047_0076835 3300049581 Bacteria 3213
699 Ga0501047_0224290 3300049581 Bacteria 1735
700 Ga0501047_0622968 3300049581 Bacteria 899
701 Ga0501048_0039775 3300049582 Bacteria 3371
702 Ga0501048_0044178 3300049582 Bacteria 3187
703 Ga0501048_0731695 3300049582 Bacteria 710
704 Ga0501067_0006208 3300049583 Bacteria 6623
705 Ga0501067_0035981 3300049583 Bacteria 2750
706 Ga0501067_0057274 3300049583 Bacteria 2158
707 Ga0501068_0051437 3300049584 Bacteria 2492
708 Ga0501068_0419598 3300049584 Bacteria 864
709 Ga0501069_0187454 3300049585 Bacteria 1196
710 Ga0501070_0016253 3300049586 Bacteria 6253
711 Ga0501071_0126727 3300049587 Bacteria 1895
712 Ga0501072_0009141 3300049588 Bacteria 7525
713 Ga0501072_0016257 3300049588 Bacteria 5709
714 Ga0501072_0516581 3300049588 Bacteria 944
715 Ga0501073_0031933 3300049589 Bacteria 3756
716 Ga0501073_0139517 3300049589 Bacteria 1680
717 Ga0501074_0000822 3300049590 Bacteria 19680
718 Ga0501075_0129407 3300049591 Bacteria 1923
719 Ga0501075_0255137 3300049591 Bacteria 1337
720 Ga0501075_0603191 3300049591 Bacteria 837
721 Ga0501076_0423836 3300049592 Bacteria 1095
722 Ga0501077_0020512 3300049593 Bacteria 4184
723 Ga0501079_0094456 3300049741 Bacteria 2317
724 Ga0501079_0343605 3300049741 Bacteria 1169
725 Ga0501080_0009070 3300049742 Bacteria 9052
726 Ga0501080_0583773 3300049742 Bacteria 993
727 Ga0501083_0016418 3300049744 Bacteria 5182
728 Ga0501266_099300 3300049763 Bacteria 515
729 Ga0501035_0111400 3300049822 Bacteria 2398
730 Ga0501035_0550660 3300049822 Bacteria 945
731 Ga0501035_0749471 3300049822 Bacteria 784
732 Ga0501044_0051399 3300049823 Bacteria 4249
733 Ga0501044_1079946 3300049823 Bacteria 672
734 Ga0501044_1620796 3300049823 Bacteria 512
735 Ga0501045_0073178 3300049824 Bacteria 2523
736 Ga0501045_0306639 3300049824 Bacteria 1182
737 nmdc:mga00v17_288115_c1 3300050491 Bacteria 610
738 nmdc:mga00v17_470356_c1 3300050491 Bacteria 816
739 nmdc:mga0yw44_103683_c1 3300050492 Bacteria 1814
740 nmdc:mga0yw44_350502_c1 3300050492 Bacteria 994
741 nmdc:mga0yw44_752359_c1 3300050492 Bacteria 662
742 nmdc:mga05p37_73124_c1 3300050507 Bacteria 4219
743 nmdc:mga09592_6091_c1 3300050508 Bacteria 9825
744 nmdc:mga0qj67_336796_c1 3300050509 Bacteria 1221
745 nmdc:mga06r32_83809_c1 3300050510 Bacteria 3107
746 nmdc:mga08y16_1860304_c1 3300050511 Bacteria 554
747 nmdc:mga08y16_546023_c1 3300050511 Bacteria 1173
748 nmdc:mga0n895_630697_c1 3300050512 Bacteria 1072
749 nmdc:mga0rr50_1486583_c1 3300050513 Bacteria 573
750 Ga0495601_0035666 3300053077 Bacteria 3105
751 Ga0495601_0106410 3300053077 Bacteria 1814
752 Ga0495601_0191331 3300053077 Bacteria 1337
753 Ga0495601_0618229 3300053077 Bacteria 694
754 Ga0495612_0034757 3300053078 Bacteria 2041
755 Ga0495612_0082099 3300053078 Bacteria 1355
756 Ga0495612_0153051 3300053078 Bacteria 1004
757 Ga0495612_0168598 3300053078 Bacteria 958
758 Ga0495655_0099469 3300053083 Bacteria 859
759 Ga0495595_0040856 3300053084 Bacteria 2120
760 Ga0495595_0148058 3300053084 Bacteria 1154
761 Ga0495619_0017367 3300053085 Bacteria 4556
762 Ga0500566_0216023 3300053094 Bacteria 957
763 Ga0500620_300858 3300053155 Bacteria 520
764 Ga0500656_016060 3300053732 Bacteria 883
765 Ga0501084_0381225 3300054114 Bacteria 1191
766 Ga0501084_0482293 3300054114 Bacteria 1048
767 Ga0501084_1649144 3300054114 Bacteria 536
768 Ga0587073_0209865 3300059492 Bacteria 589
769 Ga0587080_027090 3300059503 Bacteria 977
770 Ga0587080_065085 3300059503 Bacteria 718
771 Ga0587085_065833 3300059506 Bacteria 697
772 Ga0587090_082012 3300059510 Bacteria 648
773 Ga0587125_025058 3300059607 Bacteria 730
774 Ga0587113_006243 3300059625 Bacteria 1008
775 Ga0587115_035424 3300059626 Bacteria 759
776 Ga0587062_127378 3300059639 Bacteria 520
777 Ga0587067_048821 3300059640 Bacteria 849
778 Ga0587067_070194 3300059640 Bacteria 754
779 Ga0587067_120993 3300059640 Bacteria 628
780 Ga0587072_197288 3300059643 Bacteria 510
781 Ga0587102_019822 3300059649 Bacteria 751
782 Ga0587114_028412 3300059655 Bacteria 839
783 Ga0587114_091675 3300059655 Bacteria 580
784 Ga0587116_10717 3300059656 Bacteria 618
785 Ga0587119_032663 3300059658 Bacteria 718
786 Ga0587111_0214419 3300060346 Bacteria 553
787 Ga0501082_0008677 3300060353 Bacteria 8764
788 Ga0466962_0003191 3300061719 Bacteria 7789
789 Ga0530510_0078800 3300061734 Bacteria 2396
790 2547412829 2547132111 Bacteria 8013147
791 2554258608 2554235005 Bacteria 6457341
792 2555230040 2554235227 Bacteria 3637389
793 2585319440 2582581314 Bacteria 11452267
794 2643759745 2643221548 Bacteria 8053412
795 2643767741 2643221549 Bacteria 4042819
796 2643944688 2643221587 Bacteria 7586415
797 2644033982 2643221604 Bacteria 5014917
798 2644102714 2643221617 Bacteria 5139111
799 2644111116 2643221619 Bacteria 4158469
800 2644118376 2643221620 Bacteria 5134593
801 2644231320 2643221641 Bacteria 4490190
802 2644269242 2643221647 Bacteria 10741251
803 2644431586 2643221677 Bacteria 7584031
804 2644462838 2643221682 Bacteria 6743283
805 2644625780 2643221714 Bacteria 9015452
806 2655032757 2654587600 Bacteria 3911798
807 2723642061 2721755702 Bacteria 4373124
808 2738871572 2738541305 Bacteria 4910150
809 2740166648 2739367898 Bacteria 4367674
810 2776376159 2775506925 Bacteria 7237746
811 2784587856 2784132148 Bacteria 8627943
812 2808902040 2808606372 Bacteria 4649509
813 2808919772 2808606375 Bacteria 9466072
814 2809231441 2808606448 Bacteria 8656184
815 2812333967 2811994874 Bacteria 5367947
816 2812358997 2811994879 Bacteria 9313447
817 2812481244 2811994917 Bacteria 7761064
818 2819693685 2818991463 Bacteria 7948711
819 2852641260 2852635781 Bacteria 8251373
820 2862389462 2862382967 Bacteria 10317375
821 2862509479 2862507626 Bacteria 9425308
822 2862580010 2862574272 Bacteria 10567477
823 2862995753 2862993130 Bacteria 3860849
824 2863068533 2863067949 Bacteria 8541735
825 2863405543 2863404153 Bacteria 9672205
826 2866556103 2866552031 Bacteria 5824618
827 2867371087 2867369537 Bacteria 6501581
828 2912725026 2912723979 Bacteria 8557534
829 2917737239 2917736166 Bacteria 9690793
830 2918503813 2918501144 Bacteria 8668083
831 2919446189 2919443155 Bacteria 4072969
832 2932398609 2932398195 Bacteria 3847976
833 2935392269 2935390628 Bacteria 7043367
834 2935411411 2935409751 Bacteria 4179611
835 2946033553 2946033335 Bacteria 3835514
836 2946066880 2946064051 Bacteria 8957905
837 2946075202 2946072368 Bacteria 8999607
838 2947230349 2947224130 Bacteria 9938529
839 2954387076 2954380949 Bacteria 10050426
840 2954697912 2954691527 Bacteria 10720516
841 2954704304 2954701450 Bacteria 10834262
842 2966603301 2966598605 Bacteria 7676064
843 2977253822 2977251589 Bacteria 2952848
844 2997608174 2997600082 Bacteria 9896405
845 3006486418 3006486233 Bacteria 8157040
846 3006500963 3006493962 Bacteria 8825450
847 8003318385 8003314358 Bacteria 10575343
848 8008559533 8008558824 Bacteria 10610750
849 8008579622 8008574985 Bacteria 7815457
850 8023630850 8023623736 Bacteria 8593882
851 8025479192 8025478263 Bacteria 8209203
852 8025535129 8025530807 Bacteria 8495698
853 8046356409 8046352972 Bacteria 3613806
854 8055035792 8055034563 Bacteria 3562128
855 8056215721 8056207758 Bacteria 8639239
856 8056673156 8056667051 Bacteria 6953971
857 8056835973 8056829672 Bacteria 9045328
858 Ga0111539_10939638
859 LJNas_1022272
860 JGI24739J22299_10080331
861 JGI24743J22301_10015968
862 JGI24749J21850_1018395
863 JGI24744J21845_10005638
864 JGI24742J22300_10073995
865 Ga0006778J45830_1018265
866 Ga0006778J45830_1020392
867 Ga0006759J45824_1015951
868 Ga0006759J45824_1023826
869 Ga0006759J45824_1036218
870 Ga0006777J48905_1023427
871 Ga0007417J51691_1019609
872 Ga0007427J51700_113809
873 Ga0007427J51700_114899
874 Ga0006781J51513_1014045
875 Ga0006781J51513_1016819
876 Ga0006781J51513_1020798
877 Ga0007410J51695_1017596
878 Ga0007410J51695_1019037
879 Ga0007410J51695_1035339
880 Ga0007409J51694_1026545
881 Ga0007416J51690_1014631
882 Ga0007416J51690_1020621
883 Ga0007416J51690_1032371
884 Ga0007429J51699_1030546
885 Ga0007429J51699_1030653
886 Ga0007429J51699_1062306
887 Ga0007411J51799_113730
888 Ga0032354_1016877
889 Ga0032354_1025855
890 Ga0006780_1010384
891 JGI25405J52794_10022894
892 Ga0058859_10043592
893 Ga0058859_10073273
894 Ga0058861_10189803
895 Ga0058860_12181988
896 Ga0070676_10999377
897 Ga0070683_100589444
898 Ga0070683_102353903
899 Ga0070690_100439835
900 Ga0070670_100143399
901 Ga0068869_100486752
902 Ga0070680_100715629
903 Ga0070680_100852140
904 Ga0070682_100043086
905 Ga0070682_100892715
906 Ga0070682_101173651
907 Ga0070660_100248311
908 Ga0070660_100340074
909 Ga0070660_100885242
910 Ga0070689_100138643
911 Ga0070689_100696527
912 Ga0070691_10706932
913 Ga0070687_100136198
914 Ga0070687_100204453
915 Ga0070661_100448082
916 Ga0070692_10031106
917 Ga0070668_100004599
918 Ga0070668_100047826
919 Ga0070668_100228974
920 Ga0070668_101347081
921 Ga0070668_101403532
922 Ga0070669_100218024
923 Ga0070669_100641499
924 Ga0070669_100676686
925 Ga0070675_100013757
926 Ga0070675_101170109
927 Ga0070674_100720271
928 Ga0070674_100919961
929 Ga0070673_100157320
930 Ga0070688_100588015
931 Ga0070703_10235413
932 Ga0070709_10010163
933 Ga0070709_10267953
934 Ga0070709_10773837
935 Ga0070714_100146697
936 Ga0070714_100579236
937 Ga0070714_101139606
938 Ga0070713_100077998
939 Ga0070713_100114480
940 Ga0070713_100150891
941 Ga0070713_100347033
942 Ga0070713_100648289
943 Ga0070713_101398349
944 Ga0070710_10007895
945 Ga0070710_10045918
946 Ga0070710_10896809
947 Ga0070701_10127169
948 Ga0070711_100012615
949 Ga0070711_100028374
950 Ga0070711_100033920
951 Ga0070700_100002680
952 Ga0070700_100218280
953 Ga0070700_100564037
954 Ga0070708_100219439
955 Ga0070663_100017492
956 Ga0070662_101183912
957 Ga0070662_101544633
958 Ga0070681_10258947
959 Ga0068867_100028590
960 Ga0068867_100793556
961 Ga0068867_102211423
962 Ga0070706_100074872
963 Ga0070707_100155245
964 Ga0070698_100010328
965 Ga0070698_100019873
966 Ga0070699_101979038
967 Ga0070679_100070729
968 Ga0070679_100152808
969 Ga0070684_101153546
970 Ga0070684_102066870
971 Ga0070665_101199189
972 Ga0070665_102539765
973 Ga0068857_100326556
974 Ga0068857_100331933
975 Ga0068854_100123509
976 Ga0068854_100698775
977 Ga0068854_101343022
978 Ga0070702_100027149
979 Ga0070702_100206611
980 Ga0070702_100745168
981 Ga0068864_100597151
982 Ga0068866_10024414
983 Ga0068866_10489240
984 Ga0068861_100049241
985 Ga0068870_10157487
986 Ga0068863_100204715
987 Ga0081455_10000265
988 Ga0070717_10019007
989 Ga0070717_10049256
990 Ga0070717_10079305
991 Ga0070717_10282871
992 Ga0070717_10352794
993 Ga0070717_10946358
994 Ga0070717_11270400
995 Ga0075365_10155186
996 Ga0075365_10449884
997 Ga0075363_100729460
998 Ga0075364_11239036
999 Ga0070715_10029242
1000 Ga0070715_10034360
1001 Ga0070715_10047983
1002 Ga0070716_100001600
1003 Ga0070716_100005302
1004 Ga0070716_100011149
1005 Ga0070716_101556895
1006 Ga0070712_100002852
1007 Ga0070712_100106522
1008 Ga0070712_100790590
1009 Ga0070712_101954231
1010 Ga0097621_100798618
1011 Ga0075428_100005329
1012 Ga0075430_100012185
1013 Ga0075431_100010203
1014 Ga0075434_100766287
1015 Ga0075429_100006028
1016 Ga0075435_100483640
1017 Ga0099795_10170894
1018 Ga0105240_10057388
1019 Ga0111539_11407616
1020 Ga0111539_11943941
1021 Ga0105245_11482852
1022 Ga0114129_10009476
1023 Ga0114129_12240621
1024 Ga0105243_10007573
1025 Ga0105243_12191475
1026 Ga0105243_12204454
1027 Ga0105242_10473167
1028 Ga0105248_10051414
1029 Ga0105248_10768926
1030 Ga0105248_12556089
1031 Ga0105237_10015942
1032 Ga0105237_10842732
1033 Ga0105238_10775918
1034 Ga0105238_10835635
1035 Ga0105238_11016878
1036 Ga0105238_12615956
1037 Ga0105249_10622017
1038 Ga0105249_11484142
1039 Ga0105249_11898512
1040 Ga0105239_10626720
1041 Ga0105246_10740309
1042 Ga0157319_1055919
1043 Ga0157326_1039684
1044 Ga0154016_110258
1045 Ga0154012_122270
1046 Ga0154010_156824
1047 Ga0157369_10448910
1048 Ga0157369_12203893
1049 Ga0157374_11105710
1050 Ga0157372_10164221
1051 Ga0157372_11313083
1052 Ga0157372_12880682
1053 Ga0157375_10970590
1054 Ga0157380_10088956
1055 Ga0157380_11430486
1056 Ga0157380_11985446
1057 Ga0157380_12004527
1058 Ga0157377_10011946
1059 Ga0163161_10757275
1060 Ga0163161_11096243
1061 Ga0184603_130492
1062 Ga0197907_10568407
1063 Ga0197907_10572481
1064 Ga0197907_10694247
1065 Ga0197907_11394387
1066 Ga0206356_10277914
1067 Ga0206356_10389405
1068 Ga0206356_11200626
1069 Ga0206356_11428661
1070 Ga0206356_11480230
1071 Ga0206356_11856534
1072 Ga0206356_11868628
1073 Ga0206355_1519922
1074 Ga0206355_1520700
1075 Ga0206351_10118108
1076 Ga0206351_10394707
1077 Ga0206351_10803575
1078 Ga0206352_10043045
1079 Ga0206352_10146681
1080 Ga0206352_10577646
1081 Ga0206352_11000860
1082 Ga0206352_11359334
1083 Ga0206350_10905434
1084 Ga0206350_11053269
1085 Ga0206354_10246573
1086 Ga0206354_10411107
1087 Ga0206354_10655668
1088 Ga0206354_10932283
1089 Ga0206354_11131545
1090 Ga0206354_11187521
1091 Ga0206354_11249330
1092 Ga0206354_11251534
1093 Ga0206353_10233523
1094 Ga0206353_10367492
1095 Ga0206353_10783395
1096 Ga0206353_11549377
1097 Ga0154015_1062931
1098 Ga0154015_1335319
1099 Ga0154015_1575133
1100 Ga0213875_10032580
1101 Ga0224712_10200121
1102 Ga0224712_10304929
1103 Ga0224712_10374403
1104 Ga0224712_10417473
1105 Ga0247530_109342
1106 Ga0247525_117656
1107 Ga0207697_10144315
1108 Ga0207682_10186304
1109 Ga0207692_10003732
1110 Ga0207642_10120760
1111 Ga0207642_10496207
1112 Ga0207647_10652997
1113 Ga0207685_10026795
1114 Ga0207685_10157332
1115 Ga0207699_10002082
1116 Ga0207699_10003711
1117 Ga0207699_10270561
1118 Ga0207645_10921969
1119 Ga0207643_10005670
1120 Ga0207643_10103732
1121 Ga0207643_10161524
1122 Ga0207705_10957234
1123 Ga0207684_10002608
1124 Ga0207684_10071279
1125 Ga0207684_10543962
1126 Ga0207695_10098937
1127 Ga0207695_11261825
1128 Ga0207693_10006593
1129 Ga0207693_10075654
1130 Ga0207693_10096788
1131 Ga0207693_10952831
1132 Ga0207663_10004640
1133 Ga0207663_10105924
1134 Ga0207663_10132053
1135 Ga0207662_10112943
1136 Ga0207662_10428888
1137 Ga0207657_10340810
1138 Ga0207657_10799731
1139 Ga0207649_10091185
1140 Ga0207652_10038138
1141 Ga0207652_10312713
1142 Ga0207652_10531136
1143 Ga0207646_10171049
1144 Ga0207646_11071107
1145 Ga0207681_10124643
1146 Ga0207681_10625263
1147 Ga0207681_10670929
1148 Ga0207694_10634590
1149 Ga0207659_10112118
1150 Ga0207659_10843135
1151 Ga0207700_10000909
1152 Ga0207700_10029664
1153 Ga0207700_10096904
1154 Ga0207700_10112744
1155 Ga0207700_10281305
1156 Ga0207700_10397382
1157 Ga0207700_10668111
1158 Ga0207664_10000622
1159 Ga0207664_10000671
1160 Ga0207664_10012086
1161 Ga0207664_10020262
1162 Ga0207664_10053975
1163 Ga0207664_10328067
1164 Ga0207686_10436054
1165 Ga0207686_11555667
1166 Ga0207709_10025971
1167 Ga0207709_10101340
1168 Ga0207709_10251118
1169 Ga0207709_10924824
1170 Ga0207669_10469336
1171 Ga0207665_10000232
1172 Ga0207665_10008290
1173 Ga0207665_10065399
1174 Ga0207691_11158212
1175 Ga0207689_10108803
1176 Ga0207689_10543183
1177 Ga0207651_10138952
1178 Ga0207712_10439754
1179 Ga0207668_10021076
1180 Ga0207668_10099374
1181 Ga0207668_10490260
1182 Ga0207640_10978167
1183 Ga0207677_10412110
1184 Ga0207678_10006707
1185 Ga0207708_10004020
1186 Ga0207708_10027251
1187 Ga0207708_10576171
1188 Ga0207708_10717183
1189 Ga0207702_10015640
1190 Ga0207641_10115185
1191 Ga0207648_10001192
1192 Ga0207674_10188721
1193 Ga0207674_10213466
1194 Ga0207674_10582889
1195 Ga0207675_100012420
1196 Ga0207675_100215500
1197 Ga0207683_11756488
1198 Ga0268266_11088506
1199 Ga0265337_1001546
1200 Ga0265326_10002216
1201 Ga0265319_1009142
1202 Ga0265334_10000780
1203 Ga0265318_10022733
1204 Ga0265323_10002253
1205 Ga0265322_10010699
1206 Ga0265336_10022867
1207 Ga0307515_10120537
1208 Ga0265338_10009988
1209 Ga0265338_10075656
1210 Ga0265324_10001086
1211 Ga0265762_1036640
1212 Ga0265775_104224
1213 Ga0265763_1004177
1214 Ga0265766_1006307
1215 Ga0265764_102320
1216 Ga0265332_10045591
1217 Ga0265320_10087493
1218 Ga0265325_10166133
1219 Ga0265329_10346953
1220 Ga0265340_10165087
1221 Ga0265339_10110382
1222 Ga0265316_10121768
1223 Ga0307509_10134180
1224 Ga0265313_10015626
1225 Ga0307514_10283075
1226 Ga0307514_10520198
1227 Ga0265314_10003310
1228 Ga0265342_10006114
1229 Ga0316576_10560432
1230 Ga0307405_10561358
1231 Ga0307405_11258705
1232 Ga0307405_12149548
1233 Ga0307413_10039727
1234 Ga0307413_10089243
1235 Ga0307413_10159390
1236 Ga0307413_10192110
1237 Ga0307518_10302563
1238 Ga0307410_10233530
1239 Ga0307410_10330293
1240 Ga0326468_10070179
1241 Ga0307406_10477228
1242 Ga0307407_11617555
1243 Ga0307412_10012620
1244 Ga0307412_10263817
1245 Ga0307412_11401593
1246 Ga0307409_100021674
1247 Ga0307409_100172825
1248 Ga0307409_100469367
1249 Ga0307409_100505213
1250 Ga0307409_100831266
1251 Ga0307409_101842264
1252 Ga0307409_102665968
1253 Ga0307416_100344642
1254 Ga0307416_100435134
1255 Ga0307414_10168544
1256 Ga0307411_10085296
1257 Ga0307411_10169423
1258 Ga0307411_10665834
1259 Ga0307411_10835803
1260 Ga0307415_100166867
1261 Ga0307415_100462776
1262 Ga0373938_0147656
1263 Ga0373926_0266629
1264 Ga0373934_0007152
1265 Ga0373934_0040361
1266 Ga0373923_0006371
1267 Ga0373923_0016194
1268 Ga0373932_0232309
1269 Ga0373936_0065388
1270 Ga0373936_0343779
1271 Ga0373945_0177378
1272 Ga0373953_0003409
1273 Ga0373953_0104066
1274 Ga0373954_0049831
1275 Ga0373954_0138722
1276 Ga0373956_0010222
1277 Ga0373956_0217595
1278 Ga0373957_0001643
1279 Ga0373957_0030212
1280 Ga0373943_0395216
1281 Ga0373946_0435539
1282 Ga0373955_0016008
1283 Ga0373955_0021208
1284 Ga0373955_0142953
1285 Ga0373924_0001917
1286 Ga0373924_0287092
1287 Ga0373924_0374250
1288 Ga0373931_0466987
1289 Ga0373935_0036624
1290 Ga0373935_0916151
1291 Ga0373927_0556356
1292 Ga0373927_0659665
1293 Ga0373933_0016313
1294 Ga0373933_0078117
1295 Ga0373933_0579531
1296 Ga0373937_0180417
1297 Ga0373937_0223270
1298 Ga0265778_054023
1299 Ga0373925_0018032
1300 Ga0373925_0149335
1301 Ga0373925_0208714
1302 Ga0373925_0285353
1303 Ga0373925_0399252
1304 Ga0395900_0057814
1305 Ga0395900_0069154
1306 Ga0395900_0103132
1307 Ga0395900_1419785
1308 Ga0395900_1736200
1309 Ga0395898_1552188
1310 Ga0436364_0472656
1311 Ga0436364_0475919
1312 Ga0436364_1546886
1313 Ga0395901_0687687
1314 Ga0395901_1064334
1315 Ga0395901_1575921
1316 Ga0436365_1010234
1317 Ga0436363_1376266
1318 Ga0436362_0022211
1319 Ga0439436_0102990
1320 Ga0439466_0240473
1321 Ga0439465_0183148
1322 Ga0451789_0497625
1323 Ga0451793_0975200
1324 Ga0451797_0322045
1325 Ga0451795_0841048
1326 Ga0451798_0873055
1327 Ga0451800_0077019
1328 Ga0451805_118500
1329 Ga0451839_0776345
1330 Ga0451841_0571275
1331 Ga0451845_0382547
1332 Ga0451846_30455
1333 Ga0451849_0761349
1334 Ga0451851_0000350
1335 Ga0439431_0078321
1336 Ga0439448_0142939
1337 Ga0450906_063596
1338 Ga0439434_0151695
1339 Ga0450918_015071
1340 Ga0466965_0007730
1341 Ga0466965_0126787
1342 Ga0466965_0129361
1343 Ga0466965_0419968
1344 Ga0466966_0014281
1345 Ga0466961_0798662
1346 Ga0466963_0080016
1347 Ga0466963_0415800
1348 Ga0466964_0591319
1349 Ga0453684_2004899
1350 Ga0466971_0058607
1351 Ga0466968_0057957
1352 Ga0466957_0488252
1353 Ga0466960_0066402
1354 Ga0466960_0218205
1355 Ga0466960_0348359
1356 Ga0466959_0064431
1357 Ga0466959_0603190
1358 Ga0466958_0193746
1359 Ga0466967_0097675
1360 Ga0466967_0159656
1361 Ga0466967_0446780
1362 Ga0466967_0560204
1363 Ga0495592_0014265
1364 Ga0495592_0099594
1365 Ga0495592_0264389
1366 Ga0495629_0035983
1367 Ga0495641_0213129
1368 Ga0495651_0071547
1369 Ga0495651_0165882
1370 Ga0495653_0033404
1371 Ga0495653_0117253
1372 Ga0495582_0010638
1373 Ga0495639_0014207
1374 Ga0495662_0018564
1375 Ga0495664_0086662
1376 Ga0495664_0186152
1377 Ga0495664_0228035
1378 Ga0495594_0283656
1379 Ga0495608_0031517
1380 Ga0495608_0186575
1381 Ga0495608_0905353
1382 Ga0495618_0023400
1383 Ga0495618_0084700
1384 Ga0495618_0312456
1385 Ga0495618_0344111
1386 Ga0495628_0043079
1387 Ga0495628_0204869
1388 Ga0495628_0553700
1389 Ga0495630_0105898
1390 Ga0495630_0154289
1391 Ga0495652_0064640
1392 Ga0495652_0081261
1393 Ga0495652_0118245
1394 Ga0495652_0218915
1395 Ga0495665_0002498
1396 Ga0495640_0035860
1397 Ga0495640_0056941
1398 Ga0495586_0016308
1399 Ga0495586_0338545
1400 Ga0495587_0017039
1401 Ga0495587_0018416
1402 Ga0495645_0016012
1403 Ga0495645_0032269
1404 Ga0495645_0262589
1405 Ga0495645_0309807
1406 Ga0495667_0085388
1407 Ga0495667_0100396
1408 Ga0495667_0734107
1409 Ga0495634_0023065
1410 Ga0495634_0032828
1411 Ga0495634_0408637
1412 Ga0495635_0109034
1413 Ga0495635_0109883
1414 Ga0495635_0339409
1415 Ga0495657_0077376
1416 Ga0495657_0277550
1417 Ga0495599_0020613
1418 Ga0495599_0100198
1419 Ga0495599_0188802
1420 Ga0495623_0026198
1421 Ga0495623_0263934
1422 Ga0495623_0690379
1423 Ga0495646_0032300
1424 Ga0495646_0059914
1425 Ga0495646_0070040
1426 Ga0495647_0228445
1427 Ga0495658_0228531
1428 Ga0495613_0036340
1429 Ga0495613_0270757
1430 Ga0495613_0896495
1431 Ga0495624_0012809
1432 Ga0495624_0159314
1433 Ga0495600_0025933
1434 Ga0495600_0099213
1435 Ga0495581_0238045
1436 Ga0495604_0035140
1437 Ga0495604_0112960
1438 Ga0495674_0004732
1439 Ga0495674_0081255
1440 Ga0495674_0261645
1441 Ga0495674_0351469
1442 Ga0495676_0669287
1443 Ga0495680_0041303
1444 Ga0495680_0110029
1445 Ga0495675_0006997
1446 Ga0495675_0197701
1447 Ga0495684_0012576
1448 Ga0495684_0135854
1449 Ga0495684_0834891
1450 Ga0495593_0003359
1451 Ga0495602_0051535
1452 Ga0495602_0083088
1453 Ga0495614_0055607
1454 Ga0495626_0326509
1455 Ga0496100_0145161
1456 Ga0496100_1363518
1457 Ga0496101_0651592
1458 Ga0496102_0343276
1459 Ga0496102_0688843
1460 Ga0496102_0837918
1461 Ga0496102_1310117
1462 Ga0496103_0374319
1463 Ga0496103_0521266
1464 Ga0496104_0650210
1465 Ga0496105_0324973
1466 Ga0496105_1176060
1467 Ga0496105_1334430
1468 Ga0496106_0187119
1469 Ga0496106_0213495
1470 Ga0496107_0689378
1471 Ga0496108_0551728
1472 Ga0496110_0121482
1473 Ga0496110_0134485
1474 Ga0496110_0206423
1475 Ga0496110_0340265
1476 Ga0496110_0885067
1477 Ga0496111_0070579
1478 Ga0496111_0174698
1479 Ga0496111_1000147
1480 Ga0496113_0107905
1481 Ga0496113_0716443
1482 Ga0496114_0618380
1483 Ga0496114_1009257
1484 Ga0496117_0001213
1485 Ga0496118_0053715
1486 Ga0496122_0209595
1487 Ga0496125_0087520
1488 Ga0496125_0127555
1489 Ga0496126_0920867
1490 Ga0501306_052741
1491 Ga0501308_010519
1492 Ga0501308_030298
1493 Ga0501309_017765
1494 Ga0501309_047415
1495 Ga0501310_026801
1496 Ga0501304_015101
1497 Ga0501304_018274
1498 Ga0501305_014124
1499 Ga0501305_072459
1500 Ga0501307_014251
1501 Ga0501307_021101
1502 Ga0501307_043302
1503 Ga0501311_004883
1504 Ga0501311_063751
1505 Ga0501312_050537
1506 Ga0501314_010936
1507 Ga0501315_092919
1508 Ga0501316_019558
1509 Ga0501316_044260
1510 Ga0501316_052415
1511 Ga0501317_001780
1512 Ga0501317_016421
1513 Ga0501317_023313
1514 Ga0501317_083741
1515 Ga0501317_108746
1516 Ga0501318_003688
1517 Ga0501318_008212
1518 Ga0501318_020851
1519 Ga0501319_006313
1520 Ga0501321_034590
1521 Ga0501321_059952
1522 Ga0501031_0013583
1523 Ga0501031_0707695
1524 Ga0501031_0766955
1525 Ga0501032_0034305
1526 Ga0501032_0948106
1527 Ga0501034_0007846
1528 Ga0501034_0024571
1529 Ga0501034_0221645
1530 Ga0501036_0005719
1531 Ga0501036_0024426
1532 Ga0501036_0082908
1533 Ga0501036_0194341
1534 Ga0501036_0217929
1535 Ga0501036_0900257
1536 Ga0501037_0073148
1537 Ga0501037_0886580
1538 Ga0501037_1090038
1539 Ga0501038_0108982
1540 Ga0501038_0306943
1541 Ga0501038_0974891
1542 Ga0501039_0157934
1543 Ga0501039_0267353
1544 Ga0501039_0269446
1545 Ga0501039_0478550
1546 Ga0501039_0844877
1547 Ga0501039_0965891
1548 Ga0501040_0255926
1549 Ga0501041_0270546
1550 Ga0501042_0017142
1551 Ga0501042_0121019
1552 Ga0501043_0001003
1553 Ga0501043_0063653
1554 Ga0501046_0036030
1555 Ga0501047_0076835
1556 Ga0501047_0224290
1557 Ga0501047_0622968
1558 Ga0501048_0039775
1559 Ga0501048_0044178
1560 Ga0501048_0731695
1561 Ga0501067_0006208
1562 Ga0501067_0035981
1563 Ga0501067_0057274
1564 Ga0501068_0051437
1565 Ga0501068_0419598
1566 Ga0501069_0187454
1567 Ga0501070_0016253
1568 Ga0501071_0126727
1569 Ga0501072_0009141
1570 Ga0501072_0016257
1571 Ga0501072_0516581
1572 Ga0501073_0031933
1573 Ga0501073_0139517
1574 Ga0501074_0000822
1575 Ga0501075_0129407
1576 Ga0501075_0255137
1577 Ga0501075_0603191
1578 Ga0501076_0423836
1579 Ga0501077_0020512
1580 Ga0501079_0094456
1581 Ga0501079_0343605
1582 Ga0501080_0009070
1583 Ga0501080_0583773
1584 Ga0501083_0016418
1585 Ga0501266_099300
1586 Ga0501035_0111400
1587 Ga0501035_0550660
1588 Ga0501035_0749471
1589 Ga0501044_0051399
1590 Ga0501044_1079946
1591 Ga0501044_1620796
1592 Ga0501045_0073178
1593 Ga0501045_0306639
1594 nmdc:mga00v17_288115_c1
1595 nmdc:mga00v17_470356_c1
1596 nmdc:mga0yw44_103683_c1
1597 nmdc:mga0yw44_350502_c1
1598 nmdc:mga0yw44_752359_c1
1599 nmdc:mga05p37_73124_c1
1600 nmdc:mga09592_6091_c1
1601 nmdc:mga0qj67_336796_c1
1602 nmdc:mga06r32_83809_c1
1603 nmdc:mga08y16_1860304_c1
1604 nmdc:mga08y16_546023_c1
1605 nmdc:mga0n895_630697_c1
1606 nmdc:mga0rr50_1486583_c1
1607 Ga0495601_0035666
1608 Ga0495601_0106410
1609 Ga0495601_0191331
1610 Ga0495601_0618229
1611 Ga0495612_0034757
1612 Ga0495612_0082099
1613 Ga0495612_0153051
1614 Ga0495612_0168598
1615 Ga0495655_0099469
1616 Ga0495595_0040856
1617 Ga0495595_0148058
1618 Ga0495619_0017367
1619 Ga0500566_0216023
1620 Ga0500620_300858
1621 Ga0500656_016060
1622 Ga0501084_0381225
1623 Ga0501084_0482293
1624 Ga0501084_1649144
1625 Ga0587073_0209865
1626 Ga0587080_027090
1627 Ga0587080_065085
1628 Ga0587085_065833
1629 Ga0587090_082012
1630 Ga0587125_025058
1631 Ga0587113_006243
1632 Ga0587115_035424
1633 Ga0587062_127378
1634 Ga0587067_048821
1635 Ga0587067_070194
1636 Ga0587067_120993
1637 Ga0587072_197288
1638 Ga0587102_019822
1639 Ga0587114_028412
1640 Ga0587114_091675
1641 Ga0587116_10717
1642 Ga0587119_032663
1643 Ga0587111_0214419
1644 Ga0501082_0008677
1645 Ga0466962_0003191
1646 Ga0530510_0078800
1647 2547412829
1648 2554258608
1649 2555230040
1650 2585319440
1651 2643759745
1652 2643767741
1653 2643944688
1654 2644033982
1655 2644102714
1656 2644111116
1657 2644118376
1658 2644231320
1659 2644269242
1660 2644431586
1661 2644462838
1662 2644625780
1663 2655032757
1664 2723642061
1665 2738871572
1666 2740166648
1667 2776376159
1668 2784587856
1669 2808902040
1670 2808919772
1671 2809231441
1672 2812333967
1673 2812358997
1674 2812481244
1675 2819693685
1676 2852641260
1677 2862389462
1678 2862509479
1679 2862580010
1680 2862995753
1681 2863068533
1682 2863405543
1683 2866556103
1684 2867371087
1685 2912725026
1686 2917737239
1687 2918503813
1688 2919446189
1689 2932398609
1690 2935392269
1691 2935411411
1692 2946033553
1693 2946066880
1694 2946075202
1695 2947230349
1696 2954387076
1697 2954697912
1698 2954704304
1699 2966603301
1700 2977253822
1701 2997608174
1702 3006486418
1703 3006500963
1704 8003318385
1705 8008559533
1706 8008579622
1707 8023630850
1708 8025479192
1709 8025535129
1710 8046356409
1711 8055035792
1712 8056215721
1713 8056673156
1714 8056835973

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

72

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9488 20 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9468 20 83
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.943 19 81
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9349 21 83
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9214 20 84
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9488 20 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9214 20 84 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9047 21 84 2.40.50.100
af_Q4DLT4_19_136_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.886 21 82 2.40.50.100
2ba1A01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8612 30 81 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7Y5TEY2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9875 21 81 GO:0003735
GO:0006412
GO:0022625
AF-A0A421K8E4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9775 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A847H8S3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.974 21 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A420Z9C1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9694 19 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A421K8E4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9628 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map