F482671
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 830 | 444 | 821 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0037009|Ga0500568_0037009_1458_1745 |
| Length | 95 |
| Sequence | MAQKKGGGSTRNGRDSQPKMLGVKAYGGQLVSAGSIIVRQRGTRFHAGQNVGMGRDHTLFALVDGKISFTIKGVQSHKFVVVTPVDAPVTVAAEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 23 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 24 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 41 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 116 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 205 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 228 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 239 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 249 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 250 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 251 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 252 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 253 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 256 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 257 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041457 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT | Metatranscriptome | Rhizoplane |
| 262 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 266 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 268 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 270 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 271 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 272 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 273 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 274 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 275 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 278 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 279 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 280 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 281 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 282 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 283 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 284 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 285 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 286 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 287 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 288 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 289 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 290 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 291 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 292 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 293 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 294 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 295 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 296 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 297 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 298 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 299 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 300 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 301 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 302 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 303 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 304 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 305 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 306 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 314 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 315 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 357 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 384 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 385 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 386 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 389 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 390 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 394 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 395 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 398 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 406 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 407 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 408 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 409 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 410 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 411 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 412 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 413 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 415 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 416 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 417 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 418 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 421 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 422 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 424 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 425 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 428 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 430 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 431 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 432 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 433 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.87 |
| Metatranscriptomes | 12.05 |
| Isolates | 1.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.33 |
| Nodule | 0.24 |
| Rhizoplane | 4.7 |
| Rhizosphere | 67.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_638870 | 2162886006 | Bacteria | 934 |
| 2 | JGI24740J21852_10035537 | 3300001979 | Bacteria | 1557 |
| 3 | JGI24735J21928_10185972 | 3300002067 | Bacteria | 602 |
| 4 | JGI24744J21845_10075619 | 3300002077 | Bacteria | 614 |
| 5 | JGI25152J39213_1000892 | 3300002773 | Bacteria | 14659 |
| 6 | JGI25150J39212_1002313 | 3300002774 | Bacteria | 4795 |
| 7 | Ga0006778J45830_1018330 | 3300003162 | Bacteria | 699 |
| 8 | Ga0006759J45824_1013933 | 3300003163 | Bacteria | 664 |
| 9 | Ga0006759J45824_1017103 | 3300003163 | Bacteria | 699 |
| 10 | Ga0006759J45824_1023259 | 3300003163 | Bacteria | 622 |
| 11 | JGI25153J46596_10000420 | 3300003215 | Bacteria | 27768 |
| 12 | Ga0006770J48903_1013780 | 3300003305 | Bacteria | 699 |
| 13 | rootH1_10043230 | 3300003316 | Bacteria | 1924 |
| 14 | rootL2_10005413 | 3300003322 | Bacteria | 3367 |
| 15 | rootL2_10083805 | 3300003322 | Bacteria | 2725 |
| 16 | JGI26128J50194_1000218 | 3300003347 | Bacteria | 2744 |
| 17 | JGI26145J50221_1002388 | 3300003371 | Bacteria | 1477 |
| 18 | Ga0007417J51691_1011360 | 3300003544 | Bacteria | 666 |
| 19 | Ga0007417J51691_1011711 | 3300003544 | Bacteria | 699 |
| 20 | Ga0007417J51691_1017103 | 3300003544 | Bacteria | 613 |
| 21 | Ga0007417J51691_1045595 | 3300003544 | Bacteria | 733 |
| 22 | Ga0007417J51691_1114763 | 3300003544 | Bacteria | 634 |
| 23 | Ga0007427J51700_112861 | 3300003559 | Bacteria | 699 |
| 24 | Ga0007410J51695_1004507 | 3300003574 | Bacteria | 1438 |
| 25 | Ga0007410J51695_1011000 | 3300003574 | Bacteria | 667 |
| 26 | Ga0007410J51695_1022391 | 3300003574 | Bacteria | 699 |
| 27 | Ga0007409J51694_1012913 | 3300003575 | Bacteria | 598 |
| 28 | Ga0007409J51694_1014513 | 3300003575 | Bacteria | 706 |
| 29 | Ga0007409J51694_1027825 | 3300003575 | Bacteria | 662 |
| 30 | Ga0007416J51690_1023874 | 3300003577 | Bacteria | 759 |
| 31 | Ga0007416J51690_1026130 | 3300003577 | Bacteria | 611 |
| 32 | Ga0007416J51690_1065410 | 3300003577 | Bacteria | 552 |
| 33 | Ga0007429J51699_1012803 | 3300003579 | Bacteria | 598 |
| 34 | Ga0007411J51799_105540 | 3300003611 | Bacteria | 710 |
| 35 | Ga0007411J51799_112204 | 3300003611 | Bacteria | 566 |
| 36 | Ga0007415J51800_103902 | 3300003613 | Bacteria | 713 |
| 37 | Ga0032354_1016521 | 3300003693 | Bacteria | 766 |
| 38 | Ga0032354_1024639 | 3300003693 | Bacteria | 697 |
| 39 | Ga0032354_1031837 | 3300003693 | Bacteria | 646 |
| 40 | Ga0032354_1037179 | 3300003693 | Bacteria | 826 |
| 41 | Ga0006780_1017431 | 3300003735 | Bacteria | 639 |
| 42 | Ga0055539_1012687 | 3300003752 | Bacteria | 1035 |
| 43 | Ga0055526_1014626 | 3300003771 | Bacteria | 3211 |
| 44 | Ga0055524_1000109 | 3300003775 | Bacteria | 100308 |
| 45 | Ga0055530_10003385 | 3300003791 | Bacteria | 9105 |
| 46 | Ga0055530_10034055 | 3300003791 | Bacteria | 1305 |
| 47 | Ga0055540_1000013 | 3300003792 | Bacteria | 262274 |
| 48 | Ga0055540_1009236 | 3300003792 | Bacteria | 3430 |
| 49 | Ga0055540_1017082 | 3300003792 | Bacteria | 2037 |
| 50 | Ga0055540_1095489 | 3300003792 | Bacteria | 558 |
| 51 | Ga0055540_1112322 | 3300003792 | Bacteria | 502 |
| 52 | Ga0055531_10000158 | 3300003794 | Bacteria | 77918 |
| 53 | Ga0055531_10005660 | 3300003794 | Bacteria | 7260 |
| 54 | Ga0058859_11701938 | 3300004798 | Bacteria | 662 |
| 55 | Ga0058859_11819676 | 3300004798 | Bacteria | 766 |
| 56 | Ga0058859_11829144 | 3300004798 | Bacteria | 590 |
| 57 | Ga0058863_10004931 | 3300004799 | Bacteria | 597 |
| 58 | Ga0058863_11886072 | 3300004799 | Bacteria | 721 |
| 59 | Ga0058861_12046980 | 3300004800 | Bacteria | 576 |
| 60 | Ga0058860_10070410 | 3300004801 | Bacteria | 653 |
| 61 | Ga0058860_12216250 | 3300004801 | Bacteria | 863 |
| 62 | Ga0065165_1002013 | 3300005262 | Bacteria | 18978 |
| 63 | Ga0065165_1080711 | 3300005262 | Bacteria | 845 |
| 64 | Ga0065704_10527730 | 3300005289 | Bacteria | 648 |
| 65 | Ga0065707_10082503 | 3300005295 | Bacteria | 14412 |
| 66 | Ga0065707_11023718 | 3300005295 | Bacteria | 533 |
| 67 | Ga0070658_10068891 | 3300005327 | Bacteria | 2893 |
| 68 | Ga0070658_10320018 | 3300005327 | Bacteria | 1324 |
| 69 | Ga0070658_10534964 | 3300005327 | Bacteria | 1013 |
| 70 | Ga0070658_10649110 | 3300005327 | Bacteria | 915 |
| 71 | Ga0070677_10087294 | 3300005333 | Bacteria | 1349 |
| 72 | Ga0068869_100297442 | 3300005334 | Bacteria | 1302 |
| 73 | Ga0068869_101128982 | 3300005334 | Bacteria | 687 |
| 74 | Ga0070680_100134810 | 3300005336 | Bacteria | 2068 |
| 75 | Ga0070682_100267190 | 3300005337 | Bacteria | 1241 |
| 76 | Ga0068868_100229049 | 3300005338 | Bacteria | 1558 |
| 77 | Ga0070660_100070483 | 3300005339 | Bacteria | 2728 |
| 78 | Ga0070660_100108958 | 3300005339 | Bacteria | 2202 |
| 79 | Ga0070660_100973026 | 3300005339 | Bacteria | 717 |
| 80 | Ga0070687_101193445 | 3300005343 | Bacteria | 561 |
| 81 | Ga0070661_100126267 | 3300005344 | Bacteria | 1919 |
| 82 | Ga0070661_100748768 | 3300005344 | Bacteria | 799 |
| 83 | Ga0070668_100128990 | 3300005347 | Bacteria | 2028 |
| 84 | Ga0070669_100054025 | 3300005353 | Bacteria | 2941 |
| 85 | Ga0070671_101356837 | 3300005355 | Bacteria | 628 |
| 86 | Ga0070674_100113587 | 3300005356 | Bacteria | 1993 |
| 87 | Ga0070674_100671121 | 3300005356 | Bacteria | 883 |
| 88 | Ga0070673_101356170 | 3300005364 | Bacteria | 669 |
| 89 | Ga0070659_100008466 | 3300005366 | Bacteria | 7516 |
| 90 | Ga0070667_100116760 | 3300005367 | Bacteria | 2318 |
| 91 | Ga0070667_100145381 | 3300005367 | Bacteria | 2079 |
| 92 | Ga0070700_100058250 | 3300005441 | Bacteria | 2426 |
| 93 | Ga0070663_100125498 | 3300005455 | Bacteria | 1944 |
| 94 | Ga0070663_100377465 | 3300005455 | Bacteria | 1154 |
| 95 | Ga0070678_100020291 | 3300005456 | Bacteria | 4357 |
| 96 | Ga0070678_101574061 | 3300005456 | Bacteria | 617 |
| 97 | Ga0070681_10528773 | 3300005458 | Bacteria | 1093 |
| 98 | Ga0068867_100001947 | 3300005459 | Bacteria | 14386 |
| 99 | Ga0068867_101294889 | 3300005459 | Bacteria | 672 |
| 100 | Ga0068867_101571629 | 3300005459 | Bacteria | 614 |
| 101 | Ga0070706_100002083 | 3300005467 | Bacteria | 20391 |
| 102 | Ga0070706_101829860 | 3300005467 | Bacteria | 552 |
| 103 | Ga0070698_100128634 | 3300005471 | Bacteria | 2489 |
| 104 | Ga0070699_100243867 | 3300005518 | Bacteria | 1605 |
| 105 | Ga0070679_100212564 | 3300005530 | Bacteria | 1897 |
| 106 | Ga0070679_100500176 | 3300005530 | Bacteria | 1159 |
| 107 | Ga0070684_101644640 | 3300005535 | Bacteria | 606 |
| 108 | Ga0068853_101067456 | 3300005539 | Bacteria | 778 |
| 109 | Ga0070672_101355696 | 3300005543 | Bacteria | 636 |
| 110 | Ga0070665_100842570 | 3300005548 | Bacteria | 930 |
| 111 | Ga0070665_100928564 | 3300005548 | Bacteria | 883 |
| 112 | Ga0068855_100032613 | 3300005563 | Bacteria | 6218 |
| 113 | Ga0068855_100120364 | 3300005563 | Bacteria | 3005 |
| 114 | Ga0068855_100142205 | 3300005563 | Bacteria | 2733 |
| 115 | Ga0068852_100089473 | 3300005616 | Bacteria | 2752 |
| 116 | Ga0068852_101219474 | 3300005616 | Bacteria | 773 |
| 117 | Ga0068859_101381555 | 3300005617 | Bacteria | 777 |
| 118 | Ga0068864_100200723 | 3300005618 | Bacteria | 1832 |
| 119 | Ga0068864_100536369 | 3300005618 | Bacteria | 1130 |
| 120 | Ga0068864_101282041 | 3300005618 | Bacteria | 733 |
| 121 | Ga0068866_10003673 | 3300005718 | Bacteria | 6287 |
| 122 | Ga0068861_100006327 | 3300005719 | Bacteria | 8059 |
| 123 | Ga0068861_101944555 | 3300005719 | Bacteria | 586 |
| 124 | Ga0068863_100071767 | 3300005841 | Bacteria | 3275 |
| 125 | Ga0068863_100608432 | 3300005841 | Bacteria | 1082 |
| 126 | Ga0068863_101633437 | 3300005841 | Bacteria | 654 |
| 127 | Ga0068858_101353515 | 3300005842 | Bacteria | 701 |
| 128 | Ga0068858_102085773 | 3300005842 | Bacteria | 561 |
| 129 | Ga0068860_100002278 | 3300005843 | Bacteria | 20163 |
| 130 | Ga0068860_101796647 | 3300005843 | Bacteria | 635 |
| 131 | Ga0068862_100673631 | 3300005844 | Bacteria | 1000 |
| 132 | Ga0075365_10023056 | 3300006038 | Bacteria | 3911 |
| 133 | Ga0075365_10038406 | 3300006038 | Bacteria | 3112 |
| 134 | Ga0075365_10144102 | 3300006038 | Bacteria | 1655 |
| 135 | Ga0075365_10146992 | 3300006038 | Bacteria | 1638 |
| 136 | Ga0075365_10986743 | 3300006038 | Bacteria | 594 |
| 137 | Ga0075368_10050993 | 3300006042 | Bacteria | 1645 |
| 138 | Ga0075368_10084772 | 3300006042 | Bacteria | 1292 |
| 139 | Ga0075368_10242439 | 3300006042 | Bacteria | 769 |
| 140 | Ga0075363_100019150 | 3300006048 | Bacteria | 3420 |
| 141 | Ga0075363_100054717 | 3300006048 | Bacteria | 2135 |
| 142 | Ga0075363_100100193 | 3300006048 | Bacteria | 1602 |
| 143 | Ga0075363_100133175 | 3300006048 | Bacteria | 1395 |
| 144 | Ga0075363_100410322 | 3300006048 | Bacteria | 797 |
| 145 | Ga0075363_100698830 | 3300006048 | Bacteria | 612 |
| 146 | Ga0075363_100727169 | 3300006048 | Bacteria | 600 |
| 147 | Ga0075364_10241644 | 3300006051 | Bacteria | 1226 |
| 148 | Ga0075364_10439091 | 3300006051 | Bacteria | 892 |
| 149 | Ga0075364_10944518 | 3300006051 | Bacteria | 587 |
| 150 | Ga0075362_10043584 | 3300006177 | Bacteria | 1987 |
| 151 | Ga0075362_10052438 | 3300006177 | Bacteria | 1828 |
| 152 | Ga0075362_10057331 | 3300006177 | Bacteria | 1755 |
| 153 | Ga0075362_10164527 | 3300006177 | Bacteria | 1069 |
| 154 | Ga0075362_10182982 | 3300006177 | Bacteria | 1016 |
| 155 | Ga0075362_10242245 | 3300006177 | Bacteria | 886 |
| 156 | Ga0075362_10718003 | 3300006177 | Bacteria | 522 |
| 157 | Ga0075367_10006143 | 3300006178 | Bacteria | 6043 |
| 158 | Ga0075367_10007325 | 3300006178 | Bacteria | 5643 |
| 159 | Ga0075367_10026991 | 3300006178 | Bacteria | 3262 |
| 160 | Ga0075367_10399051 | 3300006178 | Bacteria | 870 |
| 161 | Ga0075369_10021846 | 3300006186 | Bacteria | 2635 |
| 162 | Ga0075369_10031196 | 3300006186 | Bacteria | 2248 |
| 163 | Ga0075366_10014821 | 3300006195 | Bacteria | 4458 |
| 164 | Ga0075366_10035470 | 3300006195 | Bacteria | 2940 |
| 165 | Ga0075366_10041460 | 3300006195 | Bacteria | 2725 |
| 166 | Ga0075366_10050690 | 3300006195 | Bacteria | 2465 |
| 167 | Ga0075366_10088935 | 3300006195 | Bacteria | 1849 |
| 168 | Ga0075366_10103320 | 3300006195 | Bacteria | 1711 |
| 169 | Ga0075366_10127248 | 3300006195 | Bacteria | 1537 |
| 170 | Ga0075366_10144411 | 3300006195 | Bacteria | 1439 |
| 171 | Ga0075366_10240950 | 3300006195 | Bacteria | 1102 |
| 172 | Ga0075366_10246833 | 3300006195 | Bacteria | 1089 |
| 173 | Ga0075366_10254499 | 3300006195 | Bacteria | 1071 |
| 174 | Ga0075366_10326500 | 3300006195 | Bacteria | 940 |
| 175 | Ga0075370_10002426 | 3300006353 | Bacteria | 8638 |
| 176 | Ga0075370_10002528 | 3300006353 | Bacteria | 8493 |
| 177 | Ga0075370_10015050 | 3300006353 | Bacteria | 4135 |
| 178 | Ga0075370_10232171 | 3300006353 | Bacteria | 1092 |
| 179 | Ga0075370_10252821 | 3300006353 | Bacteria | 1045 |
| 180 | Ga0068871_101698157 | 3300006358 | Bacteria | 599 |
| 181 | Ga0068871_102191088 | 3300006358 | Bacteria | 527 |
| 182 | Ga0075428_100473805 | 3300006844 | Bacteria | 1340 |
| 183 | Ga0075430_100033190 | 3300006846 | Bacteria | 4382 |
| 184 | Ga0075431_101382757 | 3300006847 | Bacteria | 664 |
| 185 | Ga0075429_100074259 | 3300006880 | Bacteria | 2962 |
| 186 | Ga0068865_100031867 | 3300006881 | Bacteria | 3518 |
| 187 | Ga0097620_101381565 | 3300006931 | Bacteria | 777 |
| 188 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 189 | Ga0105240_10017122 | 3300009093 | Bacteria | 9784 |
| 190 | Ga0105240_11888680 | 3300009093 | Bacteria | 621 |
| 191 | Ga0111539_10608222 | 3300009094 | Bacteria | 1273 |
| 192 | Ga0111539_13201018 | 3300009094 | Bacteria | 528 |
| 193 | Ga0105245_10170491 | 3300009098 | Bacteria | 2072 |
| 194 | Ga0105245_10311700 | 3300009098 | Bacteria | 1547 |
| 195 | Ga0105245_11663801 | 3300009098 | Bacteria | 690 |
| 196 | Ga0105247_10944305 | 3300009101 | Bacteria | 669 |
| 197 | Ga0114129_12840635 | 3300009147 | Bacteria | 574 |
| 198 | Ga0105241_10083226 | 3300009174 | Bacteria | 2510 |
| 199 | Ga0105242_10469742 | 3300009176 | Bacteria | 1190 |
| 200 | Ga0105248_10721083 | 3300009177 | Bacteria | 1125 |
| 201 | Ga0105248_10854833 | 3300009177 | Bacteria | 1027 |
| 202 | Ga0105248_11268854 | 3300009177 | Bacteria | 833 |
| 203 | Ga0105237_10518801 | 3300009545 | Bacteria | 1198 |
| 204 | Ga0105237_10675960 | 3300009545 | Bacteria | 1039 |
| 205 | Ga0105238_10145507 | 3300009551 | Bacteria | 2346 |
| 206 | Ga0105238_10594850 | 3300009551 | Bacteria | 1114 |
| 207 | Ga0105238_10794777 | 3300009551 | Bacteria | 961 |
| 208 | Ga0105238_10872399 | 3300009551 | Bacteria | 917 |
| 209 | Ga0105249_10037455 | 3300009553 | Bacteria | 4402 |
| 210 | Ga0105249_11185643 | 3300009553 | Bacteria | 834 |
| 211 | Ga0105239_10804060 | 3300010375 | Bacteria | 1077 |
| 212 | Ga0157319_1021801 | 3300012497 | Bacteria | 628 |
| 213 | Ga0157324_1059132 | 3300012506 | Bacteria | 520 |
| 214 | Ga0157327_1010021 | 3300012512 | Bacteria | 886 |
| 215 | Ga0157326_1076205 | 3300012513 | Bacteria | 541 |
| 216 | Ga0157374_10236650 | 3300013296 | Bacteria | 1795 |
| 217 | Ga0157374_10691420 | 3300013296 | Bacteria | 1033 |
| 218 | Ga0157378_10015555 | 3300013297 | Bacteria | 6664 |
| 219 | Ga0157378_10206273 | 3300013297 | Bacteria | 1861 |
| 220 | Ga0157378_10551355 | 3300013297 | Bacteria | 1158 |
| 221 | Ga0157378_11520289 | 3300013297 | Bacteria | 714 |
| 222 | Ga0157378_11659920 | 3300013297 | Bacteria | 685 |
| 223 | Ga0163162_10280517 | 3300013306 | Bacteria | 1798 |
| 224 | Ga0157372_12402095 | 3300013307 | Bacteria | 605 |
| 225 | Ga0157372_12455151 | 3300013307 | Bacteria | 598 |
| 226 | Ga0157372_12707485 | 3300013307 | Bacteria | 569 |
| 227 | Ga0157375_10717041 | 3300013308 | Bacteria | 1153 |
| 228 | Ga0163163_11320509 | 3300014325 | Bacteria | 783 |
| 229 | Ga0182008_10401829 | 3300014497 | Bacteria | 736 |
| 230 | Ga0182008_10759152 | 3300014497 | Bacteria | 559 |
| 231 | Ga0157379_10591784 | 3300014968 | Bacteria | 1035 |
| 232 | Ga0157379_11390960 | 3300014968 | Bacteria | 680 |
| 233 | Ga0157376_10049735 | 3300014969 | Bacteria | 3473 |
| 234 | Ga0157376_10531467 | 3300014969 | Bacteria | 1161 |
| 235 | Ga0157376_10558338 | 3300014969 | Bacteria | 1134 |
| 236 | Ga0182007_10088519 | 3300015262 | Bacteria | 1019 |
| 237 | Ga0182007_10202316 | 3300015262 | Bacteria | 695 |
| 238 | Ga0163161_10230509 | 3300017792 | Bacteria | 1437 |
| 239 | Ga0163161_10658434 | 3300017792 | Bacteria | 868 |
| 240 | Ga0197907_10563325 | 3300020069 | Bacteria | 786 |
| 241 | Ga0206355_1480352 | 3300020076 | Bacteria | 720 |
| 242 | Ga0213872_10038378 | 3300021361 | Bacteria | 2186 |
| 243 | Ga0213872_10060580 | 3300021361 | Bacteria | 1711 |
| 244 | Ga0207425_1000221 | 3300025245 | Bacteria | 44837 |
| 245 | Ga0209677_107129 | 3300025253 | Bacteria | 2452 |
| 246 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 247 | Ga0209129_1037315 | 3300025258 | Bacteria | 783 |
| 248 | Ga0209129_1059813 | 3300025258 | Bacteria | 566 |
| 249 | Ga0209129_1060622 | 3300025258 | Bacteria | 560 |
| 250 | Ga0209565_1007217 | 3300025263 | Bacteria | 3022 |
| 251 | Ga0209673_1002136 | 3300025273 | Bacteria | 14727 |
| 252 | Ga0209673_1019202 | 3300025273 | Bacteria | 2462 |
| 253 | Ga0209673_1025942 | 3300025273 | Bacteria | 1937 |
| 254 | Ga0209675_1093185 | 3300025291 | Bacteria | 541 |
| 255 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 256 | Ga0209758_1000124 | 3300025297 | Bacteria | 189933 |
| 257 | Ga0209758_1000234 | 3300025297 | Bacteria | 116217 |
| 258 | Ga0209758_1050104 | 3300025297 | Bacteria | 1467 |
| 259 | Ga0209050_1000315 | 3300025298 | Bacteria | 98447 |
| 260 | Ga0209050_1001261 | 3300025298 | Bacteria | 29214 |
| 261 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 262 | Ga0209256_1061637 | 3300025299 | Bacteria | 871 |
| 263 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 264 | Ga0209051_1000315 | 3300025303 | Bacteria | 73579 |
| 265 | Ga0209051_1031528 | 3300025303 | Bacteria | 2037 |
| 266 | Ga0209051_1044906 | 3300025303 | Bacteria | 1535 |
| 267 | Ga0209051_1070569 | 3300025303 | Bacteria | 1053 |
| 268 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 269 | Ga0209257_1000309 | 3300025304 | Bacteria | 104166 |
| 270 | Ga0209257_1017837 | 3300025304 | Bacteria | 2771 |
| 271 | Ga0209257_1043746 | 3300025304 | Bacteria | 1311 |
| 272 | Ga0209257_1149665 | 3300025304 | Bacteria | 515 |
| 273 | Ga0207642_10006139 | 3300025899 | Bacteria | 3976 |
| 274 | Ga0207705_10128716 | 3300025909 | Bacteria | 1883 |
| 275 | Ga0207705_10451851 | 3300025909 | Bacteria | 996 |
| 276 | Ga0207705_10532263 | 3300025909 | Bacteria | 913 |
| 277 | Ga0207705_10708206 | 3300025909 | Bacteria | 782 |
| 278 | Ga0207705_10870637 | 3300025909 | Bacteria | 698 |
| 279 | Ga0207684_10004074 | 3300025910 | Bacteria | 13941 |
| 280 | Ga0207684_10552915 | 3300025910 | Bacteria | 985 |
| 281 | Ga0207654_10058756 | 3300025911 | Bacteria | 2240 |
| 282 | Ga0207707_10242094 | 3300025912 | Bacteria | 1568 |
| 283 | Ga0207707_10262963 | 3300025912 | Bacteria | 1497 |
| 284 | Ga0207695_10036310 | 3300025913 | Bacteria | 5330 |
| 285 | Ga0207671_10459625 | 3300025914 | Bacteria | 1014 |
| 286 | Ga0207660_10235701 | 3300025917 | Bacteria | 1440 |
| 287 | Ga0207662_10639229 | 3300025918 | Bacteria | 742 |
| 288 | Ga0207657_10028808 | 3300025919 | Bacteria | 5060 |
| 289 | Ga0207657_10118894 | 3300025919 | Bacteria | 2175 |
| 290 | Ga0207657_10624643 | 3300025919 | Bacteria | 840 |
| 291 | Ga0207657_10774667 | 3300025919 | Bacteria | 742 |
| 292 | Ga0207657_11053164 | 3300025919 | Bacteria | 623 |
| 293 | Ga0207649_10002064 | 3300025920 | Bacteria | 11416 |
| 294 | Ga0207649_10628388 | 3300025920 | Bacteria | 828 |
| 295 | Ga0207652_10077772 | 3300025921 | Bacteria | 2896 |
| 296 | Ga0207646_10294313 | 3300025922 | Bacteria | 1467 |
| 297 | Ga0207681_10603067 | 3300025923 | Bacteria | 907 |
| 298 | Ga0207694_10242803 | 3300025924 | Bacteria | 1472 |
| 299 | Ga0207694_10561120 | 3300025924 | Bacteria | 959 |
| 300 | Ga0207687_10011249 | 3300025927 | Bacteria | 5845 |
| 301 | Ga0207687_10319509 | 3300025927 | Bacteria | 1256 |
| 302 | Ga0207644_10629291 | 3300025931 | Bacteria | 892 |
| 303 | Ga0207690_10036483 | 3300025932 | Bacteria | 3184 |
| 304 | Ga0207690_10128789 | 3300025932 | Bacteria | 1849 |
| 305 | Ga0207690_11192968 | 3300025932 | Bacteria | 635 |
| 306 | Ga0207690_11317780 | 3300025932 | Bacteria | 603 |
| 307 | Ga0207669_10273879 | 3300025937 | Bacteria | 1269 |
| 308 | Ga0207704_10001183 | 3300025938 | Bacteria | 11632 |
| 309 | Ga0207665_10767968 | 3300025939 | Bacteria | 760 |
| 310 | Ga0207691_10245468 | 3300025940 | Bacteria | 1547 |
| 311 | Ga0207689_10119995 | 3300025942 | Bacteria | 2163 |
| 312 | Ga0207689_10963758 | 3300025942 | Bacteria | 720 |
| 313 | Ga0207689_11132038 | 3300025942 | Bacteria | 659 |
| 314 | Ga0207679_10000671 | 3300025945 | Bacteria | 22930 |
| 315 | Ga0207679_10250461 | 3300025945 | Bacteria | 1505 |
| 316 | Ga0207667_10093668 | 3300025949 | Bacteria | 3102 |
| 317 | Ga0207667_10154780 | 3300025949 | Bacteria | 2359 |
| 318 | Ga0207667_11245366 | 3300025949 | Bacteria | 722 |
| 319 | Ga0207712_10077901 | 3300025961 | Bacteria | 2404 |
| 320 | Ga0207668_10108702 | 3300025972 | Bacteria | 2076 |
| 321 | Ga0207668_11697051 | 3300025972 | Bacteria | 570 |
| 322 | Ga0207658_10383710 | 3300025986 | Bacteria | 1231 |
| 323 | Ga0207677_10074561 | 3300026023 | Bacteria | 2408 |
| 324 | Ga0207677_10093561 | 3300026023 | Bacteria | 2192 |
| 325 | Ga0207703_11376543 | 3300026035 | Bacteria | 679 |
| 326 | Ga0207703_11460681 | 3300026035 | Bacteria | 658 |
| 327 | Ga0207703_11577849 | 3300026035 | Bacteria | 631 |
| 328 | Ga0207639_11879807 | 3300026041 | Bacteria | 559 |
| 329 | Ga0207678_10328650 | 3300026067 | Bacteria | 1316 |
| 330 | Ga0207678_10404304 | 3300026067 | Bacteria | 1182 |
| 331 | Ga0207678_10665796 | 3300026067 | Bacteria | 915 |
| 332 | Ga0207708_10094171 | 3300026075 | Bacteria | 2312 |
| 333 | Ga0207702_10877865 | 3300026078 | Bacteria | 888 |
| 334 | Ga0207641_10053268 | 3300026088 | Bacteria | 3429 |
| 335 | Ga0207641_11513988 | 3300026088 | Bacteria | 673 |
| 336 | Ga0207641_12351324 | 3300026088 | Bacteria | 532 |
| 337 | Ga0207648_10026441 | 3300026089 | Bacteria | 5156 |
| 338 | Ga0207648_10108549 | 3300026089 | Bacteria | 2436 |
| 339 | Ga0207648_11932623 | 3300026089 | Bacteria | 551 |
| 340 | Ga0207676_10169748 | 3300026095 | Bacteria | 1899 |
| 341 | Ga0207674_10521733 | 3300026116 | Bacteria | 1148 |
| 342 | Ga0207675_100021908 | 3300026118 | Bacteria | 5949 |
| 343 | Ga0207675_100985369 | 3300026118 | Bacteria | 861 |
| 344 | Ga0207675_101352285 | 3300026118 | Bacteria | 733 |
| 345 | Ga0207675_101384761 | 3300026118 | Bacteria | 724 |
| 346 | Ga0207683_10567937 | 3300026121 | Bacteria | 1049 |
| 347 | Ga0207683_11310273 | 3300026121 | Bacteria | 670 |
| 348 | Ga0207683_11640870 | 3300026121 | Bacteria | 592 |
| 349 | Ga0207698_10010712 | 3300026142 | Bacteria | 5914 |
| 350 | Ga0207698_10160408 | 3300026142 | Bacteria | 1966 |
| 351 | Ga0209281_1000057 | 3300027111 | Bacteria | 307145 |
| 352 | Ga0209973_1035866 | 3300027252 | Bacteria | 714 |
| 353 | Ga0209969_1016260 | 3300027360 | Bacteria | 1090 |
| 354 | Ga0209981_1041424 | 3300027378 | Bacteria | 689 |
| 355 | Ga0209996_1000964 | 3300027395 | Bacteria | 3416 |
| 356 | Ga0209995_1000738 | 3300027471 | Bacteria | 5005 |
| 357 | Ga0209968_1000202 | 3300027526 | Bacteria | 10389 |
| 358 | Ga0209999_1006976 | 3300027543 | Bacteria | 2031 |
| 359 | Ga0209999_1052179 | 3300027543 | Bacteria | 773 |
| 360 | Ga0209970_1020316 | 3300027614 | Bacteria | 1122 |
| 361 | Ga0210002_1036330 | 3300027617 | Bacteria | 829 |
| 362 | Ga0209966_1000017 | 3300027695 | Bacteria | 71183 |
| 363 | Ga0209813_10048962 | 3300027866 | Bacteria | 1314 |
| 364 | Ga0209813_10097874 | 3300027866 | Bacteria | 994 |
| 365 | Ga0209813_10411064 | 3300027866 | Bacteria | 547 |
| 366 | Ga0209974_10000240 | 3300027876 | Bacteria | 17737 |
| 367 | Ga0209974_10081232 | 3300027876 | Bacteria | 1116 |
| 368 | Ga0268266_11434181 | 3300028379 | Bacteria | 666 |
| 369 | Ga0268265_10962979 | 3300028380 | Bacteria | 841 |
| 370 | Ga0268264_10050685 | 3300028381 | Bacteria | 3457 |
| 371 | Ga0268264_11476563 | 3300028381 | Bacteria | 690 |
| 372 | Ga0307517_10060779 | 3300028786 | Bacteria | 3588 |
| 373 | Ga0307517_10064548 | 3300028786 | Bacteria | 3402 |
| 374 | Ga0307515_10000354 | 3300028794 | Bacteria | 112621 |
| 375 | Ga0307515_10007796 | 3300028794 | Bacteria | 21069 |
| 376 | Ga0307515_10022668 | 3300028794 | Bacteria | 11052 |
| 377 | Ga0307512_10021785 | 3300030522 | Bacteria | 5773 |
| 378 | Ga0316180_1130869 | 3300030736 | Bacteria | 605 |
| 379 | Ga0265332_10007658 | 3300031238 | Bacteria | 4880 |
| 380 | Ga0265328_10019266 | 3300031239 | Bacteria | 2623 |
| 381 | Ga0265328_10179358 | 3300031239 | Bacteria | 801 |
| 382 | Ga0265329_10039870 | 3300031242 | Bacteria | 1508 |
| 383 | Ga0265327_10000056 | 3300031251 | Bacteria | 243974 |
| 384 | Ga0307513_10041205 | 3300031456 | Bacteria | 5100 |
| 385 | Ga0307513_10456071 | 3300031456 | Bacteria | 1002 |
| 386 | Ga0307509_10022375 | 3300031507 | Bacteria | 7127 |
| 387 | Ga0307509_10305886 | 3300031507 | Bacteria | 1335 |
| 388 | Ga0307509_10529316 | 3300031507 | Bacteria | 859 |
| 389 | Ga0307509_11003006 | 3300031507 | Bacteria | 502 |
| 390 | Ga0307408_101392350 | 3300031548 | Bacteria | 660 |
| 391 | Ga0307408_101930907 | 3300031548 | Bacteria | 566 |
| 392 | Ga0307508_10000043 | 3300031616 | Bacteria | 143889 |
| 393 | Ga0307508_10819637 | 3300031616 | Bacteria | 549 |
| 394 | Ga0307514_10001251 | 3300031649 | Bacteria | 33354 |
| 395 | Ga0307514_10048623 | 3300031649 | Bacteria | 3303 |
| 396 | Ga0307514_10448787 | 3300031649 | Bacteria | 635 |
| 397 | Ga0265314_10004112 | 3300031711 | Bacteria | 13711 |
| 398 | Ga0316576_10491434 | 3300031727 | Bacteria | 903 |
| 399 | Ga0316576_11080681 | 3300031727 | Bacteria | 569 |
| 400 | Ga0307516_10001691 | 3300031730 | Bacteria | 30381 |
| 401 | Ga0307516_10050533 | 3300031730 | Bacteria | 4079 |
| 402 | Ga0307516_10098801 | 3300031730 | Bacteria | 2737 |
| 403 | Ga0307516_10448454 | 3300031730 | Bacteria | 947 |
| 404 | Ga0307516_10643754 | 3300031730 | Bacteria | 715 |
| 405 | Ga0307405_11725080 | 3300031731 | Bacteria | 555 |
| 406 | Ga0316577_10131901 | 3300031733 | Bacteria | 1406 |
| 407 | Ga0307413_10482850 | 3300031824 | Bacteria | 991 |
| 408 | Ga0307413_11432399 | 3300031824 | Bacteria | 609 |
| 409 | Ga0307410_11245878 | 3300031852 | Bacteria | 649 |
| 410 | Ga0307406_10708777 | 3300031901 | Bacteria | 841 |
| 411 | Ga0307406_10776367 | 3300031901 | Bacteria | 807 |
| 412 | Ga0307412_10042383 | 3300031911 | Bacteria | 2957 |
| 413 | Ga0307412_10258838 | 3300031911 | Bacteria | 1355 |
| 414 | Ga0307412_10394411 | 3300031911 | Bacteria | 1125 |
| 415 | Ga0307412_11123125 | 3300031911 | Bacteria | 700 |
| 416 | Ga0307409_102287656 | 3300031995 | Bacteria | 570 |
| 417 | Ga0307416_100080904 | 3300032002 | Bacteria | 2744 |
| 418 | Ga0307416_101782698 | 3300032002 | Bacteria | 720 |
| 419 | Ga0307416_103122858 | 3300032002 | Bacteria | 554 |
| 420 | Ga0307416_103612871 | 3300032002 | Bacteria | 518 |
| 421 | Ga0307416_103739296 | 3300032002 | Bacteria | 509 |
| 422 | Ga0307411_10772200 | 3300032005 | Bacteria | 844 |
| 423 | Ga0316585_10170124 | 3300032137 | Bacteria | 720 |
| 424 | Ga0316593_10285432 | 3300032168 | Bacteria | 622 |
| 425 | Ga0307507_10033702 | 3300033179 | Bacteria | 5310 |
| 426 | Ga0316588_1144172 | 3300033528 | Bacteria | 609 |
| 427 | Ga0316596_1120524 | 3300033541 | Bacteria | 714 |
| 428 | Ga0373944_0006303 | 3300035089 | Bacteria | 3146 |
| 429 | Ga0373941_0524949 | 3300035115 | Bacteria | 507 |
| 430 | Ga0373945_0136824 | 3300035116 | Bacteria | 985 |
| 431 | Ga0316574_0062386 | 3300035398 | Bacteria | 2342 |
| 432 | Ga0373931_0007108 | 3300035691 | Bacteria | 5263 |
| 433 | Ga0373931_0262302 | 3300035691 | Bacteria | 1055 |
| 434 | Ga0373927_0048447 | 3300035695 | Bacteria | 2749 |
| 435 | Ga0316582_0474042 | 3300036647 | Bacteria | 863 |
| 436 | Ga0316584_0159207 | 3300036712 | Bacteria | 1678 |
| 437 | Ga0373925_0046159 | 3300037068 | Bacteria | 3238 |
| 438 | Ga0395899_0011812 | 3300037312 | Bacteria | 6684 |
| 439 | Ga0395899_0028736 | 3300037312 | Bacteria | 4184 |
| 440 | Ga0395899_0037196 | 3300037312 | Bacteria | 3649 |
| 441 | Ga0395899_0965304 | 3300037312 | Bacteria | 516 |
| 442 | Ga0395900_0006372 | 3300037418 | Bacteria | 12301 |
| 443 | Ga0395900_0035948 | 3300037418 | Bacteria | 5104 |
| 444 | Ga0395900_0132373 | 3300037418 | Bacteria | 2555 |
| 445 | Ga0395900_0286476 | 3300037418 | Bacteria | 1637 |
| 446 | Ga0395900_0517106 | 3300037418 | Bacteria | 1142 |
| 447 | Ga0395900_1754385 | 3300037418 | Bacteria | 531 |
| 448 | Ga0395898_0010814 | 3300037466 | Bacteria | 9535 |
| 449 | Ga0395898_0036421 | 3300037466 | Bacteria | 4885 |
| 450 | Ga0395898_0058613 | 3300037466 | Bacteria | 3748 |
| 451 | Ga0395898_0107134 | 3300037466 | Bacteria | 2680 |
| 452 | Ga0395905_0000088 | 3300037471 | Bacteria | 152506 |
| 453 | Ga0395905_0000572 | 3300037471 | Bacteria | 49936 |
| 454 | Ga0395905_0011982 | 3300037471 | Bacteria | 8361 |
| 455 | Ga0395905_0012026 | 3300037471 | Bacteria | 8346 |
| 456 | Ga0395905_0014382 | 3300037471 | Bacteria | 7560 |
| 457 | Ga0395905_0027418 | 3300037471 | Bacteria | 5371 |
| 458 | Ga0395905_0059072 | 3300037471 | Bacteria | 3585 |
| 459 | Ga0395905_0060108 | 3300037471 | Bacteria | 3553 |
| 460 | Ga0395905_0062421 | 3300037471 | Bacteria | 3485 |
| 461 | Ga0395905_0069463 | 3300037471 | Bacteria | 3299 |
| 462 | Ga0395905_0967167 | 3300037471 | Bacteria | 754 |
| 463 | Ga0395905_1095994 | 3300037471 | Bacteria | 699 |
| 464 | Ga0395905_1101169 | 3300037471 | Bacteria | 697 |
| 465 | Ga0395901_0123193 | 3300038443 | Bacteria | 2724 |
| 466 | Ga0395901_0195280 | 3300038443 | Bacteria | 2122 |
| 467 | Ga0395901_0352224 | 3300038443 | Bacteria | 1519 |
| 468 | Ga0395901_0388373 | 3300038443 | Bacteria | 1435 |
| 469 | Ga0395901_0543406 | 3300038443 | Bacteria | 1178 |
| 470 | Ga0395901_1077478 | 3300038443 | Bacteria | 775 |
| 471 | Ga0395901_1483466 | 3300038443 | Bacteria | 634 |
| 472 | Ga0436365_0965563 | 3300039437 | Bacteria | 969 |
| 473 | Ga0436365_1322651 | 3300039437 | Bacteria | 521 |
| 474 | Ga0436365_1608897 | 3300039437 | Bacteria | 678 |
| 475 | Ga0436361_0577382 | 3300039447 | Bacteria | 5391 |
| 476 | Ga0436361_0675139 | 3300039447 | Bacteria | 672 |
| 477 | Ga0436361_0701864 | 3300039447 | Bacteria | 6726 |
| 478 | Ga0436361_0944371 | 3300039447 | Bacteria | 6799 |
| 479 | Ga0436361_1218189 | 3300039447 | Bacteria | 9496 |
| 480 | Ga0439439_0029533 | 3300041406 | Bacteria | 1391 |
| 481 | Ga0439453_0002156 | 3300041408 | Bacteria | 2671 |
| 482 | Ga0439453_0180403 | 3300041408 | Bacteria | 515 |
| 483 | Ga0439461_0015886 | 3300041410 | Bacteria | 1447 |
| 484 | Ga0439461_0078680 | 3300041410 | Bacteria | 775 |
| 485 | Ga0439461_0226220 | 3300041410 | Bacteria | 512 |
| 486 | Ga0439466_0154303 | 3300041411 | Bacteria | 703 |
| 487 | Ga0439465_0115913 | 3300041413 | Bacteria | 936 |
| 488 | Ga0451787_747456 | 3300041441 | Bacteria | 1072 |
| 489 | Ga0451789_0263010 | 3300041443 | Bacteria | 535 |
| 490 | Ga0451789_0994690 | 3300041443 | Bacteria | 521 |
| 491 | Ga0451790_40937 | 3300041444 | Bacteria | 728 |
| 492 | Ga0451792_07629 | 3300041445 | Bacteria | 737 |
| 493 | Ga0451791_0119703 | 3300041451 | Bacteria | 592 |
| 494 | Ga0451791_0434493 | 3300041451 | Bacteria | 1543 |
| 495 | Ga0451791_1528259 | 3300041451 | Bacteria | 642 |
| 496 | Ga0451793_0444831 | 3300041452 | Bacteria | 1014 |
| 497 | Ga0451797_0400801 | 3300041453 | Bacteria | 553 |
| 498 | Ga0451795_0317897 | 3300041456 | Bacteria | 550 |
| 499 | Ga0451795_0606043 | 3300041456 | Bacteria | 1025 |
| 500 | Ga0451795_0709851 | 3300041456 | Bacteria | 613 |
| 501 | Ga0451803_10289 | 3300041457 | Bacteria | 769 |
| 502 | Ga0451798_0906264 | 3300041458 | Bacteria | 2347 |
| 503 | Ga0451798_1010413 | 3300041458 | Bacteria | 526 |
| 504 | Ga0451800_1407603 | 3300041459 | Bacteria | 812 |
| 505 | Ga0451802_0165900 | 3300041460 | Bacteria | 1265 |
| 506 | Ga0451802_1253790 | 3300041460 | Bacteria | 1899 |
| 507 | Ga0451805_035215 | 3300041461 | Bacteria | 852 |
| 508 | Ga0451805_050872 | 3300041461 | Bacteria | 709 |
| 509 | Ga0451805_062719 | 3300041461 | Bacteria | 687 |
| 510 | Ga0451804_0524043 | 3300041463 | Bacteria | 2620 |
| 511 | Ga0451808_17493 | 3300041464 | Bacteria | 639 |
| 512 | Ga0451807_0330362 | 3300041486 | Bacteria | 1112 |
| 513 | Ga0451807_2270138 | 3300041486 | Bacteria | 564 |
| 514 | Ga0451833_0330071 | 3300041491 | Bacteria | 1534 |
| 515 | Ga0451833_0655318 | 3300041491 | Bacteria | 687 |
| 516 | Ga0451835_0694273 | 3300041492 | Bacteria | 999 |
| 517 | Ga0451837_1774988 | 3300041494 | Bacteria | 540 |
| 518 | Ga0451841_0105846 | 3300041498 | Bacteria | 888 |
| 519 | Ga0451841_0671554 | 3300041498 | Bacteria | 867 |
| 520 | Ga0451841_1145597 | 3300041498 | Bacteria | 755 |
| 521 | Ga0451845_0164481 | 3300041501 | Bacteria | 584 |
| 522 | Ga0451847_0278715 | 3300041503 | Bacteria | 879 |
| 523 | Ga0451850_04492 | 3300041506 | Bacteria | 577 |
| 524 | Ga0451853_1259832 | 3300041512 | Bacteria | 1233 |
| 525 | Ga0451853_1473800 | 3300041512 | Bacteria | 2221 |
| 526 | Ga0452268_35386 | 3300041907 | Bacteria | 821 |
| 527 | Ga0439432_068608 | 3300042006 | Bacteria | 1084 |
| 528 | Ga0439449_0002153 | 3300042007 | Bacteria | 7734 |
| 529 | Ga0439451_041027 | 3300042009 | Bacteria | 929 |
| 530 | Ga0439457_008880 | 3300042014 | Bacteria | 2355 |
| 531 | Ga0439457_149134 | 3300042014 | Bacteria | 562 |
| 532 | Ga0450914_028955 | 3300042118 | Bacteria | 658 |
| 533 | Ga0450914_048956 | 3300042118 | Bacteria | 553 |
| 534 | Ga0450919_001279 | 3300042121 | Bacteria | 3288 |
| 535 | Ga0450920_139938 | 3300042122 | Bacteria | 512 |
| 536 | Ga0450890_015301 | 3300042127 | Bacteria | 1009 |
| 537 | Ga0450894_027161 | 3300042131 | Bacteria | 788 |
| 538 | Ga0450896_034195 | 3300042133 | Bacteria | 777 |
| 539 | Ga0450898_006396 | 3300042134 | Bacteria | 1807 |
| 540 | Ga0450898_155362 | 3300042134 | Bacteria | 502 |
| 541 | Ga0439446_0049193 | 3300042156 | Bacteria | 1256 |
| 542 | Ga0439458_0032273 | 3300042157 | Bacteria | 1251 |
| 543 | Ga0439458_0053237 | 3300042157 | Bacteria | 1001 |
| 544 | Ga0439434_0065387 | 3300042435 | Bacteria | 1141 |
| 545 | Ga0439434_0316525 | 3300042435 | Bacteria | 541 |
| 546 | Ga0439459_0143401 | 3300042438 | Bacteria | 619 |
| 547 | Ga0439464_0007196 | 3300042439 | Bacteria | 2908 |
| 548 | Ga0450916_044966 | 3300042530 | Bacteria | 682 |
| 549 | Ga0450918_000202 | 3300042531 | Bacteria | 13469 |
| 550 | Ga0450893_0001535 | 3300042532 | Bacteria | 3547 |
| 551 | Ga0451577_0002525 | 3300042876 | Bacteria | 21654 |
| 552 | Ga0451577_0045489 | 3300042876 | Bacteria | 3929 |
| 553 | Ga0451577_0056391 | 3300042876 | Bacteria | 3504 |
| 554 | Ga0451577_1605171 | 3300042876 | Bacteria | 574 |
| 555 | Ga0466969_0000008 | 3300044656 | Bacteria | 139607 |
| 556 | Ga0466969_0003553 | 3300044656 | Bacteria | 8290 |
| 557 | Ga0466969_0009510 | 3300044656 | Bacteria | 5154 |
| 558 | Ga0466969_0010304 | 3300044656 | Bacteria | 4958 |
| 559 | Ga0466972_0088445 | 3300044658 | Bacteria | 1470 |
| 560 | Ga0453683_0002014 | 3300044673 | Bacteria | 16403 |
| 561 | Ga0453683_0306702 | 3300044673 | Bacteria | 1016 |
| 562 | Ga0466965_0003131 | 3300044683 | Bacteria | 7212 |
| 563 | Ga0466965_0059268 | 3300044683 | Bacteria | 1910 |
| 564 | Ga0466965_0113646 | 3300044683 | Bacteria | 1393 |
| 565 | Ga0466965_0333402 | 3300044683 | Bacteria | 828 |
| 566 | Ga0466965_0566753 | 3300044683 | Bacteria | 643 |
| 567 | Ga0466965_0828532 | 3300044683 | Bacteria | 537 |
| 568 | Ga0466966_0001826 | 3300044684 | Bacteria | 13814 |
| 569 | Ga0466966_0007945 | 3300044684 | Bacteria | 7027 |
| 570 | Ga0466966_0008926 | 3300044684 | Bacteria | 6643 |
| 571 | Ga0466966_0013800 | 3300044684 | Bacteria | 5346 |
| 572 | Ga0466966_0153258 | 3300044684 | Bacteria | 1405 |
| 573 | Ga0466966_0178938 | 3300044684 | Bacteria | 1287 |
| 574 | Ga0466966_0502399 | 3300044684 | Bacteria | 729 |
| 575 | Ga0466961_0027139 | 3300044693 | Bacteria | 3681 |
| 576 | Ga0466961_0041448 | 3300044693 | Bacteria | 2951 |
| 577 | Ga0466963_0006900 | 3300044694 | Bacteria | 6757 |
| 578 | Ga0466963_0059746 | 3300044694 | Bacteria | 2545 |
| 579 | Ga0466964_0002210 | 3300044706 | Bacteria | 6882 |
| 580 | Ga0466964_0007297 | 3300044706 | Bacteria | 4134 |
| 581 | Ga0466964_0154962 | 3300044706 | Bacteria | 1066 |
| 582 | Ga0453684_0006310 | 3300044712 | Bacteria | 22635 |
| 583 | Ga0453684_0077376 | 3300044712 | Bacteria | 4171 |
| 584 | Ga0453684_2081783 | 3300044712 | Bacteria | 570 |
| 585 | Ga0453684_2412378 | 3300044712 | Bacteria | 521 |
| 586 | Ga0466971_0019502 | 3300044719 | Bacteria | 3012 |
| 587 | Ga0466971_0110556 | 3300044719 | Bacteria | 1268 |
| 588 | Ga0466968_0089169 | 3300044735 | Bacteria | 1364 |
| 589 | Ga0466968_0216321 | 3300044735 | Bacteria | 901 |
| 590 | Ga0466970_0015667 | 3300044765 | Bacteria | 3903 |
| 591 | Ga0466970_0028777 | 3300044765 | Bacteria | 2922 |
| 592 | Ga0466970_0047856 | 3300044765 | Bacteria | 2279 |
| 593 | Ga0466970_0174607 | 3300044765 | Bacteria | 1191 |
| 594 | Ga0466957_0001869 | 3300044842 | Bacteria | 11135 |
| 595 | Ga0466957_0006607 | 3300044842 | Bacteria | 6559 |
| 596 | Ga0466957_0090082 | 3300044842 | Bacteria | 1921 |
| 597 | Ga0466960_0106510 | 3300044901 | Bacteria | 1450 |
| 598 | Ga0466960_0924585 | 3300044901 | Bacteria | 533 |
| 599 | Ga0466959_0000192 | 3300045049 | Bacteria | 40028 |
| 600 | Ga0466959_0001900 | 3300045049 | Bacteria | 13149 |
| 601 | Ga0466959_0146563 | 3300045049 | Bacteria | 1665 |
| 602 | Ga0466959_0237356 | 3300045049 | Bacteria | 1260 |
| 603 | Ga0466959_0310305 | 3300045049 | Bacteria | 1079 |
| 604 | Ga0466959_0349911 | 3300045049 | Bacteria | 1007 |
| 605 | Ga0451576_0002088 | 3300045051 | Bacteria | 31196 |
| 606 | Ga0451576_0008890 | 3300045051 | Bacteria | 11723 |
| 607 | Ga0451576_1541157 | 3300045051 | Bacteria | 690 |
| 608 | Ga0451576_1645678 | 3300045051 | Bacteria | 665 |
| 609 | Ga0466958_0074122 | 3300045836 | Bacteria | 2085 |
| 610 | Ga0466958_0083497 | 3300045836 | Bacteria | 1969 |
| 611 | Ga0466958_0150775 | 3300045836 | Bacteria | 1466 |
| 612 | Ga0466967_0059458 | 3300045976 | Bacteria | 3383 |
| 613 | Ga0466967_0772182 | 3300045976 | Bacteria | 953 |
| 614 | Ga0466967_1042550 | 3300045976 | Bacteria | 815 |
| 615 | Ga0466967_1936208 | 3300045976 | Bacteria | 586 |
| 616 | Ga0495638_0598691 | 3300046460 | Bacteria | 542 |
| 617 | Ga0495585_0021845 | 3300046492 | Bacteria | 3674 |
| 618 | Ga0495610_0117871 | 3300046512 | Bacteria | 1167 |
| 619 | Ga0495620_0053358 | 3300046515 | Bacteria | 1712 |
| 620 | Ga0495632_0012504 | 3300046519 | Bacteria | 4894 |
| 621 | Ga0495632_0101047 | 3300046519 | Bacteria | 1359 |
| 622 | Ga0495643_0101814 | 3300046522 | Bacteria | 1471 |
| 623 | Ga0495666_0502507 | 3300046526 | Bacteria | 542 |
| 624 | Ga0495642_0034674 | 3300046528 | Bacteria | 2033 |
| 625 | Ga0495598_0082466 | 3300046537 | Bacteria | 1034 |
| 626 | Ga0495621_0011477 | 3300046539 | Bacteria | 2742 |
| 627 | Ga0495621_0040523 | 3300046539 | Bacteria | 1633 |
| 628 | Ga0495633_0294553 | 3300046558 | Bacteria | 737 |
| 629 | Ga0495656_0001651 | 3300046615 | Bacteria | 7295 |
| 630 | Ga0495656_0073823 | 3300046615 | Bacteria | 1522 |
| 631 | Ga0495656_0646334 | 3300046615 | Bacteria | 568 |
| 632 | Ga0495625_0003495 | 3300046660 | Bacteria | 15582 |
| 633 | Ga0495661_0359139 | 3300046665 | Bacteria | 716 |
| 634 | Ga0495588_0374758 | 3300046674 | Bacteria | 747 |
| 635 | Ga0495658_0888972 | 3300046683 | Bacteria | 570 |
| 636 | Ga0495669_0409337 | 3300046684 | Bacteria | 657 |
| 637 | Ga0495670_0102184 | 3300046691 | Bacteria | 1477 |
| 638 | Ga0495636_0024213 | 3300047318 | Bacteria | 2461 |
| 639 | Ga0495636_0539224 | 3300047318 | Bacteria | 567 |
| 640 | Ga0495677_0187090 | 3300047445 | Bacteria | 803 |
| 641 | Ga0495685_072880 | 3300047447 | Bacteria | 1149 |
| 642 | Ga0495681_0147366 | 3300047470 | Bacteria | 990 |
| 643 | Ga0495686_0246667 | 3300047472 | Bacteria | 1005 |
| 644 | Ga0495602_0423707 | 3300048088 | Bacteria | 945 |
| 645 | Ga0496101_0438151 | 3300048904 | Bacteria | 1031 |
| 646 | Ga0496101_1454457 | 3300048904 | Bacteria | 534 |
| 647 | Ga0496102_0014575 | 3300048905 | Bacteria | 6833 |
| 648 | Ga0496102_0018900 | 3300048905 | Bacteria | 6063 |
| 649 | Ga0496104_0573549 | 3300048907 | Bacteria | 1039 |
| 650 | Ga0496105_0314580 | 3300048908 | Bacteria | 1256 |
| 651 | Ga0496106_0236334 | 3300048909 | Bacteria | 1460 |
| 652 | Ga0496108_1420449 | 3300048911 | Bacteria | 580 |
| 653 | Ga0496109_0040141 | 3300048912 | Bacteria | 4238 |
| 654 | Ga0496109_0066448 | 3300048912 | Bacteria | 3302 |
| 655 | Ga0496110_0054390 | 3300048913 | Bacteria | 3521 |
| 656 | Ga0496110_1658731 | 3300048913 | Bacteria | 549 |
| 657 | Ga0496114_0003154 | 3300048917 | Bacteria | 12645 |
| 658 | Ga0501306_027905 | 3300049127 | Bacteria | 824 |
| 659 | Ga0501306_045413 | 3300049127 | Bacteria | 692 |
| 660 | Ga0501306_059872 | 3300049127 | Bacteria | 626 |
| 661 | Ga0501308_017892 | 3300049128 | Bacteria | 862 |
| 662 | Ga0501308_042937 | 3300049128 | Bacteria | 642 |
| 663 | Ga0501308_044818 | 3300049128 | Bacteria | 632 |
| 664 | Ga0501310_020091 | 3300049130 | Bacteria | 827 |
| 665 | Ga0501310_027621 | 3300049130 | Bacteria | 740 |
| 666 | Ga0501310_052438 | 3300049130 | Bacteria | 593 |
| 667 | Ga0501310_066193 | 3300049130 | Bacteria | 547 |
| 668 | Ga0501341_07304 | 3300049131 | Bacteria | 690 |
| 669 | Ga0501304_013717 | 3300049160 | Bacteria | 744 |
| 670 | Ga0501305_042175 | 3300049161 | Bacteria | 745 |
| 671 | Ga0501305_044733 | 3300049161 | Bacteria | 729 |
| 672 | Ga0501305_047534 | 3300049161 | Bacteria | 713 |
| 673 | Ga0501307_046115 | 3300049162 | Bacteria | 645 |
| 674 | Ga0501293_017900 | 3300049516 | Bacteria | 672 |
| 675 | Ga0501311_025972 | 3300049527 | Bacteria | 823 |
| 676 | Ga0501312_094047 | 3300049528 | Bacteria | 556 |
| 677 | Ga0501313_013402 | 3300049529 | Bacteria | 963 |
| 678 | Ga0501314_019790 | 3300049530 | Bacteria | 693 |
| 679 | Ga0501314_023747 | 3300049530 | Bacteria | 652 |
| 680 | Ga0501315_022610 | 3300049531 | Bacteria | 858 |
| 681 | Ga0501315_049781 | 3300049531 | Bacteria | 656 |
| 682 | Ga0501317_019606 | 3300049533 | Bacteria | 904 |
| 683 | Ga0501318_022873 | 3300049534 | Bacteria | 804 |
| 684 | Ga0501319_001294 | 3300049535 | Bacteria | 1417 |
| 685 | Ga0501320_012097 | 3300049536 | Bacteria | 902 |
| 686 | Ga0501320_026922 | 3300049536 | Bacteria | 697 |
| 687 | Ga0501320_044150 | 3300049536 | Bacteria | 592 |
| 688 | Ga0501321_027612 | 3300049537 | Bacteria | 742 |
| 689 | Ga0501321_033459 | 3300049537 | Bacteria | 697 |
| 690 | Ga0501321_045406 | 3300049537 | Bacteria | 629 |
| 691 | Ga0501322_008434 | 3300049538 | Bacteria | 765 |
| 692 | Ga0501323_033620 | 3300049539 | Bacteria | 729 |
| 693 | Ga0501323_061789 | 3300049539 | Bacteria | 586 |
| 694 | Ga0501324_021119 | 3300049540 | Bacteria | 666 |
| 695 | Ga0501327_06633 | 3300049543 | Bacteria | 707 |
| 696 | Ga0501032_0164787 | 3300049569 | Bacteria | 1455 |
| 697 | Ga0501033_0198515 | 3300049570 | Bacteria | 1434 |
| 698 | Ga0501034_0055180 | 3300049571 | Bacteria | 3999 |
| 699 | Ga0501037_0187833 | 3300049573 | Bacteria | 1464 |
| 700 | Ga0501037_0619022 | 3300049573 | Bacteria | 726 |
| 701 | Ga0501038_0232521 | 3300049574 | Bacteria | 1466 |
| 702 | Ga0501038_0278315 | 3300049574 | Bacteria | 1318 |
| 703 | Ga0501042_0929024 | 3300049578 | Bacteria | 634 |
| 704 | Ga0501043_0325193 | 3300049579 | Bacteria | 1172 |
| 705 | Ga0501046_0068157 | 3300049580 | Bacteria | 2769 |
| 706 | Ga0501047_0070728 | 3300049581 | Bacteria | 3359 |
| 707 | Ga0501047_0346872 | 3300049581 | Bacteria | 1322 |
| 708 | Ga0501048_0318858 | 3300049582 | Bacteria | 1107 |
| 709 | Ga0501048_0842866 | 3300049582 | Bacteria | 659 |
| 710 | Ga0501074_0725442 | 3300049590 | Bacteria | 701 |
| 711 | Ga0501227_197108 | 3300049665 | Bacteria | 570 |
| 712 | Ga0501249_218062 | 3300049679 | Bacteria | 507 |
| 713 | Ga0501252_002187 | 3300049682 | Bacteria | 1917 |
| 714 | Ga0501253_149420 | 3300049683 | Bacteria | 588 |
| 715 | Ga0501257_041982 | 3300049686 | Bacteria | 1125 |
| 716 | Ga0501080_0171737 | 3300049742 | Bacteria | 1999 |
| 717 | Ga0501080_0423952 | 3300049742 | Bacteria | 1195 |
| 718 | Ga0501263_005364 | 3300049760 | Bacteria | 1446 |
| 719 | Ga0501268_034714 | 3300049765 | Bacteria | 928 |
| 720 | Ga0501273_033534 | 3300049770 | Bacteria | 739 |
| 721 | Ga0501035_0095501 | 3300049822 | Bacteria | 2613 |
| 722 | Ga0501035_0312400 | 3300049822 | Bacteria | 1322 |
| 723 | Ga0501044_0099572 | 3300049823 | Bacteria | 2925 |
| 724 | nmdc:mga03683_101656_c1 | 3300050489 | Bacteria | 1264 |
| 725 | nmdc:mga03683_179165_c1 | 3300050489 | Bacteria | 966 |
| 726 | nmdc:mga03683_319533_c1 | 3300050489 | Bacteria | 731 |
| 727 | nmdc:mga03683_37471_c1 | 3300050489 | Bacteria | 1976 |
| 728 | nmdc:mga03683_405020_c1 | 3300050489 | Bacteria | 652 |
| 729 | nmdc:mga03683_415430_c1 | 3300050489 | Bacteria | 644 |
| 730 | nmdc:mga03683_68090_c1 | 3300050489 | Bacteria | 1517 |
| 731 | nmdc:mga03n38_208653_c1 | 3300050490 | Bacteria | 1014 |
| 732 | nmdc:mga03n38_34562_c1 | 3300050490 | Bacteria | 2160 |
| 733 | nmdc:mga03n38_365470_c1 | 3300050490 | Bacteria | 788 |
| 734 | nmdc:mga03n38_606486_c1 | 3300050490 | Bacteria | 624 |
| 735 | nmdc:mga00v17_749059_c1 | 3300050491 | Bacteria | 624 |
| 736 | nmdc:mga0yw44_101591_c1 | 3300050492 | Bacteria | 1832 |
| 737 | nmdc:mga0yw44_1030714_c1 | 3300050492 | Bacteria | 557 |
| 738 | nmdc:mga0yw44_260353_c1 | 3300050492 | Bacteria | 1156 |
| 739 | nmdc:mga0yw44_77764_c1 | 3300050492 | Bacteria | 2073 |
| 740 | nmdc:mga0k408_110974_c1 | 3300050493 | Bacteria | 1621 |
| 741 | nmdc:mga0k408_147622_c1 | 3300050493 | Bacteria | 1400 |
| 742 | nmdc:mga0k408_212564_c1 | 3300050493 | Bacteria | 772 |
| 743 | nmdc:mga0k408_23280_c1 | 3300050493 | Bacteria | 3493 |
| 744 | nmdc:mga0k408_254_c1 | 3300050493 | Bacteria | 29029 |
| 745 | nmdc:mga0k408_276575_c1 | 3300050493 | Bacteria | 1002 |
| 746 | nmdc:mga0k408_331477_c1 | 3300050493 | Bacteria | 908 |
| 747 | nmdc:mga0k408_33733_c1 | 3300050493 | Bacteria | 2929 |
| 748 | nmdc:mga0k408_498388_c1 | 3300050493 | Bacteria | 722 |
| 749 | nmdc:mga0k408_53178_c1 | 3300050493 | Bacteria | 2347 |
| 750 | nmdc:mga0k408_594239_c1 | 3300050493 | Bacteria | 653 |
| 751 | nmdc:mga0k408_62721_c1 | 3300050493 | Bacteria | 2162 |
| 752 | nmdc:mga0k408_786658_c1 | 3300050493 | Bacteria | 555 |
| 753 | nmdc:mga0k408_8413_c1 | 3300050493 | Bacteria | 5535 |
| 754 | nmdc:mga06z11_287036_c1 | 3300050494 | Bacteria | 976 |
| 755 | nmdc:mga06z11_36498_c1 | 3300050494 | Bacteria | 2427 |
| 756 | nmdc:mga06z11_471682_c1 | 3300050494 | Bacteria | 759 |
| 757 | nmdc:mga06z11_59363_c1 | 3300050494 | Bacteria | 1988 |
| 758 | nmdc:mga06z11_65821_c1 | 3300050494 | Bacteria | 1903 |
| 759 | nmdc:mga06z11_996267_c1 | 3300050494 | Bacteria | 511 |
| 760 | nmdc:mga04h51_214891_c1 | 3300050495 | Bacteria | 760 |
| 761 | nmdc:mga07m45_10255_c1 | 3300050496 | Bacteria | 4888 |
| 762 | nmdc:mga07m45_13149_c1 | 3300050496 | Bacteria | 4384 |
| 763 | nmdc:mga07m45_219891_c1 | 3300050496 | Bacteria | 1105 |
| 764 | nmdc:mga07m45_27799_c1 | 3300050496 | Bacteria | 3120 |
| 765 | nmdc:mga07m45_331718_c1 | 3300050496 | Bacteria | 884 |
| 766 | nmdc:mga07m45_6340_c1 | 3300050496 | Bacteria | 5972 |
| 767 | nmdc:mga0sz30_15579_c2 | 3300050516 | Bacteria | 2385 |
| 768 | nmdc:mga0sz30_28442_c1 | 3300050516 | Bacteria | 2301 |
| 769 | Ga0500578_0001060 | 3300053086 | Bacteria | 29908 |
| 770 | Ga0500643_031661 | 3300053087 | Bacteria | 1610 |
| 771 | Ga0500644_0075298 | 3300053088 | Bacteria | 1227 |
| 772 | Ga0500646_0004955 | 3300053090 | Bacteria | 3379 |
| 773 | Ga0500583_0098484 | 3300053092 | Bacteria | 1430 |
| 774 | Ga0500651_0006266 | 3300053093 | Bacteria | 6845 |
| 775 | Ga0500651_0162877 | 3300053093 | Bacteria | 1333 |
| 776 | Ga0500651_0195684 | 3300053093 | Bacteria | 1195 |
| 777 | Ga0500651_0499061 | 3300053093 | Bacteria | 671 |
| 778 | Ga0500650_0074562 | 3300053098 | Bacteria | 1586 |
| 779 | Ga0500557_085454 | 3300053105 | Bacteria | 1044 |
| 780 | Ga0500562_060524 | 3300053108 | Bacteria | 1017 |
| 781 | Ga0500569_018717 | 3300053109 | Bacteria | 1793 |
| 782 | Ga0500593_000440 | 3300053117 | Bacteria | 16359 |
| 783 | Ga0500597_185142 | 3300053120 | Bacteria | 881 |
| 784 | Ga0500628_003850 | 3300053129 | Bacteria | 2478 |
| 785 | Ga0500642_0000805 | 3300053130 | Bacteria | 9200 |
| 786 | Ga0500652_000299 | 3300053131 | Bacteria | 18083 |
| 787 | Ga0500655_005214 | 3300053133 | Bacteria | 2344 |
| 788 | Ga0500658_0216462 | 3300053134 | Bacteria | 878 |
| 789 | Ga0500568_0018560 | 3300053139 | Bacteria | 3040 |
| 790 | Ga0500568_0037009 | 3300053139 | Bacteria | 1982 |
| 791 | Ga0500577_0002588 | 3300053142 | Bacteria | 4632 |
| 792 | Ga0500579_168047 | 3300053143 | Bacteria | 902 |
| 793 | Ga0500604_0056358 | 3300053151 | Bacteria | 1224 |
| 794 | Ga0500604_0356510 | 3300053151 | Bacteria | 508 |
| 795 | Ga0500619_000127 | 3300053154 | Bacteria | 19880 |
| 796 | Ga0500622_0000125 | 3300053156 | Bacteria | 81109 |
| 797 | Ga0500622_0025655 | 3300053156 | Bacteria | 3113 |
| 798 | Ga0500627_0432634 | 3300053158 | Bacteria | 556 |
| 799 | Ga0500636_0368352 | 3300053177 | Bacteria | 679 |
| 800 | Ga0500570_032674 | 3300053724 | Bacteria | 2798 |
| 801 | Ga0500570_213015 | 3300053724 | Bacteria | 566 |
| 802 | Ga0500645_110615 | 3300053730 | Bacteria | 771 |
| 803 | Ga0500587_000581 | 3300053739 | Bacteria | 4534 |
| 804 | Ga0590071_012006 | 3300059421 | Bacteria | 2030 |
| 805 | Ga0590074_078125 | 3300059423 | Bacteria | 630 |
| 806 | Ga0590075_125747 | 3300059424 | Bacteria | 672 |
| 807 | Ga0587077_167875 | 3300059493 | Bacteria | 586 |
| 808 | Ga0587080_157362 | 3300059503 | Bacteria | 530 |
| 809 | Ga0587085_143891 | 3300059506 | Bacteria | 544 |
| 810 | Ga0587088_080729 | 3300059508 | Bacteria | 696 |
| 811 | Ga0587088_097564 | 3300059508 | Bacteria | 652 |
| 812 | Ga0587091_094417 | 3300059511 | Bacteria | 692 |
| 813 | Ga0587106_061154 | 3300059605 | Bacteria | 692 |
| 814 | Ga0587101_060421 | 3300059623 | Bacteria | 675 |
| 815 | Ga0587109_053532 | 3300059624 | Bacteria | 833 |
| 816 | Ga0587109_218585 | 3300059624 | Bacteria | 504 |
| 817 | Ga0587076_079566 | 3300059645 | Bacteria | 697 |
| 818 | Ga0587100_043541 | 3300059648 | Bacteria | 512 |
| 819 | Ga0501082_1017924 | 3300060353 | Bacteria | 724 |
| 820 | Ga0466962_0005233 | 3300061719 | Bacteria | 6233 |
| 821 | Ga0466962_0014889 | 3300061719 | Bacteria | 3748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221644 | 2644244726 | 80 |
| 2 | iso_pu_bacteria | 2585428057 | 2587725328 | 81 |
| 3 | iso_pu_bacteria | 2585428058 | 2587731313 | 81 |
| 4 | iso_pu_bacteria | 2585428062 | 2587754071 | 81 |
| 5 | iso_pu_bacteria | 2588253510 | 2588290069 | 81 |
| 6 | iso_pu_bacteria | 2643221592 | 2643972789 | 81 |
| 7 | iso_pu_bacteria | 2643221625 | 2644143364 | 81 |
| 8 | iso_pu_bacteria | 2643221648 | 2644276199 | 81 |
| 9 | iso_pu_bacteria | 2643221660 | 2644340881 | 81 |
| 10 | 3300026067 | Ga0207678_10665796 | Ga0207678_106657961 | 83 |
| 11 | 3300031727 | Ga0316576_10491434 | Ga0316576_104914341 | 83 |
| 12 | 3300031727 | Ga0316576_11080681 | Ga0316576_110806811 | 83 |
| 13 | 3300031733 | Ga0316577_10131901 | Ga0316577_101319013 | 83 |
| 14 | 3300032137 | Ga0316585_10170124 | Ga0316585_101701242 | 83 |
| 15 | 3300032168 | Ga0316593_10285432 | Ga0316593_102854322 | 83 |
| 16 | 3300033528 | Ga0316588_1144172 | Ga0316588_11441722 | 83 |
| 17 | 3300033541 | Ga0316596_1120524 | Ga0316596_11205241 | 83 |
| 18 | 3300035115 | Ga0373941_0524949 | Ga0373941_0524949_228_479 | 83 |
| 19 | 3300035398 | Ga0316574_0062386 | Ga0316574_0062386_458_715 | 83 |
| 20 | 3300036647 | Ga0316582_0474042 | Ga0316582_0474042_251_508 | 83 |
| 21 | 3300036712 | Ga0316584_0159207 | Ga0316584_0159207_183_440 | 83 |
| 22 | 3300003162 | Ga0006778J45830_1018330 | Ga0006778J45830_10183302 | 84 |
| 23 | 3300003163 | Ga0006759J45824_1017103 | Ga0006759J45824_10171032 | 84 |
| 24 | 3300003305 | Ga0006770J48903_1013780 | Ga0006770J48903_10137802 | 84 |
| 25 | 3300003544 | Ga0007417J51691_1011711 | Ga0007417J51691_10117112 | 84 |
| 26 | 3300003559 | Ga0007427J51700_112861 | Ga0007427J51700_1128612 | 84 |
| 27 | 3300003574 | Ga0007410J51695_1022391 | Ga0007410J51695_10223912 | 84 |
| 28 | 3300003575 | Ga0007409J51694_1014513 | Ga0007409J51694_10145132 | 84 |
| 29 | 3300003577 | Ga0007416J51690_1023874 | Ga0007416J51690_10238742 | 84 |
| 30 | 3300003611 | Ga0007411J51799_105540 | Ga0007411J51799_1055402 | 84 |
| 31 | 3300003613 | Ga0007415J51800_103902 | Ga0007415J51800_1039022 | 84 |
| 32 | 3300003693 | Ga0032354_1024639 | Ga0032354_10246392 | 84 |
| 33 | 3300003775 | Ga0055524_1000109 | Ga0055524_100010920 | 84 |
| 34 | 3300003791 | Ga0055530_10034055 | Ga0055530_100340552 | 84 |
| 35 | 3300003792 | Ga0055540_1000013 | Ga0055540_1000013174 | 84 |
| 36 | 3300003794 | Ga0055531_10005660 | Ga0055531_100056604 | 84 |
| 37 | 3300005262 | Ga0065165_1080711 | Ga0065165_10807111 | 84 |
| 38 | 3300005339 | Ga0070660_100108958 | Ga0070660_1001089583 | 84 |
| 39 | 3300005344 | Ga0070661_100126267 | Ga0070661_1001262672 | 84 |
| 40 | 3300005366 | Ga0070659_100008466 | Ga0070659_1000084668 | 84 |
| 41 | 3300005455 | Ga0070663_100377465 | Ga0070663_1003774653 | 84 |
| 42 | 3300005467 | Ga0070706_100002083 | Ga0070706_10000208312 | 84 |
| 43 | 3300005471 | Ga0070698_100128634 | Ga0070698_1001286343 | 84 |
| 44 | 3300005518 | Ga0070699_100243867 | Ga0070699_1002438673 | 84 |
| 45 | 3300006048 | Ga0075363_100100193 | Ga0075363_1001001932 | 84 |
| 46 | 3300006178 | Ga0075367_10006143 | Ga0075367_100061435 | 84 |
| 47 | 3300006186 | Ga0075369_10031196 | Ga0075369_100311962 | 84 |
| 48 | 3300006195 | Ga0075366_10088935 | Ga0075366_100889354 | 84 |
| 49 | 3300006353 | Ga0075370_10015050 | Ga0075370_100150503 | 84 |
| 50 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001168 | 84 |
| 51 | 3300025263 | Ga0209565_1007217 | Ga0209565_10072172 | 84 |
| 52 | 3300025291 | Ga0209675_1093185 | Ga0209675_10931851 | 84 |
| 53 | 3300025298 | Ga0209050_1000315 | Ga0209050_100031544 | 84 |
| 54 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015320 | 84 |
| 55 | 3300025303 | Ga0209051_1000022 | Ga0209051_100002293 | 84 |
| 56 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030290 | 84 |
| 57 | 3300025910 | Ga0207684_10004074 | Ga0207684_1000407417 | 84 |
| 58 | 3300025919 | Ga0207657_10118894 | Ga0207657_101188942 | 84 |
| 59 | 3300025920 | Ga0207649_10002064 | Ga0207649_100020642 | 84 |
| 60 | 3300025922 | Ga0207646_10294313 | Ga0207646_102943132 | 84 |
| 61 | 3300025932 | Ga0207690_10036483 | Ga0207690_100364832 | 84 |
| 62 | 3300025932 | Ga0207690_11317780 | Ga0207690_113177801 | 84 |
| 63 | 3300025945 | Ga0207679_10000671 | Ga0207679_100006716 | 84 |
| 64 | 3300025945 | Ga0207679_10250461 | Ga0207679_102504611 | 84 |
| 65 | 3300026067 | Ga0207678_10404304 | Ga0207678_104043043 | 84 |
| 66 | 3300027111 | Ga0209281_1000057 | Ga0209281_1000057149 | 84 |
| 67 | 3300042121 | Ga0450919_001279 | Ga0450919_001279_1034_1288 | 84 |
| 68 | 3300042122 | Ga0450920_139938 | Ga0450920_139938_175_429 | 84 |
| 69 | 3300042157 | Ga0439458_0053237 | Ga0439458_0053237_453_707 | 84 |
| 70 | 3300042531 | Ga0450918_000202 | Ga0450918_000202_2562_2816 | 84 |
| 71 | 3300048917 | Ga0496114_0003154 | Ga0496114_0003154_6800_7054 | 84 |
| 72 | 3300049539 | Ga0501323_033620 | Ga0501323_033620_382_636 | 84 |
| 73 | 3300050489 | nmdc:mga03683_37471_c1 | nmdc:mga03683_37471_c1_732_986 | 84 |
| 74 | 3300050490 | nmdc:mga03n38_606486_c1 | nmdc:mga03n38_606486_c1_155_409 | 84 |
| 75 | 3300050493 | nmdc:mga0k408_23280_c1 | nmdc:mga0k408_23280_c1_917_1171 | 84 |
| 76 | 3300050494 | nmdc:mga06z11_36498_c1 | nmdc:mga06z11_36498_c1_447_701 | 84 |
| 77 | 3300050496 | nmdc:mga07m45_27799_c1 | nmdc:mga07m45_27799_c1_326_580 | 84 |
| 78 | 3300050516 | nmdc:mga0sz30_28442_c1 | nmdc:mga0sz30_28442_c1_351_605 | 84 |
| 79 | 2162886006 | SwRhRL3b_contig_638870 | SwRhRL3b_0843.00000280 | 85 |
| 80 | 3300001979 | JGI24740J21852_10035537 | JGI24740J21852_100355372 | 85 |
| 81 | 3300002067 | JGI24735J21928_10185972 | JGI24735J21928_101859722 | 85 |
| 82 | 3300002077 | JGI24744J21845_10075619 | JGI24744J21845_100756191 | 85 |
| 83 | 3300002773 | JGI25152J39213_1000892 | JGI25152J39213_100089210 | 85 |
| 84 | 3300002774 | JGI25150J39212_1002313 | JGI25150J39212_10023133 | 85 |
| 85 | 3300003163 | Ga0006759J45824_1013933 | Ga0006759J45824_10139332 | 85 |
| 86 | 3300003163 | Ga0006759J45824_1023259 | Ga0006759J45824_10232592 | 85 |
| 87 | 3300003215 | JGI25153J46596_10000420 | JGI25153J46596_1000042020 | 85 |
| 88 | 3300003316 | rootH1_10043230 | rootH1_100432302 | 85 |
| 89 | 3300003322 | rootL2_10005413 | rootL2_100054132 | 85 |
| 90 | 3300003322 | rootL2_10083805 | rootL2_100838053 | 85 |
| 91 | 3300003347 | JGI26128J50194_1000218 | JGI26128J50194_10002183 | 85 |
| 92 | 3300003371 | JGI26145J50221_1002388 | JGI26145J50221_10023881 | 85 |
| 93 | 3300003544 | Ga0007417J51691_1011360 | Ga0007417J51691_10113602 | 85 |
| 94 | 3300003544 | Ga0007417J51691_1017103 | Ga0007417J51691_10171032 | 85 |
| 95 | 3300003544 | Ga0007417J51691_1045595 | Ga0007417J51691_10455952 | 85 |
| 96 | 3300003544 | Ga0007417J51691_1114763 | Ga0007417J51691_11147632 | 85 |
| 97 | 3300003574 | Ga0007410J51695_1004507 | Ga0007410J51695_10045073 | 85 |
| 98 | 3300003574 | Ga0007410J51695_1011000 | Ga0007410J51695_10110002 | 85 |
| 99 | 3300003575 | Ga0007409J51694_1012913 | Ga0007409J51694_10129132 | 85 |
| 100 | 3300003575 | Ga0007409J51694_1027825 | Ga0007409J51694_10278252 | 85 |
| 101 | 3300003577 | Ga0007416J51690_1026130 | Ga0007416J51690_10261302 | 85 |
| 102 | 3300003577 | Ga0007416J51690_1065410 | Ga0007416J51690_10654102 | 85 |
| 103 | 3300003579 | Ga0007429J51699_1012803 | Ga0007429J51699_10128032 | 85 |
| 104 | 3300003611 | Ga0007411J51799_112204 | Ga0007411J51799_1122042 | 85 |
| 105 | 3300003693 | Ga0032354_1016521 | Ga0032354_10165212 | 85 |
| 106 | 3300003693 | Ga0032354_1031837 | Ga0032354_10318372 | 85 |
| 107 | 3300003693 | Ga0032354_1037179 | Ga0032354_10371792 | 85 |
| 108 | 3300003735 | Ga0006780_1017431 | Ga0006780_10174312 | 85 |
| 109 | 3300003752 | Ga0055539_1012687 | Ga0055539_10126872 | 85 |
| 110 | 3300003771 | Ga0055526_1014626 | Ga0055526_10146265 | 85 |
| 111 | 3300003791 | Ga0055530_10003385 | Ga0055530_100033855 | 85 |
| 112 | 3300003792 | Ga0055540_1009236 | Ga0055540_10092366 | 85 |
| 113 | 3300003792 | Ga0055540_1017082 | Ga0055540_10170822 | 85 |
| 114 | 3300003792 | Ga0055540_1095489 | Ga0055540_10954892 | 85 |
| 115 | 3300003792 | Ga0055540_1112322 | Ga0055540_11123222 | 85 |
| 116 | 3300003794 | Ga0055531_10000158 | Ga0055531_1000015869 | 85 |
| 117 | 3300004798 | Ga0058859_11701938 | Ga0058859_117019382 | 85 |
| 118 | 3300004798 | Ga0058859_11819676 | Ga0058859_118196762 | 85 |
| 119 | 3300004798 | Ga0058859_11829144 | Ga0058859_118291441 | 85 |
| 120 | 3300004799 | Ga0058863_10004931 | Ga0058863_100049311 | 85 |
| 121 | 3300004799 | Ga0058863_11886072 | Ga0058863_118860723 | 85 |
| 122 | 3300004800 | Ga0058861_12046980 | Ga0058861_120469802 | 85 |
| 123 | 3300004801 | Ga0058860_10070410 | Ga0058860_100704101 | 85 |
| 124 | 3300004801 | Ga0058860_12216250 | Ga0058860_122162502 | 85 |
| 125 | 3300005262 | Ga0065165_1002013 | Ga0065165_100201322 | 85 |
| 126 | 3300005289 | Ga0065704_10527730 | Ga0065704_105277301 | 85 |
| 127 | 3300005295 | Ga0065707_10082503 | Ga0065707_1008250313 | 85 |
| 128 | 3300005295 | Ga0065707_11023718 | Ga0065707_110237181 | 85 |
| 129 | 3300005327 | Ga0070658_10068891 | Ga0070658_100688913 | 85 |
| 130 | 3300005327 | Ga0070658_10320018 | Ga0070658_103200183 | 85 |
| 131 | 3300005327 | Ga0070658_10534964 | Ga0070658_105349642 | 85 |
| 132 | 3300005327 | Ga0070658_10649110 | Ga0070658_106491101 | 85 |
| 133 | 3300005333 | Ga0070677_10087294 | Ga0070677_100872942 | 85 |
| 134 | 3300005334 | Ga0068869_100297442 | Ga0068869_1002974421 | 85 |
| 135 | 3300005334 | Ga0068869_101128982 | Ga0068869_1011289822 | 85 |
| 136 | 3300005336 | Ga0070680_100134810 | Ga0070680_1001348102 | 85 |
| 137 | 3300005337 | Ga0070682_100267190 | Ga0070682_1002671902 | 85 |
| 138 | 3300005338 | Ga0068868_100229049 | Ga0068868_1002290492 | 85 |
| 139 | 3300005339 | Ga0070660_100070483 | Ga0070660_1000704833 | 85 |
| 140 | 3300005339 | Ga0070660_100973026 | Ga0070660_1009730262 | 85 |
| 141 | 3300005343 | Ga0070687_101193445 | Ga0070687_1011934451 | 85 |
| 142 | 3300005344 | Ga0070661_100748768 | Ga0070661_1007487682 | 85 |
| 143 | 3300005347 | Ga0070668_100128990 | Ga0070668_1001289903 | 85 |
| 144 | 3300005353 | Ga0070669_100054025 | Ga0070669_1000540255 | 85 |
| 145 | 3300005355 | Ga0070671_101356837 | Ga0070671_1013568372 | 85 |
| 146 | 3300005356 | Ga0070674_100113587 | Ga0070674_1001135871 | 85 |
| 147 | 3300005356 | Ga0070674_100671121 | Ga0070674_1006711212 | 85 |
| 148 | 3300005364 | Ga0070673_101356170 | Ga0070673_1013561702 | 85 |
| 149 | 3300005367 | Ga0070667_100116760 | Ga0070667_1001167602 | 85 |
| 150 | 3300005367 | Ga0070667_100145381 | Ga0070667_1001453813 | 85 |
| 151 | 3300005441 | Ga0070700_100058250 | Ga0070700_1000582502 | 85 |
| 152 | 3300005455 | Ga0070663_100125498 | Ga0070663_1001254981 | 85 |
| 153 | 3300005456 | Ga0070678_100020291 | Ga0070678_1000202911 | 85 |
| 154 | 3300005456 | Ga0070678_101574061 | Ga0070678_1015740612 | 85 |
| 155 | 3300005458 | Ga0070681_10528773 | Ga0070681_105287734 | 85 |
| 156 | 3300005459 | Ga0068867_100001947 | Ga0068867_1000019473 | 85 |
| 157 | 3300005459 | Ga0068867_101294889 | Ga0068867_1012948891 | 85 |
| 158 | 3300005459 | Ga0068867_101571629 | Ga0068867_1015716291 | 85 |
| 159 | 3300005467 | Ga0070706_101829860 | Ga0070706_1018298601 | 85 |
| 160 | 3300005530 | Ga0070679_100212564 | Ga0070679_1002125642 | 85 |
| 161 | 3300005530 | Ga0070679_100500176 | Ga0070679_1005001761 | 85 |
| 162 | 3300005535 | Ga0070684_101644640 | Ga0070684_1016446402 | 85 |
| 163 | 3300005539 | Ga0068853_101067456 | Ga0068853_1010674562 | 85 |
| 164 | 3300005543 | Ga0070672_101355696 | Ga0070672_1013556962 | 85 |
| 165 | 3300005548 | Ga0070665_100842570 | Ga0070665_1008425702 | 85 |
| 166 | 3300005548 | Ga0070665_100928564 | Ga0070665_1009285643 | 85 |
| 167 | 3300005563 | Ga0068855_100032613 | Ga0068855_1000326133 | 85 |
| 168 | 3300005563 | Ga0068855_100120364 | Ga0068855_1001203645 | 85 |
| 169 | 3300005563 | Ga0068855_100142205 | Ga0068855_1001422054 | 85 |
| 170 | 3300005616 | Ga0068852_100089473 | Ga0068852_1000894732 | 85 |
| 171 | 3300005616 | Ga0068852_101219474 | Ga0068852_1012194742 | 85 |
| 172 | 3300005617 | Ga0068859_101381555 | Ga0068859_1013815552 | 85 |
| 173 | 3300005618 | Ga0068864_100200723 | Ga0068864_1002007233 | 85 |
| 174 | 3300005618 | Ga0068864_100536369 | Ga0068864_1005363691 | 85 |
| 175 | 3300005618 | Ga0068864_101282041 | Ga0068864_1012820412 | 85 |
| 176 | 3300005718 | Ga0068866_10003673 | Ga0068866_100036735 | 85 |
| 177 | 3300005719 | Ga0068861_100006327 | Ga0068861_1000063277 | 85 |
| 178 | 3300005719 | Ga0068861_101944555 | Ga0068861_1019445552 | 85 |
| 179 | 3300005841 | Ga0068863_100071767 | Ga0068863_1000717672 | 85 |
| 180 | 3300005841 | Ga0068863_100608432 | Ga0068863_1006084322 | 85 |
| 181 | 3300005841 | Ga0068863_101633437 | Ga0068863_1016334371 | 85 |
| 182 | 3300005842 | Ga0068858_101353515 | Ga0068858_1013535152 | 85 |
| 183 | 3300005842 | Ga0068858_102085773 | Ga0068858_1020857732 | 85 |
| 184 | 3300005843 | Ga0068860_100002278 | Ga0068860_1000022782 | 85 |
| 185 | 3300005843 | Ga0068860_101796647 | Ga0068860_1017966472 | 85 |
| 186 | 3300005844 | Ga0068862_100673631 | Ga0068862_1006736312 | 85 |
| 187 | 3300006038 | Ga0075365_10023056 | Ga0075365_100230565 | 85 |
| 188 | 3300006038 | Ga0075365_10038406 | Ga0075365_100384063 | 85 |
| 189 | 3300006038 | Ga0075365_10144102 | Ga0075365_101441022 | 85 |
| 190 | 3300006038 | Ga0075365_10146992 | Ga0075365_101469923 | 85 |
| 191 | 3300006038 | Ga0075365_10986743 | Ga0075365_109867432 | 85 |
| 192 | 3300006042 | Ga0075368_10050993 | Ga0075368_100509932 | 85 |
| 193 | 3300006042 | Ga0075368_10084772 | Ga0075368_100847722 | 85 |
| 194 | 3300006042 | Ga0075368_10242439 | Ga0075368_102424391 | 85 |
| 195 | 3300006048 | Ga0075363_100019150 | Ga0075363_1000191502 | 85 |
| 196 | 3300006048 | Ga0075363_100054717 | Ga0075363_1000547172 | 85 |
| 197 | 3300006048 | Ga0075363_100133175 | Ga0075363_1001331752 | 85 |
| 198 | 3300006048 | Ga0075363_100410322 | Ga0075363_1004103222 | 85 |
| 199 | 3300006048 | Ga0075363_100698830 | Ga0075363_1006988301 | 85 |
| 200 | 3300006048 | Ga0075363_100727169 | Ga0075363_1007271692 | 85 |
| 201 | 3300006051 | Ga0075364_10241644 | Ga0075364_102416443 | 85 |
| 202 | 3300006051 | Ga0075364_10439091 | Ga0075364_104390912 | 85 |
| 203 | 3300006051 | Ga0075364_10944518 | Ga0075364_109445182 | 85 |
| 204 | 3300006177 | Ga0075362_10043584 | Ga0075362_100435843 | 85 |
| 205 | 3300006177 | Ga0075362_10052438 | Ga0075362_100524382 | 85 |
| 206 | 3300006177 | Ga0075362_10057331 | Ga0075362_100573312 | 85 |
| 207 | 3300006177 | Ga0075362_10164527 | Ga0075362_101645271 | 85 |
| 208 | 3300006177 | Ga0075362_10182982 | Ga0075362_101829822 | 85 |
| 209 | 3300006177 | Ga0075362_10242245 | Ga0075362_102422452 | 85 |
| 210 | 3300006177 | Ga0075362_10718003 | Ga0075362_107180031 | 85 |
| 211 | 3300006178 | Ga0075367_10007325 | Ga0075367_100073255 | 85 |
| 212 | 3300006178 | Ga0075367_10026991 | Ga0075367_100269913 | 85 |
| 213 | 3300006178 | Ga0075367_10399051 | Ga0075367_103990512 | 85 |
| 214 | 3300006186 | Ga0075369_10021846 | Ga0075369_100218463 | 85 |
| 215 | 3300006195 | Ga0075366_10014821 | Ga0075366_100148213 | 85 |
| 216 | 3300006195 | Ga0075366_10035470 | Ga0075366_100354702 | 85 |
| 217 | 3300006195 | Ga0075366_10041460 | Ga0075366_100414603 | 85 |
| 218 | 3300006195 | Ga0075366_10050690 | Ga0075366_100506906 | 85 |
| 219 | 3300006195 | Ga0075366_10103320 | Ga0075366_101033203 | 85 |
| 220 | 3300006195 | Ga0075366_10127248 | Ga0075366_101272483 | 85 |
| 221 | 3300006195 | Ga0075366_10144411 | Ga0075366_101444113 | 85 |
| 222 | 3300006195 | Ga0075366_10240950 | Ga0075366_102409501 | 85 |
| 223 | 3300006195 | Ga0075366_10246833 | Ga0075366_102468332 | 85 |
| 224 | 3300006195 | Ga0075366_10254499 | Ga0075366_102544992 | 85 |
| 225 | 3300006195 | Ga0075366_10326500 | Ga0075366_103265002 | 85 |
| 226 | 3300006353 | Ga0075370_10002426 | Ga0075370_100024264 | 85 |
| 227 | 3300006353 | Ga0075370_10002528 | Ga0075370_100025284 | 85 |
| 228 | 3300006353 | Ga0075370_10232171 | Ga0075370_102321712 | 85 |
| 229 | 3300006353 | Ga0075370_10252821 | Ga0075370_102528212 | 85 |
| 230 | 3300006358 | Ga0068871_101698157 | Ga0068871_1016981572 | 85 |
| 231 | 3300006358 | Ga0068871_102191088 | Ga0068871_1021910882 | 85 |
| 232 | 3300006844 | Ga0075428_100473805 | Ga0075428_1004738052 | 85 |
| 233 | 3300006846 | Ga0075430_100033190 | Ga0075430_1000331906 | 85 |
| 234 | 3300006847 | Ga0075431_101382757 | Ga0075431_1013827571 | 85 |
| 235 | 3300006880 | Ga0075429_100074259 | Ga0075429_1000742591 | 85 |
| 236 | 3300006881 | Ga0068865_100031867 | Ga0068865_1000318675 | 85 |
| 237 | 3300006931 | Ga0097620_101381565 | Ga0097620_1013815652 | 85 |
| 238 | 3300009093 | Ga0105240_10017122 | Ga0105240_100171229 | 85 |
| 239 | 3300009093 | Ga0105240_11888680 | Ga0105240_118886802 | 85 |
| 240 | 3300009094 | Ga0111539_10608222 | Ga0111539_106082223 | 85 |
| 241 | 3300009094 | Ga0111539_13201018 | Ga0111539_132010182 | 85 |
| 242 | 3300009098 | Ga0105245_10170491 | Ga0105245_101704913 | 85 |
| 243 | 3300009098 | Ga0105245_10311700 | Ga0105245_103117002 | 85 |
| 244 | 3300009098 | Ga0105245_11663801 | Ga0105245_116638011 | 85 |
| 245 | 3300009101 | Ga0105247_10944305 | Ga0105247_109443052 | 85 |
| 246 | 3300009147 | Ga0114129_12840635 | Ga0114129_128406351 | 85 |
| 247 | 3300009174 | Ga0105241_10083226 | Ga0105241_100832261 | 85 |
| 248 | 3300009176 | Ga0105242_10469742 | Ga0105242_104697423 | 85 |
| 249 | 3300009177 | Ga0105248_10721083 | Ga0105248_107210832 | 85 |
| 250 | 3300009177 | Ga0105248_10854833 | Ga0105248_108548332 | 85 |
| 251 | 3300009177 | Ga0105248_11268854 | Ga0105248_112688541 | 85 |
| 252 | 3300009545 | Ga0105237_10518801 | Ga0105237_105188012 | 85 |
| 253 | 3300009545 | Ga0105237_10675960 | Ga0105237_106759601 | 85 |
| 254 | 3300009551 | Ga0105238_10145507 | Ga0105238_101455072 | 85 |
| 255 | 3300009551 | Ga0105238_10594850 | Ga0105238_105948503 | 85 |
| 256 | 3300009551 | Ga0105238_10794777 | Ga0105238_107947772 | 85 |
| 257 | 3300009551 | Ga0105238_10872399 | Ga0105238_108723992 | 85 |
| 258 | 3300009553 | Ga0105249_10037455 | Ga0105249_100374553 | 85 |
| 259 | 3300009553 | Ga0105249_11185643 | Ga0105249_111856432 | 85 |
| 260 | 3300010375 | Ga0105239_10804060 | Ga0105239_108040601 | 85 |
| 261 | 3300012497 | Ga0157319_1021801 | Ga0157319_10218012 | 85 |
| 262 | 3300012506 | Ga0157324_1059132 | Ga0157324_10591321 | 85 |
| 263 | 3300012512 | Ga0157327_1010021 | Ga0157327_10100212 | 85 |
| 264 | 3300012513 | Ga0157326_1076205 | Ga0157326_10762052 | 85 |
| 265 | 3300013296 | Ga0157374_10236650 | Ga0157374_102366503 | 85 |
| 266 | 3300013296 | Ga0157374_10691420 | Ga0157374_106914203 | 85 |
| 267 | 3300013297 | Ga0157378_10015555 | Ga0157378_100155555 | 85 |
| 268 | 3300013297 | Ga0157378_10206273 | Ga0157378_102062733 | 85 |
| 269 | 3300013297 | Ga0157378_10551355 | Ga0157378_105513552 | 85 |
| 270 | 3300013297 | Ga0157378_11520289 | Ga0157378_115202892 | 85 |
| 271 | 3300013297 | Ga0157378_11659920 | Ga0157378_116599202 | 85 |
| 272 | 3300013306 | Ga0163162_10280517 | Ga0163162_102805172 | 85 |
| 273 | 3300013307 | Ga0157372_12402095 | Ga0157372_124020952 | 85 |
| 274 | 3300013307 | Ga0157372_12455151 | Ga0157372_124551511 | 85 |
| 275 | 3300013307 | Ga0157372_12707485 | Ga0157372_127074851 | 85 |
| 276 | 3300013308 | Ga0157375_10717041 | Ga0157375_107170413 | 85 |
| 277 | 3300014325 | Ga0163163_11320509 | Ga0163163_113205092 | 85 |
| 278 | 3300014497 | Ga0182008_10401829 | Ga0182008_104018292 | 85 |
| 279 | 3300014497 | Ga0182008_10759152 | Ga0182008_107591521 | 85 |
| 280 | 3300014968 | Ga0157379_10591784 | Ga0157379_105917843 | 85 |
| 281 | 3300014968 | Ga0157379_11390960 | Ga0157379_113909602 | 85 |
| 282 | 3300014969 | Ga0157376_10049735 | Ga0157376_100497352 | 85 |
| 283 | 3300014969 | Ga0157376_10531467 | Ga0157376_105314672 | 85 |
| 284 | 3300014969 | Ga0157376_10558338 | Ga0157376_105583382 | 85 |
| 285 | 3300015262 | Ga0182007_10088519 | Ga0182007_100885192 | 85 |
| 286 | 3300015262 | Ga0182007_10202316 | Ga0182007_102023162 | 85 |
| 287 | 3300017792 | Ga0163161_10230509 | Ga0163161_102305092 | 85 |
| 288 | 3300017792 | Ga0163161_10658434 | Ga0163161_106584342 | 85 |
| 289 | 3300020069 | Ga0197907_10563325 | Ga0197907_105633252 | 85 |
| 290 | 3300020076 | Ga0206355_1480352 | Ga0206355_14803522 | 85 |
| 291 | 3300021361 | Ga0213872_10038378 | Ga0213872_100383782 | 85 |
| 292 | 3300021361 | Ga0213872_10060580 | Ga0213872_100605802 | 85 |
| 293 | 3300025245 | Ga0207425_1000221 | Ga0207425_100022129 | 85 |
| 294 | 3300025253 | Ga0209677_107129 | Ga0209677_1071293 | 85 |
| 295 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012157 | 85 |
| 296 | 3300025258 | Ga0209129_1037315 | Ga0209129_10373152 | 85 |
| 297 | 3300025258 | Ga0209129_1059813 | Ga0209129_10598132 | 85 |
| 298 | 3300025258 | Ga0209129_1060622 | Ga0209129_10606221 | 85 |
| 299 | 3300025273 | Ga0209673_1002136 | Ga0209673_10021363 | 85 |
| 300 | 3300025273 | Ga0209673_1019202 | Ga0209673_10192023 | 85 |
| 301 | 3300025273 | Ga0209673_1025942 | Ga0209673_10259424 | 85 |
| 302 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022357 | 85 |
| 303 | 3300025297 | Ga0209758_1000124 | Ga0209758_100012494 | 85 |
| 304 | 3300025297 | Ga0209758_1000234 | Ga0209758_10002342 | 85 |
| 305 | 3300025297 | Ga0209758_1050104 | Ga0209758_10501043 | 85 |
| 306 | 3300025298 | Ga0209050_1001261 | Ga0209050_100126122 | 85 |
| 307 | 3300025299 | Ga0209256_1061637 | Ga0209256_10616371 | 85 |
| 308 | 3300025303 | Ga0209051_1000315 | Ga0209051_100031525 | 85 |
| 309 | 3300025303 | Ga0209051_1031528 | Ga0209051_10315282 | 85 |
| 310 | 3300025303 | Ga0209051_1044906 | Ga0209051_10449063 | 85 |
| 311 | 3300025303 | Ga0209051_1070569 | Ga0209051_10705691 | 85 |
| 312 | 3300025304 | Ga0209257_1000309 | Ga0209257_100030937 | 85 |
| 313 | 3300025304 | Ga0209257_1017837 | Ga0209257_10178372 | 85 |
| 314 | 3300025304 | Ga0209257_1043746 | Ga0209257_10437462 | 85 |
| 315 | 3300025304 | Ga0209257_1149665 | Ga0209257_11496651 | 85 |
| 316 | 3300025899 | Ga0207642_10006139 | Ga0207642_100061395 | 85 |
| 317 | 3300025909 | Ga0207705_10128716 | Ga0207705_101287163 | 85 |
| 318 | 3300025909 | Ga0207705_10451851 | Ga0207705_104518512 | 85 |
| 319 | 3300025909 | Ga0207705_10532263 | Ga0207705_105322632 | 85 |
| 320 | 3300025909 | Ga0207705_10708206 | Ga0207705_107082062 | 85 |
| 321 | 3300025909 | Ga0207705_10870637 | Ga0207705_108706372 | 85 |
| 322 | 3300025910 | Ga0207684_10552915 | Ga0207684_105529153 | 85 |
| 323 | 3300025911 | Ga0207654_10058756 | Ga0207654_100587563 | 85 |
| 324 | 3300025912 | Ga0207707_10242094 | Ga0207707_102420943 | 85 |
| 325 | 3300025912 | Ga0207707_10262963 | Ga0207707_102629633 | 85 |
| 326 | 3300025913 | Ga0207695_10036310 | Ga0207695_100363106 | 85 |
| 327 | 3300025914 | Ga0207671_10459625 | Ga0207671_104596252 | 85 |
| 328 | 3300025917 | Ga0207660_10235701 | Ga0207660_102357011 | 85 |
| 329 | 3300025918 | Ga0207662_10639229 | Ga0207662_106392292 | 85 |
| 330 | 3300025919 | Ga0207657_10028808 | Ga0207657_100288082 | 85 |
| 331 | 3300025919 | Ga0207657_10624643 | Ga0207657_106246432 | 85 |
| 332 | 3300025919 | Ga0207657_10774667 | Ga0207657_107746671 | 85 |
| 333 | 3300025919 | Ga0207657_11053164 | Ga0207657_110531642 | 85 |
| 334 | 3300025920 | Ga0207649_10628388 | Ga0207649_106283882 | 85 |
| 335 | 3300025921 | Ga0207652_10077772 | Ga0207652_100777723 | 85 |
| 336 | 3300025923 | Ga0207681_10603067 | Ga0207681_106030672 | 85 |
| 337 | 3300025924 | Ga0207694_10242803 | Ga0207694_102428032 | 85 |
| 338 | 3300025924 | Ga0207694_10561120 | Ga0207694_105611202 | 85 |
| 339 | 3300025927 | Ga0207687_10011249 | Ga0207687_100112496 | 85 |
| 340 | 3300025927 | Ga0207687_10319509 | Ga0207687_103195092 | 85 |
| 341 | 3300025931 | Ga0207644_10629291 | Ga0207644_106292912 | 85 |
| 342 | 3300025932 | Ga0207690_10128789 | Ga0207690_101287892 | 85 |
| 343 | 3300025932 | Ga0207690_11192968 | Ga0207690_111929681 | 85 |
| 344 | 3300025937 | Ga0207669_10273879 | Ga0207669_102738791 | 85 |
| 345 | 3300025938 | Ga0207704_10001183 | Ga0207704_100011833 | 85 |
| 346 | 3300025939 | Ga0207665_10767968 | Ga0207665_107679681 | 85 |
| 347 | 3300025940 | Ga0207691_10245468 | Ga0207691_102454682 | 85 |
| 348 | 3300025942 | Ga0207689_10119995 | Ga0207689_101199954 | 85 |
| 349 | 3300025942 | Ga0207689_10963758 | Ga0207689_109637582 | 85 |
| 350 | 3300025942 | Ga0207689_11132038 | Ga0207689_111320381 | 85 |
| 351 | 3300025949 | Ga0207667_10093668 | Ga0207667_100936685 | 85 |
| 352 | 3300025949 | Ga0207667_10154780 | Ga0207667_101547803 | 85 |
| 353 | 3300025949 | Ga0207667_11245366 | Ga0207667_112453662 | 85 |
| 354 | 3300025961 | Ga0207712_10077901 | Ga0207712_100779013 | 85 |
| 355 | 3300025972 | Ga0207668_10108702 | Ga0207668_101087023 | 85 |
| 356 | 3300025972 | Ga0207668_11697051 | Ga0207668_116970512 | 85 |
| 357 | 3300025986 | Ga0207658_10383710 | Ga0207658_103837102 | 85 |
| 358 | 3300026023 | Ga0207677_10074561 | Ga0207677_100745614 | 85 |
| 359 | 3300026023 | Ga0207677_10093561 | Ga0207677_100935612 | 85 |
| 360 | 3300026035 | Ga0207703_11376543 | Ga0207703_113765432 | 85 |
| 361 | 3300026035 | Ga0207703_11460681 | Ga0207703_114606812 | 85 |
| 362 | 3300026035 | Ga0207703_11577849 | Ga0207703_115778491 | 85 |
| 363 | 3300026041 | Ga0207639_11879807 | Ga0207639_118798072 | 85 |
| 364 | 3300026067 | Ga0207678_10328650 | Ga0207678_103286502 | 85 |
| 365 | 3300026075 | Ga0207708_10094171 | Ga0207708_100941712 | 85 |
| 366 | 3300026078 | Ga0207702_10877865 | Ga0207702_108778651 | 85 |
| 367 | 3300026088 | Ga0207641_10053268 | Ga0207641_100532682 | 85 |
| 368 | 3300026088 | Ga0207641_11513988 | Ga0207641_115139882 | 85 |
| 369 | 3300026088 | Ga0207641_12351324 | Ga0207641_123513242 | 85 |
| 370 | 3300026089 | Ga0207648_10026441 | Ga0207648_100264413 | 85 |
| 371 | 3300026089 | Ga0207648_10108549 | Ga0207648_101085493 | 85 |
| 372 | 3300026089 | Ga0207648_11932623 | Ga0207648_119326232 | 85 |
| 373 | 3300026095 | Ga0207676_10169748 | Ga0207676_101697483 | 85 |
| 374 | 3300026116 | Ga0207674_10521733 | Ga0207674_105217332 | 85 |
| 375 | 3300026118 | Ga0207675_100021908 | Ga0207675_1000219087 | 85 |
| 376 | 3300026118 | Ga0207675_100985369 | Ga0207675_1009853692 | 85 |
| 377 | 3300026118 | Ga0207675_101352285 | Ga0207675_1013522851 | 85 |
| 378 | 3300026118 | Ga0207675_101384761 | Ga0207675_1013847611 | 85 |
| 379 | 3300026121 | Ga0207683_10567937 | Ga0207683_105679372 | 85 |
| 380 | 3300026121 | Ga0207683_11310273 | Ga0207683_113102732 | 85 |
| 381 | 3300026121 | Ga0207683_11640870 | Ga0207683_116408701 | 85 |
| 382 | 3300026142 | Ga0207698_10010712 | Ga0207698_100107123 | 85 |
| 383 | 3300026142 | Ga0207698_10160408 | Ga0207698_101604083 | 85 |
| 384 | 3300027252 | Ga0209973_1035866 | Ga0209973_10358661 | 85 |
| 385 | 3300027360 | Ga0209969_1016260 | Ga0209969_10162601 | 85 |
| 386 | 3300027378 | Ga0209981_1041424 | Ga0209981_10414241 | 85 |
| 387 | 3300027395 | Ga0209996_1000964 | Ga0209996_10009643 | 85 |
| 388 | 3300027471 | Ga0209995_1000738 | Ga0209995_10007381 | 85 |
| 389 | 3300027526 | Ga0209968_1000202 | Ga0209968_10002027 | 85 |
| 390 | 3300027543 | Ga0209999_1006976 | Ga0209999_10069763 | 85 |
| 391 | 3300027543 | Ga0209999_1052179 | Ga0209999_10521792 | 85 |
| 392 | 3300027614 | Ga0209970_1020316 | Ga0209970_10203163 | 85 |
| 393 | 3300027617 | Ga0210002_1036330 | Ga0210002_10363302 | 85 |
| 394 | 3300027695 | Ga0209966_1000017 | Ga0209966_100001760 | 85 |
| 395 | 3300027866 | Ga0209813_10048962 | Ga0209813_100489622 | 85 |
| 396 | 3300027866 | Ga0209813_10097874 | Ga0209813_100978742 | 85 |
| 397 | 3300027866 | Ga0209813_10411064 | Ga0209813_104110641 | 85 |
| 398 | 3300027876 | Ga0209974_10000240 | Ga0209974_1000024014 | 85 |
| 399 | 3300027876 | Ga0209974_10081232 | Ga0209974_100812323 | 85 |
| 400 | 3300028379 | Ga0268266_11434181 | Ga0268266_114341812 | 85 |
| 401 | 3300028380 | Ga0268265_10962979 | Ga0268265_109629792 | 85 |
| 402 | 3300028381 | Ga0268264_10050685 | Ga0268264_100506852 | 85 |
| 403 | 3300028381 | Ga0268264_11476563 | Ga0268264_114765631 | 85 |
| 404 | 3300028786 | Ga0307517_10060779 | Ga0307517_100607794 | 85 |
| 405 | 3300028786 | Ga0307517_10064548 | Ga0307517_100645482 | 85 |
| 406 | 3300028794 | Ga0307515_10000354 | Ga0307515_1000035443 | 85 |
| 407 | 3300028794 | Ga0307515_10007796 | Ga0307515_1000779613 | 85 |
| 408 | 3300028794 | Ga0307515_10022668 | Ga0307515_100226684 | 85 |
| 409 | 3300030522 | Ga0307512_10021785 | Ga0307512_100217853 | 85 |
| 410 | 3300030736 | Ga0316180_1130869 | Ga0316180_11308691 | 85 |
| 411 | 3300031238 | Ga0265332_10007658 | Ga0265332_100076583 | 85 |
| 412 | 3300031239 | Ga0265328_10019266 | Ga0265328_100192662 | 85 |
| 413 | 3300031239 | Ga0265328_10179358 | Ga0265328_101793582 | 85 |
| 414 | 3300031242 | Ga0265329_10039870 | Ga0265329_100398703 | 85 |
| 415 | 3300031251 | Ga0265327_10000056 | Ga0265327_1000005656 | 85 |
| 416 | 3300031456 | Ga0307513_10041205 | Ga0307513_100412055 | 85 |
| 417 | 3300031456 | Ga0307513_10456071 | Ga0307513_104560712 | 85 |
| 418 | 3300031507 | Ga0307509_10022375 | Ga0307509_100223755 | 85 |
| 419 | 3300031507 | Ga0307509_10305886 | Ga0307509_103058862 | 85 |
| 420 | 3300031507 | Ga0307509_10529316 | Ga0307509_105293162 | 85 |
| 421 | 3300031507 | Ga0307509_11003006 | Ga0307509_110030061 | 85 |
| 422 | 3300031548 | Ga0307408_101392350 | Ga0307408_1013923501 | 85 |
| 423 | 3300031548 | Ga0307408_101930907 | Ga0307408_1019309071 | 85 |
| 424 | 3300031616 | Ga0307508_10000043 | Ga0307508_1000004372 | 85 |
| 425 | 3300031616 | Ga0307508_10819637 | Ga0307508_108196372 | 85 |
| 426 | 3300031649 | Ga0307514_10001251 | Ga0307514_100012516 | 85 |
| 427 | 3300031649 | Ga0307514_10048623 | Ga0307514_100486232 | 85 |
| 428 | 3300031649 | Ga0307514_10448787 | Ga0307514_104487871 | 85 |
| 429 | 3300031711 | Ga0265314_10004112 | Ga0265314_1000411215 | 85 |
| 430 | 3300031730 | Ga0307516_10001691 | Ga0307516_1000169118 | 85 |
| 431 | 3300031730 | Ga0307516_10050533 | Ga0307516_100505333 | 85 |
| 432 | 3300031730 | Ga0307516_10098801 | Ga0307516_100988013 | 85 |
| 433 | 3300031730 | Ga0307516_10448454 | Ga0307516_104484542 | 85 |
| 434 | 3300031730 | Ga0307516_10643754 | Ga0307516_106437543 | 85 |
| 435 | 3300031731 | Ga0307405_11725080 | Ga0307405_117250802 | 85 |
| 436 | 3300031824 | Ga0307413_10482850 | Ga0307413_104828501 | 85 |
| 437 | 3300031824 | Ga0307413_11432399 | Ga0307413_114323992 | 85 |
| 438 | 3300031852 | Ga0307410_11245878 | Ga0307410_112458782 | 85 |
| 439 | 3300031901 | Ga0307406_10708777 | Ga0307406_107087772 | 85 |
| 440 | 3300031901 | Ga0307406_10776367 | Ga0307406_107763672 | 85 |
| 441 | 3300031911 | Ga0307412_10042383 | Ga0307412_100423834 | 85 |
| 442 | 3300031911 | Ga0307412_10258838 | Ga0307412_102588381 | 85 |
| 443 | 3300031911 | Ga0307412_10394411 | Ga0307412_103944112 | 85 |
| 444 | 3300031911 | Ga0307412_11123125 | Ga0307412_111231252 | 85 |
| 445 | 3300031995 | Ga0307409_102287656 | Ga0307409_1022876562 | 85 |
| 446 | 3300032002 | Ga0307416_100080904 | Ga0307416_1000809043 | 85 |
| 447 | 3300032002 | Ga0307416_101782698 | Ga0307416_1017826981 | 85 |
| 448 | 3300032002 | Ga0307416_103122858 | Ga0307416_1031228581 | 85 |
| 449 | 3300032002 | Ga0307416_103612871 | Ga0307416_1036128712 | 85 |
| 450 | 3300032002 | Ga0307416_103739296 | Ga0307416_1037392961 | 85 |
| 451 | 3300032005 | Ga0307411_10772200 | Ga0307411_107722002 | 85 |
| 452 | 3300033179 | Ga0307507_10033702 | Ga0307507_100337024 | 85 |
| 453 | 3300035089 | Ga0373944_0006303 | Ga0373944_0006303_2133_2390 | 85 |
| 454 | 3300035116 | Ga0373945_0136824 | Ga0373945_0136824_242_499 | 85 |
| 455 | 3300035691 | Ga0373931_0007108 | Ga0373931_0007108_1824_2081 | 85 |
| 456 | 3300035691 | Ga0373931_0262302 | Ga0373931_0262302_55_312 | 85 |
| 457 | 3300035695 | Ga0373927_0048447 | Ga0373927_0048447_1506_1763 | 85 |
| 458 | 3300037068 | Ga0373925_0046159 | Ga0373925_0046159_723_980 | 85 |
| 459 | 3300037312 | Ga0395899_0011812 | Ga0395899_0011812_2283_2546 | 85 |
| 460 | 3300037312 | Ga0395899_0028736 | Ga0395899_0028736_2330_2587 | 85 |
| 461 | 3300037312 | Ga0395899_0037196 | Ga0395899_0037196_2653_2910 | 85 |
| 462 | 3300037312 | Ga0395899_0965304 | Ga0395899_0965304_135_392 | 85 |
| 463 | 3300037418 | Ga0395900_0006372 | Ga0395900_0006372_10613_10870 | 85 |
| 464 | 3300037418 | Ga0395900_0035948 | Ga0395900_0035948_1941_2198 | 85 |
| 465 | 3300037418 | Ga0395900_0132373 | Ga0395900_0132373_910_1167 | 85 |
| 466 | 3300037418 | Ga0395900_0286476 | Ga0395900_0286476_623_886 | 85 |
| 467 | 3300037418 | Ga0395900_0517106 | Ga0395900_0517106_800_1057 | 85 |
| 468 | 3300037418 | Ga0395900_1754385 | Ga0395900_1754385_145_408 | 85 |
| 469 | 3300037466 | Ga0395898_0010814 | Ga0395898_0010814_1624_1887 | 85 |
| 470 | 3300037466 | Ga0395898_0036421 | Ga0395898_0036421_1334_1591 | 85 |
| 471 | 3300037466 | Ga0395898_0058613 | Ga0395898_0058613_1361_1618 | 85 |
| 472 | 3300037466 | Ga0395898_0107134 | Ga0395898_0107134_1914_2171 | 85 |
| 473 | 3300037471 | Ga0395905_0000088 | Ga0395905_0000088_40186_40443 | 85 |
| 474 | 3300037471 | Ga0395905_0000572 | Ga0395905_0000572_5133_5390 | 85 |
| 475 | 3300037471 | Ga0395905_0011982 | Ga0395905_0011982_510_767 | 85 |
| 476 | 3300037471 | Ga0395905_0012026 | Ga0395905_0012026_316_573 | 85 |
| 477 | 3300037471 | Ga0395905_0014382 | Ga0395905_0014382_5378_5635 | 85 |
| 478 | 3300037471 | Ga0395905_0027418 | Ga0395905_0027418_254_517 | 85 |
| 479 | 3300037471 | Ga0395905_0059072 | Ga0395905_0059072_2066_2326 | 85 |
| 480 | 3300037471 | Ga0395905_0060108 | Ga0395905_0060108_1021_1278 | 85 |
| 481 | 3300037471 | Ga0395905_0062421 | Ga0395905_0062421_2476_2739 | 85 |
| 482 | 3300037471 | Ga0395905_0069463 | Ga0395905_0069463_2606_2863 | 85 |
| 483 | 3300037471 | Ga0395905_0967167 | Ga0395905_0967167_287_544 | 85 |
| 484 | 3300037471 | Ga0395905_1095994 | Ga0395905_1095994_144_401 | 85 |
| 485 | 3300037471 | Ga0395905_1101169 | Ga0395905_1101169_14_271 | 85 |
| 486 | 3300038443 | Ga0395901_0123193 | Ga0395901_0123193_154_417 | 85 |
| 487 | 3300038443 | Ga0395901_0195280 | Ga0395901_0195280_1378_1635 | 85 |
| 488 | 3300038443 | Ga0395901_0352224 | Ga0395901_0352224_1024_1281 | 85 |
| 489 | 3300038443 | Ga0395901_0388373 | Ga0395901_0388373_600_857 | 85 |
| 490 | 3300038443 | Ga0395901_0543406 | Ga0395901_0543406_272_529 | 85 |
| 491 | 3300038443 | Ga0395901_1077478 | Ga0395901_1077478_191_454 | 85 |
| 492 | 3300038443 | Ga0395901_1483466 | Ga0395901_1483466_154_417 | 85 |
| 493 | 3300039437 | Ga0436365_0965563 | Ga0436365_0965563_195_452 | 85 |
| 494 | 3300039437 | Ga0436365_1322651 | Ga0436365_1322651_146_403 | 85 |
| 495 | 3300039437 | Ga0436365_1608897 | Ga0436365_1608897_109_369 | 85 |
| 496 | 3300039447 | Ga0436361_0577382 | Ga0436361_0577382_3052_3309 | 85 |
| 497 | 3300039447 | Ga0436361_0675139 | Ga0436361_0675139_70_327 | 85 |
| 498 | 3300039447 | Ga0436361_0701864 | Ga0436361_0701864_4551_4808 | 85 |
| 499 | 3300039447 | Ga0436361_0944371 | Ga0436361_0944371_6214_6486 | 85 |
| 500 | 3300039447 | Ga0436361_1218189 | Ga0436361_1218189_8911_9183 | 85 |
| 501 | 3300041406 | Ga0439439_0029533 | Ga0439439_0029533_715_972 | 85 |
| 502 | 3300041408 | Ga0439453_0002156 | Ga0439453_0002156_2361_2621 | 85 |
| 503 | 3300041408 | Ga0439453_0180403 | Ga0439453_0180403_10_267 | 85 |
| 504 | 3300041410 | Ga0439461_0015886 | Ga0439461_0015886_258_518 | 85 |
| 505 | 3300041410 | Ga0439461_0078680 | Ga0439461_0078680_228_488 | 85 |
| 506 | 3300041410 | Ga0439461_0226220 | Ga0439461_0226220_165_425 | 85 |
| 507 | 3300041411 | Ga0439466_0154303 | Ga0439466_0154303_10_267 | 85 |
| 508 | 3300041413 | Ga0439465_0115913 | Ga0439465_0115913_611_868 | 85 |
| 509 | 3300041441 | Ga0451787_747456 | Ga0451787_747456_68_328 | 85 |
| 510 | 3300041443 | Ga0451789_0263010 | Ga0451789_0263010_122_382 | 85 |
| 511 | 3300041443 | Ga0451789_0994690 | Ga0451789_0994690_241_501 | 85 |
| 512 | 3300041444 | Ga0451790_40937 | Ga0451790_40937_98_358 | 85 |
| 513 | 3300041445 | Ga0451792_07629 | Ga0451792_07629_440_700 | 85 |
| 514 | 3300041451 | Ga0451791_0119703 | Ga0451791_0119703_233_493 | 85 |
| 515 | 3300041451 | Ga0451791_0434493 | Ga0451791_0434493_415_675 | 85 |
| 516 | 3300041451 | Ga0451791_1528259 | Ga0451791_1528259_73_330 | 85 |
| 517 | 3300041452 | Ga0451793_0444831 | Ga0451793_0444831_276_536 | 85 |
| 518 | 3300041453 | Ga0451797_0400801 | Ga0451797_0400801_84_344 | 85 |
| 519 | 3300041456 | Ga0451795_0317897 | Ga0451795_0317897_45_305 | 85 |
| 520 | 3300041456 | Ga0451795_0606043 | Ga0451795_0606043_320_580 | 85 |
| 521 | 3300041456 | Ga0451795_0709851 | Ga0451795_0709851_171_431 | 85 |
| 522 | 3300041457 | Ga0451803_10289 | Ga0451803_10289_440_697 | 85 |
| 523 | 3300041458 | Ga0451798_0906264 | Ga0451798_0906264_1665_1925 | 85 |
| 524 | 3300041458 | Ga0451798_1010413 | Ga0451798_1010413_122_379 | 85 |
| 525 | 3300041459 | Ga0451800_1407603 | Ga0451800_1407603_121_381 | 85 |
| 526 | 3300041460 | Ga0451802_0165900 | Ga0451802_0165900_703_963 | 85 |
| 527 | 3300041460 | Ga0451802_1253790 | Ga0451802_1253790_1242_1508 | 85 |
| 528 | 3300041461 | Ga0451805_035215 | Ga0451805_035215_304_564 | 85 |
| 529 | 3300041461 | Ga0451805_050872 | Ga0451805_050872_416_676 | 85 |
| 530 | 3300041461 | Ga0451805_062719 | Ga0451805_062719_13_270 | 85 |
| 531 | 3300041463 | Ga0451804_0524043 | Ga0451804_0524043_1687_1947 | 85 |
| 532 | 3300041464 | Ga0451808_17493 | Ga0451808_17493_36_296 | 85 |
| 533 | 3300041486 | Ga0451807_0330362 | Ga0451807_0330362_752_1012 | 85 |
| 534 | 3300041486 | Ga0451807_2270138 | Ga0451807_2270138_57_317 | 85 |
| 535 | 3300041491 | Ga0451833_0330071 | Ga0451833_0330071_151_411 | 85 |
| 536 | 3300041491 | Ga0451833_0655318 | Ga0451833_0655318_57_317 | 85 |
| 537 | 3300041492 | Ga0451835_0694273 | Ga0451835_0694273_340_600 | 85 |
| 538 | 3300041494 | Ga0451837_1774988 | Ga0451837_1774988_61_318 | 85 |
| 539 | 3300041498 | Ga0451841_0105846 | Ga0451841_0105846_525_785 | 85 |
| 540 | 3300041498 | Ga0451841_0671554 | Ga0451841_0671554_211_471 | 85 |
| 541 | 3300041498 | Ga0451841_1145597 | Ga0451841_1145597_229_486 | 85 |
| 542 | 3300041501 | Ga0451845_0164481 | Ga0451845_0164481_55_312 | 85 |
| 543 | 3300041503 | Ga0451847_0278715 | Ga0451847_0278715_158_415 | 85 |
| 544 | 3300041506 | Ga0451850_04492 | Ga0451850_04492_44_301 | 85 |
| 545 | 3300041512 | Ga0451853_1259832 | Ga0451853_1259832_292_552 | 85 |
| 546 | 3300041512 | Ga0451853_1473800 | Ga0451853_1473800_65_325 | 85 |
| 547 | 3300041907 | Ga0452268_35386 | Ga0452268_35386_261_521 | 85 |
| 548 | 3300042006 | Ga0439432_068608 | Ga0439432_068608_770_1030 | 85 |
| 549 | 3300042007 | Ga0439449_0002153 | Ga0439449_0002153_2840_3097 | 85 |
| 550 | 3300042009 | Ga0439451_041027 | Ga0439451_041027_349_606 | 85 |
| 551 | 3300042014 | Ga0439457_008880 | Ga0439457_008880_339_596 | 85 |
| 552 | 3300042014 | Ga0439457_149134 | Ga0439457_149134_262_522 | 85 |
| 553 | 3300042118 | Ga0450914_028955 | Ga0450914_028955_94_354 | 85 |
| 554 | 3300042118 | Ga0450914_048956 | Ga0450914_048956_265_525 | 85 |
| 555 | 3300042127 | Ga0450890_015301 | Ga0450890_015301_352_609 | 85 |
| 556 | 3300042131 | Ga0450894_027161 | Ga0450894_027161_307_567 | 85 |
| 557 | 3300042133 | Ga0450896_034195 | Ga0450896_034195_89_346 | 85 |
| 558 | 3300042134 | Ga0450898_006396 | Ga0450898_006396_727_987 | 85 |
| 559 | 3300042134 | Ga0450898_155362 | Ga0450898_155362_197_457 | 85 |
| 560 | 3300042156 | Ga0439446_0049193 | Ga0439446_0049193_922_1179 | 85 |
| 561 | 3300042157 | Ga0439458_0032273 | Ga0439458_0032273_757_1017 | 85 |
| 562 | 3300042435 | Ga0439434_0065387 | Ga0439434_0065387_457_714 | 85 |
| 563 | 3300042435 | Ga0439434_0316525 | Ga0439434_0316525_266_523 | 85 |
| 564 | 3300042438 | Ga0439459_0143401 | Ga0439459_0143401_127_384 | 85 |
| 565 | 3300042439 | Ga0439464_0007196 | Ga0439464_0007196_773_1033 | 85 |
| 566 | 3300042530 | Ga0450916_044966 | Ga0450916_044966_106_363 | 85 |
| 567 | 3300042532 | Ga0450893_0001535 | Ga0450893_0001535_3154_3411 | 85 |
| 568 | 3300042876 | Ga0451577_0002525 | Ga0451577_0002525_6961_7218 | 85 |
| 569 | 3300042876 | Ga0451577_0045489 | Ga0451577_0045489_2503_2760 | 85 |
| 570 | 3300042876 | Ga0451577_0056391 | Ga0451577_0056391_1041_1298 | 85 |
| 571 | 3300042876 | Ga0451577_1605171 | Ga0451577_1605171_39_299 | 85 |
| 572 | 3300044656 | Ga0466969_0000008 | Ga0466969_0000008_20026_20283 | 85 |
| 573 | 3300044656 | Ga0466969_0003553 | Ga0466969_0003553_2200_2457 | 85 |
| 574 | 3300044656 | Ga0466969_0009510 | Ga0466969_0009510_866_1129 | 85 |
| 575 | 3300044656 | Ga0466969_0010304 | Ga0466969_0010304_4339_4596 | 85 |
| 576 | 3300044658 | Ga0466972_0088445 | Ga0466972_0088445_635_892 | 85 |
| 577 | 3300044673 | Ga0453683_0002014 | Ga0453683_0002014_4058_4318 | 85 |
| 578 | 3300044673 | Ga0453683_0306702 | Ga0453683_0306702_68_325 | 85 |
| 579 | 3300044683 | Ga0466965_0003131 | Ga0466965_0003131_4740_5003 | 85 |
| 580 | 3300044683 | Ga0466965_0059268 | Ga0466965_0059268_320_577 | 85 |
| 581 | 3300044683 | Ga0466965_0113646 | Ga0466965_0113646_212_469 | 85 |
| 582 | 3300044683 | Ga0466965_0333402 | Ga0466965_0333402_550_807 | 85 |
| 583 | 3300044683 | Ga0466965_0566753 | Ga0466965_0566753_45_302 | 85 |
| 584 | 3300044683 | Ga0466965_0828532 | Ga0466965_0828532_206_466 | 85 |
| 585 | 3300044684 | Ga0466966_0001826 | Ga0466966_0001826_2595_2852 | 85 |
| 586 | 3300044684 | Ga0466966_0007945 | Ga0466966_0007945_4224_4481 | 85 |
| 587 | 3300044684 | Ga0466966_0008926 | Ga0466966_0008926_1193_1456 | 85 |
| 588 | 3300044684 | Ga0466966_0013800 | Ga0466966_0013800_3075_3332 | 85 |
| 589 | 3300044684 | Ga0466966_0153258 | Ga0466966_0153258_178_435 | 85 |
| 590 | 3300044684 | Ga0466966_0178938 | Ga0466966_0178938_903_1160 | 85 |
| 591 | 3300044684 | Ga0466966_0502399 | Ga0466966_0502399_33_290 | 85 |
| 592 | 3300044693 | Ga0466961_0027139 | Ga0466961_0027139_296_553 | 85 |
| 593 | 3300044693 | Ga0466961_0041448 | Ga0466961_0041448_476_739 | 85 |
| 594 | 3300044694 | Ga0466963_0006900 | Ga0466963_0006900_1214_1471 | 85 |
| 595 | 3300044694 | Ga0466963_0059746 | Ga0466963_0059746_854_1117 | 85 |
| 596 | 3300044706 | Ga0466964_0002210 | Ga0466964_0002210_1003_1266 | 85 |
| 597 | 3300044706 | Ga0466964_0007297 | Ga0466964_0007297_553_810 | 85 |
| 598 | 3300044706 | Ga0466964_0154962 | Ga0466964_0154962_744_1001 | 85 |
| 599 | 3300044712 | Ga0453684_0006310 | Ga0453684_0006310_3960_4220 | 85 |
| 600 | 3300044712 | Ga0453684_0077376 | Ga0453684_0077376_53_310 | 85 |
| 601 | 3300044712 | Ga0453684_2081783 | Ga0453684_2081783_195_452 | 85 |
| 602 | 3300044712 | Ga0453684_2412378 | Ga0453684_2412378_217_474 | 85 |
| 603 | 3300044719 | Ga0466971_0019502 | Ga0466971_0019502_1430_1693 | 85 |
| 604 | 3300044719 | Ga0466971_0110556 | Ga0466971_0110556_109_366 | 85 |
| 605 | 3300044735 | Ga0466968_0089169 | Ga0466968_0089169_606_863 | 85 |
| 606 | 3300044735 | Ga0466968_0216321 | Ga0466968_0216321_391_654 | 85 |
| 607 | 3300044765 | Ga0466970_0015667 | Ga0466970_0015667_1736_1999 | 85 |
| 608 | 3300044765 | Ga0466970_0028777 | Ga0466970_0028777_170_427 | 85 |
| 609 | 3300044765 | Ga0466970_0047856 | Ga0466970_0047856_1227_1484 | 85 |
| 610 | 3300044765 | Ga0466970_0174607 | Ga0466970_0174607_818_1075 | 85 |
| 611 | 3300044842 | Ga0466957_0001869 | Ga0466957_0001869_7145_7408 | 85 |
| 612 | 3300044842 | Ga0466957_0006607 | Ga0466957_0006607_1249_1506 | 85 |
| 613 | 3300044842 | Ga0466957_0090082 | Ga0466957_0090082_989_1246 | 85 |
| 614 | 3300044901 | Ga0466960_0106510 | Ga0466960_0106510_684_941 | 85 |
| 615 | 3300044901 | Ga0466960_0924585 | Ga0466960_0924585_155_412 | 85 |
| 616 | 3300045049 | Ga0466959_0000192 | Ga0466959_0000192_17080_17337 | 85 |
| 617 | 3300045049 | Ga0466959_0001900 | Ga0466959_0001900_1834_2097 | 85 |
| 618 | 3300045049 | Ga0466959_0146563 | Ga0466959_0146563_1299_1556 | 85 |
| 619 | 3300045049 | Ga0466959_0237356 | Ga0466959_0237356_453_716 | 85 |
| 620 | 3300045049 | Ga0466959_0310305 | Ga0466959_0310305_80_337 | 85 |
| 621 | 3300045049 | Ga0466959_0349911 | Ga0466959_0349911_349_606 | 85 |
| 622 | 3300045051 | Ga0451576_0002088 | Ga0451576_0002088_9006_9263 | 85 |
| 623 | 3300045051 | Ga0451576_0008890 | Ga0451576_0008890_7173_7433 | 85 |
| 624 | 3300045051 | Ga0451576_1541157 | Ga0451576_1541157_334_591 | 85 |
| 625 | 3300045051 | Ga0451576_1645678 | Ga0451576_1645678_22_279 | 85 |
| 626 | 3300045836 | Ga0466958_0074122 | Ga0466958_0074122_1312_1575 | 85 |
| 627 | 3300045836 | Ga0466958_0083497 | Ga0466958_0083497_1199_1456 | 85 |
| 628 | 3300045836 | Ga0466958_0150775 | Ga0466958_0150775_916_1173 | 85 |
| 629 | 3300045976 | Ga0466967_0059458 | Ga0466967_0059458_997_1254 | 85 |
| 630 | 3300045976 | Ga0466967_0772182 | Ga0466967_0772182_328_591 | 85 |
| 631 | 3300045976 | Ga0466967_1042550 | Ga0466967_1042550_186_443 | 85 |
| 632 | 3300045976 | Ga0466967_1936208 | Ga0466967_1936208_188_445 | 85 |
| 633 | 3300046460 | Ga0495638_0598691 | Ga0495638_0598691_120_380 | 85 |
| 634 | 3300046492 | Ga0495585_0021845 | Ga0495585_0021845_1433_1690 | 85 |
| 635 | 3300046512 | Ga0495610_0117871 | Ga0495610_0117871_450_710 | 85 |
| 636 | 3300046515 | Ga0495620_0053358 | Ga0495620_0053358_375_635 | 85 |
| 637 | 3300046519 | Ga0495632_0012504 | Ga0495632_0012504_1096_1356 | 85 |
| 638 | 3300046519 | Ga0495632_0101047 | Ga0495632_0101047_955_1215 | 85 |
| 639 | 3300046522 | Ga0495643_0101814 | Ga0495643_0101814_74_334 | 85 |
| 640 | 3300046526 | Ga0495666_0502507 | Ga0495666_0502507_185_442 | 85 |
| 641 | 3300046528 | Ga0495642_0034674 | Ga0495642_0034674_364_624 | 85 |
| 642 | 3300046537 | Ga0495598_0082466 | Ga0495598_0082466_413_670 | 85 |
| 643 | 3300046539 | Ga0495621_0011477 | Ga0495621_0011477_1702_1959 | 85 |
| 644 | 3300046539 | Ga0495621_0040523 | Ga0495621_0040523_545_805 | 85 |
| 645 | 3300046558 | Ga0495633_0294553 | Ga0495633_0294553_108_368 | 85 |
| 646 | 3300046615 | Ga0495656_0001651 | Ga0495656_0001651_4314_4574 | 85 |
| 647 | 3300046615 | Ga0495656_0073823 | Ga0495656_0073823_587_847 | 85 |
| 648 | 3300046615 | Ga0495656_0646334 | Ga0495656_0646334_185_445 | 85 |
| 649 | 3300046660 | Ga0495625_0003495 | Ga0495625_0003495_4944_5204 | 85 |
| 650 | 3300046665 | Ga0495661_0359139 | Ga0495661_0359139_368_628 | 85 |
| 651 | 3300046674 | Ga0495588_0374758 | Ga0495588_0374758_249_509 | 85 |
| 652 | 3300046683 | Ga0495658_0888972 | Ga0495658_0888972_226_486 | 85 |
| 653 | 3300046684 | Ga0495669_0409337 | Ga0495669_0409337_21_281 | 85 |
| 654 | 3300046691 | Ga0495670_0102184 | Ga0495670_0102184_813_1073 | 85 |
| 655 | 3300047318 | Ga0495636_0024213 | Ga0495636_0024213_225_485 | 85 |
| 656 | 3300047318 | Ga0495636_0539224 | Ga0495636_0539224_200_457 | 85 |
| 657 | 3300047445 | Ga0495677_0187090 | Ga0495677_0187090_255_515 | 85 |
| 658 | 3300047447 | Ga0495685_072880 | Ga0495685_072880_711_971 | 85 |
| 659 | 3300047470 | Ga0495681_0147366 | Ga0495681_0147366_437_697 | 85 |
| 660 | 3300047472 | Ga0495686_0246667 | Ga0495686_0246667_398_658 | 85 |
| 661 | 3300048088 | Ga0495602_0423707 | Ga0495602_0423707_429_686 | 85 |
| 662 | 3300048904 | Ga0496101_0438151 | Ga0496101_0438151_509_766 | 85 |
| 663 | 3300048904 | Ga0496101_1454457 | Ga0496101_1454457_220_477 | 85 |
| 664 | 3300048905 | Ga0496102_0014575 | Ga0496102_0014575_5793_6053 | 85 |
| 665 | 3300048905 | Ga0496102_0018900 | Ga0496102_0018900_5724_5981 | 85 |
| 666 | 3300048907 | Ga0496104_0573549 | Ga0496104_0573549_37_294 | 85 |
| 667 | 3300048908 | Ga0496105_0314580 | Ga0496105_0314580_400_657 | 85 |
| 668 | 3300048909 | Ga0496106_0236334 | Ga0496106_0236334_983_1243 | 85 |
| 669 | 3300048911 | Ga0496108_1420449 | Ga0496108_1420449_206_463 | 85 |
| 670 | 3300048912 | Ga0496109_0040141 | Ga0496109_0040141_550_807 | 85 |
| 671 | 3300048912 | Ga0496109_0066448 | Ga0496109_0066448_2399_2656 | 85 |
| 672 | 3300048913 | Ga0496110_0054390 | Ga0496110_0054390_2769_3026 | 85 |
| 673 | 3300048913 | Ga0496110_1658731 | Ga0496110_1658731_184_441 | 85 |
| 674 | 3300049127 | Ga0501306_027905 | Ga0501306_027905_275_532 | 85 |
| 675 | 3300049127 | Ga0501306_045413 | Ga0501306_045413_371_631 | 85 |
| 676 | 3300049127 | Ga0501306_059872 | Ga0501306_059872_20_277 | 85 |
| 677 | 3300049128 | Ga0501308_017892 | Ga0501308_017892_332_589 | 85 |
| 678 | 3300049128 | Ga0501308_042937 | Ga0501308_042937_275_538 | 85 |
| 679 | 3300049128 | Ga0501308_044818 | Ga0501308_044818_220_480 | 85 |
| 680 | 3300049130 | Ga0501310_020091 | Ga0501310_020091_337_594 | 85 |
| 681 | 3300049130 | Ga0501310_027621 | Ga0501310_027621_375_635 | 85 |
| 682 | 3300049130 | Ga0501310_052438 | Ga0501310_052438_71_331 | 85 |
| 683 | 3300049130 | Ga0501310_066193 | Ga0501310_066193_189_449 | 85 |
| 684 | 3300049131 | Ga0501341_07304 | Ga0501341_07304_397_654 | 85 |
| 685 | 3300049160 | Ga0501304_013717 | Ga0501304_013717_407_664 | 85 |
| 686 | 3300049161 | Ga0501305_042175 | Ga0501305_042175_381_641 | 85 |
| 687 | 3300049161 | Ga0501305_044733 | Ga0501305_044733_414_674 | 85 |
| 688 | 3300049161 | Ga0501305_047534 | Ga0501305_047534_58_318 | 85 |
| 689 | 3300049162 | Ga0501307_046115 | Ga0501307_046115_20_280 | 85 |
| 690 | 3300049516 | Ga0501293_017900 | Ga0501293_017900_398_655 | 85 |
| 691 | 3300049527 | Ga0501311_025972 | Ga0501311_025972_441_698 | 85 |
| 692 | 3300049528 | Ga0501312_094047 | Ga0501312_094047_236_496 | 85 |
| 693 | 3300049529 | Ga0501313_013402 | Ga0501313_013402_269_526 | 85 |
| 694 | 3300049530 | Ga0501314_019790 | Ga0501314_019790_339_596 | 85 |
| 695 | 3300049530 | Ga0501314_023747 | Ga0501314_023747_375_635 | 85 |
| 696 | 3300049531 | Ga0501315_022610 | Ga0501315_022610_470_727 | 85 |
| 697 | 3300049531 | Ga0501315_049781 | Ga0501315_049781_385_645 | 85 |
| 698 | 3300049533 | Ga0501317_019606 | Ga0501317_019606_391_648 | 85 |
| 699 | 3300049534 | Ga0501318_022873 | Ga0501318_022873_118_375 | 85 |
| 700 | 3300049535 | Ga0501319_001294 | Ga0501319_001294_568_825 | 85 |
| 701 | 3300049536 | Ga0501320_012097 | Ga0501320_012097_238_498 | 85 |
| 702 | 3300049536 | Ga0501320_026922 | Ga0501320_026922_42_299 | 85 |
| 703 | 3300049536 | Ga0501320_044150 | Ga0501320_044150_26_283 | 85 |
| 704 | 3300049537 | Ga0501321_027612 | Ga0501321_027612_110_367 | 85 |
| 705 | 3300049537 | Ga0501321_033459 | Ga0501321_033459_42_299 | 85 |
| 706 | 3300049537 | Ga0501321_045406 | Ga0501321_045406_297_557 | 85 |
| 707 | 3300049538 | Ga0501322_008434 | Ga0501322_008434_384_641 | 85 |
| 708 | 3300049539 | Ga0501323_061789 | Ga0501323_061789_47_304 | 85 |
| 709 | 3300049540 | Ga0501324_021119 | Ga0501324_021119_371_628 | 85 |
| 710 | 3300049543 | Ga0501327_06633 | Ga0501327_06633_404_661 | 85 |
| 711 | 3300049569 | Ga0501032_0164787 | Ga0501032_0164787_139_399 | 85 |
| 712 | 3300049570 | Ga0501033_0198515 | Ga0501033_0198515_549_809 | 85 |
| 713 | 3300049571 | Ga0501034_0055180 | Ga0501034_0055180_2816_3073 | 85 |
| 714 | 3300049573 | Ga0501037_0187833 | Ga0501037_0187833_919_1179 | 85 |
| 715 | 3300049573 | Ga0501037_0619022 | Ga0501037_0619022_211_468 | 85 |
| 716 | 3300049574 | Ga0501038_0232521 | Ga0501038_0232521_1145_1402 | 85 |
| 717 | 3300049574 | Ga0501038_0278315 | Ga0501038_0278315_746_1006 | 85 |
| 718 | 3300049578 | Ga0501042_0929024 | Ga0501042_0929024_238_498 | 85 |
| 719 | 3300049579 | Ga0501043_0325193 | Ga0501043_0325193_386_643 | 85 |
| 720 | 3300049580 | Ga0501046_0068157 | Ga0501046_0068157_2115_2372 | 85 |
| 721 | 3300049581 | Ga0501047_0070728 | Ga0501047_0070728_1792_2049 | 85 |
| 722 | 3300049581 | Ga0501047_0346872 | Ga0501047_0346872_338_598 | 85 |
| 723 | 3300049582 | Ga0501048_0318858 | Ga0501048_0318858_594_851 | 85 |
| 724 | 3300049582 | Ga0501048_0842866 | Ga0501048_0842866_380_640 | 85 |
| 725 | 3300049590 | Ga0501074_0725442 | Ga0501074_0725442_343_600 | 85 |
| 726 | 3300049665 | Ga0501227_197108 | Ga0501227_197108_294_554 | 85 |
| 727 | 3300049679 | Ga0501249_218062 | Ga0501249_218062_170_427 | 85 |
| 728 | 3300049682 | Ga0501252_002187 | Ga0501252_002187_355_612 | 85 |
| 729 | 3300049683 | Ga0501253_149420 | Ga0501253_149420_271_531 | 85 |
| 730 | 3300049686 | Ga0501257_041982 | Ga0501257_041982_725_982 | 85 |
| 731 | 3300049742 | Ga0501080_0171737 | Ga0501080_0171737_771_1028 | 85 |
| 732 | 3300049742 | Ga0501080_0423952 | Ga0501080_0423952_718_978 | 85 |
| 733 | 3300049760 | Ga0501263_005364 | Ga0501263_005364_156_416 | 85 |
| 734 | 3300049765 | Ga0501268_034714 | Ga0501268_034714_533_790 | 85 |
| 735 | 3300049770 | Ga0501273_033534 | Ga0501273_033534_70_330 | 85 |
| 736 | 3300049822 | Ga0501035_0095501 | Ga0501035_0095501_2164_2421 | 85 |
| 737 | 3300049822 | Ga0501035_0312400 | Ga0501035_0312400_986_1246 | 85 |
| 738 | 3300049823 | Ga0501044_0099572 | Ga0501044_0099572_2008_2265 | 85 |
| 739 | 3300050489 | nmdc:mga03683_101656_c1 | nmdc:mga03683_101656_c1_160_420 | 85 |
| 740 | 3300050489 | nmdc:mga03683_179165_c1 | nmdc:mga03683_179165_c1_528_785 | 85 |
| 741 | 3300050489 | nmdc:mga03683_319533_c1 | nmdc:mga03683_319533_c1_139_399 | 85 |
| 742 | 3300050489 | nmdc:mga03683_405020_c1 | nmdc:mga03683_405020_c1_251_508 | 85 |
| 743 | 3300050489 | nmdc:mga03683_415430_c1 | nmdc:mga03683_415430_c1_215_472 | 85 |
| 744 | 3300050489 | nmdc:mga03683_68090_c1 | nmdc:mga03683_68090_c1_716_973 | 85 |
| 745 | 3300050490 | nmdc:mga03n38_208653_c1 | nmdc:mga03n38_208653_c1_466_726 | 85 |
| 746 | 3300050490 | nmdc:mga03n38_34562_c1 | nmdc:mga03n38_34562_c1_1270_1530 | 85 |
| 747 | 3300050490 | nmdc:mga03n38_365470_c1 | nmdc:mga03n38_365470_c1_467_724 | 85 |
| 748 | 3300050491 | nmdc:mga00v17_749059_c1 | nmdc:mga00v17_749059_c1_210_467 | 85 |
| 749 | 3300050492 | nmdc:mga0yw44_101591_c1 | nmdc:mga0yw44_101591_c1_319_576 | 85 |
| 750 | 3300050492 | nmdc:mga0yw44_1030714_c1 | nmdc:mga0yw44_1030714_c1_208_465 | 85 |
| 751 | 3300050492 | nmdc:mga0yw44_260353_c1 | nmdc:mga0yw44_260353_c1_409_669 | 85 |
| 752 | 3300050492 | nmdc:mga0yw44_77764_c1 | nmdc:mga0yw44_77764_c1_1035_1298 | 85 |
| 753 | 3300050493 | nmdc:mga0k408_110974_c1 | nmdc:mga0k408_110974_c1_1182_1439 | 85 |
| 754 | 3300050493 | nmdc:mga0k408_147622_c1 | nmdc:mga0k408_147622_c1_785_1045 | 85 |
| 755 | 3300050493 | nmdc:mga0k408_212564_c1 | nmdc:mga0k408_212564_c1_398_655 | 85 |
| 756 | 3300050493 | nmdc:mga0k408_254_c1 | nmdc:mga0k408_254_c1_11790_12047 | 85 |
| 757 | 3300050493 | nmdc:mga0k408_276575_c1 | nmdc:mga0k408_276575_c1_542_799 | 85 |
| 758 | 3300050493 | nmdc:mga0k408_331477_c1 | nmdc:mga0k408_331477_c1_139_399 | 85 |
| 759 | 3300050493 | nmdc:mga0k408_33733_c1 | nmdc:mga0k408_33733_c1_1029_1289 | 85 |
| 760 | 3300050493 | nmdc:mga0k408_498388_c1 | nmdc:mga0k408_498388_c1_52_309 | 85 |
| 761 | 3300050493 | nmdc:mga0k408_53178_c1 | nmdc:mga0k408_53178_c1_1029_1289 | 85 |
| 762 | 3300050493 | nmdc:mga0k408_594239_c1 | nmdc:mga0k408_594239_c1_22_282 | 85 |
| 763 | 3300050493 | nmdc:mga0k408_62721_c1 | nmdc:mga0k408_62721_c1_802_1062 | 85 |
| 764 | 3300050493 | nmdc:mga0k408_786658_c1 | nmdc:mga0k408_786658_c1_277_534 | 85 |
| 765 | 3300050493 | nmdc:mga0k408_8413_c1 | nmdc:mga0k408_8413_c1_3617_3874 | 85 |
| 766 | 3300050494 | nmdc:mga06z11_287036_c1 | nmdc:mga06z11_287036_c1_447_704 | 85 |
| 767 | 3300050494 | nmdc:mga06z11_471682_c1 | nmdc:mga06z11_471682_c1_115_372 | 85 |
| 768 | 3300050494 | nmdc:mga06z11_59363_c1 | nmdc:mga06z11_59363_c1_15_275 | 85 |
| 769 | 3300050494 | nmdc:mga06z11_65821_c1 | nmdc:mga06z11_65821_c1_94_354 | 85 |
| 770 | 3300050494 | nmdc:mga06z11_996267_c1 | nmdc:mga06z11_996267_c1_40_297 | 85 |
| 771 | 3300050495 | nmdc:mga04h51_214891_c1 | nmdc:mga04h51_214891_c1_323_580 | 85 |
| 772 | 3300050496 | nmdc:mga07m45_10255_c1 | nmdc:mga07m45_10255_c1_2810_3070 | 85 |
| 773 | 3300050496 | nmdc:mga07m45_13149_c1 | nmdc:mga07m45_13149_c1_4092_4349 | 85 |
| 774 | 3300050496 | nmdc:mga07m45_219891_c1 | nmdc:mga07m45_219891_c1_57_314 | 85 |
| 775 | 3300050496 | nmdc:mga07m45_331718_c1 | nmdc:mga07m45_331718_c1_485_742 | 85 |
| 776 | 3300050496 | nmdc:mga07m45_6340_c1 | nmdc:mga07m45_6340_c1_412_672 | 85 |
| 777 | 3300050516 | nmdc:mga0sz30_15579_c2 | nmdc:mga0sz30_15579_c2_927_1187 | 85 |
| 778 | 3300053086 | Ga0500578_0001060 | Ga0500578_0001060_15347_15607 | 85 |
| 779 | 3300053087 | Ga0500643_031661 | Ga0500643_031661_108_368 | 85 |
| 780 | 3300053088 | Ga0500644_0075298 | Ga0500644_0075298_222_482 | 85 |
| 781 | 3300053090 | Ga0500646_0004955 | Ga0500646_0004955_1518_1778 | 85 |
| 782 | 3300053092 | Ga0500583_0098484 | Ga0500583_0098484_728_988 | 85 |
| 783 | 3300053093 | Ga0500651_0006266 | Ga0500651_0006266_5972_6232 | 85 |
| 784 | 3300053093 | Ga0500651_0162877 | Ga0500651_0162877_206_466 | 85 |
| 785 | 3300053093 | Ga0500651_0195684 | Ga0500651_0195684_552_812 | 85 |
| 786 | 3300053093 | Ga0500651_0499061 | Ga0500651_0499061_359_616 | 85 |
| 787 | 3300053098 | Ga0500650_0074562 | Ga0500650_0074562_267_527 | 85 |
| 788 | 3300053105 | Ga0500557_085454 | Ga0500557_085454_300_560 | 85 |
| 789 | 3300053108 | Ga0500562_060524 | Ga0500562_060524_69_329 | 85 |
| 790 | 3300053109 | Ga0500569_018717 | Ga0500569_018717_534_794 | 85 |
| 791 | 3300053117 | Ga0500593_000440 | Ga0500593_000440_10710_10970 | 85 |
| 792 | 3300053120 | Ga0500597_185142 | Ga0500597_185142_182_442 | 85 |
| 793 | 3300053129 | Ga0500628_003850 | Ga0500628_003850_1593_1853 | 85 |
| 794 | 3300053130 | Ga0500642_0000805 | Ga0500642_0000805_1557_1817 | 85 |
| 795 | 3300053131 | Ga0500652_000299 | Ga0500652_000299_12920_13180 | 85 |
| 796 | 3300053133 | Ga0500655_005214 | Ga0500655_005214_613_873 | 85 |
| 797 | 3300053134 | Ga0500658_0216462 | Ga0500658_0216462_191_451 | 85 |
| 798 | 3300053139 | Ga0500568_0018560 | Ga0500568_0018560_2370_2630 | 85 |
| 799 | 3300053139 | Ga0500568_0037009 | Ga0500568_0037009_1458_1745 | 85 |
| 800 | 3300053142 | Ga0500577_0002588 | Ga0500577_0002588_1149_1409 | 85 |
| 801 | 3300053143 | Ga0500579_168047 | Ga0500579_168047_234_494 | 85 |
| 802 | 3300053151 | Ga0500604_0056358 | Ga0500604_0056358_603_863 | 85 |
| 803 | 3300053151 | Ga0500604_0356510 | Ga0500604_0356510_75_362 | 85 |
| 804 | 3300053154 | Ga0500619_000127 | Ga0500619_000127_8062_8322 | 85 |
| 805 | 3300053156 | Ga0500622_0000125 | Ga0500622_0000125_15178_15438 | 85 |
| 806 | 3300053156 | Ga0500622_0025655 | Ga0500622_0025655_1863_2123 | 85 |
| 807 | 3300053158 | Ga0500627_0432634 | Ga0500627_0432634_219_476 | 85 |
| 808 | 3300053177 | Ga0500636_0368352 | Ga0500636_0368352_364_621 | 85 |
| 809 | 3300053724 | Ga0500570_032674 | Ga0500570_032674_65_325 | 85 |
| 810 | 3300053724 | Ga0500570_213015 | Ga0500570_213015_136_396 | 85 |
| 811 | 3300053730 | Ga0500645_110615 | Ga0500645_110615_115_375 | 85 |
| 812 | 3300053739 | Ga0500587_000581 | Ga0500587_000581_4221_4481 | 85 |
| 813 | 3300059421 | Ga0590071_012006 | Ga0590071_012006_701_958 | 85 |
| 814 | 3300059423 | Ga0590074_078125 | Ga0590074_078125_168_431 | 85 |
| 815 | 3300059424 | Ga0590075_125747 | Ga0590075_125747_328_585 | 85 |
| 816 | 3300059493 | Ga0587077_167875 | Ga0587077_167875_23_280 | 85 |
| 817 | 3300059503 | Ga0587080_157362 | Ga0587080_157362_156_413 | 85 |
| 818 | 3300059506 | Ga0587085_143891 | Ga0587085_143891_220_477 | 85 |
| 819 | 3300059508 | Ga0587088_080729 | Ga0587088_080729_407_670 | 85 |
| 820 | 3300059508 | Ga0587088_097564 | Ga0587088_097564_83_340 | 85 |
| 821 | 3300059511 | Ga0587091_094417 | Ga0587091_094417_418_681 | 85 |
| 822 | 3300059605 | Ga0587106_061154 | Ga0587106_061154_103_360 | 85 |
| 823 | 3300059623 | Ga0587101_060421 | Ga0587101_060421_38_295 | 85 |
| 824 | 3300059624 | Ga0587109_053532 | Ga0587109_053532_86_343 | 85 |
| 825 | 3300059624 | Ga0587109_218585 | Ga0587109_218585_234_491 | 85 |
| 826 | 3300059645 | Ga0587076_079566 | Ga0587076_079566_24_287 | 85 |
| 827 | 3300059648 | Ga0587100_043541 | Ga0587100_043541_218_475 | 85 |
| 828 | 3300060353 | Ga0501082_1017924 | Ga0501082_1017924_421_678 | 85 |
| 829 | 3300061719 | Ga0466962_0005233 | Ga0466962_0005233_4179_4442 | 85 |
| 830 | 3300061719 | Ga0466962_0014889 | Ga0466962_0014889_363_620 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.8583 | 22 | 85 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.854 | 22 | 85 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.8484 | 24 | 85 |
| 8c95-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.8398 | 22 | 85 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.8274 | 22 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9NDU6_129_252_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8428 | 22 | 85 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8274 | 22 | 85 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8065 | 29 | 83 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8033 | 22 | 85 | 2.40.50.100 |
| af_Q9Y3B2_6_56_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.7894 | 29 | 83 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5N5K3-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9057 | 29 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A5C8B9S1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9039 | 25 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A484PSD2-F1-model_v4 | LSU ribosomal protein L27p | 0.9012 | 25 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2D6RJT0-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.8978 | 31 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A455UVJ5-F1-model_v4 | deleted | 0.8946 | 24 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar