F483686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 857 | 486 | 1714 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10939638|Ga0111539_109396382 |
| Length | 80 |
| Sequence | MSKKKGAASSRNGRDSAAQRLGVKVHSIVRQRGTKFHPGKNVGRGNDDTLFALVAGIVKFEPKDKKRQKISVYPADAGDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 100 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 101 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 115 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 124 | 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 250 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 251 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 252 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 253 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 258 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 399 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 400 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 419 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 420 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 421 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 422 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 423 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 424 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 425 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 426 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 427 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 428 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 429 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 430 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 431 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 432 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 433 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 434 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 435 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 436 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 437 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 438 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 439 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 440 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 441 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 442 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 443 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 444 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 445 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 446 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 447 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 448 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 449 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 450 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 451 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 452 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 453 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 454 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 455 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 456 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 457 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 458 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 459 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 460 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 461 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 462 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 463 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 464 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 465 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 466 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 467 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 468 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 469 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 470 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 471 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 472 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 473 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 474 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 475 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 476 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 477 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 478 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 479 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 480 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 481 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 482 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 483 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 484 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 485 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 486 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.08 |
| Metatranscriptomes | 15.99 |
| Isolates | 7.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.4 |
| Nodule | 0.35 |
| Rhizoplane | 4.2 |
| Rhizosphere | 87.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10939638 | 3300009094 | Bacteria | 1005 |
| 2 | LJNas_1022272 | 3300000546 | Bacteria | 676 |
| 3 | JGI24739J22299_10080331 | 3300001989 | Bacteria | 1002 |
| 4 | JGI24743J22301_10015968 | 3300001991 | Bacteria | 1396 |
| 5 | JGI24749J21850_1018395 | 3300002076 | Bacteria | 986 |
| 6 | JGI24744J21845_10005638 | 3300002077 | Bacteria | 2594 |
| 7 | JGI24742J22300_10073995 | 3300002244 | Bacteria | 638 |
| 8 | Ga0006778J45830_1018265 | 3300003162 | Bacteria | 735 |
| 9 | Ga0006778J45830_1020392 | 3300003162 | Bacteria | 631 |
| 10 | Ga0006759J45824_1015951 | 3300003163 | Bacteria | 717 |
| 11 | Ga0006759J45824_1023826 | 3300003163 | Bacteria | 694 |
| 12 | Ga0006759J45824_1036218 | 3300003163 | Bacteria | 558 |
| 13 | Ga0006777J48905_1023427 | 3300003308 | Bacteria | 723 |
| 14 | Ga0007417J51691_1019609 | 3300003544 | Bacteria | 726 |
| 15 | Ga0007427J51700_113809 | 3300003559 | Bacteria | 642 |
| 16 | Ga0007427J51700_114899 | 3300003559 | Bacteria | 581 |
| 17 | Ga0006781J51513_1014045 | 3300003568 | Bacteria | 727 |
| 18 | Ga0006781J51513_1016819 | 3300003568 | Bacteria | 738 |
| 19 | Ga0006781J51513_1020798 | 3300003568 | Bacteria | 645 |
| 20 | Ga0007410J51695_1017596 | 3300003574 | Bacteria | 737 |
| 21 | Ga0007410J51695_1019037 | 3300003574 | Bacteria | 654 |
| 22 | Ga0007410J51695_1035339 | 3300003574 | Bacteria | 724 |
| 23 | Ga0007409J51694_1026545 | 3300003575 | Bacteria | 657 |
| 24 | Ga0007416J51690_1014631 | 3300003577 | Bacteria | 655 |
| 25 | Ga0007416J51690_1020621 | 3300003577 | Bacteria | 686 |
| 26 | Ga0007416J51690_1032371 | 3300003577 | Bacteria | 741 |
| 27 | Ga0007429J51699_1030546 | 3300003579 | Bacteria | 638 |
| 28 | Ga0007429J51699_1030653 | 3300003579 | Bacteria | 593 |
| 29 | Ga0007429J51699_1062306 | 3300003579 | Bacteria | 702 |
| 30 | Ga0007411J51799_113730 | 3300003611 | Bacteria | 730 |
| 31 | Ga0032354_1016877 | 3300003693 | Bacteria | 709 |
| 32 | Ga0032354_1025855 | 3300003693 | Bacteria | 727 |
| 33 | Ga0006780_1010384 | 3300003735 | Bacteria | 676 |
| 34 | JGI25405J52794_10022894 | 3300003911 | Bacteria | 1269 |
| 35 | Ga0058859_10043592 | 3300004798 | Bacteria | 637 |
| 36 | Ga0058859_10073273 | 3300004798 | Bacteria | 748 |
| 37 | Ga0058861_10189803 | 3300004800 | Bacteria | 630 |
| 38 | Ga0058860_12181988 | 3300004801 | Bacteria | 504 |
| 39 | Ga0070676_10999377 | 3300005328 | Bacteria | 628 |
| 40 | Ga0070683_100589444 | 3300005329 | Bacteria | 1064 |
| 41 | Ga0070683_102353903 | 3300005329 | Bacteria | 511 |
| 42 | Ga0070690_100439835 | 3300005330 | Bacteria | 965 |
| 43 | Ga0070670_100143399 | 3300005331 | Bacteria | 2066 |
| 44 | Ga0068869_100486752 | 3300005334 | Bacteria | 1028 |
| 45 | Ga0070680_100715629 | 3300005336 | Bacteria | 862 |
| 46 | Ga0070680_100852140 | 3300005336 | Bacteria | 786 |
| 47 | Ga0070682_100043086 | 3300005337 | Bacteria | 2789 |
| 48 | Ga0070682_100892715 | 3300005337 | Bacteria | 730 |
| 49 | Ga0070682_101173651 | 3300005337 | Bacteria | 646 |
| 50 | Ga0070660_100248311 | 3300005339 | Bacteria | 1451 |
| 51 | Ga0070660_100340074 | 3300005339 | Bacteria | 1235 |
| 52 | Ga0070660_100885242 | 3300005339 | Bacteria | 752 |
| 53 | Ga0070689_100138643 | 3300005340 | Bacteria | 1955 |
| 54 | Ga0070689_100696527 | 3300005340 | Bacteria | 887 |
| 55 | Ga0070691_10706932 | 3300005341 | Bacteria | 606 |
| 56 | Ga0070687_100136198 | 3300005343 | Bacteria | 1424 |
| 57 | Ga0070687_100204453 | 3300005343 | Bacteria | 1199 |
| 58 | Ga0070661_100448082 | 3300005344 | Bacteria | 1027 |
| 59 | Ga0070692_10031106 | 3300005345 | Bacteria | 2673 |
| 60 | Ga0070668_100004599 | 3300005347 | Bacteria | 10220 |
| 61 | Ga0070668_100047826 | 3300005347 | Bacteria | 3289 |
| 62 | Ga0070668_100228974 | 3300005347 | Bacteria | 1536 |
| 63 | Ga0070668_101347081 | 3300005347 | Bacteria | 650 |
| 64 | Ga0070668_101403532 | 3300005347 | Bacteria | 637 |
| 65 | Ga0070669_100218024 | 3300005353 | Bacteria | 1508 |
| 66 | Ga0070669_100641499 | 3300005353 | Bacteria | 893 |
| 67 | Ga0070669_100676686 | 3300005353 | Bacteria | 870 |
| 68 | Ga0070675_100013757 | 3300005354 | Bacteria | 6368 |
| 69 | Ga0070675_101170109 | 3300005354 | Bacteria | 708 |
| 70 | Ga0070674_100720271 | 3300005356 | Bacteria | 855 |
| 71 | Ga0070674_100919961 | 3300005356 | Bacteria | 763 |
| 72 | Ga0070673_100157320 | 3300005364 | Bacteria | 1930 |
| 73 | Ga0070688_100588015 | 3300005365 | Bacteria | 851 |
| 74 | Ga0070703_10235413 | 3300005406 | Bacteria | 736 |
| 75 | Ga0070709_10010163 | 3300005434 | Bacteria | 5201 |
| 76 | Ga0070709_10267953 | 3300005434 | Bacteria | 1236 |
| 77 | Ga0070709_10773837 | 3300005434 | Bacteria | 751 |
| 78 | Ga0070714_100146697 | 3300005435 | Bacteria | 2123 |
| 79 | Ga0070714_100579236 | 3300005435 | Bacteria | 1076 |
| 80 | Ga0070714_101139606 | 3300005435 | Bacteria | 760 |
| 81 | Ga0070713_100077998 | 3300005436 | Bacteria | 2819 |
| 82 | Ga0070713_100114480 | 3300005436 | Bacteria | 2356 |
| 83 | Ga0070713_100150891 | 3300005436 | Bacteria | 2067 |
| 84 | Ga0070713_100347033 | 3300005436 | Bacteria | 1376 |
| 85 | Ga0070713_100648289 | 3300005436 | Bacteria | 1005 |
| 86 | Ga0070713_101398349 | 3300005436 | Bacteria | 679 |
| 87 | Ga0070710_10007895 | 3300005437 | Bacteria | 5169 |
| 88 | Ga0070710_10045918 | 3300005437 | Bacteria | 2430 |
| 89 | Ga0070710_10896809 | 3300005437 | Bacteria | 640 |
| 90 | Ga0070701_10127169 | 3300005438 | Bacteria | 1443 |
| 91 | Ga0070711_100012615 | 3300005439 | Bacteria | 5284 |
| 92 | Ga0070711_100028374 | 3300005439 | Bacteria | 3683 |
| 93 | Ga0070711_100033920 | 3300005439 | Bacteria | 3401 |
| 94 | Ga0070700_100002680 | 3300005441 | Bacteria | 9097 |
| 95 | Ga0070700_100218280 | 3300005441 | Bacteria | 1349 |
| 96 | Ga0070700_100564037 | 3300005441 | Bacteria | 887 |
| 97 | Ga0070708_100219439 | 3300005445 | Bacteria | 1783 |
| 98 | Ga0070663_100017492 | 3300005455 | Bacteria | 4680 |
| 99 | Ga0070662_101183912 | 3300005457 | Bacteria | 657 |
| 100 | Ga0070662_101544633 | 3300005457 | Bacteria | 573 |
| 101 | Ga0070681_10258947 | 3300005458 | Bacteria | 1652 |
| 102 | Ga0068867_100028590 | 3300005459 | Bacteria | 4015 |
| 103 | Ga0068867_100793556 | 3300005459 | Bacteria | 844 |
| 104 | Ga0068867_102211423 | 3300005459 | Bacteria | 522 |
| 105 | Ga0070706_100074872 | 3300005467 | Bacteria | 3133 |
| 106 | Ga0070707_100155245 | 3300005468 | Bacteria | 2230 |
| 107 | Ga0070698_100010328 | 3300005471 | Bacteria | 9968 |
| 108 | Ga0070698_100019873 | 3300005471 | Bacteria | 7045 |
| 109 | Ga0070699_101979038 | 3300005518 | Bacteria | 533 |
| 110 | Ga0070679_100070729 | 3300005530 | Bacteria | 3480 |
| 111 | Ga0070679_100152808 | 3300005530 | Bacteria | 2284 |
| 112 | Ga0070684_101153546 | 3300005535 | Bacteria | 728 |
| 113 | Ga0070684_102066870 | 3300005535 | Bacteria | 538 |
| 114 | Ga0070665_101199189 | 3300005548 | Bacteria | 770 |
| 115 | Ga0070665_102539765 | 3300005548 | Bacteria | 513 |
| 116 | Ga0068857_100326556 | 3300005577 | Bacteria | 1417 |
| 117 | Ga0068857_100331933 | 3300005577 | Bacteria | 1406 |
| 118 | Ga0068854_100123509 | 3300005578 | Bacteria | 1969 |
| 119 | Ga0068854_100698775 | 3300005578 | Bacteria | 875 |
| 120 | Ga0068854_101343022 | 3300005578 | Bacteria | 645 |
| 121 | Ga0070702_100027149 | 3300005615 | Bacteria | 3085 |
| 122 | Ga0070702_100206611 | 3300005615 | Bacteria | 1304 |
| 123 | Ga0070702_100745168 | 3300005615 | Bacteria | 752 |
| 124 | Ga0068864_100597151 | 3300005618 | Bacteria | 1071 |
| 125 | Ga0068866_10024414 | 3300005718 | Bacteria | 2827 |
| 126 | Ga0068866_10489240 | 3300005718 | Bacteria | 812 |
| 127 | Ga0068861_100049241 | 3300005719 | Bacteria | 3189 |
| 128 | Ga0068870_10157487 | 3300005840 | Bacteria | 1344 |
| 129 | Ga0068863_100204715 | 3300005841 | Unclassified | 1899 |
| 130 | Ga0081455_10000265 | 3300005937 | Bacteria | 68995 |
| 131 | Ga0070717_10019007 | 3300006028 | Bacteria | 5380 |
| 132 | Ga0070717_10049256 | 3300006028 | Bacteria | 3458 |
| 133 | Ga0070717_10079305 | 3300006028 | Bacteria | 2753 |
| 134 | Ga0070717_10282871 | 3300006028 | Bacteria | 1471 |
| 135 | Ga0070717_10352794 | 3300006028 | Bacteria | 1315 |
| 136 | Ga0070717_10946358 | 3300006028 | Bacteria | 784 |
| 137 | Ga0070717_11270400 | 3300006028 | Bacteria | 669 |
| 138 | Ga0075365_10155186 | 3300006038 | Bacteria | 1593 |
| 139 | Ga0075365_10449884 | 3300006038 | Bacteria | 909 |
| 140 | Ga0075363_100729460 | 3300006048 | Bacteria | 600 |
| 141 | Ga0075364_11239036 | 3300006051 | Bacteria | 505 |
| 142 | Ga0070715_10029242 | 3300006163 | Bacteria | 2218 |
| 143 | Ga0070715_10034360 | 3300006163 | Bacteria | 2078 |
| 144 | Ga0070715_10047983 | 3300006163 | Bacteria | 1823 |
| 145 | Ga0070716_100001600 | 3300006173 | Bacteria | 10191 |
| 146 | Ga0070716_100005302 | 3300006173 | Bacteria | 6233 |
| 147 | Ga0070716_100011149 | 3300006173 | Bacteria | 4524 |
| 148 | Ga0070716_101556895 | 3300006173 | Bacteria | 542 |
| 149 | Ga0070712_100002852 | 3300006175 | Bacteria | 10700 |
| 150 | Ga0070712_100106522 | 3300006175 | Bacteria | 2084 |
| 151 | Ga0070712_100790590 | 3300006175 | Bacteria | 814 |
| 152 | Ga0070712_101954231 | 3300006175 | Bacteria | 514 |
| 153 | Ga0097621_100798618 | 3300006237 | Bacteria | 874 |
| 154 | Ga0075428_100005329 | 3300006844 | Bacteria | 14297 |
| 155 | Ga0075430_100012185 | 3300006846 | Bacteria | 7322 |
| 156 | Ga0075431_100010203 | 3300006847 | Bacteria | 9443 |
| 157 | Ga0075434_100766287 | 3300006871 | Bacteria | 982 |
| 158 | Ga0075429_100006028 | 3300006880 | Bacteria | 10480 |
| 159 | Ga0075435_100483640 | 3300007076 | Bacteria | 1069 |
| 160 | Ga0099795_10170894 | 3300007788 | Bacteria | 903 |
| 161 | Ga0105240_10057388 | 3300009093 | Bacteria | 4864 |
| 162 | Ga0111539_11407616 | 3300009094 | Bacteria | 809 |
| 163 | Ga0111539_11943941 | 3300009094 | Bacteria | 682 |
| 164 | Ga0105245_11482852 | 3300009098 | Bacteria | 729 |
| 165 | Ga0114129_10009476 | 3300009147 | Bacteria | 13880 |
| 166 | Ga0114129_12240621 | 3300009147 | Bacteria | 657 |
| 167 | Ga0105243_10007573 | 3300009148 | Bacteria | 8342 |
| 168 | Ga0105243_12191475 | 3300009148 | Bacteria | 589 |
| 169 | Ga0105243_12204454 | 3300009148 | Bacteria | 588 |
| 170 | Ga0105242_10473167 | 3300009176 | Bacteria | 1186 |
| 171 | Ga0105248_10051414 | 3300009177 | Bacteria | 4623 |
| 172 | Ga0105248_10768926 | 3300009177 | Bacteria | 1087 |
| 173 | Ga0105248_12556089 | 3300009177 | Bacteria | 582 |
| 174 | Ga0105237_10015942 | 3300009545 | Bacteria | 7813 |
| 175 | Ga0105237_10842732 | 3300009545 | Bacteria | 923 |
| 176 | Ga0105238_10775918 | 3300009551 | Bacteria | 973 |
| 177 | Ga0105238_10835635 | 3300009551 | Bacteria | 938 |
| 178 | Ga0105238_11016878 | 3300009551 | Bacteria | 850 |
| 179 | Ga0105238_12615956 | 3300009551 | Bacteria | 541 |
| 180 | Ga0105249_10622017 | 3300009553 | Bacteria | 1136 |
| 181 | Ga0105249_11484142 | 3300009553 | Bacteria | 750 |
| 182 | Ga0105249_11898512 | 3300009553 | Bacteria | 668 |
| 183 | Ga0105239_10626720 | 3300010375 | Bacteria | 1227 |
| 184 | Ga0105246_10740309 | 3300011119 | Bacteria | 866 |
| 185 | Ga0157319_1055919 | 3300012497 | Bacteria | 502 |
| 186 | Ga0157326_1039684 | 3300012513 | Bacteria | 656 |
| 187 | Ga0154016_110258 | 3300013045 | Bacteria | 802 |
| 188 | Ga0154012_122270 | 3300013059 | Bacteria | 622 |
| 189 | Ga0154010_156824 | 3300013062 | Bacteria | 727 |
| 190 | Ga0157369_10448910 | 3300013105 | Bacteria | 1335 |
| 191 | Ga0157369_12203893 | 3300013105 | Bacteria | 559 |
| 192 | Ga0157374_11105710 | 3300013296 | Bacteria | 813 |
| 193 | Ga0157372_10164221 | 3300013307 | Bacteria | 2567 |
| 194 | Ga0157372_11313083 | 3300013307 | Bacteria | 835 |
| 195 | Ga0157372_12880682 | 3300013307 | Bacteria | 551 |
| 196 | Ga0157375_10970590 | 3300013308 | Bacteria | 991 |
| 197 | Ga0157380_10088956 | 3300014326 | Bacteria | 2542 |
| 198 | Ga0157380_11430486 | 3300014326 | Bacteria | 743 |
| 199 | Ga0157380_11985446 | 3300014326 | Bacteria | 643 |
| 200 | Ga0157380_12004527 | 3300014326 | Bacteria | 641 |
| 201 | Ga0157377_10011946 | 3300014745 | Bacteria | 4352 |
| 202 | Ga0163161_10757275 | 3300017792 | Bacteria | 813 |
| 203 | Ga0163161_11096243 | 3300017792 | Bacteria | 684 |
| 204 | Ga0184603_130492 | 3300019192 | Bacteria | 563 |
| 205 | Ga0197907_10568407 | 3300020069 | Bacteria | 708 |
| 206 | Ga0197907_10572481 | 3300020069 | Bacteria | 939 |
| 207 | Ga0197907_10694247 | 3300020069 | Bacteria | 977 |
| 208 | Ga0197907_11394387 | 3300020069 | Bacteria | 1046 |
| 209 | Ga0206356_10277914 | 3300020070 | Bacteria | 656 |
| 210 | Ga0206356_10389405 | 3300020070 | Bacteria | 501 |
| 211 | Ga0206356_11200626 | 3300020070 | Bacteria | 1047 |
| 212 | Ga0206356_11428661 | 3300020070 | Bacteria | 755 |
| 213 | Ga0206356_11480230 | 3300020070 | Bacteria | 906 |
| 214 | Ga0206356_11856534 | 3300020070 | Bacteria | 656 |
| 215 | Ga0206356_11868628 | 3300020070 | Bacteria | 1442 |
| 216 | Ga0206355_1519922 | 3300020076 | Bacteria | 728 |
| 217 | Ga0206355_1520700 | 3300020076 | Bacteria | 608 |
| 218 | Ga0206351_10118108 | 3300020077 | Bacteria | 878 |
| 219 | Ga0206351_10394707 | 3300020077 | Bacteria | 1036 |
| 220 | Ga0206351_10803575 | 3300020077 | Bacteria | 870 |
| 221 | Ga0206352_10043045 | 3300020078 | Bacteria | 624 |
| 222 | Ga0206352_10146681 | 3300020078 | Bacteria | 795 |
| 223 | Ga0206352_10577646 | 3300020078 | Bacteria | 750 |
| 224 | Ga0206352_11000860 | 3300020078 | Bacteria | 716 |
| 225 | Ga0206352_11359334 | 3300020078 | Bacteria | 539 |
| 226 | Ga0206350_10905434 | 3300020080 | Bacteria | 1144 |
| 227 | Ga0206350_11053269 | 3300020080 | Bacteria | 697 |
| 228 | Ga0206354_10246573 | 3300020081 | Bacteria | 1420 |
| 229 | Ga0206354_10411107 | 3300020081 | Bacteria | 652 |
| 230 | Ga0206354_10655668 | 3300020081 | Bacteria | 723 |
| 231 | Ga0206354_10932283 | 3300020081 | Bacteria | 817 |
| 232 | Ga0206354_11131545 | 3300020081 | Bacteria | 612 |
| 233 | Ga0206354_11187521 | 3300020081 | Bacteria | 902 |
| 234 | Ga0206354_11249330 | 3300020081 | Bacteria | 610 |
| 235 | Ga0206354_11251534 | 3300020081 | Bacteria | 709 |
| 236 | Ga0206353_10233523 | 3300020082 | Bacteria | 684 |
| 237 | Ga0206353_10367492 | 3300020082 | Bacteria | 639 |
| 238 | Ga0206353_10783395 | 3300020082 | Bacteria | 697 |
| 239 | Ga0206353_11549377 | 3300020082 | Bacteria | 1034 |
| 240 | Ga0154015_1062931 | 3300020610 | Bacteria | 634 |
| 241 | Ga0154015_1335319 | 3300020610 | Bacteria | 518 |
| 242 | Ga0154015_1575133 | 3300020610 | Bacteria | 591 |
| 243 | Ga0213875_10032580 | 3300021388 | Bacteria | 2462 |
| 244 | Ga0224712_10200121 | 3300022467 | Bacteria | 908 |
| 245 | Ga0224712_10304929 | 3300022467 | Bacteria | 745 |
| 246 | Ga0224712_10374403 | 3300022467 | Bacteria | 676 |
| 247 | Ga0224712_10417473 | 3300022467 | Bacteria | 641 |
| 248 | Ga0247530_109342 | 3300023563 | Bacteria | 793 |
| 249 | Ga0247525_117656 | 3300023668 | Bacteria | 539 |
| 250 | Ga0207697_10144315 | 3300025315 | Bacteria | 1034 |
| 251 | Ga0207682_10186304 | 3300025893 | Bacteria | 950 |
| 252 | Ga0207692_10003732 | 3300025898 | Bacteria | 5983 |
| 253 | Ga0207642_10120760 | 3300025899 | Bacteria | 1351 |
| 254 | Ga0207642_10496207 | 3300025899 | Bacteria | 747 |
| 255 | Ga0207647_10652997 | 3300025904 | Bacteria | 577 |
| 256 | Ga0207685_10026795 | 3300025905 | Bacteria | 2009 |
| 257 | Ga0207685_10157332 | 3300025905 | Bacteria | 1034 |
| 258 | Ga0207699_10002082 | 3300025906 | Bacteria | 9452 |
| 259 | Ga0207699_10003711 | 3300025906 | Bacteria | 7292 |
| 260 | Ga0207699_10270561 | 3300025906 | Bacteria | 1177 |
| 261 | Ga0207645_10921969 | 3300025907 | Bacteria | 593 |
| 262 | Ga0207643_10005670 | 3300025908 | Bacteria | 6679 |
| 263 | Ga0207643_10103732 | 3300025908 | Bacteria | 1669 |
| 264 | Ga0207643_10161524 | 3300025908 | Bacteria | 1348 |
| 265 | Ga0207705_10957234 | 3300025909 | Bacteria | 662 |
| 266 | Ga0207684_10002608 | 3300025910 | Bacteria | 18029 |
| 267 | Ga0207684_10071279 | 3300025910 | Bacteria | 2953 |
| 268 | Ga0207684_10543962 | 3300025910 | Bacteria | 994 |
| 269 | Ga0207695_10098937 | 3300025913 | Bacteria | 2915 |
| 270 | Ga0207695_11261825 | 3300025913 | Bacteria | 619 |
| 271 | Ga0207693_10006593 | 3300025915 | Bacteria | 9600 |
| 272 | Ga0207693_10075654 | 3300025915 | Bacteria | 2637 |
| 273 | Ga0207693_10096788 | 3300025915 | Bacteria | 2314 |
| 274 | Ga0207693_10952831 | 3300025915 | Bacteria | 657 |
| 275 | Ga0207663_10004640 | 3300025916 | Bacteria | 6853 |
| 276 | Ga0207663_10105924 | 3300025916 | Bacteria | 1899 |
| 277 | Ga0207663_10132053 | 3300025916 | Bacteria | 1727 |
| 278 | Ga0207662_10112943 | 3300025918 | Bacteria | 1696 |
| 279 | Ga0207662_10428888 | 3300025918 | Bacteria | 901 |
| 280 | Ga0207657_10340810 | 3300025919 | Bacteria | 1183 |
| 281 | Ga0207657_10799731 | 3300025919 | Bacteria | 729 |
| 282 | Ga0207649_10091185 | 3300025920 | Bacteria | 1996 |
| 283 | Ga0207652_10038138 | 3300025921 | Bacteria | 4071 |
| 284 | Ga0207652_10312713 | 3300025921 | Bacteria | 1418 |
| 285 | Ga0207652_10531136 | 3300025921 | Bacteria | 1058 |
| 286 | Ga0207646_10171049 | 3300025922 | Bacteria | 1962 |
| 287 | Ga0207646_11071107 | 3300025922 | Bacteria | 710 |
| 288 | Ga0207681_10124643 | 3300025923 | Bacteria | 1895 |
| 289 | Ga0207681_10625263 | 3300025923 | Bacteria | 891 |
| 290 | Ga0207681_10670929 | 3300025923 | Bacteria | 860 |
| 291 | Ga0207694_10634590 | 3300025924 | Bacteria | 899 |
| 292 | Ga0207659_10112118 | 3300025926 | Bacteria | 2075 |
| 293 | Ga0207659_10843135 | 3300025926 | Bacteria | 788 |
| 294 | Ga0207700_10000909 | 3300025928 | Bacteria | 16980 |
| 295 | Ga0207700_10029664 | 3300025928 | Bacteria | 3863 |
| 296 | Ga0207700_10096904 | 3300025928 | Bacteria | 2343 |
| 297 | Ga0207700_10112744 | 3300025928 | Bacteria | 2191 |
| 298 | Ga0207700_10281305 | 3300025928 | Bacteria | 1431 |
| 299 | Ga0207700_10397382 | 3300025928 | Bacteria | 1207 |
| 300 | Ga0207700_10668111 | 3300025928 | Bacteria | 927 |
| 301 | Ga0207664_10000622 | 3300025929 | Bacteria | 24554 |
| 302 | Ga0207664_10000671 | 3300025929 | Bacteria | 23504 |
| 303 | Ga0207664_10012086 | 3300025929 | Bacteria | 6165 |
| 304 | Ga0207664_10020262 | 3300025929 | Bacteria | 4926 |
| 305 | Ga0207664_10053975 | 3300025929 | Bacteria | 3183 |
| 306 | Ga0207664_10328067 | 3300025929 | Bacteria | 1351 |
| 307 | Ga0207686_10436054 | 3300025934 | Bacteria | 1005 |
| 308 | Ga0207686_11555667 | 3300025934 | Bacteria | 546 |
| 309 | Ga0207709_10025971 | 3300025935 | Bacteria | 3359 |
| 310 | Ga0207709_10101340 | 3300025935 | Bacteria | 1904 |
| 311 | Ga0207709_10251118 | 3300025935 | Bacteria | 1292 |
| 312 | Ga0207709_10924824 | 3300025935 | Bacteria | 710 |
| 313 | Ga0207669_10469336 | 3300025937 | Bacteria | 1001 |
| 314 | Ga0207665_10000232 | 3300025939 | Bacteria | 37974 |
| 315 | Ga0207665_10008290 | 3300025939 | Bacteria | 6860 |
| 316 | Ga0207665_10065399 | 3300025939 | Bacteria | 2473 |
| 317 | Ga0207691_11158212 | 3300025940 | Bacteria | 642 |
| 318 | Ga0207689_10108803 | 3300025942 | Bacteria | 2278 |
| 319 | Ga0207689_10543183 | 3300025942 | Bacteria | 976 |
| 320 | Ga0207651_10138952 | 3300025960 | Bacteria | 1873 |
| 321 | Ga0207712_10439754 | 3300025961 | Bacteria | 1104 |
| 322 | Ga0207668_10021076 | 3300025972 | Bacteria | 4152 |
| 323 | Ga0207668_10099374 | 3300025972 | Bacteria | 2159 |
| 324 | Ga0207668_10490260 | 3300025972 | Bacteria | 1055 |
| 325 | Ga0207640_10978167 | 3300025981 | Bacteria | 743 |
| 326 | Ga0207677_10412110 | 3300026023 | Bacteria | 1149 |
| 327 | Ga0207678_10006707 | 3300026067 | Bacteria | 10211 |
| 328 | Ga0207708_10004020 | 3300026075 | Bacteria | 10818 |
| 329 | Ga0207708_10027251 | 3300026075 | Bacteria | 4326 |
| 330 | Ga0207708_10576171 | 3300026075 | Bacteria | 951 |
| 331 | Ga0207708_10717183 | 3300026075 | Bacteria | 856 |
| 332 | Ga0207702_10015640 | 3300026078 | Bacteria | 6281 |
| 333 | Ga0207641_10115185 | 3300026088 | Unclassified | 2390 |
| 334 | Ga0207648_10001192 | 3300026089 | Bacteria | 29118 |
| 335 | Ga0207674_10188721 | 3300026116 | Bacteria | 2011 |
| 336 | Ga0207674_10213466 | 3300026116 | Bacteria | 1878 |
| 337 | Ga0207674_10582889 | 3300026116 | Bacteria | 1080 |
| 338 | Ga0207675_100012420 | 3300026118 | Bacteria | 7957 |
| 339 | Ga0207675_100215500 | 3300026118 | Bacteria | 1848 |
| 340 | Ga0207683_11756488 | 3300026121 | Bacteria | 569 |
| 341 | Ga0268266_11088506 | 3300028379 | Bacteria | 773 |
| 342 | Ga0265337_1001546 | 3300028556 | Bacteria | 11291 |
| 343 | Ga0265326_10002216 | 3300028558 | Bacteria | 6584 |
| 344 | Ga0265319_1009142 | 3300028563 | Bacteria | 4251 |
| 345 | Ga0265334_10000780 | 3300028573 | Bacteria | 15904 |
| 346 | Ga0265318_10022733 | 3300028577 | Bacteria | 2504 |
| 347 | Ga0265323_10002253 | 3300028653 | Bacteria | 8966 |
| 348 | Ga0265322_10010699 | 3300028654 | Bacteria | 2664 |
| 349 | Ga0265336_10022867 | 3300028666 | Bacteria | 1987 |
| 350 | Ga0307515_10120537 | 3300028794 | Bacteria | 2975 |
| 351 | Ga0265338_10009988 | 3300028800 | Bacteria | 11222 |
| 352 | Ga0265338_10075656 | 3300028800 | Bacteria | 2856 |
| 353 | Ga0265324_10001086 | 3300029957 | Bacteria | 16372 |
| 354 | Ga0265762_1036640 | 3300030760 | Bacteria | 948 |
| 355 | Ga0265775_104224 | 3300030762 | Bacteria | 802 |
| 356 | Ga0265763_1004177 | 3300030763 | Bacteria | 1174 |
| 357 | Ga0265766_1006307 | 3300030863 | Bacteria | 774 |
| 358 | Ga0265764_102320 | 3300030882 | Bacteria | 924 |
| 359 | Ga0265332_10045591 | 3300031238 | Bacteria | 1889 |
| 360 | Ga0265320_10087493 | 3300031240 | Bacteria | 1446 |
| 361 | Ga0265325_10166133 | 3300031241 | Bacteria | 1035 |
| 362 | Ga0265329_10346953 | 3300031242 | Bacteria | 508 |
| 363 | Ga0265340_10165087 | 3300031247 | Bacteria | 1004 |
| 364 | Ga0265339_10110382 | 3300031249 | Bacteria | 1423 |
| 365 | Ga0265316_10121768 | 3300031344 | Bacteria | 1970 |
| 366 | Ga0307509_10134180 | 3300031507 | Bacteria | 2425 |
| 367 | Ga0265313_10015626 | 3300031595 | Bacteria | 4407 |
| 368 | Ga0307514_10283075 | 3300031649 | Bacteria | 947 |
| 369 | Ga0307514_10520198 | 3300031649 | Bacteria | 559 |
| 370 | Ga0265314_10003310 | 3300031711 | Bacteria | 15719 |
| 371 | Ga0265342_10006114 | 3300031712 | Bacteria | 9020 |
| 372 | Ga0316576_10560432 | 3300031727 | Bacteria | 837 |
| 373 | Ga0307405_10561358 | 3300031731 | Bacteria | 925 |
| 374 | Ga0307405_11258705 | 3300031731 | Bacteria | 642 |
| 375 | Ga0307405_12149548 | 3300031731 | Bacteria | 502 |
| 376 | Ga0307413_10039727 | 3300031824 | Bacteria | 2739 |
| 377 | Ga0307413_10089243 | 3300031824 | Bacteria | 2002 |
| 378 | Ga0307413_10159390 | 3300031824 | Bacteria | 1583 |
| 379 | Ga0307413_10192110 | 3300031824 | Bacteria | 1467 |
| 380 | Ga0307518_10302563 | 3300031838 | Bacteria | 971 |
| 381 | Ga0307410_10233530 | 3300031852 | Bacteria | 1421 |
| 382 | Ga0307410_10330293 | 3300031852 | Bacteria | 1212 |
| 383 | Ga0326468_10070179 | 3300031889 | Bacteria | 580 |
| 384 | Ga0307406_10477228 | 3300031901 | Bacteria | 1006 |
| 385 | Ga0307407_11617555 | 3300031903 | Bacteria | 514 |
| 386 | Ga0307412_10012620 | 3300031911 | Bacteria | 4930 |
| 387 | Ga0307412_10263817 | 3300031911 | Bacteria | 1344 |
| 388 | Ga0307412_11401593 | 3300031911 | Bacteria | 632 |
| 389 | Ga0307409_100021674 | 3300031995 | Bacteria | 4411 |
| 390 | Ga0307409_100172825 | 3300031995 | Bacteria | 1904 |
| 391 | Ga0307409_100469367 | 3300031995 | Bacteria | 1218 |
| 392 | Ga0307409_100505213 | 3300031995 | Bacteria | 1178 |
| 393 | Ga0307409_100831266 | 3300031995 | Bacteria | 933 |
| 394 | Ga0307409_101842264 | 3300031995 | Bacteria | 634 |
| 395 | Ga0307409_102665968 | 3300031995 | Bacteria | 528 |
| 396 | Ga0307416_100344642 | 3300032002 | Bacteria | 1505 |
| 397 | Ga0307416_100435134 | 3300032002 | Bacteria | 1360 |
| 398 | Ga0307414_10168544 | 3300032004 | Bacteria | 1748 |
| 399 | Ga0307411_10085296 | 3300032005 | Bacteria | 2187 |
| 400 | Ga0307411_10169423 | 3300032005 | Bacteria | 1645 |
| 401 | Ga0307411_10665834 | 3300032005 | Bacteria | 903 |
| 402 | Ga0307411_10835803 | 3300032005 | Bacteria | 814 |
| 403 | Ga0307415_100166867 | 3300032126 | Bacteria | 1713 |
| 404 | Ga0307415_100462776 | 3300032126 | Bacteria | 1099 |
| 405 | Ga0373938_0147656 | 3300034957 | Bacteria | 624 |
| 406 | Ga0373926_0266629 | 3300035083 | Bacteria | 665 |
| 407 | Ga0373934_0007152 | 3300035086 | Bacteria | 4139 |
| 408 | Ga0373934_0040361 | 3300035086 | Bacteria | 1840 |
| 409 | Ga0373923_0006371 | 3300035111 | Bacteria | 4074 |
| 410 | Ga0373923_0016194 | 3300035111 | Bacteria | 2827 |
| 411 | Ga0373932_0232309 | 3300035112 | Bacteria | 667 |
| 412 | Ga0373936_0065388 | 3300035113 | Bacteria | 1491 |
| 413 | Ga0373936_0343779 | 3300035113 | Bacteria | 679 |
| 414 | Ga0373945_0177378 | 3300035116 | Bacteria | 876 |
| 415 | Ga0373953_0003409 | 3300035117 | Bacteria | 4943 |
| 416 | Ga0373953_0104066 | 3300035117 | Bacteria | 1196 |
| 417 | Ga0373954_0049831 | 3300035118 | Bacteria | 1964 |
| 418 | Ga0373954_0138722 | 3300035118 | Bacteria | 1185 |
| 419 | Ga0373956_0010222 | 3300035119 | Bacteria | 3839 |
| 420 | Ga0373956_0217595 | 3300035119 | Bacteria | 906 |
| 421 | Ga0373957_0001643 | 3300035120 | Bacteria | 6121 |
| 422 | Ga0373957_0030212 | 3300035120 | Bacteria | 1984 |
| 423 | Ga0373943_0395216 | 3300035170 | Bacteria | 798 |
| 424 | Ga0373946_0435539 | 3300035171 | Bacteria | 666 |
| 425 | Ga0373955_0016008 | 3300035172 | Bacteria | 3683 |
| 426 | Ga0373955_0021208 | 3300035172 | Bacteria | 3275 |
| 427 | Ga0373955_0142953 | 3300035172 | Bacteria | 1404 |
| 428 | Ga0373924_0001917 | 3300035410 | Bacteria | 6919 |
| 429 | Ga0373924_0287092 | 3300035410 | Bacteria | 730 |
| 430 | Ga0373924_0374250 | 3300035410 | Bacteria | 636 |
| 431 | Ga0373931_0466987 | 3300035691 | Bacteria | 809 |
| 432 | Ga0373935_0036624 | 3300035692 | Bacteria | 3068 |
| 433 | Ga0373935_0916151 | 3300035692 | Bacteria | 649 |
| 434 | Ga0373927_0556356 | 3300035695 | Bacteria | 758 |
| 435 | Ga0373927_0659665 | 3300035695 | Bacteria | 691 |
| 436 | Ga0373933_0016313 | 3300035724 | Bacteria | 4150 |
| 437 | Ga0373933_0078117 | 3300035724 | Bacteria | 2024 |
| 438 | Ga0373933_0579531 | 3300035724 | Bacteria | 736 |
| 439 | Ga0373937_0180417 | 3300036401 | Bacteria | 1982 |
| 440 | Ga0373937_0223270 | 3300036401 | Bacteria | 1773 |
| 441 | Ga0265778_054023 | 3300036457 | Bacteria | 554 |
| 442 | Ga0373925_0018032 | 3300037068 | Bacteria | 5126 |
| 443 | Ga0373925_0149335 | 3300037068 | Bacteria | 1834 |
| 444 | Ga0373925_0208714 | 3300037068 | Bacteria | 1555 |
| 445 | Ga0373925_0285353 | 3300037068 | Bacteria | 1330 |
| 446 | Ga0373925_0399252 | 3300037068 | Bacteria | 1121 |
| 447 | Ga0395900_0057814 | 3300037418 | Bacteria | 3993 |
| 448 | Ga0395900_0069154 | 3300037418 | Bacteria | 3629 |
| 449 | Ga0395900_0103132 | 3300037418 | Bacteria | 2930 |
| 450 | Ga0395900_1419785 | 3300037418 | Bacteria | 607 |
| 451 | Ga0395900_1736200 | 3300037418 | Bacteria | 535 |
| 452 | Ga0395898_1552188 | 3300037466 | Bacteria | 587 |
| 453 | Ga0436364_0472656 | 3300037853 | Bacteria | 3801 |
| 454 | Ga0436364_0475919 | 3300037853 | Bacteria | 1150 |
| 455 | Ga0436364_1546886 | 3300037853 | Bacteria | 5866 |
| 456 | Ga0395901_0687687 | 3300038443 | Bacteria | 1022 |
| 457 | Ga0395901_1064334 | 3300038443 | Bacteria | 781 |
| 458 | Ga0395901_1575921 | 3300038443 | Bacteria | 611 |
| 459 | Ga0436365_1010234 | 3300039437 | Bacteria | 720 |
| 460 | Ga0436363_1376266 | 3300039450 | Bacteria | 569 |
| 461 | Ga0436362_0022211 | 3300039453 | Bacteria | 1862 |
| 462 | Ga0439436_0102990 | 3300041404 | Bacteria | 796 |
| 463 | Ga0439466_0240473 | 3300041411 | Bacteria | 549 |
| 464 | Ga0439465_0183148 | 3300041413 | Bacteria | 758 |
| 465 | Ga0451789_0497625 | 3300041443 | Bacteria | 584 |
| 466 | Ga0451793_0975200 | 3300041452 | Bacteria | 1702 |
| 467 | Ga0451797_0322045 | 3300041453 | Bacteria | 534 |
| 468 | Ga0451795_0841048 | 3300041456 | Bacteria | 1183 |
| 469 | Ga0451798_0873055 | 3300041458 | Bacteria | 576 |
| 470 | Ga0451800_0077019 | 3300041459 | Bacteria | 1418 |
| 471 | Ga0451805_118500 | 3300041461 | Bacteria | 701 |
| 472 | Ga0451839_0776345 | 3300041496 | Bacteria | 838 |
| 473 | Ga0451841_0571275 | 3300041498 | Bacteria | 577 |
| 474 | Ga0451845_0382547 | 3300041501 | Bacteria | 997 |
| 475 | Ga0451846_30455 | 3300041502 | Bacteria | 586 |
| 476 | Ga0451849_0761349 | 3300041505 | Bacteria | 752 |
| 477 | Ga0451851_0000350 | 3300041507 | Bacteria | 559 |
| 478 | Ga0439431_0078321 | 3300041997 | Bacteria | 888 |
| 479 | Ga0439448_0142939 | 3300042005 | Bacteria | 829 |
| 480 | Ga0450906_063596 | 3300042145 | Bacteria | 657 |
| 481 | Ga0439434_0151695 | 3300042435 | Bacteria | 768 |
| 482 | Ga0450918_015071 | 3300042531 | Bacteria | 1344 |
| 483 | Ga0466965_0007730 | 3300044683 | Bacteria | 4947 |
| 484 | Ga0466965_0126787 | 3300044683 | Bacteria | 1321 |
| 485 | Ga0466965_0129361 | 3300044683 | Bacteria | 1308 |
| 486 | Ga0466965_0419968 | 3300044683 | Bacteria | 741 |
| 487 | Ga0466966_0014281 | 3300044684 | Bacteria | 5258 |
| 488 | Ga0466961_0798662 | 3300044693 | Bacteria | 563 |
| 489 | Ga0466963_0080016 | 3300044694 | Bacteria | 2211 |
| 490 | Ga0466963_0415800 | 3300044694 | Bacteria | 948 |
| 491 | Ga0466964_0591319 | 3300044706 | Bacteria | 607 |
| 492 | Ga0453684_2004899 | 3300044712 | Bacteria | 583 |
| 493 | Ga0466971_0058607 | 3300044719 | Bacteria | 1738 |
| 494 | Ga0466968_0057957 | 3300044735 | Bacteria | 1666 |
| 495 | Ga0466957_0488252 | 3300044842 | Bacteria | 853 |
| 496 | Ga0466960_0066402 | 3300044901 | Bacteria | 1784 |
| 497 | Ga0466960_0218205 | 3300044901 | Bacteria | 1048 |
| 498 | Ga0466960_0348359 | 3300044901 | Bacteria | 844 |
| 499 | Ga0466959_0064431 | 3300045049 | Bacteria | 2661 |
| 500 | Ga0466959_0603190 | 3300045049 | Bacteria | 738 |
| 501 | Ga0466958_0193746 | 3300045836 | Bacteria | 1292 |
| 502 | Ga0466967_0097675 | 3300045976 | Bacteria | 2681 |
| 503 | Ga0466967_0159656 | 3300045976 | Bacteria | 2115 |
| 504 | Ga0466967_0446780 | 3300045976 | Bacteria | 1263 |
| 505 | Ga0466967_0560204 | 3300045976 | Bacteria | 1125 |
| 506 | Ga0495592_0014265 | 3300046454 | Bacteria | 6035 |
| 507 | Ga0495592_0099594 | 3300046454 | Bacteria | 2073 |
| 508 | Ga0495592_0264389 | 3300046454 | Bacteria | 1131 |
| 509 | Ga0495629_0035983 | 3300046459 | Bacteria | 3497 |
| 510 | Ga0495641_0213129 | 3300046461 | Bacteria | 866 |
| 511 | Ga0495651_0071547 | 3300046462 | Bacteria | 2636 |
| 512 | Ga0495651_0165882 | 3300046462 | Bacteria | 1577 |
| 513 | Ga0495653_0033404 | 3300046463 | Bacteria | 4076 |
| 514 | Ga0495653_0117253 | 3300046463 | Bacteria | 1902 |
| 515 | Ga0495582_0010638 | 3300046473 | Bacteria | 5060 |
| 516 | Ga0495639_0014207 | 3300046475 | Bacteria | 3446 |
| 517 | Ga0495662_0018564 | 3300046476 | Bacteria | 3366 |
| 518 | Ga0495664_0086662 | 3300046477 | Bacteria | 1881 |
| 519 | Ga0495664_0186152 | 3300046477 | Bacteria | 1258 |
| 520 | Ga0495664_0228035 | 3300046477 | Bacteria | 1127 |
| 521 | Ga0495594_0283656 | 3300046499 | Bacteria | 944 |
| 522 | Ga0495608_0031517 | 3300046511 | Bacteria | 3585 |
| 523 | Ga0495608_0186575 | 3300046511 | Bacteria | 1310 |
| 524 | Ga0495608_0905353 | 3300046511 | Bacteria | 516 |
| 525 | Ga0495618_0023400 | 3300046514 | Bacteria | 3819 |
| 526 | Ga0495618_0084700 | 3300046514 | Bacteria | 2025 |
| 527 | Ga0495618_0312456 | 3300046514 | Bacteria | 975 |
| 528 | Ga0495618_0344111 | 3300046514 | Bacteria | 920 |
| 529 | Ga0495628_0043079 | 3300046516 | Bacteria | 3597 |
| 530 | Ga0495628_0204869 | 3300046516 | Bacteria | 1485 |
| 531 | Ga0495628_0553700 | 3300046516 | Bacteria | 825 |
| 532 | Ga0495630_0105898 | 3300046517 | Bacteria | 2129 |
| 533 | Ga0495630_0154289 | 3300046517 | Bacteria | 1748 |
| 534 | Ga0495652_0064640 | 3300046529 | Bacteria | 3076 |
| 535 | Ga0495652_0081261 | 3300046529 | Bacteria | 2673 |
| 536 | Ga0495652_0118245 | 3300046529 | Bacteria | 2118 |
| 537 | Ga0495652_0218915 | 3300046529 | Bacteria | 1432 |
| 538 | Ga0495665_0002498 | 3300046531 | Bacteria | 9931 |
| 539 | Ga0495640_0035860 | 3300046533 | Bacteria | 3508 |
| 540 | Ga0495640_0056941 | 3300046533 | Bacteria | 2669 |
| 541 | Ga0495586_0016308 | 3300046535 | Bacteria | 3951 |
| 542 | Ga0495586_0338545 | 3300046535 | Bacteria | 863 |
| 543 | Ga0495587_0017039 | 3300046536 | Bacteria | 4518 |
| 544 | Ga0495587_0018416 | 3300046536 | Bacteria | 4330 |
| 545 | Ga0495645_0016012 | 3300046543 | Bacteria | 5345 |
| 546 | Ga0495645_0032269 | 3300046543 | Bacteria | 3819 |
| 547 | Ga0495645_0262589 | 3300046543 | Bacteria | 1142 |
| 548 | Ga0495645_0309807 | 3300046543 | Bacteria | 1028 |
| 549 | Ga0495667_0085388 | 3300046559 | Bacteria | 2048 |
| 550 | Ga0495667_0100396 | 3300046559 | Bacteria | 1872 |
| 551 | Ga0495667_0734107 | 3300046559 | Bacteria | 611 |
| 552 | Ga0495634_0023065 | 3300046642 | Bacteria | 4380 |
| 553 | Ga0495634_0032828 | 3300046642 | Bacteria | 3567 |
| 554 | Ga0495634_0408637 | 3300046642 | Bacteria | 805 |
| 555 | Ga0495635_0109034 | 3300046663 | Bacteria | 1891 |
| 556 | Ga0495635_0109883 | 3300046663 | Bacteria | 1883 |
| 557 | Ga0495635_0339409 | 3300046663 | Bacteria | 1003 |
| 558 | Ga0495657_0077376 | 3300046675 | Bacteria | 2158 |
| 559 | Ga0495657_0277550 | 3300046675 | Bacteria | 1003 |
| 560 | Ga0495599_0020613 | 3300046678 | Bacteria | 4106 |
| 561 | Ga0495599_0100198 | 3300046678 | Bacteria | 1806 |
| 562 | Ga0495599_0188802 | 3300046678 | Bacteria | 1268 |
| 563 | Ga0495623_0026198 | 3300046679 | Bacteria | 3754 |
| 564 | Ga0495623_0263934 | 3300046679 | Bacteria | 963 |
| 565 | Ga0495623_0690379 | 3300046679 | Bacteria | 523 |
| 566 | Ga0495646_0032300 | 3300046680 | Bacteria | 3257 |
| 567 | Ga0495646_0059914 | 3300046680 | Bacteria | 2272 |
| 568 | Ga0495646_0070040 | 3300046680 | Bacteria | 2067 |
| 569 | Ga0495647_0228445 | 3300046681 | Bacteria | 823 |
| 570 | Ga0495658_0228531 | 3300046683 | Bacteria | 1166 |
| 571 | Ga0495613_0036340 | 3300046689 | Bacteria | 3652 |
| 572 | Ga0495613_0270757 | 3300046689 | Bacteria | 1181 |
| 573 | Ga0495613_0896495 | 3300046689 | Bacteria | 574 |
| 574 | Ga0495624_0012809 | 3300046690 | Bacteria | 5726 |
| 575 | Ga0495624_0159314 | 3300046690 | Bacteria | 1379 |
| 576 | Ga0495600_0025933 | 3300046809 | Bacteria | 3780 |
| 577 | Ga0495600_0099213 | 3300046809 | Bacteria | 1898 |
| 578 | Ga0495581_0238045 | 3300047315 | Bacteria | 1064 |
| 579 | Ga0495604_0035140 | 3300047317 | Bacteria | 3959 |
| 580 | Ga0495604_0112960 | 3300047317 | Bacteria | 1978 |
| 581 | Ga0495674_0004732 | 3300047319 | Bacteria | 13086 |
| 582 | Ga0495674_0081255 | 3300047319 | Bacteria | 2780 |
| 583 | Ga0495674_0261645 | 3300047319 | Bacteria | 1421 |
| 584 | Ga0495674_0351469 | 3300047319 | Bacteria | 1196 |
| 585 | Ga0495676_0669287 | 3300047321 | Bacteria | 673 |
| 586 | Ga0495680_0041303 | 3300047322 | Bacteria | 3669 |
| 587 | Ga0495680_0110029 | 3300047322 | Bacteria | 2042 |
| 588 | Ga0495675_0006997 | 3300047444 | Bacteria | 6937 |
| 589 | Ga0495675_0197701 | 3300047444 | Bacteria | 1225 |
| 590 | Ga0495684_0012576 | 3300047471 | Bacteria | 6525 |
| 591 | Ga0495684_0135854 | 3300047471 | Bacteria | 1845 |
| 592 | Ga0495684_0834891 | 3300047471 | Bacteria | 599 |
| 593 | Ga0495593_0003359 | 3300047673 | Bacteria | 9588 |
| 594 | Ga0495602_0051535 | 3300048088 | Bacteria | 3664 |
| 595 | Ga0495602_0083088 | 3300048088 | Bacteria | 2684 |
| 596 | Ga0495614_0055607 | 3300048089 | Bacteria | 1697 |
| 597 | Ga0495626_0326509 | 3300048091 | Bacteria | 602 |
| 598 | Ga0496100_0145161 | 3300048903 | Bacteria | 1686 |
| 599 | Ga0496100_1363518 | 3300048903 | Bacteria | 560 |
| 600 | Ga0496101_0651592 | 3300048904 | Bacteria | 832 |
| 601 | Ga0496102_0343276 | 3300048905 | Bacteria | 1406 |
| 602 | Ga0496102_0688843 | 3300048905 | Bacteria | 945 |
| 603 | Ga0496102_0837918 | 3300048905 | Bacteria | 842 |
| 604 | Ga0496102_1310117 | 3300048905 | Bacteria | 643 |
| 605 | Ga0496103_0374319 | 3300048906 | Bacteria | 915 |
| 606 | Ga0496103_0521266 | 3300048906 | Bacteria | 760 |
| 607 | Ga0496104_0650210 | 3300048907 | Bacteria | 963 |
| 608 | Ga0496105_0324973 | 3300048908 | Bacteria | 1232 |
| 609 | Ga0496105_1176060 | 3300048908 | Bacteria | 566 |
| 610 | Ga0496105_1334430 | 3300048908 | Bacteria | 522 |
| 611 | Ga0496106_0187119 | 3300048909 | Bacteria | 1645 |
| 612 | Ga0496106_0213495 | 3300048909 | Bacteria | 1538 |
| 613 | Ga0496107_0689378 | 3300048910 | Bacteria | 752 |
| 614 | Ga0496108_0551728 | 3300048911 | Bacteria | 1005 |
| 615 | Ga0496110_0121482 | 3300048913 | Bacteria | 2354 |
| 616 | Ga0496110_0134485 | 3300048913 | Bacteria | 2234 |
| 617 | Ga0496110_0206423 | 3300048913 | Bacteria | 1786 |
| 618 | Ga0496110_0340265 | 3300048913 | Bacteria | 1367 |
| 619 | Ga0496110_0885067 | 3300048913 | Bacteria | 799 |
| 620 | Ga0496111_0070579 | 3300048914 | Bacteria | 2541 |
| 621 | Ga0496111_0174698 | 3300048914 | Bacteria | 1597 |
| 622 | Ga0496111_1000147 | 3300048914 | Bacteria | 599 |
| 623 | Ga0496113_0107905 | 3300048916 | Bacteria | 2164 |
| 624 | Ga0496113_0716443 | 3300048916 | Bacteria | 798 |
| 625 | Ga0496114_0618380 | 3300048917 | Bacteria | 954 |
| 626 | Ga0496114_1009257 | 3300048917 | Bacteria | 715 |
| 627 | Ga0496117_0001213 | 3300048920 | Bacteria | 38688 |
| 628 | Ga0496118_0053715 | 3300048921 | Bacteria | 3059 |
| 629 | Ga0496122_0209595 | 3300048925 | Bacteria | 1130 |
| 630 | Ga0496125_0087520 | 3300048928 | Bacteria | 2352 |
| 631 | Ga0496125_0127555 | 3300048928 | Bacteria | 1799 |
| 632 | Ga0496126_0920867 | 3300048929 | Bacteria | 661 |
| 633 | Ga0501306_052741 | 3300049127 | Bacteria | 655 |
| 634 | Ga0501308_010519 | 3300049128 | Bacteria | 1029 |
| 635 | Ga0501308_030298 | 3300049128 | Bacteria | 723 |
| 636 | Ga0501309_017765 | 3300049129 | Bacteria | 978 |
| 637 | Ga0501309_047415 | 3300049129 | Bacteria | 669 |
| 638 | Ga0501310_026801 | 3300049130 | Bacteria | 748 |
| 639 | Ga0501304_015101 | 3300049160 | Bacteria | 721 |
| 640 | Ga0501304_018274 | 3300049160 | Bacteria | 676 |
| 641 | Ga0501305_014124 | 3300049161 | Bacteria | 1114 |
| 642 | Ga0501305_072459 | 3300049161 | Bacteria | 608 |
| 643 | Ga0501307_014251 | 3300049162 | Bacteria | 969 |
| 644 | Ga0501307_021101 | 3300049162 | Bacteria | 848 |
| 645 | Ga0501307_043302 | 3300049162 | Bacteria | 659 |
| 646 | Ga0501311_004883 | 3300049527 | Bacteria | 1445 |
| 647 | Ga0501311_063751 | 3300049527 | Bacteria | 600 |
| 648 | Ga0501312_050537 | 3300049528 | Bacteria | 700 |
| 649 | Ga0501314_010936 | 3300049530 | Bacteria | 851 |
| 650 | Ga0501315_092919 | 3300049531 | Bacteria | 525 |
| 651 | Ga0501316_019558 | 3300049532 | Bacteria | 844 |
| 652 | Ga0501316_044260 | 3300049532 | Bacteria | 628 |
| 653 | Ga0501316_052415 | 3300049532 | Bacteria | 590 |
| 654 | Ga0501317_001780 | 3300049533 | Bacteria | 1929 |
| 655 | Ga0501317_016421 | 3300049533 | Bacteria | 960 |
| 656 | Ga0501317_023313 | 3300049533 | Bacteria | 854 |
| 657 | Ga0501317_083741 | 3300049533 | Bacteria | 555 |
| 658 | Ga0501317_108746 | 3300049533 | Bacteria | 507 |
| 659 | Ga0501318_003688 | 3300049534 | Bacteria | 1422 |
| 660 | Ga0501318_008212 | 3300049534 | Bacteria | 1110 |
| 661 | Ga0501318_020851 | 3300049534 | Bacteria | 828 |
| 662 | Ga0501319_006313 | 3300049535 | Bacteria | 871 |
| 663 | Ga0501321_034590 | 3300049537 | Bacteria | 689 |
| 664 | Ga0501321_059952 | 3300049537 | Bacteria | 573 |
| 665 | Ga0501031_0013583 | 3300049568 | Bacteria | 5306 |
| 666 | Ga0501031_0707695 | 3300049568 | Bacteria | 647 |
| 667 | Ga0501031_0766955 | 3300049568 | Bacteria | 619 |
| 668 | Ga0501032_0034305 | 3300049569 | Bacteria | 3474 |
| 669 | Ga0501032_0948106 | 3300049569 | Bacteria | 541 |
| 670 | Ga0501034_0007846 | 3300049571 | Bacteria | 11350 |
| 671 | Ga0501034_0024571 | 3300049571 | Bacteria | 6129 |
| 672 | Ga0501034_0221645 | 3300049571 | Bacteria | 1843 |
| 673 | Ga0501036_0005719 | 3300049572 | Bacteria | 10083 |
| 674 | Ga0501036_0024426 | 3300049572 | Bacteria | 5095 |
| 675 | Ga0501036_0082908 | 3300049572 | Bacteria | 2710 |
| 676 | Ga0501036_0194341 | 3300049572 | Bacteria | 1707 |
| 677 | Ga0501036_0217929 | 3300049572 | Bacteria | 1603 |
| 678 | Ga0501036_0900257 | 3300049572 | Bacteria | 726 |
| 679 | Ga0501037_0073148 | 3300049573 | Bacteria | 2492 |
| 680 | Ga0501037_0886580 | 3300049573 | Bacteria | 585 |
| 681 | Ga0501037_1090038 | 3300049573 | Bacteria | 517 |
| 682 | Ga0501038_0108982 | 3300049574 | Bacteria | 2295 |
| 683 | Ga0501038_0306943 | 3300049574 | Bacteria | 1244 |
| 684 | Ga0501038_0974891 | 3300049574 | Bacteria | 623 |
| 685 | Ga0501039_0157934 | 3300049575 | Bacteria | 1782 |
| 686 | Ga0501039_0267353 | 3300049575 | Bacteria | 1344 |
| 687 | Ga0501039_0269446 | 3300049575 | Bacteria | 1338 |
| 688 | Ga0501039_0478550 | 3300049575 | Bacteria | 978 |
| 689 | Ga0501039_0844877 | 3300049575 | Bacteria | 713 |
| 690 | Ga0501039_0965891 | 3300049575 | Bacteria | 662 |
| 691 | Ga0501040_0255926 | 3300049576 | Bacteria | 1249 |
| 692 | Ga0501041_0270546 | 3300049577 | Bacteria | 1069 |
| 693 | Ga0501042_0017142 | 3300049578 | Bacteria | 4991 |
| 694 | Ga0501042_0121019 | 3300049578 | Bacteria | 1884 |
| 695 | Ga0501043_0001003 | 3300049579 | Bacteria | 24826 |
| 696 | Ga0501043_0063653 | 3300049579 | Bacteria | 2896 |
| 697 | Ga0501046_0036030 | 3300049580 | Bacteria | 3983 |
| 698 | Ga0501047_0076835 | 3300049581 | Bacteria | 3213 |
| 699 | Ga0501047_0224290 | 3300049581 | Bacteria | 1735 |
| 700 | Ga0501047_0622968 | 3300049581 | Bacteria | 899 |
| 701 | Ga0501048_0039775 | 3300049582 | Bacteria | 3371 |
| 702 | Ga0501048_0044178 | 3300049582 | Bacteria | 3187 |
| 703 | Ga0501048_0731695 | 3300049582 | Bacteria | 710 |
| 704 | Ga0501067_0006208 | 3300049583 | Bacteria | 6623 |
| 705 | Ga0501067_0035981 | 3300049583 | Bacteria | 2750 |
| 706 | Ga0501067_0057274 | 3300049583 | Bacteria | 2158 |
| 707 | Ga0501068_0051437 | 3300049584 | Bacteria | 2492 |
| 708 | Ga0501068_0419598 | 3300049584 | Bacteria | 864 |
| 709 | Ga0501069_0187454 | 3300049585 | Bacteria | 1196 |
| 710 | Ga0501070_0016253 | 3300049586 | Bacteria | 6253 |
| 711 | Ga0501071_0126727 | 3300049587 | Bacteria | 1895 |
| 712 | Ga0501072_0009141 | 3300049588 | Bacteria | 7525 |
| 713 | Ga0501072_0016257 | 3300049588 | Bacteria | 5709 |
| 714 | Ga0501072_0516581 | 3300049588 | Bacteria | 944 |
| 715 | Ga0501073_0031933 | 3300049589 | Bacteria | 3756 |
| 716 | Ga0501073_0139517 | 3300049589 | Bacteria | 1680 |
| 717 | Ga0501074_0000822 | 3300049590 | Bacteria | 19680 |
| 718 | Ga0501075_0129407 | 3300049591 | Bacteria | 1923 |
| 719 | Ga0501075_0255137 | 3300049591 | Bacteria | 1337 |
| 720 | Ga0501075_0603191 | 3300049591 | Bacteria | 837 |
| 721 | Ga0501076_0423836 | 3300049592 | Bacteria | 1095 |
| 722 | Ga0501077_0020512 | 3300049593 | Bacteria | 4184 |
| 723 | Ga0501079_0094456 | 3300049741 | Bacteria | 2317 |
| 724 | Ga0501079_0343605 | 3300049741 | Bacteria | 1169 |
| 725 | Ga0501080_0009070 | 3300049742 | Bacteria | 9052 |
| 726 | Ga0501080_0583773 | 3300049742 | Bacteria | 993 |
| 727 | Ga0501083_0016418 | 3300049744 | Bacteria | 5182 |
| 728 | Ga0501266_099300 | 3300049763 | Bacteria | 515 |
| 729 | Ga0501035_0111400 | 3300049822 | Bacteria | 2398 |
| 730 | Ga0501035_0550660 | 3300049822 | Bacteria | 945 |
| 731 | Ga0501035_0749471 | 3300049822 | Bacteria | 784 |
| 732 | Ga0501044_0051399 | 3300049823 | Bacteria | 4249 |
| 733 | Ga0501044_1079946 | 3300049823 | Bacteria | 672 |
| 734 | Ga0501044_1620796 | 3300049823 | Bacteria | 512 |
| 735 | Ga0501045_0073178 | 3300049824 | Bacteria | 2523 |
| 736 | Ga0501045_0306639 | 3300049824 | Bacteria | 1182 |
| 737 | nmdc:mga00v17_288115_c1 | 3300050491 | Bacteria | 610 |
| 738 | nmdc:mga00v17_470356_c1 | 3300050491 | Bacteria | 816 |
| 739 | nmdc:mga0yw44_103683_c1 | 3300050492 | Bacteria | 1814 |
| 740 | nmdc:mga0yw44_350502_c1 | 3300050492 | Bacteria | 994 |
| 741 | nmdc:mga0yw44_752359_c1 | 3300050492 | Bacteria | 662 |
| 742 | nmdc:mga05p37_73124_c1 | 3300050507 | Bacteria | 4219 |
| 743 | nmdc:mga09592_6091_c1 | 3300050508 | Bacteria | 9825 |
| 744 | nmdc:mga0qj67_336796_c1 | 3300050509 | Bacteria | 1221 |
| 745 | nmdc:mga06r32_83809_c1 | 3300050510 | Bacteria | 3107 |
| 746 | nmdc:mga08y16_1860304_c1 | 3300050511 | Bacteria | 554 |
| 747 | nmdc:mga08y16_546023_c1 | 3300050511 | Bacteria | 1173 |
| 748 | nmdc:mga0n895_630697_c1 | 3300050512 | Bacteria | 1072 |
| 749 | nmdc:mga0rr50_1486583_c1 | 3300050513 | Bacteria | 573 |
| 750 | Ga0495601_0035666 | 3300053077 | Bacteria | 3105 |
| 751 | Ga0495601_0106410 | 3300053077 | Bacteria | 1814 |
| 752 | Ga0495601_0191331 | 3300053077 | Bacteria | 1337 |
| 753 | Ga0495601_0618229 | 3300053077 | Bacteria | 694 |
| 754 | Ga0495612_0034757 | 3300053078 | Bacteria | 2041 |
| 755 | Ga0495612_0082099 | 3300053078 | Bacteria | 1355 |
| 756 | Ga0495612_0153051 | 3300053078 | Bacteria | 1004 |
| 757 | Ga0495612_0168598 | 3300053078 | Bacteria | 958 |
| 758 | Ga0495655_0099469 | 3300053083 | Bacteria | 859 |
| 759 | Ga0495595_0040856 | 3300053084 | Bacteria | 2120 |
| 760 | Ga0495595_0148058 | 3300053084 | Bacteria | 1154 |
| 761 | Ga0495619_0017367 | 3300053085 | Bacteria | 4556 |
| 762 | Ga0500566_0216023 | 3300053094 | Bacteria | 957 |
| 763 | Ga0500620_300858 | 3300053155 | Bacteria | 520 |
| 764 | Ga0500656_016060 | 3300053732 | Bacteria | 883 |
| 765 | Ga0501084_0381225 | 3300054114 | Bacteria | 1191 |
| 766 | Ga0501084_0482293 | 3300054114 | Bacteria | 1048 |
| 767 | Ga0501084_1649144 | 3300054114 | Bacteria | 536 |
| 768 | Ga0587073_0209865 | 3300059492 | Bacteria | 589 |
| 769 | Ga0587080_027090 | 3300059503 | Bacteria | 977 |
| 770 | Ga0587080_065085 | 3300059503 | Bacteria | 718 |
| 771 | Ga0587085_065833 | 3300059506 | Bacteria | 697 |
| 772 | Ga0587090_082012 | 3300059510 | Bacteria | 648 |
| 773 | Ga0587125_025058 | 3300059607 | Bacteria | 730 |
| 774 | Ga0587113_006243 | 3300059625 | Bacteria | 1008 |
| 775 | Ga0587115_035424 | 3300059626 | Bacteria | 759 |
| 776 | Ga0587062_127378 | 3300059639 | Bacteria | 520 |
| 777 | Ga0587067_048821 | 3300059640 | Bacteria | 849 |
| 778 | Ga0587067_070194 | 3300059640 | Bacteria | 754 |
| 779 | Ga0587067_120993 | 3300059640 | Bacteria | 628 |
| 780 | Ga0587072_197288 | 3300059643 | Bacteria | 510 |
| 781 | Ga0587102_019822 | 3300059649 | Bacteria | 751 |
| 782 | Ga0587114_028412 | 3300059655 | Bacteria | 839 |
| 783 | Ga0587114_091675 | 3300059655 | Bacteria | 580 |
| 784 | Ga0587116_10717 | 3300059656 | Bacteria | 618 |
| 785 | Ga0587119_032663 | 3300059658 | Bacteria | 718 |
| 786 | Ga0587111_0214419 | 3300060346 | Bacteria | 553 |
| 787 | Ga0501082_0008677 | 3300060353 | Bacteria | 8764 |
| 788 | Ga0466962_0003191 | 3300061719 | Bacteria | 7789 |
| 789 | Ga0530510_0078800 | 3300061734 | Bacteria | 2396 |
| 790 | 2547412829 | 2547132111 | Bacteria | 8013147 |
| 791 | 2554258608 | 2554235005 | Bacteria | 6457341 |
| 792 | 2555230040 | 2554235227 | Bacteria | 3637389 |
| 793 | 2585319440 | 2582581314 | Bacteria | 11452267 |
| 794 | 2643759745 | 2643221548 | Bacteria | 8053412 |
| 795 | 2643767741 | 2643221549 | Bacteria | 4042819 |
| 796 | 2643944688 | 2643221587 | Bacteria | 7586415 |
| 797 | 2644033982 | 2643221604 | Bacteria | 5014917 |
| 798 | 2644102714 | 2643221617 | Bacteria | 5139111 |
| 799 | 2644111116 | 2643221619 | Bacteria | 4158469 |
| 800 | 2644118376 | 2643221620 | Bacteria | 5134593 |
| 801 | 2644231320 | 2643221641 | Bacteria | 4490190 |
| 802 | 2644269242 | 2643221647 | Bacteria | 10741251 |
| 803 | 2644431586 | 2643221677 | Bacteria | 7584031 |
| 804 | 2644462838 | 2643221682 | Bacteria | 6743283 |
| 805 | 2644625780 | 2643221714 | Bacteria | 9015452 |
| 806 | 2655032757 | 2654587600 | Bacteria | 3911798 |
| 807 | 2723642061 | 2721755702 | Bacteria | 4373124 |
| 808 | 2738871572 | 2738541305 | Bacteria | 4910150 |
| 809 | 2740166648 | 2739367898 | Bacteria | 4367674 |
| 810 | 2776376159 | 2775506925 | Bacteria | 7237746 |
| 811 | 2784587856 | 2784132148 | Bacteria | 8627943 |
| 812 | 2808902040 | 2808606372 | Bacteria | 4649509 |
| 813 | 2808919772 | 2808606375 | Bacteria | 9466072 |
| 814 | 2809231441 | 2808606448 | Bacteria | 8656184 |
| 815 | 2812333967 | 2811994874 | Bacteria | 5367947 |
| 816 | 2812358997 | 2811994879 | Bacteria | 9313447 |
| 817 | 2812481244 | 2811994917 | Bacteria | 7761064 |
| 818 | 2819693685 | 2818991463 | Bacteria | 7948711 |
| 819 | 2852641260 | 2852635781 | Bacteria | 8251373 |
| 820 | 2862389462 | 2862382967 | Bacteria | 10317375 |
| 821 | 2862509479 | 2862507626 | Bacteria | 9425308 |
| 822 | 2862580010 | 2862574272 | Bacteria | 10567477 |
| 823 | 2862995753 | 2862993130 | Bacteria | 3860849 |
| 824 | 2863068533 | 2863067949 | Bacteria | 8541735 |
| 825 | 2863405543 | 2863404153 | Bacteria | 9672205 |
| 826 | 2866556103 | 2866552031 | Bacteria | 5824618 |
| 827 | 2867371087 | 2867369537 | Bacteria | 6501581 |
| 828 | 2912725026 | 2912723979 | Bacteria | 8557534 |
| 829 | 2917737239 | 2917736166 | Bacteria | 9690793 |
| 830 | 2918503813 | 2918501144 | Bacteria | 8668083 |
| 831 | 2919446189 | 2919443155 | Bacteria | 4072969 |
| 832 | 2932398609 | 2932398195 | Bacteria | 3847976 |
| 833 | 2935392269 | 2935390628 | Bacteria | 7043367 |
| 834 | 2935411411 | 2935409751 | Bacteria | 4179611 |
| 835 | 2946033553 | 2946033335 | Bacteria | 3835514 |
| 836 | 2946066880 | 2946064051 | Bacteria | 8957905 |
| 837 | 2946075202 | 2946072368 | Bacteria | 8999607 |
| 838 | 2947230349 | 2947224130 | Bacteria | 9938529 |
| 839 | 2954387076 | 2954380949 | Bacteria | 10050426 |
| 840 | 2954697912 | 2954691527 | Bacteria | 10720516 |
| 841 | 2954704304 | 2954701450 | Bacteria | 10834262 |
| 842 | 2966603301 | 2966598605 | Bacteria | 7676064 |
| 843 | 2977253822 | 2977251589 | Bacteria | 2952848 |
| 844 | 2997608174 | 2997600082 | Bacteria | 9896405 |
| 845 | 3006486418 | 3006486233 | Bacteria | 8157040 |
| 846 | 3006500963 | 3006493962 | Bacteria | 8825450 |
| 847 | 8003318385 | 8003314358 | Bacteria | 10575343 |
| 848 | 8008559533 | 8008558824 | Bacteria | 10610750 |
| 849 | 8008579622 | 8008574985 | Bacteria | 7815457 |
| 850 | 8023630850 | 8023623736 | Bacteria | 8593882 |
| 851 | 8025479192 | 8025478263 | Bacteria | 8209203 |
| 852 | 8025535129 | 8025530807 | Bacteria | 8495698 |
| 853 | 8046356409 | 8046352972 | Bacteria | 3613806 |
| 854 | 8055035792 | 8055034563 | Bacteria | 3562128 |
| 855 | 8056215721 | 8056207758 | Bacteria | 8639239 |
| 856 | 8056673156 | 8056667051 | Bacteria | 6953971 |
| 857 | 8056835973 | 8056829672 | Bacteria | 9045328 |
| 858 | Ga0111539_10939638 | |||
| 859 | LJNas_1022272 | |||
| 860 | JGI24739J22299_10080331 | |||
| 861 | JGI24743J22301_10015968 | |||
| 862 | JGI24749J21850_1018395 | |||
| 863 | JGI24744J21845_10005638 | |||
| 864 | JGI24742J22300_10073995 | |||
| 865 | Ga0006778J45830_1018265 | |||
| 866 | Ga0006778J45830_1020392 | |||
| 867 | Ga0006759J45824_1015951 | |||
| 868 | Ga0006759J45824_1023826 | |||
| 869 | Ga0006759J45824_1036218 | |||
| 870 | Ga0006777J48905_1023427 | |||
| 871 | Ga0007417J51691_1019609 | |||
| 872 | Ga0007427J51700_113809 | |||
| 873 | Ga0007427J51700_114899 | |||
| 874 | Ga0006781J51513_1014045 | |||
| 875 | Ga0006781J51513_1016819 | |||
| 876 | Ga0006781J51513_1020798 | |||
| 877 | Ga0007410J51695_1017596 | |||
| 878 | Ga0007410J51695_1019037 | |||
| 879 | Ga0007410J51695_1035339 | |||
| 880 | Ga0007409J51694_1026545 | |||
| 881 | Ga0007416J51690_1014631 | |||
| 882 | Ga0007416J51690_1020621 | |||
| 883 | Ga0007416J51690_1032371 | |||
| 884 | Ga0007429J51699_1030546 | |||
| 885 | Ga0007429J51699_1030653 | |||
| 886 | Ga0007429J51699_1062306 | |||
| 887 | Ga0007411J51799_113730 | |||
| 888 | Ga0032354_1016877 | |||
| 889 | Ga0032354_1025855 | |||
| 890 | Ga0006780_1010384 | |||
| 891 | JGI25405J52794_10022894 | |||
| 892 | Ga0058859_10043592 | |||
| 893 | Ga0058859_10073273 | |||
| 894 | Ga0058861_10189803 | |||
| 895 | Ga0058860_12181988 | |||
| 896 | Ga0070676_10999377 | |||
| 897 | Ga0070683_100589444 | |||
| 898 | Ga0070683_102353903 | |||
| 899 | Ga0070690_100439835 | |||
| 900 | Ga0070670_100143399 | |||
| 901 | Ga0068869_100486752 | |||
| 902 | Ga0070680_100715629 | |||
| 903 | Ga0070680_100852140 | |||
| 904 | Ga0070682_100043086 | |||
| 905 | Ga0070682_100892715 | |||
| 906 | Ga0070682_101173651 | |||
| 907 | Ga0070660_100248311 | |||
| 908 | Ga0070660_100340074 | |||
| 909 | Ga0070660_100885242 | |||
| 910 | Ga0070689_100138643 | |||
| 911 | Ga0070689_100696527 | |||
| 912 | Ga0070691_10706932 | |||
| 913 | Ga0070687_100136198 | |||
| 914 | Ga0070687_100204453 | |||
| 915 | Ga0070661_100448082 | |||
| 916 | Ga0070692_10031106 | |||
| 917 | Ga0070668_100004599 | |||
| 918 | Ga0070668_100047826 | |||
| 919 | Ga0070668_100228974 | |||
| 920 | Ga0070668_101347081 | |||
| 921 | Ga0070668_101403532 | |||
| 922 | Ga0070669_100218024 | |||
| 923 | Ga0070669_100641499 | |||
| 924 | Ga0070669_100676686 | |||
| 925 | Ga0070675_100013757 | |||
| 926 | Ga0070675_101170109 | |||
| 927 | Ga0070674_100720271 | |||
| 928 | Ga0070674_100919961 | |||
| 929 | Ga0070673_100157320 | |||
| 930 | Ga0070688_100588015 | |||
| 931 | Ga0070703_10235413 | |||
| 932 | Ga0070709_10010163 | |||
| 933 | Ga0070709_10267953 | |||
| 934 | Ga0070709_10773837 | |||
| 935 | Ga0070714_100146697 | |||
| 936 | Ga0070714_100579236 | |||
| 937 | Ga0070714_101139606 | |||
| 938 | Ga0070713_100077998 | |||
| 939 | Ga0070713_100114480 | |||
| 940 | Ga0070713_100150891 | |||
| 941 | Ga0070713_100347033 | |||
| 942 | Ga0070713_100648289 | |||
| 943 | Ga0070713_101398349 | |||
| 944 | Ga0070710_10007895 | |||
| 945 | Ga0070710_10045918 | |||
| 946 | Ga0070710_10896809 | |||
| 947 | Ga0070701_10127169 | |||
| 948 | Ga0070711_100012615 | |||
| 949 | Ga0070711_100028374 | |||
| 950 | Ga0070711_100033920 | |||
| 951 | Ga0070700_100002680 | |||
| 952 | Ga0070700_100218280 | |||
| 953 | Ga0070700_100564037 | |||
| 954 | Ga0070708_100219439 | |||
| 955 | Ga0070663_100017492 | |||
| 956 | Ga0070662_101183912 | |||
| 957 | Ga0070662_101544633 | |||
| 958 | Ga0070681_10258947 | |||
| 959 | Ga0068867_100028590 | |||
| 960 | Ga0068867_100793556 | |||
| 961 | Ga0068867_102211423 | |||
| 962 | Ga0070706_100074872 | |||
| 963 | Ga0070707_100155245 | |||
| 964 | Ga0070698_100010328 | |||
| 965 | Ga0070698_100019873 | |||
| 966 | Ga0070699_101979038 | |||
| 967 | Ga0070679_100070729 | |||
| 968 | Ga0070679_100152808 | |||
| 969 | Ga0070684_101153546 | |||
| 970 | Ga0070684_102066870 | |||
| 971 | Ga0070665_101199189 | |||
| 972 | Ga0070665_102539765 | |||
| 973 | Ga0068857_100326556 | |||
| 974 | Ga0068857_100331933 | |||
| 975 | Ga0068854_100123509 | |||
| 976 | Ga0068854_100698775 | |||
| 977 | Ga0068854_101343022 | |||
| 978 | Ga0070702_100027149 | |||
| 979 | Ga0070702_100206611 | |||
| 980 | Ga0070702_100745168 | |||
| 981 | Ga0068864_100597151 | |||
| 982 | Ga0068866_10024414 | |||
| 983 | Ga0068866_10489240 | |||
| 984 | Ga0068861_100049241 | |||
| 985 | Ga0068870_10157487 | |||
| 986 | Ga0068863_100204715 | |||
| 987 | Ga0081455_10000265 | |||
| 988 | Ga0070717_10019007 | |||
| 989 | Ga0070717_10049256 | |||
| 990 | Ga0070717_10079305 | |||
| 991 | Ga0070717_10282871 | |||
| 992 | Ga0070717_10352794 | |||
| 993 | Ga0070717_10946358 | |||
| 994 | Ga0070717_11270400 | |||
| 995 | Ga0075365_10155186 | |||
| 996 | Ga0075365_10449884 | |||
| 997 | Ga0075363_100729460 | |||
| 998 | Ga0075364_11239036 | |||
| 999 | Ga0070715_10029242 | |||
| 1000 | Ga0070715_10034360 | |||
| 1001 | Ga0070715_10047983 | |||
| 1002 | Ga0070716_100001600 | |||
| 1003 | Ga0070716_100005302 | |||
| 1004 | Ga0070716_100011149 | |||
| 1005 | Ga0070716_101556895 | |||
| 1006 | Ga0070712_100002852 | |||
| 1007 | Ga0070712_100106522 | |||
| 1008 | Ga0070712_100790590 | |||
| 1009 | Ga0070712_101954231 | |||
| 1010 | Ga0097621_100798618 | |||
| 1011 | Ga0075428_100005329 | |||
| 1012 | Ga0075430_100012185 | |||
| 1013 | Ga0075431_100010203 | |||
| 1014 | Ga0075434_100766287 | |||
| 1015 | Ga0075429_100006028 | |||
| 1016 | Ga0075435_100483640 | |||
| 1017 | Ga0099795_10170894 | |||
| 1018 | Ga0105240_10057388 | |||
| 1019 | Ga0111539_11407616 | |||
| 1020 | Ga0111539_11943941 | |||
| 1021 | Ga0105245_11482852 | |||
| 1022 | Ga0114129_10009476 | |||
| 1023 | Ga0114129_12240621 | |||
| 1024 | Ga0105243_10007573 | |||
| 1025 | Ga0105243_12191475 | |||
| 1026 | Ga0105243_12204454 | |||
| 1027 | Ga0105242_10473167 | |||
| 1028 | Ga0105248_10051414 | |||
| 1029 | Ga0105248_10768926 | |||
| 1030 | Ga0105248_12556089 | |||
| 1031 | Ga0105237_10015942 | |||
| 1032 | Ga0105237_10842732 | |||
| 1033 | Ga0105238_10775918 | |||
| 1034 | Ga0105238_10835635 | |||
| 1035 | Ga0105238_11016878 | |||
| 1036 | Ga0105238_12615956 | |||
| 1037 | Ga0105249_10622017 | |||
| 1038 | Ga0105249_11484142 | |||
| 1039 | Ga0105249_11898512 | |||
| 1040 | Ga0105239_10626720 | |||
| 1041 | Ga0105246_10740309 | |||
| 1042 | Ga0157319_1055919 | |||
| 1043 | Ga0157326_1039684 | |||
| 1044 | Ga0154016_110258 | |||
| 1045 | Ga0154012_122270 | |||
| 1046 | Ga0154010_156824 | |||
| 1047 | Ga0157369_10448910 | |||
| 1048 | Ga0157369_12203893 | |||
| 1049 | Ga0157374_11105710 | |||
| 1050 | Ga0157372_10164221 | |||
| 1051 | Ga0157372_11313083 | |||
| 1052 | Ga0157372_12880682 | |||
| 1053 | Ga0157375_10970590 | |||
| 1054 | Ga0157380_10088956 | |||
| 1055 | Ga0157380_11430486 | |||
| 1056 | Ga0157380_11985446 | |||
| 1057 | Ga0157380_12004527 | |||
| 1058 | Ga0157377_10011946 | |||
| 1059 | Ga0163161_10757275 | |||
| 1060 | Ga0163161_11096243 | |||
| 1061 | Ga0184603_130492 | |||
| 1062 | Ga0197907_10568407 | |||
| 1063 | Ga0197907_10572481 | |||
| 1064 | Ga0197907_10694247 | |||
| 1065 | Ga0197907_11394387 | |||
| 1066 | Ga0206356_10277914 | |||
| 1067 | Ga0206356_10389405 | |||
| 1068 | Ga0206356_11200626 | |||
| 1069 | Ga0206356_11428661 | |||
| 1070 | Ga0206356_11480230 | |||
| 1071 | Ga0206356_11856534 | |||
| 1072 | Ga0206356_11868628 | |||
| 1073 | Ga0206355_1519922 | |||
| 1074 | Ga0206355_1520700 | |||
| 1075 | Ga0206351_10118108 | |||
| 1076 | Ga0206351_10394707 | |||
| 1077 | Ga0206351_10803575 | |||
| 1078 | Ga0206352_10043045 | |||
| 1079 | Ga0206352_10146681 | |||
| 1080 | Ga0206352_10577646 | |||
| 1081 | Ga0206352_11000860 | |||
| 1082 | Ga0206352_11359334 | |||
| 1083 | Ga0206350_10905434 | |||
| 1084 | Ga0206350_11053269 | |||
| 1085 | Ga0206354_10246573 | |||
| 1086 | Ga0206354_10411107 | |||
| 1087 | Ga0206354_10655668 | |||
| 1088 | Ga0206354_10932283 | |||
| 1089 | Ga0206354_11131545 | |||
| 1090 | Ga0206354_11187521 | |||
| 1091 | Ga0206354_11249330 | |||
| 1092 | Ga0206354_11251534 | |||
| 1093 | Ga0206353_10233523 | |||
| 1094 | Ga0206353_10367492 | |||
| 1095 | Ga0206353_10783395 | |||
| 1096 | Ga0206353_11549377 | |||
| 1097 | Ga0154015_1062931 | |||
| 1098 | Ga0154015_1335319 | |||
| 1099 | Ga0154015_1575133 | |||
| 1100 | Ga0213875_10032580 | |||
| 1101 | Ga0224712_10200121 | |||
| 1102 | Ga0224712_10304929 | |||
| 1103 | Ga0224712_10374403 | |||
| 1104 | Ga0224712_10417473 | |||
| 1105 | Ga0247530_109342 | |||
| 1106 | Ga0247525_117656 | |||
| 1107 | Ga0207697_10144315 | |||
| 1108 | Ga0207682_10186304 | |||
| 1109 | Ga0207692_10003732 | |||
| 1110 | Ga0207642_10120760 | |||
| 1111 | Ga0207642_10496207 | |||
| 1112 | Ga0207647_10652997 | |||
| 1113 | Ga0207685_10026795 | |||
| 1114 | Ga0207685_10157332 | |||
| 1115 | Ga0207699_10002082 | |||
| 1116 | Ga0207699_10003711 | |||
| 1117 | Ga0207699_10270561 | |||
| 1118 | Ga0207645_10921969 | |||
| 1119 | Ga0207643_10005670 | |||
| 1120 | Ga0207643_10103732 | |||
| 1121 | Ga0207643_10161524 | |||
| 1122 | Ga0207705_10957234 | |||
| 1123 | Ga0207684_10002608 | |||
| 1124 | Ga0207684_10071279 | |||
| 1125 | Ga0207684_10543962 | |||
| 1126 | Ga0207695_10098937 | |||
| 1127 | Ga0207695_11261825 | |||
| 1128 | Ga0207693_10006593 | |||
| 1129 | Ga0207693_10075654 | |||
| 1130 | Ga0207693_10096788 | |||
| 1131 | Ga0207693_10952831 | |||
| 1132 | Ga0207663_10004640 | |||
| 1133 | Ga0207663_10105924 | |||
| 1134 | Ga0207663_10132053 | |||
| 1135 | Ga0207662_10112943 | |||
| 1136 | Ga0207662_10428888 | |||
| 1137 | Ga0207657_10340810 | |||
| 1138 | Ga0207657_10799731 | |||
| 1139 | Ga0207649_10091185 | |||
| 1140 | Ga0207652_10038138 | |||
| 1141 | Ga0207652_10312713 | |||
| 1142 | Ga0207652_10531136 | |||
| 1143 | Ga0207646_10171049 | |||
| 1144 | Ga0207646_11071107 | |||
| 1145 | Ga0207681_10124643 | |||
| 1146 | Ga0207681_10625263 | |||
| 1147 | Ga0207681_10670929 | |||
| 1148 | Ga0207694_10634590 | |||
| 1149 | Ga0207659_10112118 | |||
| 1150 | Ga0207659_10843135 | |||
| 1151 | Ga0207700_10000909 | |||
| 1152 | Ga0207700_10029664 | |||
| 1153 | Ga0207700_10096904 | |||
| 1154 | Ga0207700_10112744 | |||
| 1155 | Ga0207700_10281305 | |||
| 1156 | Ga0207700_10397382 | |||
| 1157 | Ga0207700_10668111 | |||
| 1158 | Ga0207664_10000622 | |||
| 1159 | Ga0207664_10000671 | |||
| 1160 | Ga0207664_10012086 | |||
| 1161 | Ga0207664_10020262 | |||
| 1162 | Ga0207664_10053975 | |||
| 1163 | Ga0207664_10328067 | |||
| 1164 | Ga0207686_10436054 | |||
| 1165 | Ga0207686_11555667 | |||
| 1166 | Ga0207709_10025971 | |||
| 1167 | Ga0207709_10101340 | |||
| 1168 | Ga0207709_10251118 | |||
| 1169 | Ga0207709_10924824 | |||
| 1170 | Ga0207669_10469336 | |||
| 1171 | Ga0207665_10000232 | |||
| 1172 | Ga0207665_10008290 | |||
| 1173 | Ga0207665_10065399 | |||
| 1174 | Ga0207691_11158212 | |||
| 1175 | Ga0207689_10108803 | |||
| 1176 | Ga0207689_10543183 | |||
| 1177 | Ga0207651_10138952 | |||
| 1178 | Ga0207712_10439754 | |||
| 1179 | Ga0207668_10021076 | |||
| 1180 | Ga0207668_10099374 | |||
| 1181 | Ga0207668_10490260 | |||
| 1182 | Ga0207640_10978167 | |||
| 1183 | Ga0207677_10412110 | |||
| 1184 | Ga0207678_10006707 | |||
| 1185 | Ga0207708_10004020 | |||
| 1186 | Ga0207708_10027251 | |||
| 1187 | Ga0207708_10576171 | |||
| 1188 | Ga0207708_10717183 | |||
| 1189 | Ga0207702_10015640 | |||
| 1190 | Ga0207641_10115185 | |||
| 1191 | Ga0207648_10001192 | |||
| 1192 | Ga0207674_10188721 | |||
| 1193 | Ga0207674_10213466 | |||
| 1194 | Ga0207674_10582889 | |||
| 1195 | Ga0207675_100012420 | |||
| 1196 | Ga0207675_100215500 | |||
| 1197 | Ga0207683_11756488 | |||
| 1198 | Ga0268266_11088506 | |||
| 1199 | Ga0265337_1001546 | |||
| 1200 | Ga0265326_10002216 | |||
| 1201 | Ga0265319_1009142 | |||
| 1202 | Ga0265334_10000780 | |||
| 1203 | Ga0265318_10022733 | |||
| 1204 | Ga0265323_10002253 | |||
| 1205 | Ga0265322_10010699 | |||
| 1206 | Ga0265336_10022867 | |||
| 1207 | Ga0307515_10120537 | |||
| 1208 | Ga0265338_10009988 | |||
| 1209 | Ga0265338_10075656 | |||
| 1210 | Ga0265324_10001086 | |||
| 1211 | Ga0265762_1036640 | |||
| 1212 | Ga0265775_104224 | |||
| 1213 | Ga0265763_1004177 | |||
| 1214 | Ga0265766_1006307 | |||
| 1215 | Ga0265764_102320 | |||
| 1216 | Ga0265332_10045591 | |||
| 1217 | Ga0265320_10087493 | |||
| 1218 | Ga0265325_10166133 | |||
| 1219 | Ga0265329_10346953 | |||
| 1220 | Ga0265340_10165087 | |||
| 1221 | Ga0265339_10110382 | |||
| 1222 | Ga0265316_10121768 | |||
| 1223 | Ga0307509_10134180 | |||
| 1224 | Ga0265313_10015626 | |||
| 1225 | Ga0307514_10283075 | |||
| 1226 | Ga0307514_10520198 | |||
| 1227 | Ga0265314_10003310 | |||
| 1228 | Ga0265342_10006114 | |||
| 1229 | Ga0316576_10560432 | |||
| 1230 | Ga0307405_10561358 | |||
| 1231 | Ga0307405_11258705 | |||
| 1232 | Ga0307405_12149548 | |||
| 1233 | Ga0307413_10039727 | |||
| 1234 | Ga0307413_10089243 | |||
| 1235 | Ga0307413_10159390 | |||
| 1236 | Ga0307413_10192110 | |||
| 1237 | Ga0307518_10302563 | |||
| 1238 | Ga0307410_10233530 | |||
| 1239 | Ga0307410_10330293 | |||
| 1240 | Ga0326468_10070179 | |||
| 1241 | Ga0307406_10477228 | |||
| 1242 | Ga0307407_11617555 | |||
| 1243 | Ga0307412_10012620 | |||
| 1244 | Ga0307412_10263817 | |||
| 1245 | Ga0307412_11401593 | |||
| 1246 | Ga0307409_100021674 | |||
| 1247 | Ga0307409_100172825 | |||
| 1248 | Ga0307409_100469367 | |||
| 1249 | Ga0307409_100505213 | |||
| 1250 | Ga0307409_100831266 | |||
| 1251 | Ga0307409_101842264 | |||
| 1252 | Ga0307409_102665968 | |||
| 1253 | Ga0307416_100344642 | |||
| 1254 | Ga0307416_100435134 | |||
| 1255 | Ga0307414_10168544 | |||
| 1256 | Ga0307411_10085296 | |||
| 1257 | Ga0307411_10169423 | |||
| 1258 | Ga0307411_10665834 | |||
| 1259 | Ga0307411_10835803 | |||
| 1260 | Ga0307415_100166867 | |||
| 1261 | Ga0307415_100462776 | |||
| 1262 | Ga0373938_0147656 | |||
| 1263 | Ga0373926_0266629 | |||
| 1264 | Ga0373934_0007152 | |||
| 1265 | Ga0373934_0040361 | |||
| 1266 | Ga0373923_0006371 | |||
| 1267 | Ga0373923_0016194 | |||
| 1268 | Ga0373932_0232309 | |||
| 1269 | Ga0373936_0065388 | |||
| 1270 | Ga0373936_0343779 | |||
| 1271 | Ga0373945_0177378 | |||
| 1272 | Ga0373953_0003409 | |||
| 1273 | Ga0373953_0104066 | |||
| 1274 | Ga0373954_0049831 | |||
| 1275 | Ga0373954_0138722 | |||
| 1276 | Ga0373956_0010222 | |||
| 1277 | Ga0373956_0217595 | |||
| 1278 | Ga0373957_0001643 | |||
| 1279 | Ga0373957_0030212 | |||
| 1280 | Ga0373943_0395216 | |||
| 1281 | Ga0373946_0435539 | |||
| 1282 | Ga0373955_0016008 | |||
| 1283 | Ga0373955_0021208 | |||
| 1284 | Ga0373955_0142953 | |||
| 1285 | Ga0373924_0001917 | |||
| 1286 | Ga0373924_0287092 | |||
| 1287 | Ga0373924_0374250 | |||
| 1288 | Ga0373931_0466987 | |||
| 1289 | Ga0373935_0036624 | |||
| 1290 | Ga0373935_0916151 | |||
| 1291 | Ga0373927_0556356 | |||
| 1292 | Ga0373927_0659665 | |||
| 1293 | Ga0373933_0016313 | |||
| 1294 | Ga0373933_0078117 | |||
| 1295 | Ga0373933_0579531 | |||
| 1296 | Ga0373937_0180417 | |||
| 1297 | Ga0373937_0223270 | |||
| 1298 | Ga0265778_054023 | |||
| 1299 | Ga0373925_0018032 | |||
| 1300 | Ga0373925_0149335 | |||
| 1301 | Ga0373925_0208714 | |||
| 1302 | Ga0373925_0285353 | |||
| 1303 | Ga0373925_0399252 | |||
| 1304 | Ga0395900_0057814 | |||
| 1305 | Ga0395900_0069154 | |||
| 1306 | Ga0395900_0103132 | |||
| 1307 | Ga0395900_1419785 | |||
| 1308 | Ga0395900_1736200 | |||
| 1309 | Ga0395898_1552188 | |||
| 1310 | Ga0436364_0472656 | |||
| 1311 | Ga0436364_0475919 | |||
| 1312 | Ga0436364_1546886 | |||
| 1313 | Ga0395901_0687687 | |||
| 1314 | Ga0395901_1064334 | |||
| 1315 | Ga0395901_1575921 | |||
| 1316 | Ga0436365_1010234 | |||
| 1317 | Ga0436363_1376266 | |||
| 1318 | Ga0436362_0022211 | |||
| 1319 | Ga0439436_0102990 | |||
| 1320 | Ga0439466_0240473 | |||
| 1321 | Ga0439465_0183148 | |||
| 1322 | Ga0451789_0497625 | |||
| 1323 | Ga0451793_0975200 | |||
| 1324 | Ga0451797_0322045 | |||
| 1325 | Ga0451795_0841048 | |||
| 1326 | Ga0451798_0873055 | |||
| 1327 | Ga0451800_0077019 | |||
| 1328 | Ga0451805_118500 | |||
| 1329 | Ga0451839_0776345 | |||
| 1330 | Ga0451841_0571275 | |||
| 1331 | Ga0451845_0382547 | |||
| 1332 | Ga0451846_30455 | |||
| 1333 | Ga0451849_0761349 | |||
| 1334 | Ga0451851_0000350 | |||
| 1335 | Ga0439431_0078321 | |||
| 1336 | Ga0439448_0142939 | |||
| 1337 | Ga0450906_063596 | |||
| 1338 | Ga0439434_0151695 | |||
| 1339 | Ga0450918_015071 | |||
| 1340 | Ga0466965_0007730 | |||
| 1341 | Ga0466965_0126787 | |||
| 1342 | Ga0466965_0129361 | |||
| 1343 | Ga0466965_0419968 | |||
| 1344 | Ga0466966_0014281 | |||
| 1345 | Ga0466961_0798662 | |||
| 1346 | Ga0466963_0080016 | |||
| 1347 | Ga0466963_0415800 | |||
| 1348 | Ga0466964_0591319 | |||
| 1349 | Ga0453684_2004899 | |||
| 1350 | Ga0466971_0058607 | |||
| 1351 | Ga0466968_0057957 | |||
| 1352 | Ga0466957_0488252 | |||
| 1353 | Ga0466960_0066402 | |||
| 1354 | Ga0466960_0218205 | |||
| 1355 | Ga0466960_0348359 | |||
| 1356 | Ga0466959_0064431 | |||
| 1357 | Ga0466959_0603190 | |||
| 1358 | Ga0466958_0193746 | |||
| 1359 | Ga0466967_0097675 | |||
| 1360 | Ga0466967_0159656 | |||
| 1361 | Ga0466967_0446780 | |||
| 1362 | Ga0466967_0560204 | |||
| 1363 | Ga0495592_0014265 | |||
| 1364 | Ga0495592_0099594 | |||
| 1365 | Ga0495592_0264389 | |||
| 1366 | Ga0495629_0035983 | |||
| 1367 | Ga0495641_0213129 | |||
| 1368 | Ga0495651_0071547 | |||
| 1369 | Ga0495651_0165882 | |||
| 1370 | Ga0495653_0033404 | |||
| 1371 | Ga0495653_0117253 | |||
| 1372 | Ga0495582_0010638 | |||
| 1373 | Ga0495639_0014207 | |||
| 1374 | Ga0495662_0018564 | |||
| 1375 | Ga0495664_0086662 | |||
| 1376 | Ga0495664_0186152 | |||
| 1377 | Ga0495664_0228035 | |||
| 1378 | Ga0495594_0283656 | |||
| 1379 | Ga0495608_0031517 | |||
| 1380 | Ga0495608_0186575 | |||
| 1381 | Ga0495608_0905353 | |||
| 1382 | Ga0495618_0023400 | |||
| 1383 | Ga0495618_0084700 | |||
| 1384 | Ga0495618_0312456 | |||
| 1385 | Ga0495618_0344111 | |||
| 1386 | Ga0495628_0043079 | |||
| 1387 | Ga0495628_0204869 | |||
| 1388 | Ga0495628_0553700 | |||
| 1389 | Ga0495630_0105898 | |||
| 1390 | Ga0495630_0154289 | |||
| 1391 | Ga0495652_0064640 | |||
| 1392 | Ga0495652_0081261 | |||
| 1393 | Ga0495652_0118245 | |||
| 1394 | Ga0495652_0218915 | |||
| 1395 | Ga0495665_0002498 | |||
| 1396 | Ga0495640_0035860 | |||
| 1397 | Ga0495640_0056941 | |||
| 1398 | Ga0495586_0016308 | |||
| 1399 | Ga0495586_0338545 | |||
| 1400 | Ga0495587_0017039 | |||
| 1401 | Ga0495587_0018416 | |||
| 1402 | Ga0495645_0016012 | |||
| 1403 | Ga0495645_0032269 | |||
| 1404 | Ga0495645_0262589 | |||
| 1405 | Ga0495645_0309807 | |||
| 1406 | Ga0495667_0085388 | |||
| 1407 | Ga0495667_0100396 | |||
| 1408 | Ga0495667_0734107 | |||
| 1409 | Ga0495634_0023065 | |||
| 1410 | Ga0495634_0032828 | |||
| 1411 | Ga0495634_0408637 | |||
| 1412 | Ga0495635_0109034 | |||
| 1413 | Ga0495635_0109883 | |||
| 1414 | Ga0495635_0339409 | |||
| 1415 | Ga0495657_0077376 | |||
| 1416 | Ga0495657_0277550 | |||
| 1417 | Ga0495599_0020613 | |||
| 1418 | Ga0495599_0100198 | |||
| 1419 | Ga0495599_0188802 | |||
| 1420 | Ga0495623_0026198 | |||
| 1421 | Ga0495623_0263934 | |||
| 1422 | Ga0495623_0690379 | |||
| 1423 | Ga0495646_0032300 | |||
| 1424 | Ga0495646_0059914 | |||
| 1425 | Ga0495646_0070040 | |||
| 1426 | Ga0495647_0228445 | |||
| 1427 | Ga0495658_0228531 | |||
| 1428 | Ga0495613_0036340 | |||
| 1429 | Ga0495613_0270757 | |||
| 1430 | Ga0495613_0896495 | |||
| 1431 | Ga0495624_0012809 | |||
| 1432 | Ga0495624_0159314 | |||
| 1433 | Ga0495600_0025933 | |||
| 1434 | Ga0495600_0099213 | |||
| 1435 | Ga0495581_0238045 | |||
| 1436 | Ga0495604_0035140 | |||
| 1437 | Ga0495604_0112960 | |||
| 1438 | Ga0495674_0004732 | |||
| 1439 | Ga0495674_0081255 | |||
| 1440 | Ga0495674_0261645 | |||
| 1441 | Ga0495674_0351469 | |||
| 1442 | Ga0495676_0669287 | |||
| 1443 | Ga0495680_0041303 | |||
| 1444 | Ga0495680_0110029 | |||
| 1445 | Ga0495675_0006997 | |||
| 1446 | Ga0495675_0197701 | |||
| 1447 | Ga0495684_0012576 | |||
| 1448 | Ga0495684_0135854 | |||
| 1449 | Ga0495684_0834891 | |||
| 1450 | Ga0495593_0003359 | |||
| 1451 | Ga0495602_0051535 | |||
| 1452 | Ga0495602_0083088 | |||
| 1453 | Ga0495614_0055607 | |||
| 1454 | Ga0495626_0326509 | |||
| 1455 | Ga0496100_0145161 | |||
| 1456 | Ga0496100_1363518 | |||
| 1457 | Ga0496101_0651592 | |||
| 1458 | Ga0496102_0343276 | |||
| 1459 | Ga0496102_0688843 | |||
| 1460 | Ga0496102_0837918 | |||
| 1461 | Ga0496102_1310117 | |||
| 1462 | Ga0496103_0374319 | |||
| 1463 | Ga0496103_0521266 | |||
| 1464 | Ga0496104_0650210 | |||
| 1465 | Ga0496105_0324973 | |||
| 1466 | Ga0496105_1176060 | |||
| 1467 | Ga0496105_1334430 | |||
| 1468 | Ga0496106_0187119 | |||
| 1469 | Ga0496106_0213495 | |||
| 1470 | Ga0496107_0689378 | |||
| 1471 | Ga0496108_0551728 | |||
| 1472 | Ga0496110_0121482 | |||
| 1473 | Ga0496110_0134485 | |||
| 1474 | Ga0496110_0206423 | |||
| 1475 | Ga0496110_0340265 | |||
| 1476 | Ga0496110_0885067 | |||
| 1477 | Ga0496111_0070579 | |||
| 1478 | Ga0496111_0174698 | |||
| 1479 | Ga0496111_1000147 | |||
| 1480 | Ga0496113_0107905 | |||
| 1481 | Ga0496113_0716443 | |||
| 1482 | Ga0496114_0618380 | |||
| 1483 | Ga0496114_1009257 | |||
| 1484 | Ga0496117_0001213 | |||
| 1485 | Ga0496118_0053715 | |||
| 1486 | Ga0496122_0209595 | |||
| 1487 | Ga0496125_0087520 | |||
| 1488 | Ga0496125_0127555 | |||
| 1489 | Ga0496126_0920867 | |||
| 1490 | Ga0501306_052741 | |||
| 1491 | Ga0501308_010519 | |||
| 1492 | Ga0501308_030298 | |||
| 1493 | Ga0501309_017765 | |||
| 1494 | Ga0501309_047415 | |||
| 1495 | Ga0501310_026801 | |||
| 1496 | Ga0501304_015101 | |||
| 1497 | Ga0501304_018274 | |||
| 1498 | Ga0501305_014124 | |||
| 1499 | Ga0501305_072459 | |||
| 1500 | Ga0501307_014251 | |||
| 1501 | Ga0501307_021101 | |||
| 1502 | Ga0501307_043302 | |||
| 1503 | Ga0501311_004883 | |||
| 1504 | Ga0501311_063751 | |||
| 1505 | Ga0501312_050537 | |||
| 1506 | Ga0501314_010936 | |||
| 1507 | Ga0501315_092919 | |||
| 1508 | Ga0501316_019558 | |||
| 1509 | Ga0501316_044260 | |||
| 1510 | Ga0501316_052415 | |||
| 1511 | Ga0501317_001780 | |||
| 1512 | Ga0501317_016421 | |||
| 1513 | Ga0501317_023313 | |||
| 1514 | Ga0501317_083741 | |||
| 1515 | Ga0501317_108746 | |||
| 1516 | Ga0501318_003688 | |||
| 1517 | Ga0501318_008212 | |||
| 1518 | Ga0501318_020851 | |||
| 1519 | Ga0501319_006313 | |||
| 1520 | Ga0501321_034590 | |||
| 1521 | Ga0501321_059952 | |||
| 1522 | Ga0501031_0013583 | |||
| 1523 | Ga0501031_0707695 | |||
| 1524 | Ga0501031_0766955 | |||
| 1525 | Ga0501032_0034305 | |||
| 1526 | Ga0501032_0948106 | |||
| 1527 | Ga0501034_0007846 | |||
| 1528 | Ga0501034_0024571 | |||
| 1529 | Ga0501034_0221645 | |||
| 1530 | Ga0501036_0005719 | |||
| 1531 | Ga0501036_0024426 | |||
| 1532 | Ga0501036_0082908 | |||
| 1533 | Ga0501036_0194341 | |||
| 1534 | Ga0501036_0217929 | |||
| 1535 | Ga0501036_0900257 | |||
| 1536 | Ga0501037_0073148 | |||
| 1537 | Ga0501037_0886580 | |||
| 1538 | Ga0501037_1090038 | |||
| 1539 | Ga0501038_0108982 | |||
| 1540 | Ga0501038_0306943 | |||
| 1541 | Ga0501038_0974891 | |||
| 1542 | Ga0501039_0157934 | |||
| 1543 | Ga0501039_0267353 | |||
| 1544 | Ga0501039_0269446 | |||
| 1545 | Ga0501039_0478550 | |||
| 1546 | Ga0501039_0844877 | |||
| 1547 | Ga0501039_0965891 | |||
| 1548 | Ga0501040_0255926 | |||
| 1549 | Ga0501041_0270546 | |||
| 1550 | Ga0501042_0017142 | |||
| 1551 | Ga0501042_0121019 | |||
| 1552 | Ga0501043_0001003 | |||
| 1553 | Ga0501043_0063653 | |||
| 1554 | Ga0501046_0036030 | |||
| 1555 | Ga0501047_0076835 | |||
| 1556 | Ga0501047_0224290 | |||
| 1557 | Ga0501047_0622968 | |||
| 1558 | Ga0501048_0039775 | |||
| 1559 | Ga0501048_0044178 | |||
| 1560 | Ga0501048_0731695 | |||
| 1561 | Ga0501067_0006208 | |||
| 1562 | Ga0501067_0035981 | |||
| 1563 | Ga0501067_0057274 | |||
| 1564 | Ga0501068_0051437 | |||
| 1565 | Ga0501068_0419598 | |||
| 1566 | Ga0501069_0187454 | |||
| 1567 | Ga0501070_0016253 | |||
| 1568 | Ga0501071_0126727 | |||
| 1569 | Ga0501072_0009141 | |||
| 1570 | Ga0501072_0016257 | |||
| 1571 | Ga0501072_0516581 | |||
| 1572 | Ga0501073_0031933 | |||
| 1573 | Ga0501073_0139517 | |||
| 1574 | Ga0501074_0000822 | |||
| 1575 | Ga0501075_0129407 | |||
| 1576 | Ga0501075_0255137 | |||
| 1577 | Ga0501075_0603191 | |||
| 1578 | Ga0501076_0423836 | |||
| 1579 | Ga0501077_0020512 | |||
| 1580 | Ga0501079_0094456 | |||
| 1581 | Ga0501079_0343605 | |||
| 1582 | Ga0501080_0009070 | |||
| 1583 | Ga0501080_0583773 | |||
| 1584 | Ga0501083_0016418 | |||
| 1585 | Ga0501266_099300 | |||
| 1586 | Ga0501035_0111400 | |||
| 1587 | Ga0501035_0550660 | |||
| 1588 | Ga0501035_0749471 | |||
| 1589 | Ga0501044_0051399 | |||
| 1590 | Ga0501044_1079946 | |||
| 1591 | Ga0501044_1620796 | |||
| 1592 | Ga0501045_0073178 | |||
| 1593 | Ga0501045_0306639 | |||
| 1594 | nmdc:mga00v17_288115_c1 | |||
| 1595 | nmdc:mga00v17_470356_c1 | |||
| 1596 | nmdc:mga0yw44_103683_c1 | |||
| 1597 | nmdc:mga0yw44_350502_c1 | |||
| 1598 | nmdc:mga0yw44_752359_c1 | |||
| 1599 | nmdc:mga05p37_73124_c1 | |||
| 1600 | nmdc:mga09592_6091_c1 | |||
| 1601 | nmdc:mga0qj67_336796_c1 | |||
| 1602 | nmdc:mga06r32_83809_c1 | |||
| 1603 | nmdc:mga08y16_1860304_c1 | |||
| 1604 | nmdc:mga08y16_546023_c1 | |||
| 1605 | nmdc:mga0n895_630697_c1 | |||
| 1606 | nmdc:mga0rr50_1486583_c1 | |||
| 1607 | Ga0495601_0035666 | |||
| 1608 | Ga0495601_0106410 | |||
| 1609 | Ga0495601_0191331 | |||
| 1610 | Ga0495601_0618229 | |||
| 1611 | Ga0495612_0034757 | |||
| 1612 | Ga0495612_0082099 | |||
| 1613 | Ga0495612_0153051 | |||
| 1614 | Ga0495612_0168598 | |||
| 1615 | Ga0495655_0099469 | |||
| 1616 | Ga0495595_0040856 | |||
| 1617 | Ga0495595_0148058 | |||
| 1618 | Ga0495619_0017367 | |||
| 1619 | Ga0500566_0216023 | |||
| 1620 | Ga0500620_300858 | |||
| 1621 | Ga0500656_016060 | |||
| 1622 | Ga0501084_0381225 | |||
| 1623 | Ga0501084_0482293 | |||
| 1624 | Ga0501084_1649144 | |||
| 1625 | Ga0587073_0209865 | |||
| 1626 | Ga0587080_027090 | |||
| 1627 | Ga0587080_065085 | |||
| 1628 | Ga0587085_065833 | |||
| 1629 | Ga0587090_082012 | |||
| 1630 | Ga0587125_025058 | |||
| 1631 | Ga0587113_006243 | |||
| 1632 | Ga0587115_035424 | |||
| 1633 | Ga0587062_127378 | |||
| 1634 | Ga0587067_048821 | |||
| 1635 | Ga0587067_070194 | |||
| 1636 | Ga0587067_120993 | |||
| 1637 | Ga0587072_197288 | |||
| 1638 | Ga0587102_019822 | |||
| 1639 | Ga0587114_028412 | |||
| 1640 | Ga0587114_091675 | |||
| 1641 | Ga0587116_10717 | |||
| 1642 | Ga0587119_032663 | |||
| 1643 | Ga0587111_0214419 | |||
| 1644 | Ga0501082_0008677 | |||
| 1645 | Ga0466962_0003191 | |||
| 1646 | Ga0530510_0078800 | |||
| 1647 | 2547412829 | |||
| 1648 | 2554258608 | |||
| 1649 | 2555230040 | |||
| 1650 | 2585319440 | |||
| 1651 | 2643759745 | |||
| 1652 | 2643767741 | |||
| 1653 | 2643944688 | |||
| 1654 | 2644033982 | |||
| 1655 | 2644102714 | |||
| 1656 | 2644111116 | |||
| 1657 | 2644118376 | |||
| 1658 | 2644231320 | |||
| 1659 | 2644269242 | |||
| 1660 | 2644431586 | |||
| 1661 | 2644462838 | |||
| 1662 | 2644625780 | |||
| 1663 | 2655032757 | |||
| 1664 | 2723642061 | |||
| 1665 | 2738871572 | |||
| 1666 | 2740166648 | |||
| 1667 | 2776376159 | |||
| 1668 | 2784587856 | |||
| 1669 | 2808902040 | |||
| 1670 | 2808919772 | |||
| 1671 | 2809231441 | |||
| 1672 | 2812333967 | |||
| 1673 | 2812358997 | |||
| 1674 | 2812481244 | |||
| 1675 | 2819693685 | |||
| 1676 | 2852641260 | |||
| 1677 | 2862389462 | |||
| 1678 | 2862509479 | |||
| 1679 | 2862580010 | |||
| 1680 | 2862995753 | |||
| 1681 | 2863068533 | |||
| 1682 | 2863405543 | |||
| 1683 | 2866556103 | |||
| 1684 | 2867371087 | |||
| 1685 | 2912725026 | |||
| 1686 | 2917737239 | |||
| 1687 | 2918503813 | |||
| 1688 | 2919446189 | |||
| 1689 | 2932398609 | |||
| 1690 | 2935392269 | |||
| 1691 | 2935411411 | |||
| 1692 | 2946033553 | |||
| 1693 | 2946066880 | |||
| 1694 | 2946075202 | |||
| 1695 | 2947230349 | |||
| 1696 | 2954387076 | |||
| 1697 | 2954697912 | |||
| 1698 | 2954704304 | |||
| 1699 | 2966603301 | |||
| 1700 | 2977253822 | |||
| 1701 | 2997608174 | |||
| 1702 | 3006486418 | |||
| 1703 | 3006500963 | |||
| 1704 | 8003318385 | |||
| 1705 | 8008559533 | |||
| 1706 | 8008579622 | |||
| 1707 | 8023630850 | |||
| 1708 | 8025479192 | |||
| 1709 | 8025535129 | |||
| 1710 | 8046356409 | |||
| 1711 | 8055035792 | |||
| 1712 | 8056215721 | |||
| 1713 | 8056673156 | |||
| 1714 | 8056835973 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9488 | 20 | 84 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9468 | 20 | 83 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.943 | 19 | 81 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9349 | 21 | 83 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9214 | 20 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9488 | 20 | 84 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9214 | 20 | 84 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9047 | 21 | 84 | 2.40.50.100 |
| af_Q4DLT4_19_136_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.886 | 21 | 82 | 2.40.50.100 |
| 2ba1A01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8612 | 30 | 81 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5TEY2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9875 | 21 | 81 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A421K8E4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9775 | 21 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A847H8S3-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.974 | 21 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A420Z9C1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9694 | 19 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A421K8E4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9628 | 21 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |