F482671

General Info

Members Datasets Scaffolds Average Seq Length
830 444 821 85

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0037009|Ga0500568_0037009_1458_1745
Length 95
Sequence MAQKKGGGSTRNGRDSQPKMLGVKAYGGQLVSAGSIIVRQRGTRFHAGQNVGMGRDHTLFALVDGKISFTIKGVQSHKFVVVTPVDAPVTVAAEA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221660 Methylibium sp. Root1272 Isolate Unclassified
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
23 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
24 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
41 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
116 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
117 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
118 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
205 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
208 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
228 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
249 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
250 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
251 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
254 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
255 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
256 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
257 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
258 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
259 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
260 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
261 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
262 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
263 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
266 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
267 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
270 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
271 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
272 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
273 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
274 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
275 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
278 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
281 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
282 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
283 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
284 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
285 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
286 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
287 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
288 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
289 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
290 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
291 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
292 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
293 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
294 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
295 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
296 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
297 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
298 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
301 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
302 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
303 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
304 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
305 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
306 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
314 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
315 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
319 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
323 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
335 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
336 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
357 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
383 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
384 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
385 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
386 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
389 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
390 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
394 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
395 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
396 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
397 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
398 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
399 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
406 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
409 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
410 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
411 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
412 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
413 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
414 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
415 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
416 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
417 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
420 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
421 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
422 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
423 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
424 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
425 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
426 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
427 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
428 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
429 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
430 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
431 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
432 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
433 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
444 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.87
Metatranscriptomes 12.05
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.33
Nodule 0.24
Rhizoplane 4.7
Rhizosphere 67.47
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_638870 2162886006 Bacteria 934
2 JGI24740J21852_10035537 3300001979 Bacteria 1557
3 JGI24735J21928_10185972 3300002067 Bacteria 602
4 JGI24744J21845_10075619 3300002077 Bacteria 614
5 JGI25152J39213_1000892 3300002773 Bacteria 14659
6 JGI25150J39212_1002313 3300002774 Bacteria 4795
7 Ga0006778J45830_1018330 3300003162 Bacteria 699
8 Ga0006759J45824_1013933 3300003163 Bacteria 664
9 Ga0006759J45824_1017103 3300003163 Bacteria 699
10 Ga0006759J45824_1023259 3300003163 Bacteria 622
11 JGI25153J46596_10000420 3300003215 Bacteria 27768
12 Ga0006770J48903_1013780 3300003305 Bacteria 699
13 rootH1_10043230 3300003316 Bacteria 1924
14 rootL2_10005413 3300003322 Bacteria 3367
15 rootL2_10083805 3300003322 Bacteria 2725
16 JGI26128J50194_1000218 3300003347 Bacteria 2744
17 JGI26145J50221_1002388 3300003371 Bacteria 1477
18 Ga0007417J51691_1011360 3300003544 Bacteria 666
19 Ga0007417J51691_1011711 3300003544 Bacteria 699
20 Ga0007417J51691_1017103 3300003544 Bacteria 613
21 Ga0007417J51691_1045595 3300003544 Bacteria 733
22 Ga0007417J51691_1114763 3300003544 Bacteria 634
23 Ga0007427J51700_112861 3300003559 Bacteria 699
24 Ga0007410J51695_1004507 3300003574 Bacteria 1438
25 Ga0007410J51695_1011000 3300003574 Bacteria 667
26 Ga0007410J51695_1022391 3300003574 Bacteria 699
27 Ga0007409J51694_1012913 3300003575 Bacteria 598
28 Ga0007409J51694_1014513 3300003575 Bacteria 706
29 Ga0007409J51694_1027825 3300003575 Bacteria 662
30 Ga0007416J51690_1023874 3300003577 Bacteria 759
31 Ga0007416J51690_1026130 3300003577 Bacteria 611
32 Ga0007416J51690_1065410 3300003577 Bacteria 552
33 Ga0007429J51699_1012803 3300003579 Bacteria 598
34 Ga0007411J51799_105540 3300003611 Bacteria 710
35 Ga0007411J51799_112204 3300003611 Bacteria 566
36 Ga0007415J51800_103902 3300003613 Bacteria 713
37 Ga0032354_1016521 3300003693 Bacteria 766
38 Ga0032354_1024639 3300003693 Bacteria 697
39 Ga0032354_1031837 3300003693 Bacteria 646
40 Ga0032354_1037179 3300003693 Bacteria 826
41 Ga0006780_1017431 3300003735 Bacteria 639
42 Ga0055539_1012687 3300003752 Bacteria 1035
43 Ga0055526_1014626 3300003771 Bacteria 3211
44 Ga0055524_1000109 3300003775 Bacteria 100308
45 Ga0055530_10003385 3300003791 Bacteria 9105
46 Ga0055530_10034055 3300003791 Bacteria 1305
47 Ga0055540_1000013 3300003792 Bacteria 262274
48 Ga0055540_1009236 3300003792 Bacteria 3430
49 Ga0055540_1017082 3300003792 Bacteria 2037
50 Ga0055540_1095489 3300003792 Bacteria 558
51 Ga0055540_1112322 3300003792 Bacteria 502
52 Ga0055531_10000158 3300003794 Bacteria 77918
53 Ga0055531_10005660 3300003794 Bacteria 7260
54 Ga0058859_11701938 3300004798 Bacteria 662
55 Ga0058859_11819676 3300004798 Bacteria 766
56 Ga0058859_11829144 3300004798 Bacteria 590
57 Ga0058863_10004931 3300004799 Bacteria 597
58 Ga0058863_11886072 3300004799 Bacteria 721
59 Ga0058861_12046980 3300004800 Bacteria 576
60 Ga0058860_10070410 3300004801 Bacteria 653
61 Ga0058860_12216250 3300004801 Bacteria 863
62 Ga0065165_1002013 3300005262 Bacteria 18978
63 Ga0065165_1080711 3300005262 Bacteria 845
64 Ga0065704_10527730 3300005289 Bacteria 648
65 Ga0065707_10082503 3300005295 Bacteria 14412
66 Ga0065707_11023718 3300005295 Bacteria 533
67 Ga0070658_10068891 3300005327 Bacteria 2893
68 Ga0070658_10320018 3300005327 Bacteria 1324
69 Ga0070658_10534964 3300005327 Bacteria 1013
70 Ga0070658_10649110 3300005327 Bacteria 915
71 Ga0070677_10087294 3300005333 Bacteria 1349
72 Ga0068869_100297442 3300005334 Bacteria 1302
73 Ga0068869_101128982 3300005334 Bacteria 687
74 Ga0070680_100134810 3300005336 Bacteria 2068
75 Ga0070682_100267190 3300005337 Bacteria 1241
76 Ga0068868_100229049 3300005338 Bacteria 1558
77 Ga0070660_100070483 3300005339 Bacteria 2728
78 Ga0070660_100108958 3300005339 Bacteria 2202
79 Ga0070660_100973026 3300005339 Bacteria 717
80 Ga0070687_101193445 3300005343 Bacteria 561
81 Ga0070661_100126267 3300005344 Bacteria 1919
82 Ga0070661_100748768 3300005344 Bacteria 799
83 Ga0070668_100128990 3300005347 Bacteria 2028
84 Ga0070669_100054025 3300005353 Bacteria 2941
85 Ga0070671_101356837 3300005355 Bacteria 628
86 Ga0070674_100113587 3300005356 Bacteria 1993
87 Ga0070674_100671121 3300005356 Bacteria 883
88 Ga0070673_101356170 3300005364 Bacteria 669
89 Ga0070659_100008466 3300005366 Bacteria 7516
90 Ga0070667_100116760 3300005367 Bacteria 2318
91 Ga0070667_100145381 3300005367 Bacteria 2079
92 Ga0070700_100058250 3300005441 Bacteria 2426
93 Ga0070663_100125498 3300005455 Bacteria 1944
94 Ga0070663_100377465 3300005455 Bacteria 1154
95 Ga0070678_100020291 3300005456 Bacteria 4357
96 Ga0070678_101574061 3300005456 Bacteria 617
97 Ga0070681_10528773 3300005458 Bacteria 1093
98 Ga0068867_100001947 3300005459 Bacteria 14386
99 Ga0068867_101294889 3300005459 Bacteria 672
100 Ga0068867_101571629 3300005459 Bacteria 614
101 Ga0070706_100002083 3300005467 Bacteria 20391
102 Ga0070706_101829860 3300005467 Bacteria 552
103 Ga0070698_100128634 3300005471 Bacteria 2489
104 Ga0070699_100243867 3300005518 Bacteria 1605
105 Ga0070679_100212564 3300005530 Bacteria 1897
106 Ga0070679_100500176 3300005530 Bacteria 1159
107 Ga0070684_101644640 3300005535 Bacteria 606
108 Ga0068853_101067456 3300005539 Bacteria 778
109 Ga0070672_101355696 3300005543 Bacteria 636
110 Ga0070665_100842570 3300005548 Bacteria 930
111 Ga0070665_100928564 3300005548 Bacteria 883
112 Ga0068855_100032613 3300005563 Bacteria 6218
113 Ga0068855_100120364 3300005563 Bacteria 3005
114 Ga0068855_100142205 3300005563 Bacteria 2733
115 Ga0068852_100089473 3300005616 Bacteria 2752
116 Ga0068852_101219474 3300005616 Bacteria 773
117 Ga0068859_101381555 3300005617 Bacteria 777
118 Ga0068864_100200723 3300005618 Bacteria 1832
119 Ga0068864_100536369 3300005618 Bacteria 1130
120 Ga0068864_101282041 3300005618 Bacteria 733
121 Ga0068866_10003673 3300005718 Bacteria 6287
122 Ga0068861_100006327 3300005719 Bacteria 8059
123 Ga0068861_101944555 3300005719 Bacteria 586
124 Ga0068863_100071767 3300005841 Bacteria 3275
125 Ga0068863_100608432 3300005841 Bacteria 1082
126 Ga0068863_101633437 3300005841 Bacteria 654
127 Ga0068858_101353515 3300005842 Bacteria 701
128 Ga0068858_102085773 3300005842 Bacteria 561
129 Ga0068860_100002278 3300005843 Bacteria 20163
130 Ga0068860_101796647 3300005843 Bacteria 635
131 Ga0068862_100673631 3300005844 Bacteria 1000
132 Ga0075365_10023056 3300006038 Bacteria 3911
133 Ga0075365_10038406 3300006038 Bacteria 3112
134 Ga0075365_10144102 3300006038 Bacteria 1655
135 Ga0075365_10146992 3300006038 Bacteria 1638
136 Ga0075365_10986743 3300006038 Bacteria 594
137 Ga0075368_10050993 3300006042 Bacteria 1645
138 Ga0075368_10084772 3300006042 Bacteria 1292
139 Ga0075368_10242439 3300006042 Bacteria 769
140 Ga0075363_100019150 3300006048 Bacteria 3420
141 Ga0075363_100054717 3300006048 Bacteria 2135
142 Ga0075363_100100193 3300006048 Bacteria 1602
143 Ga0075363_100133175 3300006048 Bacteria 1395
144 Ga0075363_100410322 3300006048 Bacteria 797
145 Ga0075363_100698830 3300006048 Bacteria 612
146 Ga0075363_100727169 3300006048 Bacteria 600
147 Ga0075364_10241644 3300006051 Bacteria 1226
148 Ga0075364_10439091 3300006051 Bacteria 892
149 Ga0075364_10944518 3300006051 Bacteria 587
150 Ga0075362_10043584 3300006177 Bacteria 1987
151 Ga0075362_10052438 3300006177 Bacteria 1828
152 Ga0075362_10057331 3300006177 Bacteria 1755
153 Ga0075362_10164527 3300006177 Bacteria 1069
154 Ga0075362_10182982 3300006177 Bacteria 1016
155 Ga0075362_10242245 3300006177 Bacteria 886
156 Ga0075362_10718003 3300006177 Bacteria 522
157 Ga0075367_10006143 3300006178 Bacteria 6043
158 Ga0075367_10007325 3300006178 Bacteria 5643
159 Ga0075367_10026991 3300006178 Bacteria 3262
160 Ga0075367_10399051 3300006178 Bacteria 870
161 Ga0075369_10021846 3300006186 Bacteria 2635
162 Ga0075369_10031196 3300006186 Bacteria 2248
163 Ga0075366_10014821 3300006195 Bacteria 4458
164 Ga0075366_10035470 3300006195 Bacteria 2940
165 Ga0075366_10041460 3300006195 Bacteria 2725
166 Ga0075366_10050690 3300006195 Bacteria 2465
167 Ga0075366_10088935 3300006195 Bacteria 1849
168 Ga0075366_10103320 3300006195 Bacteria 1711
169 Ga0075366_10127248 3300006195 Bacteria 1537
170 Ga0075366_10144411 3300006195 Bacteria 1439
171 Ga0075366_10240950 3300006195 Bacteria 1102
172 Ga0075366_10246833 3300006195 Bacteria 1089
173 Ga0075366_10254499 3300006195 Bacteria 1071
174 Ga0075366_10326500 3300006195 Bacteria 940
175 Ga0075370_10002426 3300006353 Bacteria 8638
176 Ga0075370_10002528 3300006353 Bacteria 8493
177 Ga0075370_10015050 3300006353 Bacteria 4135
178 Ga0075370_10232171 3300006353 Bacteria 1092
179 Ga0075370_10252821 3300006353 Bacteria 1045
180 Ga0068871_101698157 3300006358 Bacteria 599
181 Ga0068871_102191088 3300006358 Bacteria 527
182 Ga0075428_100473805 3300006844 Bacteria 1340
183 Ga0075430_100033190 3300006846 Bacteria 4382
184 Ga0075431_101382757 3300006847 Bacteria 664
185 Ga0075429_100074259 3300006880 Bacteria 2962
186 Ga0068865_100031867 3300006881 Bacteria 3518
187 Ga0097620_101381565 3300006931 Bacteria 777
188 Ga0079104_1000001 3300006946 Bacteria 521847
189 Ga0105240_10017122 3300009093 Bacteria 9784
190 Ga0105240_11888680 3300009093 Bacteria 621
191 Ga0111539_10608222 3300009094 Bacteria 1273
192 Ga0111539_13201018 3300009094 Bacteria 528
193 Ga0105245_10170491 3300009098 Bacteria 2072
194 Ga0105245_10311700 3300009098 Bacteria 1547
195 Ga0105245_11663801 3300009098 Bacteria 690
196 Ga0105247_10944305 3300009101 Bacteria 669
197 Ga0114129_12840635 3300009147 Bacteria 574
198 Ga0105241_10083226 3300009174 Bacteria 2510
199 Ga0105242_10469742 3300009176 Bacteria 1190
200 Ga0105248_10721083 3300009177 Bacteria 1125
201 Ga0105248_10854833 3300009177 Bacteria 1027
202 Ga0105248_11268854 3300009177 Bacteria 833
203 Ga0105237_10518801 3300009545 Bacteria 1198
204 Ga0105237_10675960 3300009545 Bacteria 1039
205 Ga0105238_10145507 3300009551 Bacteria 2346
206 Ga0105238_10594850 3300009551 Bacteria 1114
207 Ga0105238_10794777 3300009551 Bacteria 961
208 Ga0105238_10872399 3300009551 Bacteria 917
209 Ga0105249_10037455 3300009553 Bacteria 4402
210 Ga0105249_11185643 3300009553 Bacteria 834
211 Ga0105239_10804060 3300010375 Bacteria 1077
212 Ga0157319_1021801 3300012497 Bacteria 628
213 Ga0157324_1059132 3300012506 Bacteria 520
214 Ga0157327_1010021 3300012512 Bacteria 886
215 Ga0157326_1076205 3300012513 Bacteria 541
216 Ga0157374_10236650 3300013296 Bacteria 1795
217 Ga0157374_10691420 3300013296 Bacteria 1033
218 Ga0157378_10015555 3300013297 Bacteria 6664
219 Ga0157378_10206273 3300013297 Bacteria 1861
220 Ga0157378_10551355 3300013297 Bacteria 1158
221 Ga0157378_11520289 3300013297 Bacteria 714
222 Ga0157378_11659920 3300013297 Bacteria 685
223 Ga0163162_10280517 3300013306 Bacteria 1798
224 Ga0157372_12402095 3300013307 Bacteria 605
225 Ga0157372_12455151 3300013307 Bacteria 598
226 Ga0157372_12707485 3300013307 Bacteria 569
227 Ga0157375_10717041 3300013308 Bacteria 1153
228 Ga0163163_11320509 3300014325 Bacteria 783
229 Ga0182008_10401829 3300014497 Bacteria 736
230 Ga0182008_10759152 3300014497 Bacteria 559
231 Ga0157379_10591784 3300014968 Bacteria 1035
232 Ga0157379_11390960 3300014968 Bacteria 680
233 Ga0157376_10049735 3300014969 Bacteria 3473
234 Ga0157376_10531467 3300014969 Bacteria 1161
235 Ga0157376_10558338 3300014969 Bacteria 1134
236 Ga0182007_10088519 3300015262 Bacteria 1019
237 Ga0182007_10202316 3300015262 Bacteria 695
238 Ga0163161_10230509 3300017792 Bacteria 1437
239 Ga0163161_10658434 3300017792 Bacteria 868
240 Ga0197907_10563325 3300020069 Bacteria 786
241 Ga0206355_1480352 3300020076 Bacteria 720
242 Ga0213872_10038378 3300021361 Bacteria 2186
243 Ga0213872_10060580 3300021361 Bacteria 1711
244 Ga0207425_1000221 3300025245 Bacteria 44837
245 Ga0209677_107129 3300025253 Bacteria 2452
246 Ga0209129_1000012 3300025258 Bacteria 541516
247 Ga0209129_1037315 3300025258 Bacteria 783
248 Ga0209129_1059813 3300025258 Bacteria 566
249 Ga0209129_1060622 3300025258 Bacteria 560
250 Ga0209565_1007217 3300025263 Bacteria 3022
251 Ga0209673_1002136 3300025273 Bacteria 14727
252 Ga0209673_1019202 3300025273 Bacteria 2462
253 Ga0209673_1025942 3300025273 Bacteria 1937
254 Ga0209675_1093185 3300025291 Bacteria 541
255 Ga0209564_1000022 3300025295 Bacteria 555109
256 Ga0209758_1000124 3300025297 Bacteria 189933
257 Ga0209758_1000234 3300025297 Bacteria 116217
258 Ga0209758_1050104 3300025297 Bacteria 1467
259 Ga0209050_1000315 3300025298 Bacteria 98447
260 Ga0209050_1001261 3300025298 Bacteria 29214
261 Ga0209256_1000015 3300025299 Bacteria 622953
262 Ga0209256_1061637 3300025299 Bacteria 871
263 Ga0209051_1000022 3300025303 Bacteria 474879
264 Ga0209051_1000315 3300025303 Bacteria 73579
265 Ga0209051_1031528 3300025303 Bacteria 2037
266 Ga0209051_1044906 3300025303 Bacteria 1535
267 Ga0209051_1070569 3300025303 Bacteria 1053
268 Ga0209257_1000030 3300025304 Bacteria 689812
269 Ga0209257_1000309 3300025304 Bacteria 104166
270 Ga0209257_1017837 3300025304 Bacteria 2771
271 Ga0209257_1043746 3300025304 Bacteria 1311
272 Ga0209257_1149665 3300025304 Bacteria 515
273 Ga0207642_10006139 3300025899 Bacteria 3976
274 Ga0207705_10128716 3300025909 Bacteria 1883
275 Ga0207705_10451851 3300025909 Bacteria 996
276 Ga0207705_10532263 3300025909 Bacteria 913
277 Ga0207705_10708206 3300025909 Bacteria 782
278 Ga0207705_10870637 3300025909 Bacteria 698
279 Ga0207684_10004074 3300025910 Bacteria 13941
280 Ga0207684_10552915 3300025910 Bacteria 985
281 Ga0207654_10058756 3300025911 Bacteria 2240
282 Ga0207707_10242094 3300025912 Bacteria 1568
283 Ga0207707_10262963 3300025912 Bacteria 1497
284 Ga0207695_10036310 3300025913 Bacteria 5330
285 Ga0207671_10459625 3300025914 Bacteria 1014
286 Ga0207660_10235701 3300025917 Bacteria 1440
287 Ga0207662_10639229 3300025918 Bacteria 742
288 Ga0207657_10028808 3300025919 Bacteria 5060
289 Ga0207657_10118894 3300025919 Bacteria 2175
290 Ga0207657_10624643 3300025919 Bacteria 840
291 Ga0207657_10774667 3300025919 Bacteria 742
292 Ga0207657_11053164 3300025919 Bacteria 623
293 Ga0207649_10002064 3300025920 Bacteria 11416
294 Ga0207649_10628388 3300025920 Bacteria 828
295 Ga0207652_10077772 3300025921 Bacteria 2896
296 Ga0207646_10294313 3300025922 Bacteria 1467
297 Ga0207681_10603067 3300025923 Bacteria 907
298 Ga0207694_10242803 3300025924 Bacteria 1472
299 Ga0207694_10561120 3300025924 Bacteria 959
300 Ga0207687_10011249 3300025927 Bacteria 5845
301 Ga0207687_10319509 3300025927 Bacteria 1256
302 Ga0207644_10629291 3300025931 Bacteria 892
303 Ga0207690_10036483 3300025932 Bacteria 3184
304 Ga0207690_10128789 3300025932 Bacteria 1849
305 Ga0207690_11192968 3300025932 Bacteria 635
306 Ga0207690_11317780 3300025932 Bacteria 603
307 Ga0207669_10273879 3300025937 Bacteria 1269
308 Ga0207704_10001183 3300025938 Bacteria 11632
309 Ga0207665_10767968 3300025939 Bacteria 760
310 Ga0207691_10245468 3300025940 Bacteria 1547
311 Ga0207689_10119995 3300025942 Bacteria 2163
312 Ga0207689_10963758 3300025942 Bacteria 720
313 Ga0207689_11132038 3300025942 Bacteria 659
314 Ga0207679_10000671 3300025945 Bacteria 22930
315 Ga0207679_10250461 3300025945 Bacteria 1505
316 Ga0207667_10093668 3300025949 Bacteria 3102
317 Ga0207667_10154780 3300025949 Bacteria 2359
318 Ga0207667_11245366 3300025949 Bacteria 722
319 Ga0207712_10077901 3300025961 Bacteria 2404
320 Ga0207668_10108702 3300025972 Bacteria 2076
321 Ga0207668_11697051 3300025972 Bacteria 570
322 Ga0207658_10383710 3300025986 Bacteria 1231
323 Ga0207677_10074561 3300026023 Bacteria 2408
324 Ga0207677_10093561 3300026023 Bacteria 2192
325 Ga0207703_11376543 3300026035 Bacteria 679
326 Ga0207703_11460681 3300026035 Bacteria 658
327 Ga0207703_11577849 3300026035 Bacteria 631
328 Ga0207639_11879807 3300026041 Bacteria 559
329 Ga0207678_10328650 3300026067 Bacteria 1316
330 Ga0207678_10404304 3300026067 Bacteria 1182
331 Ga0207678_10665796 3300026067 Bacteria 915
332 Ga0207708_10094171 3300026075 Bacteria 2312
333 Ga0207702_10877865 3300026078 Bacteria 888
334 Ga0207641_10053268 3300026088 Bacteria 3429
335 Ga0207641_11513988 3300026088 Bacteria 673
336 Ga0207641_12351324 3300026088 Bacteria 532
337 Ga0207648_10026441 3300026089 Bacteria 5156
338 Ga0207648_10108549 3300026089 Bacteria 2436
339 Ga0207648_11932623 3300026089 Bacteria 551
340 Ga0207676_10169748 3300026095 Bacteria 1899
341 Ga0207674_10521733 3300026116 Bacteria 1148
342 Ga0207675_100021908 3300026118 Bacteria 5949
343 Ga0207675_100985369 3300026118 Bacteria 861
344 Ga0207675_101352285 3300026118 Bacteria 733
345 Ga0207675_101384761 3300026118 Bacteria 724
346 Ga0207683_10567937 3300026121 Bacteria 1049
347 Ga0207683_11310273 3300026121 Bacteria 670
348 Ga0207683_11640870 3300026121 Bacteria 592
349 Ga0207698_10010712 3300026142 Bacteria 5914
350 Ga0207698_10160408 3300026142 Bacteria 1966
351 Ga0209281_1000057 3300027111 Bacteria 307145
352 Ga0209973_1035866 3300027252 Bacteria 714
353 Ga0209969_1016260 3300027360 Bacteria 1090
354 Ga0209981_1041424 3300027378 Bacteria 689
355 Ga0209996_1000964 3300027395 Bacteria 3416
356 Ga0209995_1000738 3300027471 Bacteria 5005
357 Ga0209968_1000202 3300027526 Bacteria 10389
358 Ga0209999_1006976 3300027543 Bacteria 2031
359 Ga0209999_1052179 3300027543 Bacteria 773
360 Ga0209970_1020316 3300027614 Bacteria 1122
361 Ga0210002_1036330 3300027617 Bacteria 829
362 Ga0209966_1000017 3300027695 Bacteria 71183
363 Ga0209813_10048962 3300027866 Bacteria 1314
364 Ga0209813_10097874 3300027866 Bacteria 994
365 Ga0209813_10411064 3300027866 Bacteria 547
366 Ga0209974_10000240 3300027876 Bacteria 17737
367 Ga0209974_10081232 3300027876 Bacteria 1116
368 Ga0268266_11434181 3300028379 Bacteria 666
369 Ga0268265_10962979 3300028380 Bacteria 841
370 Ga0268264_10050685 3300028381 Bacteria 3457
371 Ga0268264_11476563 3300028381 Bacteria 690
372 Ga0307517_10060779 3300028786 Bacteria 3588
373 Ga0307517_10064548 3300028786 Bacteria 3402
374 Ga0307515_10000354 3300028794 Bacteria 112621
375 Ga0307515_10007796 3300028794 Bacteria 21069
376 Ga0307515_10022668 3300028794 Bacteria 11052
377 Ga0307512_10021785 3300030522 Bacteria 5773
378 Ga0316180_1130869 3300030736 Bacteria 605
379 Ga0265332_10007658 3300031238 Bacteria 4880
380 Ga0265328_10019266 3300031239 Bacteria 2623
381 Ga0265328_10179358 3300031239 Bacteria 801
382 Ga0265329_10039870 3300031242 Bacteria 1508
383 Ga0265327_10000056 3300031251 Bacteria 243974
384 Ga0307513_10041205 3300031456 Bacteria 5100
385 Ga0307513_10456071 3300031456 Bacteria 1002
386 Ga0307509_10022375 3300031507 Bacteria 7127
387 Ga0307509_10305886 3300031507 Bacteria 1335
388 Ga0307509_10529316 3300031507 Bacteria 859
389 Ga0307509_11003006 3300031507 Bacteria 502
390 Ga0307408_101392350 3300031548 Bacteria 660
391 Ga0307408_101930907 3300031548 Bacteria 566
392 Ga0307508_10000043 3300031616 Bacteria 143889
393 Ga0307508_10819637 3300031616 Bacteria 549
394 Ga0307514_10001251 3300031649 Bacteria 33354
395 Ga0307514_10048623 3300031649 Bacteria 3303
396 Ga0307514_10448787 3300031649 Bacteria 635
397 Ga0265314_10004112 3300031711 Bacteria 13711
398 Ga0316576_10491434 3300031727 Bacteria 903
399 Ga0316576_11080681 3300031727 Bacteria 569
400 Ga0307516_10001691 3300031730 Bacteria 30381
401 Ga0307516_10050533 3300031730 Bacteria 4079
402 Ga0307516_10098801 3300031730 Bacteria 2737
403 Ga0307516_10448454 3300031730 Bacteria 947
404 Ga0307516_10643754 3300031730 Bacteria 715
405 Ga0307405_11725080 3300031731 Bacteria 555
406 Ga0316577_10131901 3300031733 Bacteria 1406
407 Ga0307413_10482850 3300031824 Bacteria 991
408 Ga0307413_11432399 3300031824 Bacteria 609
409 Ga0307410_11245878 3300031852 Bacteria 649
410 Ga0307406_10708777 3300031901 Bacteria 841
411 Ga0307406_10776367 3300031901 Bacteria 807
412 Ga0307412_10042383 3300031911 Bacteria 2957
413 Ga0307412_10258838 3300031911 Bacteria 1355
414 Ga0307412_10394411 3300031911 Bacteria 1125
415 Ga0307412_11123125 3300031911 Bacteria 700
416 Ga0307409_102287656 3300031995 Bacteria 570
417 Ga0307416_100080904 3300032002 Bacteria 2744
418 Ga0307416_101782698 3300032002 Bacteria 720
419 Ga0307416_103122858 3300032002 Bacteria 554
420 Ga0307416_103612871 3300032002 Bacteria 518
421 Ga0307416_103739296 3300032002 Bacteria 509
422 Ga0307411_10772200 3300032005 Bacteria 844
423 Ga0316585_10170124 3300032137 Bacteria 720
424 Ga0316593_10285432 3300032168 Bacteria 622
425 Ga0307507_10033702 3300033179 Bacteria 5310
426 Ga0316588_1144172 3300033528 Bacteria 609
427 Ga0316596_1120524 3300033541 Bacteria 714
428 Ga0373944_0006303 3300035089 Bacteria 3146
429 Ga0373941_0524949 3300035115 Bacteria 507
430 Ga0373945_0136824 3300035116 Bacteria 985
431 Ga0316574_0062386 3300035398 Bacteria 2342
432 Ga0373931_0007108 3300035691 Bacteria 5263
433 Ga0373931_0262302 3300035691 Bacteria 1055
434 Ga0373927_0048447 3300035695 Bacteria 2749
435 Ga0316582_0474042 3300036647 Bacteria 863
436 Ga0316584_0159207 3300036712 Bacteria 1678
437 Ga0373925_0046159 3300037068 Bacteria 3238
438 Ga0395899_0011812 3300037312 Bacteria 6684
439 Ga0395899_0028736 3300037312 Bacteria 4184
440 Ga0395899_0037196 3300037312 Bacteria 3649
441 Ga0395899_0965304 3300037312 Bacteria 516
442 Ga0395900_0006372 3300037418 Bacteria 12301
443 Ga0395900_0035948 3300037418 Bacteria 5104
444 Ga0395900_0132373 3300037418 Bacteria 2555
445 Ga0395900_0286476 3300037418 Bacteria 1637
446 Ga0395900_0517106 3300037418 Bacteria 1142
447 Ga0395900_1754385 3300037418 Bacteria 531
448 Ga0395898_0010814 3300037466 Bacteria 9535
449 Ga0395898_0036421 3300037466 Bacteria 4885
450 Ga0395898_0058613 3300037466 Bacteria 3748
451 Ga0395898_0107134 3300037466 Bacteria 2680
452 Ga0395905_0000088 3300037471 Bacteria 152506
453 Ga0395905_0000572 3300037471 Bacteria 49936
454 Ga0395905_0011982 3300037471 Bacteria 8361
455 Ga0395905_0012026 3300037471 Bacteria 8346
456 Ga0395905_0014382 3300037471 Bacteria 7560
457 Ga0395905_0027418 3300037471 Bacteria 5371
458 Ga0395905_0059072 3300037471 Bacteria 3585
459 Ga0395905_0060108 3300037471 Bacteria 3553
460 Ga0395905_0062421 3300037471 Bacteria 3485
461 Ga0395905_0069463 3300037471 Bacteria 3299
462 Ga0395905_0967167 3300037471 Bacteria 754
463 Ga0395905_1095994 3300037471 Bacteria 699
464 Ga0395905_1101169 3300037471 Bacteria 697
465 Ga0395901_0123193 3300038443 Bacteria 2724
466 Ga0395901_0195280 3300038443 Bacteria 2122
467 Ga0395901_0352224 3300038443 Bacteria 1519
468 Ga0395901_0388373 3300038443 Bacteria 1435
469 Ga0395901_0543406 3300038443 Bacteria 1178
470 Ga0395901_1077478 3300038443 Bacteria 775
471 Ga0395901_1483466 3300038443 Bacteria 634
472 Ga0436365_0965563 3300039437 Bacteria 969
473 Ga0436365_1322651 3300039437 Bacteria 521
474 Ga0436365_1608897 3300039437 Bacteria 678
475 Ga0436361_0577382 3300039447 Bacteria 5391
476 Ga0436361_0675139 3300039447 Bacteria 672
477 Ga0436361_0701864 3300039447 Bacteria 6726
478 Ga0436361_0944371 3300039447 Bacteria 6799
479 Ga0436361_1218189 3300039447 Bacteria 9496
480 Ga0439439_0029533 3300041406 Bacteria 1391
481 Ga0439453_0002156 3300041408 Bacteria 2671
482 Ga0439453_0180403 3300041408 Bacteria 515
483 Ga0439461_0015886 3300041410 Bacteria 1447
484 Ga0439461_0078680 3300041410 Bacteria 775
485 Ga0439461_0226220 3300041410 Bacteria 512
486 Ga0439466_0154303 3300041411 Bacteria 703
487 Ga0439465_0115913 3300041413 Bacteria 936
488 Ga0451787_747456 3300041441 Bacteria 1072
489 Ga0451789_0263010 3300041443 Bacteria 535
490 Ga0451789_0994690 3300041443 Bacteria 521
491 Ga0451790_40937 3300041444 Bacteria 728
492 Ga0451792_07629 3300041445 Bacteria 737
493 Ga0451791_0119703 3300041451 Bacteria 592
494 Ga0451791_0434493 3300041451 Bacteria 1543
495 Ga0451791_1528259 3300041451 Bacteria 642
496 Ga0451793_0444831 3300041452 Bacteria 1014
497 Ga0451797_0400801 3300041453 Bacteria 553
498 Ga0451795_0317897 3300041456 Bacteria 550
499 Ga0451795_0606043 3300041456 Bacteria 1025
500 Ga0451795_0709851 3300041456 Bacteria 613
501 Ga0451803_10289 3300041457 Bacteria 769
502 Ga0451798_0906264 3300041458 Bacteria 2347
503 Ga0451798_1010413 3300041458 Bacteria 526
504 Ga0451800_1407603 3300041459 Bacteria 812
505 Ga0451802_0165900 3300041460 Bacteria 1265
506 Ga0451802_1253790 3300041460 Bacteria 1899
507 Ga0451805_035215 3300041461 Bacteria 852
508 Ga0451805_050872 3300041461 Bacteria 709
509 Ga0451805_062719 3300041461 Bacteria 687
510 Ga0451804_0524043 3300041463 Bacteria 2620
511 Ga0451808_17493 3300041464 Bacteria 639
512 Ga0451807_0330362 3300041486 Bacteria 1112
513 Ga0451807_2270138 3300041486 Bacteria 564
514 Ga0451833_0330071 3300041491 Bacteria 1534
515 Ga0451833_0655318 3300041491 Bacteria 687
516 Ga0451835_0694273 3300041492 Bacteria 999
517 Ga0451837_1774988 3300041494 Bacteria 540
518 Ga0451841_0105846 3300041498 Bacteria 888
519 Ga0451841_0671554 3300041498 Bacteria 867
520 Ga0451841_1145597 3300041498 Bacteria 755
521 Ga0451845_0164481 3300041501 Bacteria 584
522 Ga0451847_0278715 3300041503 Bacteria 879
523 Ga0451850_04492 3300041506 Bacteria 577
524 Ga0451853_1259832 3300041512 Bacteria 1233
525 Ga0451853_1473800 3300041512 Bacteria 2221
526 Ga0452268_35386 3300041907 Bacteria 821
527 Ga0439432_068608 3300042006 Bacteria 1084
528 Ga0439449_0002153 3300042007 Bacteria 7734
529 Ga0439451_041027 3300042009 Bacteria 929
530 Ga0439457_008880 3300042014 Bacteria 2355
531 Ga0439457_149134 3300042014 Bacteria 562
532 Ga0450914_028955 3300042118 Bacteria 658
533 Ga0450914_048956 3300042118 Bacteria 553
534 Ga0450919_001279 3300042121 Bacteria 3288
535 Ga0450920_139938 3300042122 Bacteria 512
536 Ga0450890_015301 3300042127 Bacteria 1009
537 Ga0450894_027161 3300042131 Bacteria 788
538 Ga0450896_034195 3300042133 Bacteria 777
539 Ga0450898_006396 3300042134 Bacteria 1807
540 Ga0450898_155362 3300042134 Bacteria 502
541 Ga0439446_0049193 3300042156 Bacteria 1256
542 Ga0439458_0032273 3300042157 Bacteria 1251
543 Ga0439458_0053237 3300042157 Bacteria 1001
544 Ga0439434_0065387 3300042435 Bacteria 1141
545 Ga0439434_0316525 3300042435 Bacteria 541
546 Ga0439459_0143401 3300042438 Bacteria 619
547 Ga0439464_0007196 3300042439 Bacteria 2908
548 Ga0450916_044966 3300042530 Bacteria 682
549 Ga0450918_000202 3300042531 Bacteria 13469
550 Ga0450893_0001535 3300042532 Bacteria 3547
551 Ga0451577_0002525 3300042876 Bacteria 21654
552 Ga0451577_0045489 3300042876 Bacteria 3929
553 Ga0451577_0056391 3300042876 Bacteria 3504
554 Ga0451577_1605171 3300042876 Bacteria 574
555 Ga0466969_0000008 3300044656 Bacteria 139607
556 Ga0466969_0003553 3300044656 Bacteria 8290
557 Ga0466969_0009510 3300044656 Bacteria 5154
558 Ga0466969_0010304 3300044656 Bacteria 4958
559 Ga0466972_0088445 3300044658 Bacteria 1470
560 Ga0453683_0002014 3300044673 Bacteria 16403
561 Ga0453683_0306702 3300044673 Bacteria 1016
562 Ga0466965_0003131 3300044683 Bacteria 7212
563 Ga0466965_0059268 3300044683 Bacteria 1910
564 Ga0466965_0113646 3300044683 Bacteria 1393
565 Ga0466965_0333402 3300044683 Bacteria 828
566 Ga0466965_0566753 3300044683 Bacteria 643
567 Ga0466965_0828532 3300044683 Bacteria 537
568 Ga0466966_0001826 3300044684 Bacteria 13814
569 Ga0466966_0007945 3300044684 Bacteria 7027
570 Ga0466966_0008926 3300044684 Bacteria 6643
571 Ga0466966_0013800 3300044684 Bacteria 5346
572 Ga0466966_0153258 3300044684 Bacteria 1405
573 Ga0466966_0178938 3300044684 Bacteria 1287
574 Ga0466966_0502399 3300044684 Bacteria 729
575 Ga0466961_0027139 3300044693 Bacteria 3681
576 Ga0466961_0041448 3300044693 Bacteria 2951
577 Ga0466963_0006900 3300044694 Bacteria 6757
578 Ga0466963_0059746 3300044694 Bacteria 2545
579 Ga0466964_0002210 3300044706 Bacteria 6882
580 Ga0466964_0007297 3300044706 Bacteria 4134
581 Ga0466964_0154962 3300044706 Bacteria 1066
582 Ga0453684_0006310 3300044712 Bacteria 22635
583 Ga0453684_0077376 3300044712 Bacteria 4171
584 Ga0453684_2081783 3300044712 Bacteria 570
585 Ga0453684_2412378 3300044712 Bacteria 521
586 Ga0466971_0019502 3300044719 Bacteria 3012
587 Ga0466971_0110556 3300044719 Bacteria 1268
588 Ga0466968_0089169 3300044735 Bacteria 1364
589 Ga0466968_0216321 3300044735 Bacteria 901
590 Ga0466970_0015667 3300044765 Bacteria 3903
591 Ga0466970_0028777 3300044765 Bacteria 2922
592 Ga0466970_0047856 3300044765 Bacteria 2279
593 Ga0466970_0174607 3300044765 Bacteria 1191
594 Ga0466957_0001869 3300044842 Bacteria 11135
595 Ga0466957_0006607 3300044842 Bacteria 6559
596 Ga0466957_0090082 3300044842 Bacteria 1921
597 Ga0466960_0106510 3300044901 Bacteria 1450
598 Ga0466960_0924585 3300044901 Bacteria 533
599 Ga0466959_0000192 3300045049 Bacteria 40028
600 Ga0466959_0001900 3300045049 Bacteria 13149
601 Ga0466959_0146563 3300045049 Bacteria 1665
602 Ga0466959_0237356 3300045049 Bacteria 1260
603 Ga0466959_0310305 3300045049 Bacteria 1079
604 Ga0466959_0349911 3300045049 Bacteria 1007
605 Ga0451576_0002088 3300045051 Bacteria 31196
606 Ga0451576_0008890 3300045051 Bacteria 11723
607 Ga0451576_1541157 3300045051 Bacteria 690
608 Ga0451576_1645678 3300045051 Bacteria 665
609 Ga0466958_0074122 3300045836 Bacteria 2085
610 Ga0466958_0083497 3300045836 Bacteria 1969
611 Ga0466958_0150775 3300045836 Bacteria 1466
612 Ga0466967_0059458 3300045976 Bacteria 3383
613 Ga0466967_0772182 3300045976 Bacteria 953
614 Ga0466967_1042550 3300045976 Bacteria 815
615 Ga0466967_1936208 3300045976 Bacteria 586
616 Ga0495638_0598691 3300046460 Bacteria 542
617 Ga0495585_0021845 3300046492 Bacteria 3674
618 Ga0495610_0117871 3300046512 Bacteria 1167
619 Ga0495620_0053358 3300046515 Bacteria 1712
620 Ga0495632_0012504 3300046519 Bacteria 4894
621 Ga0495632_0101047 3300046519 Bacteria 1359
622 Ga0495643_0101814 3300046522 Bacteria 1471
623 Ga0495666_0502507 3300046526 Bacteria 542
624 Ga0495642_0034674 3300046528 Bacteria 2033
625 Ga0495598_0082466 3300046537 Bacteria 1034
626 Ga0495621_0011477 3300046539 Bacteria 2742
627 Ga0495621_0040523 3300046539 Bacteria 1633
628 Ga0495633_0294553 3300046558 Bacteria 737
629 Ga0495656_0001651 3300046615 Bacteria 7295
630 Ga0495656_0073823 3300046615 Bacteria 1522
631 Ga0495656_0646334 3300046615 Bacteria 568
632 Ga0495625_0003495 3300046660 Bacteria 15582
633 Ga0495661_0359139 3300046665 Bacteria 716
634 Ga0495588_0374758 3300046674 Bacteria 747
635 Ga0495658_0888972 3300046683 Bacteria 570
636 Ga0495669_0409337 3300046684 Bacteria 657
637 Ga0495670_0102184 3300046691 Bacteria 1477
638 Ga0495636_0024213 3300047318 Bacteria 2461
639 Ga0495636_0539224 3300047318 Bacteria 567
640 Ga0495677_0187090 3300047445 Bacteria 803
641 Ga0495685_072880 3300047447 Bacteria 1149
642 Ga0495681_0147366 3300047470 Bacteria 990
643 Ga0495686_0246667 3300047472 Bacteria 1005
644 Ga0495602_0423707 3300048088 Bacteria 945
645 Ga0496101_0438151 3300048904 Bacteria 1031
646 Ga0496101_1454457 3300048904 Bacteria 534
647 Ga0496102_0014575 3300048905 Bacteria 6833
648 Ga0496102_0018900 3300048905 Bacteria 6063
649 Ga0496104_0573549 3300048907 Bacteria 1039
650 Ga0496105_0314580 3300048908 Bacteria 1256
651 Ga0496106_0236334 3300048909 Bacteria 1460
652 Ga0496108_1420449 3300048911 Bacteria 580
653 Ga0496109_0040141 3300048912 Bacteria 4238
654 Ga0496109_0066448 3300048912 Bacteria 3302
655 Ga0496110_0054390 3300048913 Bacteria 3521
656 Ga0496110_1658731 3300048913 Bacteria 549
657 Ga0496114_0003154 3300048917 Bacteria 12645
658 Ga0501306_027905 3300049127 Bacteria 824
659 Ga0501306_045413 3300049127 Bacteria 692
660 Ga0501306_059872 3300049127 Bacteria 626
661 Ga0501308_017892 3300049128 Bacteria 862
662 Ga0501308_042937 3300049128 Bacteria 642
663 Ga0501308_044818 3300049128 Bacteria 632
664 Ga0501310_020091 3300049130 Bacteria 827
665 Ga0501310_027621 3300049130 Bacteria 740
666 Ga0501310_052438 3300049130 Bacteria 593
667 Ga0501310_066193 3300049130 Bacteria 547
668 Ga0501341_07304 3300049131 Bacteria 690
669 Ga0501304_013717 3300049160 Bacteria 744
670 Ga0501305_042175 3300049161 Bacteria 745
671 Ga0501305_044733 3300049161 Bacteria 729
672 Ga0501305_047534 3300049161 Bacteria 713
673 Ga0501307_046115 3300049162 Bacteria 645
674 Ga0501293_017900 3300049516 Bacteria 672
675 Ga0501311_025972 3300049527 Bacteria 823
676 Ga0501312_094047 3300049528 Bacteria 556
677 Ga0501313_013402 3300049529 Bacteria 963
678 Ga0501314_019790 3300049530 Bacteria 693
679 Ga0501314_023747 3300049530 Bacteria 652
680 Ga0501315_022610 3300049531 Bacteria 858
681 Ga0501315_049781 3300049531 Bacteria 656
682 Ga0501317_019606 3300049533 Bacteria 904
683 Ga0501318_022873 3300049534 Bacteria 804
684 Ga0501319_001294 3300049535 Bacteria 1417
685 Ga0501320_012097 3300049536 Bacteria 902
686 Ga0501320_026922 3300049536 Bacteria 697
687 Ga0501320_044150 3300049536 Bacteria 592
688 Ga0501321_027612 3300049537 Bacteria 742
689 Ga0501321_033459 3300049537 Bacteria 697
690 Ga0501321_045406 3300049537 Bacteria 629
691 Ga0501322_008434 3300049538 Bacteria 765
692 Ga0501323_033620 3300049539 Bacteria 729
693 Ga0501323_061789 3300049539 Bacteria 586
694 Ga0501324_021119 3300049540 Bacteria 666
695 Ga0501327_06633 3300049543 Bacteria 707
696 Ga0501032_0164787 3300049569 Bacteria 1455
697 Ga0501033_0198515 3300049570 Bacteria 1434
698 Ga0501034_0055180 3300049571 Bacteria 3999
699 Ga0501037_0187833 3300049573 Bacteria 1464
700 Ga0501037_0619022 3300049573 Bacteria 726
701 Ga0501038_0232521 3300049574 Bacteria 1466
702 Ga0501038_0278315 3300049574 Bacteria 1318
703 Ga0501042_0929024 3300049578 Bacteria 634
704 Ga0501043_0325193 3300049579 Bacteria 1172
705 Ga0501046_0068157 3300049580 Bacteria 2769
706 Ga0501047_0070728 3300049581 Bacteria 3359
707 Ga0501047_0346872 3300049581 Bacteria 1322
708 Ga0501048_0318858 3300049582 Bacteria 1107
709 Ga0501048_0842866 3300049582 Bacteria 659
710 Ga0501074_0725442 3300049590 Bacteria 701
711 Ga0501227_197108 3300049665 Bacteria 570
712 Ga0501249_218062 3300049679 Bacteria 507
713 Ga0501252_002187 3300049682 Bacteria 1917
714 Ga0501253_149420 3300049683 Bacteria 588
715 Ga0501257_041982 3300049686 Bacteria 1125
716 Ga0501080_0171737 3300049742 Bacteria 1999
717 Ga0501080_0423952 3300049742 Bacteria 1195
718 Ga0501263_005364 3300049760 Bacteria 1446
719 Ga0501268_034714 3300049765 Bacteria 928
720 Ga0501273_033534 3300049770 Bacteria 739
721 Ga0501035_0095501 3300049822 Bacteria 2613
722 Ga0501035_0312400 3300049822 Bacteria 1322
723 Ga0501044_0099572 3300049823 Bacteria 2925
724 nmdc:mga03683_101656_c1 3300050489 Bacteria 1264
725 nmdc:mga03683_179165_c1 3300050489 Bacteria 966
726 nmdc:mga03683_319533_c1 3300050489 Bacteria 731
727 nmdc:mga03683_37471_c1 3300050489 Bacteria 1976
728 nmdc:mga03683_405020_c1 3300050489 Bacteria 652
729 nmdc:mga03683_415430_c1 3300050489 Bacteria 644
730 nmdc:mga03683_68090_c1 3300050489 Bacteria 1517
731 nmdc:mga03n38_208653_c1 3300050490 Bacteria 1014
732 nmdc:mga03n38_34562_c1 3300050490 Bacteria 2160
733 nmdc:mga03n38_365470_c1 3300050490 Bacteria 788
734 nmdc:mga03n38_606486_c1 3300050490 Bacteria 624
735 nmdc:mga00v17_749059_c1 3300050491 Bacteria 624
736 nmdc:mga0yw44_101591_c1 3300050492 Bacteria 1832
737 nmdc:mga0yw44_1030714_c1 3300050492 Bacteria 557
738 nmdc:mga0yw44_260353_c1 3300050492 Bacteria 1156
739 nmdc:mga0yw44_77764_c1 3300050492 Bacteria 2073
740 nmdc:mga0k408_110974_c1 3300050493 Bacteria 1621
741 nmdc:mga0k408_147622_c1 3300050493 Bacteria 1400
742 nmdc:mga0k408_212564_c1 3300050493 Bacteria 772
743 nmdc:mga0k408_23280_c1 3300050493 Bacteria 3493
744 nmdc:mga0k408_254_c1 3300050493 Bacteria 29029
745 nmdc:mga0k408_276575_c1 3300050493 Bacteria 1002
746 nmdc:mga0k408_331477_c1 3300050493 Bacteria 908
747 nmdc:mga0k408_33733_c1 3300050493 Bacteria 2929
748 nmdc:mga0k408_498388_c1 3300050493 Bacteria 722
749 nmdc:mga0k408_53178_c1 3300050493 Bacteria 2347
750 nmdc:mga0k408_594239_c1 3300050493 Bacteria 653
751 nmdc:mga0k408_62721_c1 3300050493 Bacteria 2162
752 nmdc:mga0k408_786658_c1 3300050493 Bacteria 555
753 nmdc:mga0k408_8413_c1 3300050493 Bacteria 5535
754 nmdc:mga06z11_287036_c1 3300050494 Bacteria 976
755 nmdc:mga06z11_36498_c1 3300050494 Bacteria 2427
756 nmdc:mga06z11_471682_c1 3300050494 Bacteria 759
757 nmdc:mga06z11_59363_c1 3300050494 Bacteria 1988
758 nmdc:mga06z11_65821_c1 3300050494 Bacteria 1903
759 nmdc:mga06z11_996267_c1 3300050494 Bacteria 511
760 nmdc:mga04h51_214891_c1 3300050495 Bacteria 760
761 nmdc:mga07m45_10255_c1 3300050496 Bacteria 4888
762 nmdc:mga07m45_13149_c1 3300050496 Bacteria 4384
763 nmdc:mga07m45_219891_c1 3300050496 Bacteria 1105
764 nmdc:mga07m45_27799_c1 3300050496 Bacteria 3120
765 nmdc:mga07m45_331718_c1 3300050496 Bacteria 884
766 nmdc:mga07m45_6340_c1 3300050496 Bacteria 5972
767 nmdc:mga0sz30_15579_c2 3300050516 Bacteria 2385
768 nmdc:mga0sz30_28442_c1 3300050516 Bacteria 2301
769 Ga0500578_0001060 3300053086 Bacteria 29908
770 Ga0500643_031661 3300053087 Bacteria 1610
771 Ga0500644_0075298 3300053088 Bacteria 1227
772 Ga0500646_0004955 3300053090 Bacteria 3379
773 Ga0500583_0098484 3300053092 Bacteria 1430
774 Ga0500651_0006266 3300053093 Bacteria 6845
775 Ga0500651_0162877 3300053093 Bacteria 1333
776 Ga0500651_0195684 3300053093 Bacteria 1195
777 Ga0500651_0499061 3300053093 Bacteria 671
778 Ga0500650_0074562 3300053098 Bacteria 1586
779 Ga0500557_085454 3300053105 Bacteria 1044
780 Ga0500562_060524 3300053108 Bacteria 1017
781 Ga0500569_018717 3300053109 Bacteria 1793
782 Ga0500593_000440 3300053117 Bacteria 16359
783 Ga0500597_185142 3300053120 Bacteria 881
784 Ga0500628_003850 3300053129 Bacteria 2478
785 Ga0500642_0000805 3300053130 Bacteria 9200
786 Ga0500652_000299 3300053131 Bacteria 18083
787 Ga0500655_005214 3300053133 Bacteria 2344
788 Ga0500658_0216462 3300053134 Bacteria 878
789 Ga0500568_0018560 3300053139 Bacteria 3040
790 Ga0500568_0037009 3300053139 Bacteria 1982
791 Ga0500577_0002588 3300053142 Bacteria 4632
792 Ga0500579_168047 3300053143 Bacteria 902
793 Ga0500604_0056358 3300053151 Bacteria 1224
794 Ga0500604_0356510 3300053151 Bacteria 508
795 Ga0500619_000127 3300053154 Bacteria 19880
796 Ga0500622_0000125 3300053156 Bacteria 81109
797 Ga0500622_0025655 3300053156 Bacteria 3113
798 Ga0500627_0432634 3300053158 Bacteria 556
799 Ga0500636_0368352 3300053177 Bacteria 679
800 Ga0500570_032674 3300053724 Bacteria 2798
801 Ga0500570_213015 3300053724 Bacteria 566
802 Ga0500645_110615 3300053730 Bacteria 771
803 Ga0500587_000581 3300053739 Bacteria 4534
804 Ga0590071_012006 3300059421 Bacteria 2030
805 Ga0590074_078125 3300059423 Bacteria 630
806 Ga0590075_125747 3300059424 Bacteria 672
807 Ga0587077_167875 3300059493 Bacteria 586
808 Ga0587080_157362 3300059503 Bacteria 530
809 Ga0587085_143891 3300059506 Bacteria 544
810 Ga0587088_080729 3300059508 Bacteria 696
811 Ga0587088_097564 3300059508 Bacteria 652
812 Ga0587091_094417 3300059511 Bacteria 692
813 Ga0587106_061154 3300059605 Bacteria 692
814 Ga0587101_060421 3300059623 Bacteria 675
815 Ga0587109_053532 3300059624 Bacteria 833
816 Ga0587109_218585 3300059624 Bacteria 504
817 Ga0587076_079566 3300059645 Bacteria 697
818 Ga0587100_043541 3300059648 Bacteria 512
819 Ga0501082_1017924 3300060353 Bacteria 724
820 Ga0466962_0005233 3300061719 Bacteria 6233
821 Ga0466962_0014889 3300061719 Bacteria 3748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221644 2644244726 80
2 iso_pu_bacteria 2585428057 2587725328 81
3 iso_pu_bacteria 2585428058 2587731313 81
4 iso_pu_bacteria 2585428062 2587754071 81
5 iso_pu_bacteria 2588253510 2588290069 81
6 iso_pu_bacteria 2643221592 2643972789 81
7 iso_pu_bacteria 2643221625 2644143364 81
8 iso_pu_bacteria 2643221648 2644276199 81
9 iso_pu_bacteria 2643221660 2644340881 81
10 3300026067 Ga0207678_10665796 Ga0207678_106657961 83
11 3300031727 Ga0316576_10491434 Ga0316576_104914341 83
12 3300031727 Ga0316576_11080681 Ga0316576_110806811 83
13 3300031733 Ga0316577_10131901 Ga0316577_101319013 83
14 3300032137 Ga0316585_10170124 Ga0316585_101701242 83
15 3300032168 Ga0316593_10285432 Ga0316593_102854322 83
16 3300033528 Ga0316588_1144172 Ga0316588_11441722 83
17 3300033541 Ga0316596_1120524 Ga0316596_11205241 83
18 3300035115 Ga0373941_0524949 Ga0373941_0524949_228_479 83
19 3300035398 Ga0316574_0062386 Ga0316574_0062386_458_715 83
20 3300036647 Ga0316582_0474042 Ga0316582_0474042_251_508 83
21 3300036712 Ga0316584_0159207 Ga0316584_0159207_183_440 83
22 3300003162 Ga0006778J45830_1018330 Ga0006778J45830_10183302 84
23 3300003163 Ga0006759J45824_1017103 Ga0006759J45824_10171032 84
24 3300003305 Ga0006770J48903_1013780 Ga0006770J48903_10137802 84
25 3300003544 Ga0007417J51691_1011711 Ga0007417J51691_10117112 84
26 3300003559 Ga0007427J51700_112861 Ga0007427J51700_1128612 84
27 3300003574 Ga0007410J51695_1022391 Ga0007410J51695_10223912 84
28 3300003575 Ga0007409J51694_1014513 Ga0007409J51694_10145132 84
29 3300003577 Ga0007416J51690_1023874 Ga0007416J51690_10238742 84
30 3300003611 Ga0007411J51799_105540 Ga0007411J51799_1055402 84
31 3300003613 Ga0007415J51800_103902 Ga0007415J51800_1039022 84
32 3300003693 Ga0032354_1024639 Ga0032354_10246392 84
33 3300003775 Ga0055524_1000109 Ga0055524_100010920 84
34 3300003791 Ga0055530_10034055 Ga0055530_100340552 84
35 3300003792 Ga0055540_1000013 Ga0055540_1000013174 84
36 3300003794 Ga0055531_10005660 Ga0055531_100056604 84
37 3300005262 Ga0065165_1080711 Ga0065165_10807111 84
38 3300005339 Ga0070660_100108958 Ga0070660_1001089583 84
39 3300005344 Ga0070661_100126267 Ga0070661_1001262672 84
40 3300005366 Ga0070659_100008466 Ga0070659_1000084668 84
41 3300005455 Ga0070663_100377465 Ga0070663_1003774653 84
42 3300005467 Ga0070706_100002083 Ga0070706_10000208312 84
43 3300005471 Ga0070698_100128634 Ga0070698_1001286343 84
44 3300005518 Ga0070699_100243867 Ga0070699_1002438673 84
45 3300006048 Ga0075363_100100193 Ga0075363_1001001932 84
46 3300006178 Ga0075367_10006143 Ga0075367_100061435 84
47 3300006186 Ga0075369_10031196 Ga0075369_100311962 84
48 3300006195 Ga0075366_10088935 Ga0075366_100889354 84
49 3300006353 Ga0075370_10015050 Ga0075370_100150503 84
50 3300006946 Ga0079104_1000001 Ga0079104_1000001168 84
51 3300025263 Ga0209565_1007217 Ga0209565_10072172 84
52 3300025291 Ga0209675_1093185 Ga0209675_10931851 84
53 3300025298 Ga0209050_1000315 Ga0209050_100031544 84
54 3300025299 Ga0209256_1000015 Ga0209256_1000015320 84
55 3300025303 Ga0209051_1000022 Ga0209051_100002293 84
56 3300025304 Ga0209257_1000030 Ga0209257_1000030290 84
57 3300025910 Ga0207684_10004074 Ga0207684_1000407417 84
58 3300025919 Ga0207657_10118894 Ga0207657_101188942 84
59 3300025920 Ga0207649_10002064 Ga0207649_100020642 84
60 3300025922 Ga0207646_10294313 Ga0207646_102943132 84
61 3300025932 Ga0207690_10036483 Ga0207690_100364832 84
62 3300025932 Ga0207690_11317780 Ga0207690_113177801 84
63 3300025945 Ga0207679_10000671 Ga0207679_100006716 84
64 3300025945 Ga0207679_10250461 Ga0207679_102504611 84
65 3300026067 Ga0207678_10404304 Ga0207678_104043043 84
66 3300027111 Ga0209281_1000057 Ga0209281_1000057149 84
67 3300042121 Ga0450919_001279 Ga0450919_001279_1034_1288 84
68 3300042122 Ga0450920_139938 Ga0450920_139938_175_429 84
69 3300042157 Ga0439458_0053237 Ga0439458_0053237_453_707 84
70 3300042531 Ga0450918_000202 Ga0450918_000202_2562_2816 84
71 3300048917 Ga0496114_0003154 Ga0496114_0003154_6800_7054 84
72 3300049539 Ga0501323_033620 Ga0501323_033620_382_636 84
73 3300050489 nmdc:mga03683_37471_c1 nmdc:mga03683_37471_c1_732_986 84
74 3300050490 nmdc:mga03n38_606486_c1 nmdc:mga03n38_606486_c1_155_409 84
75 3300050493 nmdc:mga0k408_23280_c1 nmdc:mga0k408_23280_c1_917_1171 84
76 3300050494 nmdc:mga06z11_36498_c1 nmdc:mga06z11_36498_c1_447_701 84
77 3300050496 nmdc:mga07m45_27799_c1 nmdc:mga07m45_27799_c1_326_580 84
78 3300050516 nmdc:mga0sz30_28442_c1 nmdc:mga0sz30_28442_c1_351_605 84
79 2162886006 SwRhRL3b_contig_638870 SwRhRL3b_0843.00000280 85
80 3300001979 JGI24740J21852_10035537 JGI24740J21852_100355372 85
81 3300002067 JGI24735J21928_10185972 JGI24735J21928_101859722 85
82 3300002077 JGI24744J21845_10075619 JGI24744J21845_100756191 85
83 3300002773 JGI25152J39213_1000892 JGI25152J39213_100089210 85
84 3300002774 JGI25150J39212_1002313 JGI25150J39212_10023133 85
85 3300003163 Ga0006759J45824_1013933 Ga0006759J45824_10139332 85
86 3300003163 Ga0006759J45824_1023259 Ga0006759J45824_10232592 85
87 3300003215 JGI25153J46596_10000420 JGI25153J46596_1000042020 85
88 3300003316 rootH1_10043230 rootH1_100432302 85
89 3300003322 rootL2_10005413 rootL2_100054132 85
90 3300003322 rootL2_10083805 rootL2_100838053 85
91 3300003347 JGI26128J50194_1000218 JGI26128J50194_10002183 85
92 3300003371 JGI26145J50221_1002388 JGI26145J50221_10023881 85
93 3300003544 Ga0007417J51691_1011360 Ga0007417J51691_10113602 85
94 3300003544 Ga0007417J51691_1017103 Ga0007417J51691_10171032 85
95 3300003544 Ga0007417J51691_1045595 Ga0007417J51691_10455952 85
96 3300003544 Ga0007417J51691_1114763 Ga0007417J51691_11147632 85
97 3300003574 Ga0007410J51695_1004507 Ga0007410J51695_10045073 85
98 3300003574 Ga0007410J51695_1011000 Ga0007410J51695_10110002 85
99 3300003575 Ga0007409J51694_1012913 Ga0007409J51694_10129132 85
100 3300003575 Ga0007409J51694_1027825 Ga0007409J51694_10278252 85
101 3300003577 Ga0007416J51690_1026130 Ga0007416J51690_10261302 85
102 3300003577 Ga0007416J51690_1065410 Ga0007416J51690_10654102 85
103 3300003579 Ga0007429J51699_1012803 Ga0007429J51699_10128032 85
104 3300003611 Ga0007411J51799_112204 Ga0007411J51799_1122042 85
105 3300003693 Ga0032354_1016521 Ga0032354_10165212 85
106 3300003693 Ga0032354_1031837 Ga0032354_10318372 85
107 3300003693 Ga0032354_1037179 Ga0032354_10371792 85
108 3300003735 Ga0006780_1017431 Ga0006780_10174312 85
109 3300003752 Ga0055539_1012687 Ga0055539_10126872 85
110 3300003771 Ga0055526_1014626 Ga0055526_10146265 85
111 3300003791 Ga0055530_10003385 Ga0055530_100033855 85
112 3300003792 Ga0055540_1009236 Ga0055540_10092366 85
113 3300003792 Ga0055540_1017082 Ga0055540_10170822 85
114 3300003792 Ga0055540_1095489 Ga0055540_10954892 85
115 3300003792 Ga0055540_1112322 Ga0055540_11123222 85
116 3300003794 Ga0055531_10000158 Ga0055531_1000015869 85
117 3300004798 Ga0058859_11701938 Ga0058859_117019382 85
118 3300004798 Ga0058859_11819676 Ga0058859_118196762 85
119 3300004798 Ga0058859_11829144 Ga0058859_118291441 85
120 3300004799 Ga0058863_10004931 Ga0058863_100049311 85
121 3300004799 Ga0058863_11886072 Ga0058863_118860723 85
122 3300004800 Ga0058861_12046980 Ga0058861_120469802 85
123 3300004801 Ga0058860_10070410 Ga0058860_100704101 85
124 3300004801 Ga0058860_12216250 Ga0058860_122162502 85
125 3300005262 Ga0065165_1002013 Ga0065165_100201322 85
126 3300005289 Ga0065704_10527730 Ga0065704_105277301 85
127 3300005295 Ga0065707_10082503 Ga0065707_1008250313 85
128 3300005295 Ga0065707_11023718 Ga0065707_110237181 85
129 3300005327 Ga0070658_10068891 Ga0070658_100688913 85
130 3300005327 Ga0070658_10320018 Ga0070658_103200183 85
131 3300005327 Ga0070658_10534964 Ga0070658_105349642 85
132 3300005327 Ga0070658_10649110 Ga0070658_106491101 85
133 3300005333 Ga0070677_10087294 Ga0070677_100872942 85
134 3300005334 Ga0068869_100297442 Ga0068869_1002974421 85
135 3300005334 Ga0068869_101128982 Ga0068869_1011289822 85
136 3300005336 Ga0070680_100134810 Ga0070680_1001348102 85
137 3300005337 Ga0070682_100267190 Ga0070682_1002671902 85
138 3300005338 Ga0068868_100229049 Ga0068868_1002290492 85
139 3300005339 Ga0070660_100070483 Ga0070660_1000704833 85
140 3300005339 Ga0070660_100973026 Ga0070660_1009730262 85
141 3300005343 Ga0070687_101193445 Ga0070687_1011934451 85
142 3300005344 Ga0070661_100748768 Ga0070661_1007487682 85
143 3300005347 Ga0070668_100128990 Ga0070668_1001289903 85
144 3300005353 Ga0070669_100054025 Ga0070669_1000540255 85
145 3300005355 Ga0070671_101356837 Ga0070671_1013568372 85
146 3300005356 Ga0070674_100113587 Ga0070674_1001135871 85
147 3300005356 Ga0070674_100671121 Ga0070674_1006711212 85
148 3300005364 Ga0070673_101356170 Ga0070673_1013561702 85
149 3300005367 Ga0070667_100116760 Ga0070667_1001167602 85
150 3300005367 Ga0070667_100145381 Ga0070667_1001453813 85
151 3300005441 Ga0070700_100058250 Ga0070700_1000582502 85
152 3300005455 Ga0070663_100125498 Ga0070663_1001254981 85
153 3300005456 Ga0070678_100020291 Ga0070678_1000202911 85
154 3300005456 Ga0070678_101574061 Ga0070678_1015740612 85
155 3300005458 Ga0070681_10528773 Ga0070681_105287734 85
156 3300005459 Ga0068867_100001947 Ga0068867_1000019473 85
157 3300005459 Ga0068867_101294889 Ga0068867_1012948891 85
158 3300005459 Ga0068867_101571629 Ga0068867_1015716291 85
159 3300005467 Ga0070706_101829860 Ga0070706_1018298601 85
160 3300005530 Ga0070679_100212564 Ga0070679_1002125642 85
161 3300005530 Ga0070679_100500176 Ga0070679_1005001761 85
162 3300005535 Ga0070684_101644640 Ga0070684_1016446402 85
163 3300005539 Ga0068853_101067456 Ga0068853_1010674562 85
164 3300005543 Ga0070672_101355696 Ga0070672_1013556962 85
165 3300005548 Ga0070665_100842570 Ga0070665_1008425702 85
166 3300005548 Ga0070665_100928564 Ga0070665_1009285643 85
167 3300005563 Ga0068855_100032613 Ga0068855_1000326133 85
168 3300005563 Ga0068855_100120364 Ga0068855_1001203645 85
169 3300005563 Ga0068855_100142205 Ga0068855_1001422054 85
170 3300005616 Ga0068852_100089473 Ga0068852_1000894732 85
171 3300005616 Ga0068852_101219474 Ga0068852_1012194742 85
172 3300005617 Ga0068859_101381555 Ga0068859_1013815552 85
173 3300005618 Ga0068864_100200723 Ga0068864_1002007233 85
174 3300005618 Ga0068864_100536369 Ga0068864_1005363691 85
175 3300005618 Ga0068864_101282041 Ga0068864_1012820412 85
176 3300005718 Ga0068866_10003673 Ga0068866_100036735 85
177 3300005719 Ga0068861_100006327 Ga0068861_1000063277 85
178 3300005719 Ga0068861_101944555 Ga0068861_1019445552 85
179 3300005841 Ga0068863_100071767 Ga0068863_1000717672 85
180 3300005841 Ga0068863_100608432 Ga0068863_1006084322 85
181 3300005841 Ga0068863_101633437 Ga0068863_1016334371 85
182 3300005842 Ga0068858_101353515 Ga0068858_1013535152 85
183 3300005842 Ga0068858_102085773 Ga0068858_1020857732 85
184 3300005843 Ga0068860_100002278 Ga0068860_1000022782 85
185 3300005843 Ga0068860_101796647 Ga0068860_1017966472 85
186 3300005844 Ga0068862_100673631 Ga0068862_1006736312 85
187 3300006038 Ga0075365_10023056 Ga0075365_100230565 85
188 3300006038 Ga0075365_10038406 Ga0075365_100384063 85
189 3300006038 Ga0075365_10144102 Ga0075365_101441022 85
190 3300006038 Ga0075365_10146992 Ga0075365_101469923 85
191 3300006038 Ga0075365_10986743 Ga0075365_109867432 85
192 3300006042 Ga0075368_10050993 Ga0075368_100509932 85
193 3300006042 Ga0075368_10084772 Ga0075368_100847722 85
194 3300006042 Ga0075368_10242439 Ga0075368_102424391 85
195 3300006048 Ga0075363_100019150 Ga0075363_1000191502 85
196 3300006048 Ga0075363_100054717 Ga0075363_1000547172 85
197 3300006048 Ga0075363_100133175 Ga0075363_1001331752 85
198 3300006048 Ga0075363_100410322 Ga0075363_1004103222 85
199 3300006048 Ga0075363_100698830 Ga0075363_1006988301 85
200 3300006048 Ga0075363_100727169 Ga0075363_1007271692 85
201 3300006051 Ga0075364_10241644 Ga0075364_102416443 85
202 3300006051 Ga0075364_10439091 Ga0075364_104390912 85
203 3300006051 Ga0075364_10944518 Ga0075364_109445182 85
204 3300006177 Ga0075362_10043584 Ga0075362_100435843 85
205 3300006177 Ga0075362_10052438 Ga0075362_100524382 85
206 3300006177 Ga0075362_10057331 Ga0075362_100573312 85
207 3300006177 Ga0075362_10164527 Ga0075362_101645271 85
208 3300006177 Ga0075362_10182982 Ga0075362_101829822 85
209 3300006177 Ga0075362_10242245 Ga0075362_102422452 85
210 3300006177 Ga0075362_10718003 Ga0075362_107180031 85
211 3300006178 Ga0075367_10007325 Ga0075367_100073255 85
212 3300006178 Ga0075367_10026991 Ga0075367_100269913 85
213 3300006178 Ga0075367_10399051 Ga0075367_103990512 85
214 3300006186 Ga0075369_10021846 Ga0075369_100218463 85
215 3300006195 Ga0075366_10014821 Ga0075366_100148213 85
216 3300006195 Ga0075366_10035470 Ga0075366_100354702 85
217 3300006195 Ga0075366_10041460 Ga0075366_100414603 85
218 3300006195 Ga0075366_10050690 Ga0075366_100506906 85
219 3300006195 Ga0075366_10103320 Ga0075366_101033203 85
220 3300006195 Ga0075366_10127248 Ga0075366_101272483 85
221 3300006195 Ga0075366_10144411 Ga0075366_101444113 85
222 3300006195 Ga0075366_10240950 Ga0075366_102409501 85
223 3300006195 Ga0075366_10246833 Ga0075366_102468332 85
224 3300006195 Ga0075366_10254499 Ga0075366_102544992 85
225 3300006195 Ga0075366_10326500 Ga0075366_103265002 85
226 3300006353 Ga0075370_10002426 Ga0075370_100024264 85
227 3300006353 Ga0075370_10002528 Ga0075370_100025284 85
228 3300006353 Ga0075370_10232171 Ga0075370_102321712 85
229 3300006353 Ga0075370_10252821 Ga0075370_102528212 85
230 3300006358 Ga0068871_101698157 Ga0068871_1016981572 85
231 3300006358 Ga0068871_102191088 Ga0068871_1021910882 85
232 3300006844 Ga0075428_100473805 Ga0075428_1004738052 85
233 3300006846 Ga0075430_100033190 Ga0075430_1000331906 85
234 3300006847 Ga0075431_101382757 Ga0075431_1013827571 85
235 3300006880 Ga0075429_100074259 Ga0075429_1000742591 85
236 3300006881 Ga0068865_100031867 Ga0068865_1000318675 85
237 3300006931 Ga0097620_101381565 Ga0097620_1013815652 85
238 3300009093 Ga0105240_10017122 Ga0105240_100171229 85
239 3300009093 Ga0105240_11888680 Ga0105240_118886802 85
240 3300009094 Ga0111539_10608222 Ga0111539_106082223 85
241 3300009094 Ga0111539_13201018 Ga0111539_132010182 85
242 3300009098 Ga0105245_10170491 Ga0105245_101704913 85
243 3300009098 Ga0105245_10311700 Ga0105245_103117002 85
244 3300009098 Ga0105245_11663801 Ga0105245_116638011 85
245 3300009101 Ga0105247_10944305 Ga0105247_109443052 85
246 3300009147 Ga0114129_12840635 Ga0114129_128406351 85
247 3300009174 Ga0105241_10083226 Ga0105241_100832261 85
248 3300009176 Ga0105242_10469742 Ga0105242_104697423 85
249 3300009177 Ga0105248_10721083 Ga0105248_107210832 85
250 3300009177 Ga0105248_10854833 Ga0105248_108548332 85
251 3300009177 Ga0105248_11268854 Ga0105248_112688541 85
252 3300009545 Ga0105237_10518801 Ga0105237_105188012 85
253 3300009545 Ga0105237_10675960 Ga0105237_106759601 85
254 3300009551 Ga0105238_10145507 Ga0105238_101455072 85
255 3300009551 Ga0105238_10594850 Ga0105238_105948503 85
256 3300009551 Ga0105238_10794777 Ga0105238_107947772 85
257 3300009551 Ga0105238_10872399 Ga0105238_108723992 85
258 3300009553 Ga0105249_10037455 Ga0105249_100374553 85
259 3300009553 Ga0105249_11185643 Ga0105249_111856432 85
260 3300010375 Ga0105239_10804060 Ga0105239_108040601 85
261 3300012497 Ga0157319_1021801 Ga0157319_10218012 85
262 3300012506 Ga0157324_1059132 Ga0157324_10591321 85
263 3300012512 Ga0157327_1010021 Ga0157327_10100212 85
264 3300012513 Ga0157326_1076205 Ga0157326_10762052 85
265 3300013296 Ga0157374_10236650 Ga0157374_102366503 85
266 3300013296 Ga0157374_10691420 Ga0157374_106914203 85
267 3300013297 Ga0157378_10015555 Ga0157378_100155555 85
268 3300013297 Ga0157378_10206273 Ga0157378_102062733 85
269 3300013297 Ga0157378_10551355 Ga0157378_105513552 85
270 3300013297 Ga0157378_11520289 Ga0157378_115202892 85
271 3300013297 Ga0157378_11659920 Ga0157378_116599202 85
272 3300013306 Ga0163162_10280517 Ga0163162_102805172 85
273 3300013307 Ga0157372_12402095 Ga0157372_124020952 85
274 3300013307 Ga0157372_12455151 Ga0157372_124551511 85
275 3300013307 Ga0157372_12707485 Ga0157372_127074851 85
276 3300013308 Ga0157375_10717041 Ga0157375_107170413 85
277 3300014325 Ga0163163_11320509 Ga0163163_113205092 85
278 3300014497 Ga0182008_10401829 Ga0182008_104018292 85
279 3300014497 Ga0182008_10759152 Ga0182008_107591521 85
280 3300014968 Ga0157379_10591784 Ga0157379_105917843 85
281 3300014968 Ga0157379_11390960 Ga0157379_113909602 85
282 3300014969 Ga0157376_10049735 Ga0157376_100497352 85
283 3300014969 Ga0157376_10531467 Ga0157376_105314672 85
284 3300014969 Ga0157376_10558338 Ga0157376_105583382 85
285 3300015262 Ga0182007_10088519 Ga0182007_100885192 85
286 3300015262 Ga0182007_10202316 Ga0182007_102023162 85
287 3300017792 Ga0163161_10230509 Ga0163161_102305092 85
288 3300017792 Ga0163161_10658434 Ga0163161_106584342 85
289 3300020069 Ga0197907_10563325 Ga0197907_105633252 85
290 3300020076 Ga0206355_1480352 Ga0206355_14803522 85
291 3300021361 Ga0213872_10038378 Ga0213872_100383782 85
292 3300021361 Ga0213872_10060580 Ga0213872_100605802 85
293 3300025245 Ga0207425_1000221 Ga0207425_100022129 85
294 3300025253 Ga0209677_107129 Ga0209677_1071293 85
295 3300025258 Ga0209129_1000012 Ga0209129_1000012157 85
296 3300025258 Ga0209129_1037315 Ga0209129_10373152 85
297 3300025258 Ga0209129_1059813 Ga0209129_10598132 85
298 3300025258 Ga0209129_1060622 Ga0209129_10606221 85
299 3300025273 Ga0209673_1002136 Ga0209673_10021363 85
300 3300025273 Ga0209673_1019202 Ga0209673_10192023 85
301 3300025273 Ga0209673_1025942 Ga0209673_10259424 85
302 3300025295 Ga0209564_1000022 Ga0209564_1000022357 85
303 3300025297 Ga0209758_1000124 Ga0209758_100012494 85
304 3300025297 Ga0209758_1000234 Ga0209758_10002342 85
305 3300025297 Ga0209758_1050104 Ga0209758_10501043 85
306 3300025298 Ga0209050_1001261 Ga0209050_100126122 85
307 3300025299 Ga0209256_1061637 Ga0209256_10616371 85
308 3300025303 Ga0209051_1000315 Ga0209051_100031525 85
309 3300025303 Ga0209051_1031528 Ga0209051_10315282 85
310 3300025303 Ga0209051_1044906 Ga0209051_10449063 85
311 3300025303 Ga0209051_1070569 Ga0209051_10705691 85
312 3300025304 Ga0209257_1000309 Ga0209257_100030937 85
313 3300025304 Ga0209257_1017837 Ga0209257_10178372 85
314 3300025304 Ga0209257_1043746 Ga0209257_10437462 85
315 3300025304 Ga0209257_1149665 Ga0209257_11496651 85
316 3300025899 Ga0207642_10006139 Ga0207642_100061395 85
317 3300025909 Ga0207705_10128716 Ga0207705_101287163 85
318 3300025909 Ga0207705_10451851 Ga0207705_104518512 85
319 3300025909 Ga0207705_10532263 Ga0207705_105322632 85
320 3300025909 Ga0207705_10708206 Ga0207705_107082062 85
321 3300025909 Ga0207705_10870637 Ga0207705_108706372 85
322 3300025910 Ga0207684_10552915 Ga0207684_105529153 85
323 3300025911 Ga0207654_10058756 Ga0207654_100587563 85
324 3300025912 Ga0207707_10242094 Ga0207707_102420943 85
325 3300025912 Ga0207707_10262963 Ga0207707_102629633 85
326 3300025913 Ga0207695_10036310 Ga0207695_100363106 85
327 3300025914 Ga0207671_10459625 Ga0207671_104596252 85
328 3300025917 Ga0207660_10235701 Ga0207660_102357011 85
329 3300025918 Ga0207662_10639229 Ga0207662_106392292 85
330 3300025919 Ga0207657_10028808 Ga0207657_100288082 85
331 3300025919 Ga0207657_10624643 Ga0207657_106246432 85
332 3300025919 Ga0207657_10774667 Ga0207657_107746671 85
333 3300025919 Ga0207657_11053164 Ga0207657_110531642 85
334 3300025920 Ga0207649_10628388 Ga0207649_106283882 85
335 3300025921 Ga0207652_10077772 Ga0207652_100777723 85
336 3300025923 Ga0207681_10603067 Ga0207681_106030672 85
337 3300025924 Ga0207694_10242803 Ga0207694_102428032 85
338 3300025924 Ga0207694_10561120 Ga0207694_105611202 85
339 3300025927 Ga0207687_10011249 Ga0207687_100112496 85
340 3300025927 Ga0207687_10319509 Ga0207687_103195092 85
341 3300025931 Ga0207644_10629291 Ga0207644_106292912 85
342 3300025932 Ga0207690_10128789 Ga0207690_101287892 85
343 3300025932 Ga0207690_11192968 Ga0207690_111929681 85
344 3300025937 Ga0207669_10273879 Ga0207669_102738791 85
345 3300025938 Ga0207704_10001183 Ga0207704_100011833 85
346 3300025939 Ga0207665_10767968 Ga0207665_107679681 85
347 3300025940 Ga0207691_10245468 Ga0207691_102454682 85
348 3300025942 Ga0207689_10119995 Ga0207689_101199954 85
349 3300025942 Ga0207689_10963758 Ga0207689_109637582 85
350 3300025942 Ga0207689_11132038 Ga0207689_111320381 85
351 3300025949 Ga0207667_10093668 Ga0207667_100936685 85
352 3300025949 Ga0207667_10154780 Ga0207667_101547803 85
353 3300025949 Ga0207667_11245366 Ga0207667_112453662 85
354 3300025961 Ga0207712_10077901 Ga0207712_100779013 85
355 3300025972 Ga0207668_10108702 Ga0207668_101087023 85
356 3300025972 Ga0207668_11697051 Ga0207668_116970512 85
357 3300025986 Ga0207658_10383710 Ga0207658_103837102 85
358 3300026023 Ga0207677_10074561 Ga0207677_100745614 85
359 3300026023 Ga0207677_10093561 Ga0207677_100935612 85
360 3300026035 Ga0207703_11376543 Ga0207703_113765432 85
361 3300026035 Ga0207703_11460681 Ga0207703_114606812 85
362 3300026035 Ga0207703_11577849 Ga0207703_115778491 85
363 3300026041 Ga0207639_11879807 Ga0207639_118798072 85
364 3300026067 Ga0207678_10328650 Ga0207678_103286502 85
365 3300026075 Ga0207708_10094171 Ga0207708_100941712 85
366 3300026078 Ga0207702_10877865 Ga0207702_108778651 85
367 3300026088 Ga0207641_10053268 Ga0207641_100532682 85
368 3300026088 Ga0207641_11513988 Ga0207641_115139882 85
369 3300026088 Ga0207641_12351324 Ga0207641_123513242 85
370 3300026089 Ga0207648_10026441 Ga0207648_100264413 85
371 3300026089 Ga0207648_10108549 Ga0207648_101085493 85
372 3300026089 Ga0207648_11932623 Ga0207648_119326232 85
373 3300026095 Ga0207676_10169748 Ga0207676_101697483 85
374 3300026116 Ga0207674_10521733 Ga0207674_105217332 85
375 3300026118 Ga0207675_100021908 Ga0207675_1000219087 85
376 3300026118 Ga0207675_100985369 Ga0207675_1009853692 85
377 3300026118 Ga0207675_101352285 Ga0207675_1013522851 85
378 3300026118 Ga0207675_101384761 Ga0207675_1013847611 85
379 3300026121 Ga0207683_10567937 Ga0207683_105679372 85
380 3300026121 Ga0207683_11310273 Ga0207683_113102732 85
381 3300026121 Ga0207683_11640870 Ga0207683_116408701 85
382 3300026142 Ga0207698_10010712 Ga0207698_100107123 85
383 3300026142 Ga0207698_10160408 Ga0207698_101604083 85
384 3300027252 Ga0209973_1035866 Ga0209973_10358661 85
385 3300027360 Ga0209969_1016260 Ga0209969_10162601 85
386 3300027378 Ga0209981_1041424 Ga0209981_10414241 85
387 3300027395 Ga0209996_1000964 Ga0209996_10009643 85
388 3300027471 Ga0209995_1000738 Ga0209995_10007381 85
389 3300027526 Ga0209968_1000202 Ga0209968_10002027 85
390 3300027543 Ga0209999_1006976 Ga0209999_10069763 85
391 3300027543 Ga0209999_1052179 Ga0209999_10521792 85
392 3300027614 Ga0209970_1020316 Ga0209970_10203163 85
393 3300027617 Ga0210002_1036330 Ga0210002_10363302 85
394 3300027695 Ga0209966_1000017 Ga0209966_100001760 85
395 3300027866 Ga0209813_10048962 Ga0209813_100489622 85
396 3300027866 Ga0209813_10097874 Ga0209813_100978742 85
397 3300027866 Ga0209813_10411064 Ga0209813_104110641 85
398 3300027876 Ga0209974_10000240 Ga0209974_1000024014 85
399 3300027876 Ga0209974_10081232 Ga0209974_100812323 85
400 3300028379 Ga0268266_11434181 Ga0268266_114341812 85
401 3300028380 Ga0268265_10962979 Ga0268265_109629792 85
402 3300028381 Ga0268264_10050685 Ga0268264_100506852 85
403 3300028381 Ga0268264_11476563 Ga0268264_114765631 85
404 3300028786 Ga0307517_10060779 Ga0307517_100607794 85
405 3300028786 Ga0307517_10064548 Ga0307517_100645482 85
406 3300028794 Ga0307515_10000354 Ga0307515_1000035443 85
407 3300028794 Ga0307515_10007796 Ga0307515_1000779613 85
408 3300028794 Ga0307515_10022668 Ga0307515_100226684 85
409 3300030522 Ga0307512_10021785 Ga0307512_100217853 85
410 3300030736 Ga0316180_1130869 Ga0316180_11308691 85
411 3300031238 Ga0265332_10007658 Ga0265332_100076583 85
412 3300031239 Ga0265328_10019266 Ga0265328_100192662 85
413 3300031239 Ga0265328_10179358 Ga0265328_101793582 85
414 3300031242 Ga0265329_10039870 Ga0265329_100398703 85
415 3300031251 Ga0265327_10000056 Ga0265327_1000005656 85
416 3300031456 Ga0307513_10041205 Ga0307513_100412055 85
417 3300031456 Ga0307513_10456071 Ga0307513_104560712 85
418 3300031507 Ga0307509_10022375 Ga0307509_100223755 85
419 3300031507 Ga0307509_10305886 Ga0307509_103058862 85
420 3300031507 Ga0307509_10529316 Ga0307509_105293162 85
421 3300031507 Ga0307509_11003006 Ga0307509_110030061 85
422 3300031548 Ga0307408_101392350 Ga0307408_1013923501 85
423 3300031548 Ga0307408_101930907 Ga0307408_1019309071 85
424 3300031616 Ga0307508_10000043 Ga0307508_1000004372 85
425 3300031616 Ga0307508_10819637 Ga0307508_108196372 85
426 3300031649 Ga0307514_10001251 Ga0307514_100012516 85
427 3300031649 Ga0307514_10048623 Ga0307514_100486232 85
428 3300031649 Ga0307514_10448787 Ga0307514_104487871 85
429 3300031711 Ga0265314_10004112 Ga0265314_1000411215 85
430 3300031730 Ga0307516_10001691 Ga0307516_1000169118 85
431 3300031730 Ga0307516_10050533 Ga0307516_100505333 85
432 3300031730 Ga0307516_10098801 Ga0307516_100988013 85
433 3300031730 Ga0307516_10448454 Ga0307516_104484542 85
434 3300031730 Ga0307516_10643754 Ga0307516_106437543 85
435 3300031731 Ga0307405_11725080 Ga0307405_117250802 85
436 3300031824 Ga0307413_10482850 Ga0307413_104828501 85
437 3300031824 Ga0307413_11432399 Ga0307413_114323992 85
438 3300031852 Ga0307410_11245878 Ga0307410_112458782 85
439 3300031901 Ga0307406_10708777 Ga0307406_107087772 85
440 3300031901 Ga0307406_10776367 Ga0307406_107763672 85
441 3300031911 Ga0307412_10042383 Ga0307412_100423834 85
442 3300031911 Ga0307412_10258838 Ga0307412_102588381 85
443 3300031911 Ga0307412_10394411 Ga0307412_103944112 85
444 3300031911 Ga0307412_11123125 Ga0307412_111231252 85
445 3300031995 Ga0307409_102287656 Ga0307409_1022876562 85
446 3300032002 Ga0307416_100080904 Ga0307416_1000809043 85
447 3300032002 Ga0307416_101782698 Ga0307416_1017826981 85
448 3300032002 Ga0307416_103122858 Ga0307416_1031228581 85
449 3300032002 Ga0307416_103612871 Ga0307416_1036128712 85
450 3300032002 Ga0307416_103739296 Ga0307416_1037392961 85
451 3300032005 Ga0307411_10772200 Ga0307411_107722002 85
452 3300033179 Ga0307507_10033702 Ga0307507_100337024 85
453 3300035089 Ga0373944_0006303 Ga0373944_0006303_2133_2390 85
454 3300035116 Ga0373945_0136824 Ga0373945_0136824_242_499 85
455 3300035691 Ga0373931_0007108 Ga0373931_0007108_1824_2081 85
456 3300035691 Ga0373931_0262302 Ga0373931_0262302_55_312 85
457 3300035695 Ga0373927_0048447 Ga0373927_0048447_1506_1763 85
458 3300037068 Ga0373925_0046159 Ga0373925_0046159_723_980 85
459 3300037312 Ga0395899_0011812 Ga0395899_0011812_2283_2546 85
460 3300037312 Ga0395899_0028736 Ga0395899_0028736_2330_2587 85
461 3300037312 Ga0395899_0037196 Ga0395899_0037196_2653_2910 85
462 3300037312 Ga0395899_0965304 Ga0395899_0965304_135_392 85
463 3300037418 Ga0395900_0006372 Ga0395900_0006372_10613_10870 85
464 3300037418 Ga0395900_0035948 Ga0395900_0035948_1941_2198 85
465 3300037418 Ga0395900_0132373 Ga0395900_0132373_910_1167 85
466 3300037418 Ga0395900_0286476 Ga0395900_0286476_623_886 85
467 3300037418 Ga0395900_0517106 Ga0395900_0517106_800_1057 85
468 3300037418 Ga0395900_1754385 Ga0395900_1754385_145_408 85
469 3300037466 Ga0395898_0010814 Ga0395898_0010814_1624_1887 85
470 3300037466 Ga0395898_0036421 Ga0395898_0036421_1334_1591 85
471 3300037466 Ga0395898_0058613 Ga0395898_0058613_1361_1618 85
472 3300037466 Ga0395898_0107134 Ga0395898_0107134_1914_2171 85
473 3300037471 Ga0395905_0000088 Ga0395905_0000088_40186_40443 85
474 3300037471 Ga0395905_0000572 Ga0395905_0000572_5133_5390 85
475 3300037471 Ga0395905_0011982 Ga0395905_0011982_510_767 85
476 3300037471 Ga0395905_0012026 Ga0395905_0012026_316_573 85
477 3300037471 Ga0395905_0014382 Ga0395905_0014382_5378_5635 85
478 3300037471 Ga0395905_0027418 Ga0395905_0027418_254_517 85
479 3300037471 Ga0395905_0059072 Ga0395905_0059072_2066_2326 85
480 3300037471 Ga0395905_0060108 Ga0395905_0060108_1021_1278 85
481 3300037471 Ga0395905_0062421 Ga0395905_0062421_2476_2739 85
482 3300037471 Ga0395905_0069463 Ga0395905_0069463_2606_2863 85
483 3300037471 Ga0395905_0967167 Ga0395905_0967167_287_544 85
484 3300037471 Ga0395905_1095994 Ga0395905_1095994_144_401 85
485 3300037471 Ga0395905_1101169 Ga0395905_1101169_14_271 85
486 3300038443 Ga0395901_0123193 Ga0395901_0123193_154_417 85
487 3300038443 Ga0395901_0195280 Ga0395901_0195280_1378_1635 85
488 3300038443 Ga0395901_0352224 Ga0395901_0352224_1024_1281 85
489 3300038443 Ga0395901_0388373 Ga0395901_0388373_600_857 85
490 3300038443 Ga0395901_0543406 Ga0395901_0543406_272_529 85
491 3300038443 Ga0395901_1077478 Ga0395901_1077478_191_454 85
492 3300038443 Ga0395901_1483466 Ga0395901_1483466_154_417 85
493 3300039437 Ga0436365_0965563 Ga0436365_0965563_195_452 85
494 3300039437 Ga0436365_1322651 Ga0436365_1322651_146_403 85
495 3300039437 Ga0436365_1608897 Ga0436365_1608897_109_369 85
496 3300039447 Ga0436361_0577382 Ga0436361_0577382_3052_3309 85
497 3300039447 Ga0436361_0675139 Ga0436361_0675139_70_327 85
498 3300039447 Ga0436361_0701864 Ga0436361_0701864_4551_4808 85
499 3300039447 Ga0436361_0944371 Ga0436361_0944371_6214_6486 85
500 3300039447 Ga0436361_1218189 Ga0436361_1218189_8911_9183 85
501 3300041406 Ga0439439_0029533 Ga0439439_0029533_715_972 85
502 3300041408 Ga0439453_0002156 Ga0439453_0002156_2361_2621 85
503 3300041408 Ga0439453_0180403 Ga0439453_0180403_10_267 85
504 3300041410 Ga0439461_0015886 Ga0439461_0015886_258_518 85
505 3300041410 Ga0439461_0078680 Ga0439461_0078680_228_488 85
506 3300041410 Ga0439461_0226220 Ga0439461_0226220_165_425 85
507 3300041411 Ga0439466_0154303 Ga0439466_0154303_10_267 85
508 3300041413 Ga0439465_0115913 Ga0439465_0115913_611_868 85
509 3300041441 Ga0451787_747456 Ga0451787_747456_68_328 85
510 3300041443 Ga0451789_0263010 Ga0451789_0263010_122_382 85
511 3300041443 Ga0451789_0994690 Ga0451789_0994690_241_501 85
512 3300041444 Ga0451790_40937 Ga0451790_40937_98_358 85
513 3300041445 Ga0451792_07629 Ga0451792_07629_440_700 85
514 3300041451 Ga0451791_0119703 Ga0451791_0119703_233_493 85
515 3300041451 Ga0451791_0434493 Ga0451791_0434493_415_675 85
516 3300041451 Ga0451791_1528259 Ga0451791_1528259_73_330 85
517 3300041452 Ga0451793_0444831 Ga0451793_0444831_276_536 85
518 3300041453 Ga0451797_0400801 Ga0451797_0400801_84_344 85
519 3300041456 Ga0451795_0317897 Ga0451795_0317897_45_305 85
520 3300041456 Ga0451795_0606043 Ga0451795_0606043_320_580 85
521 3300041456 Ga0451795_0709851 Ga0451795_0709851_171_431 85
522 3300041457 Ga0451803_10289 Ga0451803_10289_440_697 85
523 3300041458 Ga0451798_0906264 Ga0451798_0906264_1665_1925 85
524 3300041458 Ga0451798_1010413 Ga0451798_1010413_122_379 85
525 3300041459 Ga0451800_1407603 Ga0451800_1407603_121_381 85
526 3300041460 Ga0451802_0165900 Ga0451802_0165900_703_963 85
527 3300041460 Ga0451802_1253790 Ga0451802_1253790_1242_1508 85
528 3300041461 Ga0451805_035215 Ga0451805_035215_304_564 85
529 3300041461 Ga0451805_050872 Ga0451805_050872_416_676 85
530 3300041461 Ga0451805_062719 Ga0451805_062719_13_270 85
531 3300041463 Ga0451804_0524043 Ga0451804_0524043_1687_1947 85
532 3300041464 Ga0451808_17493 Ga0451808_17493_36_296 85
533 3300041486 Ga0451807_0330362 Ga0451807_0330362_752_1012 85
534 3300041486 Ga0451807_2270138 Ga0451807_2270138_57_317 85
535 3300041491 Ga0451833_0330071 Ga0451833_0330071_151_411 85
536 3300041491 Ga0451833_0655318 Ga0451833_0655318_57_317 85
537 3300041492 Ga0451835_0694273 Ga0451835_0694273_340_600 85
538 3300041494 Ga0451837_1774988 Ga0451837_1774988_61_318 85
539 3300041498 Ga0451841_0105846 Ga0451841_0105846_525_785 85
540 3300041498 Ga0451841_0671554 Ga0451841_0671554_211_471 85
541 3300041498 Ga0451841_1145597 Ga0451841_1145597_229_486 85
542 3300041501 Ga0451845_0164481 Ga0451845_0164481_55_312 85
543 3300041503 Ga0451847_0278715 Ga0451847_0278715_158_415 85
544 3300041506 Ga0451850_04492 Ga0451850_04492_44_301 85
545 3300041512 Ga0451853_1259832 Ga0451853_1259832_292_552 85
546 3300041512 Ga0451853_1473800 Ga0451853_1473800_65_325 85
547 3300041907 Ga0452268_35386 Ga0452268_35386_261_521 85
548 3300042006 Ga0439432_068608 Ga0439432_068608_770_1030 85
549 3300042007 Ga0439449_0002153 Ga0439449_0002153_2840_3097 85
550 3300042009 Ga0439451_041027 Ga0439451_041027_349_606 85
551 3300042014 Ga0439457_008880 Ga0439457_008880_339_596 85
552 3300042014 Ga0439457_149134 Ga0439457_149134_262_522 85
553 3300042118 Ga0450914_028955 Ga0450914_028955_94_354 85
554 3300042118 Ga0450914_048956 Ga0450914_048956_265_525 85
555 3300042127 Ga0450890_015301 Ga0450890_015301_352_609 85
556 3300042131 Ga0450894_027161 Ga0450894_027161_307_567 85
557 3300042133 Ga0450896_034195 Ga0450896_034195_89_346 85
558 3300042134 Ga0450898_006396 Ga0450898_006396_727_987 85
559 3300042134 Ga0450898_155362 Ga0450898_155362_197_457 85
560 3300042156 Ga0439446_0049193 Ga0439446_0049193_922_1179 85
561 3300042157 Ga0439458_0032273 Ga0439458_0032273_757_1017 85
562 3300042435 Ga0439434_0065387 Ga0439434_0065387_457_714 85
563 3300042435 Ga0439434_0316525 Ga0439434_0316525_266_523 85
564 3300042438 Ga0439459_0143401 Ga0439459_0143401_127_384 85
565 3300042439 Ga0439464_0007196 Ga0439464_0007196_773_1033 85
566 3300042530 Ga0450916_044966 Ga0450916_044966_106_363 85
567 3300042532 Ga0450893_0001535 Ga0450893_0001535_3154_3411 85
568 3300042876 Ga0451577_0002525 Ga0451577_0002525_6961_7218 85
569 3300042876 Ga0451577_0045489 Ga0451577_0045489_2503_2760 85
570 3300042876 Ga0451577_0056391 Ga0451577_0056391_1041_1298 85
571 3300042876 Ga0451577_1605171 Ga0451577_1605171_39_299 85
572 3300044656 Ga0466969_0000008 Ga0466969_0000008_20026_20283 85
573 3300044656 Ga0466969_0003553 Ga0466969_0003553_2200_2457 85
574 3300044656 Ga0466969_0009510 Ga0466969_0009510_866_1129 85
575 3300044656 Ga0466969_0010304 Ga0466969_0010304_4339_4596 85
576 3300044658 Ga0466972_0088445 Ga0466972_0088445_635_892 85
577 3300044673 Ga0453683_0002014 Ga0453683_0002014_4058_4318 85
578 3300044673 Ga0453683_0306702 Ga0453683_0306702_68_325 85
579 3300044683 Ga0466965_0003131 Ga0466965_0003131_4740_5003 85
580 3300044683 Ga0466965_0059268 Ga0466965_0059268_320_577 85
581 3300044683 Ga0466965_0113646 Ga0466965_0113646_212_469 85
582 3300044683 Ga0466965_0333402 Ga0466965_0333402_550_807 85
583 3300044683 Ga0466965_0566753 Ga0466965_0566753_45_302 85
584 3300044683 Ga0466965_0828532 Ga0466965_0828532_206_466 85
585 3300044684 Ga0466966_0001826 Ga0466966_0001826_2595_2852 85
586 3300044684 Ga0466966_0007945 Ga0466966_0007945_4224_4481 85
587 3300044684 Ga0466966_0008926 Ga0466966_0008926_1193_1456 85
588 3300044684 Ga0466966_0013800 Ga0466966_0013800_3075_3332 85
589 3300044684 Ga0466966_0153258 Ga0466966_0153258_178_435 85
590 3300044684 Ga0466966_0178938 Ga0466966_0178938_903_1160 85
591 3300044684 Ga0466966_0502399 Ga0466966_0502399_33_290 85
592 3300044693 Ga0466961_0027139 Ga0466961_0027139_296_553 85
593 3300044693 Ga0466961_0041448 Ga0466961_0041448_476_739 85
594 3300044694 Ga0466963_0006900 Ga0466963_0006900_1214_1471 85
595 3300044694 Ga0466963_0059746 Ga0466963_0059746_854_1117 85
596 3300044706 Ga0466964_0002210 Ga0466964_0002210_1003_1266 85
597 3300044706 Ga0466964_0007297 Ga0466964_0007297_553_810 85
598 3300044706 Ga0466964_0154962 Ga0466964_0154962_744_1001 85
599 3300044712 Ga0453684_0006310 Ga0453684_0006310_3960_4220 85
600 3300044712 Ga0453684_0077376 Ga0453684_0077376_53_310 85
601 3300044712 Ga0453684_2081783 Ga0453684_2081783_195_452 85
602 3300044712 Ga0453684_2412378 Ga0453684_2412378_217_474 85
603 3300044719 Ga0466971_0019502 Ga0466971_0019502_1430_1693 85
604 3300044719 Ga0466971_0110556 Ga0466971_0110556_109_366 85
605 3300044735 Ga0466968_0089169 Ga0466968_0089169_606_863 85
606 3300044735 Ga0466968_0216321 Ga0466968_0216321_391_654 85
607 3300044765 Ga0466970_0015667 Ga0466970_0015667_1736_1999 85
608 3300044765 Ga0466970_0028777 Ga0466970_0028777_170_427 85
609 3300044765 Ga0466970_0047856 Ga0466970_0047856_1227_1484 85
610 3300044765 Ga0466970_0174607 Ga0466970_0174607_818_1075 85
611 3300044842 Ga0466957_0001869 Ga0466957_0001869_7145_7408 85
612 3300044842 Ga0466957_0006607 Ga0466957_0006607_1249_1506 85
613 3300044842 Ga0466957_0090082 Ga0466957_0090082_989_1246 85
614 3300044901 Ga0466960_0106510 Ga0466960_0106510_684_941 85
615 3300044901 Ga0466960_0924585 Ga0466960_0924585_155_412 85
616 3300045049 Ga0466959_0000192 Ga0466959_0000192_17080_17337 85
617 3300045049 Ga0466959_0001900 Ga0466959_0001900_1834_2097 85
618 3300045049 Ga0466959_0146563 Ga0466959_0146563_1299_1556 85
619 3300045049 Ga0466959_0237356 Ga0466959_0237356_453_716 85
620 3300045049 Ga0466959_0310305 Ga0466959_0310305_80_337 85
621 3300045049 Ga0466959_0349911 Ga0466959_0349911_349_606 85
622 3300045051 Ga0451576_0002088 Ga0451576_0002088_9006_9263 85
623 3300045051 Ga0451576_0008890 Ga0451576_0008890_7173_7433 85
624 3300045051 Ga0451576_1541157 Ga0451576_1541157_334_591 85
625 3300045051 Ga0451576_1645678 Ga0451576_1645678_22_279 85
626 3300045836 Ga0466958_0074122 Ga0466958_0074122_1312_1575 85
627 3300045836 Ga0466958_0083497 Ga0466958_0083497_1199_1456 85
628 3300045836 Ga0466958_0150775 Ga0466958_0150775_916_1173 85
629 3300045976 Ga0466967_0059458 Ga0466967_0059458_997_1254 85
630 3300045976 Ga0466967_0772182 Ga0466967_0772182_328_591 85
631 3300045976 Ga0466967_1042550 Ga0466967_1042550_186_443 85
632 3300045976 Ga0466967_1936208 Ga0466967_1936208_188_445 85
633 3300046460 Ga0495638_0598691 Ga0495638_0598691_120_380 85
634 3300046492 Ga0495585_0021845 Ga0495585_0021845_1433_1690 85
635 3300046512 Ga0495610_0117871 Ga0495610_0117871_450_710 85
636 3300046515 Ga0495620_0053358 Ga0495620_0053358_375_635 85
637 3300046519 Ga0495632_0012504 Ga0495632_0012504_1096_1356 85
638 3300046519 Ga0495632_0101047 Ga0495632_0101047_955_1215 85
639 3300046522 Ga0495643_0101814 Ga0495643_0101814_74_334 85
640 3300046526 Ga0495666_0502507 Ga0495666_0502507_185_442 85
641 3300046528 Ga0495642_0034674 Ga0495642_0034674_364_624 85
642 3300046537 Ga0495598_0082466 Ga0495598_0082466_413_670 85
643 3300046539 Ga0495621_0011477 Ga0495621_0011477_1702_1959 85
644 3300046539 Ga0495621_0040523 Ga0495621_0040523_545_805 85
645 3300046558 Ga0495633_0294553 Ga0495633_0294553_108_368 85
646 3300046615 Ga0495656_0001651 Ga0495656_0001651_4314_4574 85
647 3300046615 Ga0495656_0073823 Ga0495656_0073823_587_847 85
648 3300046615 Ga0495656_0646334 Ga0495656_0646334_185_445 85
649 3300046660 Ga0495625_0003495 Ga0495625_0003495_4944_5204 85
650 3300046665 Ga0495661_0359139 Ga0495661_0359139_368_628 85
651 3300046674 Ga0495588_0374758 Ga0495588_0374758_249_509 85
652 3300046683 Ga0495658_0888972 Ga0495658_0888972_226_486 85
653 3300046684 Ga0495669_0409337 Ga0495669_0409337_21_281 85
654 3300046691 Ga0495670_0102184 Ga0495670_0102184_813_1073 85
655 3300047318 Ga0495636_0024213 Ga0495636_0024213_225_485 85
656 3300047318 Ga0495636_0539224 Ga0495636_0539224_200_457 85
657 3300047445 Ga0495677_0187090 Ga0495677_0187090_255_515 85
658 3300047447 Ga0495685_072880 Ga0495685_072880_711_971 85
659 3300047470 Ga0495681_0147366 Ga0495681_0147366_437_697 85
660 3300047472 Ga0495686_0246667 Ga0495686_0246667_398_658 85
661 3300048088 Ga0495602_0423707 Ga0495602_0423707_429_686 85
662 3300048904 Ga0496101_0438151 Ga0496101_0438151_509_766 85
663 3300048904 Ga0496101_1454457 Ga0496101_1454457_220_477 85
664 3300048905 Ga0496102_0014575 Ga0496102_0014575_5793_6053 85
665 3300048905 Ga0496102_0018900 Ga0496102_0018900_5724_5981 85
666 3300048907 Ga0496104_0573549 Ga0496104_0573549_37_294 85
667 3300048908 Ga0496105_0314580 Ga0496105_0314580_400_657 85
668 3300048909 Ga0496106_0236334 Ga0496106_0236334_983_1243 85
669 3300048911 Ga0496108_1420449 Ga0496108_1420449_206_463 85
670 3300048912 Ga0496109_0040141 Ga0496109_0040141_550_807 85
671 3300048912 Ga0496109_0066448 Ga0496109_0066448_2399_2656 85
672 3300048913 Ga0496110_0054390 Ga0496110_0054390_2769_3026 85
673 3300048913 Ga0496110_1658731 Ga0496110_1658731_184_441 85
674 3300049127 Ga0501306_027905 Ga0501306_027905_275_532 85
675 3300049127 Ga0501306_045413 Ga0501306_045413_371_631 85
676 3300049127 Ga0501306_059872 Ga0501306_059872_20_277 85
677 3300049128 Ga0501308_017892 Ga0501308_017892_332_589 85
678 3300049128 Ga0501308_042937 Ga0501308_042937_275_538 85
679 3300049128 Ga0501308_044818 Ga0501308_044818_220_480 85
680 3300049130 Ga0501310_020091 Ga0501310_020091_337_594 85
681 3300049130 Ga0501310_027621 Ga0501310_027621_375_635 85
682 3300049130 Ga0501310_052438 Ga0501310_052438_71_331 85
683 3300049130 Ga0501310_066193 Ga0501310_066193_189_449 85
684 3300049131 Ga0501341_07304 Ga0501341_07304_397_654 85
685 3300049160 Ga0501304_013717 Ga0501304_013717_407_664 85
686 3300049161 Ga0501305_042175 Ga0501305_042175_381_641 85
687 3300049161 Ga0501305_044733 Ga0501305_044733_414_674 85
688 3300049161 Ga0501305_047534 Ga0501305_047534_58_318 85
689 3300049162 Ga0501307_046115 Ga0501307_046115_20_280 85
690 3300049516 Ga0501293_017900 Ga0501293_017900_398_655 85
691 3300049527 Ga0501311_025972 Ga0501311_025972_441_698 85
692 3300049528 Ga0501312_094047 Ga0501312_094047_236_496 85
693 3300049529 Ga0501313_013402 Ga0501313_013402_269_526 85
694 3300049530 Ga0501314_019790 Ga0501314_019790_339_596 85
695 3300049530 Ga0501314_023747 Ga0501314_023747_375_635 85
696 3300049531 Ga0501315_022610 Ga0501315_022610_470_727 85
697 3300049531 Ga0501315_049781 Ga0501315_049781_385_645 85
698 3300049533 Ga0501317_019606 Ga0501317_019606_391_648 85
699 3300049534 Ga0501318_022873 Ga0501318_022873_118_375 85
700 3300049535 Ga0501319_001294 Ga0501319_001294_568_825 85
701 3300049536 Ga0501320_012097 Ga0501320_012097_238_498 85
702 3300049536 Ga0501320_026922 Ga0501320_026922_42_299 85
703 3300049536 Ga0501320_044150 Ga0501320_044150_26_283 85
704 3300049537 Ga0501321_027612 Ga0501321_027612_110_367 85
705 3300049537 Ga0501321_033459 Ga0501321_033459_42_299 85
706 3300049537 Ga0501321_045406 Ga0501321_045406_297_557 85
707 3300049538 Ga0501322_008434 Ga0501322_008434_384_641 85
708 3300049539 Ga0501323_061789 Ga0501323_061789_47_304 85
709 3300049540 Ga0501324_021119 Ga0501324_021119_371_628 85
710 3300049543 Ga0501327_06633 Ga0501327_06633_404_661 85
711 3300049569 Ga0501032_0164787 Ga0501032_0164787_139_399 85
712 3300049570 Ga0501033_0198515 Ga0501033_0198515_549_809 85
713 3300049571 Ga0501034_0055180 Ga0501034_0055180_2816_3073 85
714 3300049573 Ga0501037_0187833 Ga0501037_0187833_919_1179 85
715 3300049573 Ga0501037_0619022 Ga0501037_0619022_211_468 85
716 3300049574 Ga0501038_0232521 Ga0501038_0232521_1145_1402 85
717 3300049574 Ga0501038_0278315 Ga0501038_0278315_746_1006 85
718 3300049578 Ga0501042_0929024 Ga0501042_0929024_238_498 85
719 3300049579 Ga0501043_0325193 Ga0501043_0325193_386_643 85
720 3300049580 Ga0501046_0068157 Ga0501046_0068157_2115_2372 85
721 3300049581 Ga0501047_0070728 Ga0501047_0070728_1792_2049 85
722 3300049581 Ga0501047_0346872 Ga0501047_0346872_338_598 85
723 3300049582 Ga0501048_0318858 Ga0501048_0318858_594_851 85
724 3300049582 Ga0501048_0842866 Ga0501048_0842866_380_640 85
725 3300049590 Ga0501074_0725442 Ga0501074_0725442_343_600 85
726 3300049665 Ga0501227_197108 Ga0501227_197108_294_554 85
727 3300049679 Ga0501249_218062 Ga0501249_218062_170_427 85
728 3300049682 Ga0501252_002187 Ga0501252_002187_355_612 85
729 3300049683 Ga0501253_149420 Ga0501253_149420_271_531 85
730 3300049686 Ga0501257_041982 Ga0501257_041982_725_982 85
731 3300049742 Ga0501080_0171737 Ga0501080_0171737_771_1028 85
732 3300049742 Ga0501080_0423952 Ga0501080_0423952_718_978 85
733 3300049760 Ga0501263_005364 Ga0501263_005364_156_416 85
734 3300049765 Ga0501268_034714 Ga0501268_034714_533_790 85
735 3300049770 Ga0501273_033534 Ga0501273_033534_70_330 85
736 3300049822 Ga0501035_0095501 Ga0501035_0095501_2164_2421 85
737 3300049822 Ga0501035_0312400 Ga0501035_0312400_986_1246 85
738 3300049823 Ga0501044_0099572 Ga0501044_0099572_2008_2265 85
739 3300050489 nmdc:mga03683_101656_c1 nmdc:mga03683_101656_c1_160_420 85
740 3300050489 nmdc:mga03683_179165_c1 nmdc:mga03683_179165_c1_528_785 85
741 3300050489 nmdc:mga03683_319533_c1 nmdc:mga03683_319533_c1_139_399 85
742 3300050489 nmdc:mga03683_405020_c1 nmdc:mga03683_405020_c1_251_508 85
743 3300050489 nmdc:mga03683_415430_c1 nmdc:mga03683_415430_c1_215_472 85
744 3300050489 nmdc:mga03683_68090_c1 nmdc:mga03683_68090_c1_716_973 85
745 3300050490 nmdc:mga03n38_208653_c1 nmdc:mga03n38_208653_c1_466_726 85
746 3300050490 nmdc:mga03n38_34562_c1 nmdc:mga03n38_34562_c1_1270_1530 85
747 3300050490 nmdc:mga03n38_365470_c1 nmdc:mga03n38_365470_c1_467_724 85
748 3300050491 nmdc:mga00v17_749059_c1 nmdc:mga00v17_749059_c1_210_467 85
749 3300050492 nmdc:mga0yw44_101591_c1 nmdc:mga0yw44_101591_c1_319_576 85
750 3300050492 nmdc:mga0yw44_1030714_c1 nmdc:mga0yw44_1030714_c1_208_465 85
751 3300050492 nmdc:mga0yw44_260353_c1 nmdc:mga0yw44_260353_c1_409_669 85
752 3300050492 nmdc:mga0yw44_77764_c1 nmdc:mga0yw44_77764_c1_1035_1298 85
753 3300050493 nmdc:mga0k408_110974_c1 nmdc:mga0k408_110974_c1_1182_1439 85
754 3300050493 nmdc:mga0k408_147622_c1 nmdc:mga0k408_147622_c1_785_1045 85
755 3300050493 nmdc:mga0k408_212564_c1 nmdc:mga0k408_212564_c1_398_655 85
756 3300050493 nmdc:mga0k408_254_c1 nmdc:mga0k408_254_c1_11790_12047 85
757 3300050493 nmdc:mga0k408_276575_c1 nmdc:mga0k408_276575_c1_542_799 85
758 3300050493 nmdc:mga0k408_331477_c1 nmdc:mga0k408_331477_c1_139_399 85
759 3300050493 nmdc:mga0k408_33733_c1 nmdc:mga0k408_33733_c1_1029_1289 85
760 3300050493 nmdc:mga0k408_498388_c1 nmdc:mga0k408_498388_c1_52_309 85
761 3300050493 nmdc:mga0k408_53178_c1 nmdc:mga0k408_53178_c1_1029_1289 85
762 3300050493 nmdc:mga0k408_594239_c1 nmdc:mga0k408_594239_c1_22_282 85
763 3300050493 nmdc:mga0k408_62721_c1 nmdc:mga0k408_62721_c1_802_1062 85
764 3300050493 nmdc:mga0k408_786658_c1 nmdc:mga0k408_786658_c1_277_534 85
765 3300050493 nmdc:mga0k408_8413_c1 nmdc:mga0k408_8413_c1_3617_3874 85
766 3300050494 nmdc:mga06z11_287036_c1 nmdc:mga06z11_287036_c1_447_704 85
767 3300050494 nmdc:mga06z11_471682_c1 nmdc:mga06z11_471682_c1_115_372 85
768 3300050494 nmdc:mga06z11_59363_c1 nmdc:mga06z11_59363_c1_15_275 85
769 3300050494 nmdc:mga06z11_65821_c1 nmdc:mga06z11_65821_c1_94_354 85
770 3300050494 nmdc:mga06z11_996267_c1 nmdc:mga06z11_996267_c1_40_297 85
771 3300050495 nmdc:mga04h51_214891_c1 nmdc:mga04h51_214891_c1_323_580 85
772 3300050496 nmdc:mga07m45_10255_c1 nmdc:mga07m45_10255_c1_2810_3070 85
773 3300050496 nmdc:mga07m45_13149_c1 nmdc:mga07m45_13149_c1_4092_4349 85
774 3300050496 nmdc:mga07m45_219891_c1 nmdc:mga07m45_219891_c1_57_314 85
775 3300050496 nmdc:mga07m45_331718_c1 nmdc:mga07m45_331718_c1_485_742 85
776 3300050496 nmdc:mga07m45_6340_c1 nmdc:mga07m45_6340_c1_412_672 85
777 3300050516 nmdc:mga0sz30_15579_c2 nmdc:mga0sz30_15579_c2_927_1187 85
778 3300053086 Ga0500578_0001060 Ga0500578_0001060_15347_15607 85
779 3300053087 Ga0500643_031661 Ga0500643_031661_108_368 85
780 3300053088 Ga0500644_0075298 Ga0500644_0075298_222_482 85
781 3300053090 Ga0500646_0004955 Ga0500646_0004955_1518_1778 85
782 3300053092 Ga0500583_0098484 Ga0500583_0098484_728_988 85
783 3300053093 Ga0500651_0006266 Ga0500651_0006266_5972_6232 85
784 3300053093 Ga0500651_0162877 Ga0500651_0162877_206_466 85
785 3300053093 Ga0500651_0195684 Ga0500651_0195684_552_812 85
786 3300053093 Ga0500651_0499061 Ga0500651_0499061_359_616 85
787 3300053098 Ga0500650_0074562 Ga0500650_0074562_267_527 85
788 3300053105 Ga0500557_085454 Ga0500557_085454_300_560 85
789 3300053108 Ga0500562_060524 Ga0500562_060524_69_329 85
790 3300053109 Ga0500569_018717 Ga0500569_018717_534_794 85
791 3300053117 Ga0500593_000440 Ga0500593_000440_10710_10970 85
792 3300053120 Ga0500597_185142 Ga0500597_185142_182_442 85
793 3300053129 Ga0500628_003850 Ga0500628_003850_1593_1853 85
794 3300053130 Ga0500642_0000805 Ga0500642_0000805_1557_1817 85
795 3300053131 Ga0500652_000299 Ga0500652_000299_12920_13180 85
796 3300053133 Ga0500655_005214 Ga0500655_005214_613_873 85
797 3300053134 Ga0500658_0216462 Ga0500658_0216462_191_451 85
798 3300053139 Ga0500568_0018560 Ga0500568_0018560_2370_2630 85
799 3300053139 Ga0500568_0037009 Ga0500568_0037009_1458_1745 85
800 3300053142 Ga0500577_0002588 Ga0500577_0002588_1149_1409 85
801 3300053143 Ga0500579_168047 Ga0500579_168047_234_494 85
802 3300053151 Ga0500604_0056358 Ga0500604_0056358_603_863 85
803 3300053151 Ga0500604_0356510 Ga0500604_0356510_75_362 85
804 3300053154 Ga0500619_000127 Ga0500619_000127_8062_8322 85
805 3300053156 Ga0500622_0000125 Ga0500622_0000125_15178_15438 85
806 3300053156 Ga0500622_0025655 Ga0500622_0025655_1863_2123 85
807 3300053158 Ga0500627_0432634 Ga0500627_0432634_219_476 85
808 3300053177 Ga0500636_0368352 Ga0500636_0368352_364_621 85
809 3300053724 Ga0500570_032674 Ga0500570_032674_65_325 85
810 3300053724 Ga0500570_213015 Ga0500570_213015_136_396 85
811 3300053730 Ga0500645_110615 Ga0500645_110615_115_375 85
812 3300053739 Ga0500587_000581 Ga0500587_000581_4221_4481 85
813 3300059421 Ga0590071_012006 Ga0590071_012006_701_958 85
814 3300059423 Ga0590074_078125 Ga0590074_078125_168_431 85
815 3300059424 Ga0590075_125747 Ga0590075_125747_328_585 85
816 3300059493 Ga0587077_167875 Ga0587077_167875_23_280 85
817 3300059503 Ga0587080_157362 Ga0587080_157362_156_413 85
818 3300059506 Ga0587085_143891 Ga0587085_143891_220_477 85
819 3300059508 Ga0587088_080729 Ga0587088_080729_407_670 85
820 3300059508 Ga0587088_097564 Ga0587088_097564_83_340 85
821 3300059511 Ga0587091_094417 Ga0587091_094417_418_681 85
822 3300059605 Ga0587106_061154 Ga0587106_061154_103_360 85
823 3300059623 Ga0587101_060421 Ga0587101_060421_38_295 85
824 3300059624 Ga0587109_053532 Ga0587109_053532_86_343 85
825 3300059624 Ga0587109_218585 Ga0587109_218585_234_491 85
826 3300059645 Ga0587076_079566 Ga0587076_079566_24_287 85
827 3300059648 Ga0587100_043541 Ga0587100_043541_218_475 85
828 3300060353 Ga0501082_1017924 Ga0501082_1017924_421_678 85
829 3300061719 Ga0466962_0005233 Ga0466962_0005233_4179_4442 85
830 3300061719 Ga0466962_0014889 Ga0466962_0014889_363_620 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

82

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8583 22 85
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.854 22 85
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.8484 24 85
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8398 22 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8274 22 85
ID Description Score Start End Superfamily
af_Q9NDU6_129_252_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8428 22 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8274 22 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8065 29 83 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8033 22 85 2.40.50.100
af_Q9Y3B2_6_56_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7894 29 83 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2S5N5K3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9057 29 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A5C8B9S1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9039 25 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A484PSD2-F1-model_v4 LSU ribosomal protein L27p 0.9012 25 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A2D6RJT0-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.8978 31 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A455UVJ5-F1-model_v4 deleted 0.8946 24 85

Feature Viewer

pLDDT pTM Quality
80.4 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map