F482394

General Info

Members Datasets Scaffolds Average Seq Length
824 429 1648 120

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1172536|Ga0436363_1172536_735_1163
Length 142
Sequence MARVKRGVTTHARHKKVLEQAKGYVGRSSTNYRIALERLEKALRYAYRDRRQKKRDFRGLWIQRINAAVREHGITYSKFIGGLKRTGIELDRKVLAAIAYEEPAAFAAIVEQVKVVMSHHEGEDATVAQLNELTEHPAQIVT

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
90 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
168 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
229 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
230 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
231 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
232 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
235 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
355 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
356 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
365 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
368 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
369 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
370 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
373 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
374 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
378 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
379 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
382 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
383 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
386 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
387 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
388 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
421 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
422 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
423 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
424 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
425 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
426 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
427 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
428 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
429 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.83
Metatranscriptomes 10.07
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 1.7
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1172536 3300039450 Bacteria 1286
2 JGI25153J46596_10048541 3300003215 Bacteria 1239
3 rootH2_10084649 3300003320 Bacteria 1536
4 JGI25407J50210_10100853 3300003373 Bacteria 714
5 Ga0055542_1032123 3300003762 Bacteria 664
6 Ga0055529_1005692 3300003763 Bacteria 1781
7 Ga0065707_10529883 3300005295 Bacteria 735
8 Ga0065707_10694543 3300005295 Bacteria 642
9 Ga0070683_100734017 3300005329 Bacteria 946
10 Ga0070690_100519084 3300005330 Bacteria 894
11 Ga0070682_100375510 3300005337 Bacteria 1067
12 Ga0070660_100019804 3300005339 Bacteria 4936
13 Ga0070687_101317041 3300005343 Bacteria 537
14 Ga0070661_100815827 3300005344 Bacteria 766
15 Ga0070668_100633844 3300005347 Bacteria 938
16 Ga0070668_101536345 3300005347 Bacteria 609
17 Ga0070669_100019204 3300005353 Bacteria 4883
18 Ga0070675_100235090 3300005354 Bacteria 1600
19 Ga0070675_100342528 3300005354 Unclassified 1324
20 Ga0070671_100032613 3300005355 Bacteria 4305
21 Ga0070674_100045997 3300005356 Bacteria 2984
22 Ga0070673_101509844 3300005364 Bacteria 634
23 Ga0070667_100073717 3300005367 Bacteria 2911
24 Ga0070667_101431013 3300005367 Bacteria 648
25 Ga0070667_101904977 3300005367 Bacteria 560
26 Ga0070709_10045263 3300005434 Bacteria 2730
27 Ga0070709_10147261 3300005434 Bacteria 1623
28 Ga0070709_11789089 3300005434 Bacteria 502
29 Ga0070714_100018163 3300005435 Bacteria 5706
30 Ga0070714_100060633 3300005435 Bacteria 3247
31 Ga0070714_100665045 3300005435 Bacteria 1003
32 Ga0070713_100027158 3300005436 Bacteria 4503
33 Ga0070713_100171433 3300005436 Bacteria 1944
34 Ga0070713_100621305 3300005436 Bacteria 1028
35 Ga0070713_100816165 3300005436 Bacteria 895
36 Ga0070713_101599296 3300005436 Bacteria 633
37 Ga0070713_101748285 3300005436 Bacteria 604
38 Ga0070713_102466554 3300005436 Bacteria 502
39 Ga0070710_10109863 3300005437 Bacteria 1655
40 Ga0070701_10780407 3300005438 Bacteria 650
41 Ga0070711_100034702 3300005439 Bacteria 3366
42 Ga0070711_100274012 3300005439 Bacteria 1332
43 Ga0070711_100529858 3300005439 Bacteria 975
44 Ga0070705_100336340 3300005440 Bacteria 1096
45 Ga0070705_101078037 3300005440 Bacteria 656
46 Ga0070700_100121321 3300005441 Bacteria 1752
47 Ga0070708_100026636 3300005445 Bacteria 4951
48 Ga0070663_101346564 3300005455 Bacteria 631
49 Ga0070678_100034822 3300005456 Bacteria 3510
50 Ga0070681_10247951 3300005458 Bacteria 1694
51 Ga0070681_11100242 3300005458 Bacteria 716
52 Ga0068867_100793578 3300005459 Bacteria 844
53 Ga0068867_101749618 3300005459 Bacteria 584
54 Ga0070706_100015780 3300005467 Bacteria 6974
55 Ga0070706_100578738 3300005467 Bacteria 1044
56 Ga0070707_100006963 3300005468 Bacteria 10480
57 Ga0070707_100940494 3300005468 Bacteria 829
58 Ga0070707_101132356 3300005468 Bacteria 748
59 Ga0070698_100449258 3300005471 Bacteria 1224
60 Ga0070699_100054969 3300005518 Bacteria 3448
61 Ga0070699_100304552 3300005518 Bacteria 1430
62 Ga0070699_101580583 3300005518 Bacteria 601
63 Ga0070679_100440976 3300005530 Bacteria 1247
64 Ga0070679_101238461 3300005530 Bacteria 692
65 Ga0070684_100232170 3300005535 Bacteria 1685
66 Ga0070697_101516784 3300005536 Bacteria 599
67 Ga0070697_101657431 3300005536 Bacteria 572
68 Ga0070672_101630081 3300005543 Bacteria 579
69 Ga0070695_100544305 3300005545 Bacteria 904
70 Ga0070695_101687877 3300005545 Bacteria 530
71 Ga0070696_100190673 3300005546 Bacteria 1525
72 Ga0070665_100279649 3300005548 Bacteria 1671
73 Ga0070665_100532523 3300005548 Bacteria 1186
74 Ga0070665_100541007 3300005548 Bacteria 1177
75 Ga0068855_100219801 3300005563 Bacteria 2131
76 Ga0070664_100869329 3300005564 Bacteria 845
77 Ga0070664_101330305 3300005564 Bacteria 679
78 Ga0068856_100203499 3300005614 Bacteria 1994
79 Ga0068856_100475926 3300005614 Bacteria 1270
80 Ga0068856_101129810 3300005614 Bacteria 800
81 Ga0068852_100594612 3300005616 Bacteria 1110
82 Ga0068859_100282132 3300005617 Bacteria 1754
83 Ga0068864_100217683 3300005618 Bacteria 1761
84 Ga0068864_100751039 3300005618 Bacteria 956
85 Ga0068866_10031660 3300005718 Bacteria 2550
86 Ga0068863_100483428 3300005841 Bacteria 1218
87 Ga0068863_101960061 3300005841 Bacteria 596
88 Ga0068860_101241949 3300005843 Bacteria 766
89 Ga0068862_100016491 3300005844 Bacteria 6149
90 Ga0068862_100054170 3300005844 Bacteria 3435
91 Ga0081455_10069430 3300005937 Bacteria 2930
92 Ga0081455_10428047 3300005937 Bacteria 911
93 Ga0081538_10006607 3300005981 Bacteria 10169
94 Ga0081540_1126213 3300005983 Bacteria 1052
95 Ga0081540_1152538 3300005983 Bacteria 909
96 Ga0081540_1210303 3300005983 Bacteria 700
97 Ga0070717_10042502 3300006028 Bacteria 3707
98 Ga0070717_10095123 3300006028 Bacteria 2521
99 Ga0070717_10342238 3300006028 Bacteria 1336
100 Ga0070717_10989273 3300006028 Bacteria 766
101 Ga0070715_10764494 3300006163 Bacteria 583
102 Ga0070716_100049627 3300006173 Bacteria 2379
103 Ga0070716_101092380 3300006173 Bacteria 636
104 Ga0070716_101185921 3300006173 Bacteria 613
105 Ga0070712_100044274 3300006175 Bacteria 3068
106 Ga0070712_100060927 3300006175 Bacteria 2664
107 Ga0070712_100886571 3300006175 Bacteria 769
108 Ga0070712_101312699 3300006175 Bacteria 631
109 Ga0075362_10267291 3300006177 Bacteria 844
110 Ga0075362_10377295 3300006177 Bacteria 713
111 Ga0075369_10008204 3300006186 Bacteria 4010
112 Ga0075369_10237625 3300006186 Bacteria 845
113 Ga0075366_10128650 3300006195 Bacteria 1528
114 Ga0075366_10249882 3300006195 Bacteria 1082
115 Ga0075370_10214929 3300006353 Bacteria 1136
116 Ga0075370_10282571 3300006353 Bacteria 986
117 Ga0068871_100408671 3300006358 Bacteria 1210
118 Ga0068871_101648894 3300006358 Bacteria 608
119 Ga0075428_100341554 3300006844 Bacteria 1607
120 Ga0075430_100259435 3300006846 Bacteria 1439
121 Ga0075431_101521510 3300006847 Bacteria 627
122 Ga0075431_101536099 3300006847 Bacteria 624
123 Ga0075433_10734932 3300006852 Bacteria 864
124 Ga0075434_100821982 3300006871 Bacteria 945
125 Ga0075429_100796608 3300006880 Bacteria 827
126 Ga0068865_100123262 3300006881 Bacteria 1931
127 Ga0075436_100086444 3300006914 Bacteria 2177
128 Ga0075436_100369524 3300006914 Bacteria 1036
129 Ga0097620_100282113 3300006931 Bacteria 1754
130 Ga0075435_100342089 3300007076 Bacteria 1282
131 Ga0075435_100589487 3300007076 Bacteria 964
132 Ga0099795_10000803 3300007788 Bacteria 6202
133 Ga0099795_10495156 3300007788 Bacteria 569
134 Ga0105240_10485059 3300009093 Bacteria 1377
135 Ga0111539_10003803 3300009094 Bacteria 19856
136 Ga0111539_11642372 3300009094 Bacteria 745
137 Ga0105245_10064936 3300009098 Bacteria 3300
138 Ga0105245_10908256 3300009098 Bacteria 922
139 Ga0105247_10804857 3300009101 Bacteria 717
140 Ga0105247_11573037 3300009101 Bacteria 539
141 Ga0114129_10908263 3300009147 Bacteria 1115
142 Ga0114129_13101753 3300009147 Bacteria 543
143 Ga0105241_11327988 3300009174 Bacteria 686
144 Ga0105242_10468332 3300009176 Bacteria 1191
145 Ga0105242_11919263 3300009176 Bacteria 633
146 Ga0105248_10324678 3300009177 Bacteria 1734
147 Ga0105248_10327506 3300009177 Bacteria 1725
148 Ga0105248_11422592 3300009177 Bacteria 785
149 Ga0105237_11473394 3300009545 Bacteria 687
150 Ga0105237_12690082 3300009545 Bacteria 508
151 Ga0105238_10392358 3300009551 Bacteria 1380
152 Ga0105238_12408706 3300009551 Bacteria 562
153 Ga0105249_10037396 3300009553 Bacteria 4405
154 Ga0105035_108046 3300009988 Bacteria 896
155 Ga0105028_106479 3300009993 Bacteria 1222
156 Ga0099796_10025286 3300010159 Bacteria 1873
157 Ga0105239_10244989 3300010375 Bacteria 2012
158 Ga0105239_11146177 3300010375 Bacteria 895
159 Ga0105239_11203086 3300010375 Bacteria 873
160 Ga0105239_11604950 3300010375 Bacteria 752
161 Ga0105239_11689715 3300010375 Bacteria 733
162 Ga0105246_10096436 3300011119 Bacteria 2144
163 Ga0105246_10819585 3300011119 Bacteria 827
164 Ga0157373_10509888 3300013100 Bacteria 869
165 Ga0157370_10183926 3300013104 Bacteria 1941
166 Ga0157369_11435510 3300013105 Bacteria 702
167 Ga0157374_10388192 3300013296 Bacteria 1391
168 Ga0157374_10474522 3300013296 Bacteria 1254
169 Ga0157374_12845414 3300013296 Bacteria 511
170 Ga0157378_11210217 3300013297 Bacteria 795
171 Ga0157378_11218879 3300013297 Bacteria 792
172 Ga0163162_10706939 3300013306 Bacteria 1129
173 Ga0163162_13236133 3300013306 Bacteria 522
174 Ga0157375_11195325 3300013308 Bacteria 892
175 Ga0157375_11619401 3300013308 Bacteria 766
176 Ga0157375_12833046 3300013308 Bacteria 580
177 Ga0163163_10015068 3300014325 Bacteria 7132
178 Ga0163163_10226533 3300014325 Bacteria 1918
179 Ga0163163_10999107 3300014325 Bacteria 900
180 Ga0163163_13108434 3300014325 Bacteria 518
181 Ga0157380_10037752 3300014326 Bacteria 3745
182 Ga0157380_10259256 3300014326 Bacteria 1578
183 Ga0157380_11861616 3300014326 Bacteria 662
184 Ga0157380_13509407 3300014326 Bacteria 502
185 Ga0182008_10014674 3300014497 Bacteria 4096
186 Ga0182008_10296243 3300014497 Bacteria 845
187 Ga0157379_10591840 3300014968 Bacteria 1035
188 Ga0157379_11810498 3300014968 Bacteria 600
189 Ga0157376_10877136 3300014969 Bacteria 914
190 Ga0182007_10135177 3300015262 Bacteria 831
191 Ga0163161_10475397 3300017792 Bacteria 1014
192 Ga0163161_10711093 3300017792 Bacteria 837
193 Ga0197907_11285424 3300020069 Bacteria 702
194 Ga0206349_1228716 3300020075 Bacteria 572
195 Ga0213872_10048000 3300021361 Bacteria 1941
196 Ga0213872_10306093 3300021361 Bacteria 659
197 Ga0213874_10026987 3300021377 Bacteria 1631
198 Ga0213876_10006707 3300021384 Bacteria 6283
199 Ga0213876_10078863 3300021384 Bacteria 1740
200 Ga0213876_10257086 3300021384 Bacteria 928
201 Ga0213876_10631536 3300021384 Bacteria 570
202 Ga0213875_10003437 3300021388 Bacteria 9015
203 Ga0213875_10005028 3300021388 Bacteria 7167
204 Ga0213875_10007080 3300021388 Bacteria 5829
205 Ga0213875_10046529 3300021388 Bacteria 2035
206 Ga0213875_10108836 3300021388 Bacteria 1293
207 Ga0213875_10376840 3300021388 Bacteria 675
208 Ga0224712_10081686 3300022467 Bacteria 1335
209 Ga0224712_10259722 3300022467 Bacteria 804
210 Ga0224712_10286892 3300022467 Bacteria 767
211 Ga0224712_10335249 3300022467 Bacteria 713
212 Ga0224712_10375971 3300022467 Bacteria 674
213 Ga0209258_105392 3300025242 Bacteria 2180
214 Ga0209148_1009566 3300025254 Bacteria 1879
215 Ga0209455_1000225 3300025272 Bacteria 76514
216 Ga0209676_1013131 3300025292 Bacteria 3202
217 Ga0207426_1019958 3300025302 Bacteria 2336
218 Ga0209051_1018112 3300025303 Bacteria 3125
219 Ga0209257_1000418 3300025304 Bacteria 82230
220 Ga0207692_10156851 3300025898 Bacteria 1308
221 Ga0207692_10177133 3300025898 Bacteria 1240
222 Ga0207642_10018319 3300025899 Bacteria 2685
223 Ga0207680_10541902 3300025903 Bacteria 830
224 Ga0207699_10047885 3300025906 Bacteria 2508
225 Ga0207699_10182763 3300025906 Bacteria 1410
226 Ga0207705_10134644 3300025909 Bacteria 1841
227 Ga0207684_10019438 3300025910 Bacteria 5813
228 Ga0207707_10203394 3300025912 Bacteria 1726
229 Ga0207707_10774416 3300025912 Bacteria 801
230 Ga0207707_11249547 3300025912 Bacteria 599
231 Ga0207693_10047418 3300025915 Bacteria 3376
232 Ga0207693_10071832 3300025915 Bacteria 2709
233 Ga0207693_10588720 3300025915 Bacteria 866
234 Ga0207663_10034000 3300025916 Bacteria 3043
235 Ga0207663_10089585 3300025916 Bacteria 2037
236 Ga0207657_10039365 3300025919 Bacteria 4203
237 Ga0207652_10458892 3300025921 Bacteria 1148
238 Ga0207652_10972781 3300025921 Bacteria 747
239 Ga0207646_10007590 3300025922 Bacteria 10989
240 Ga0207646_11570618 3300025922 Bacteria 568
241 Ga0207646_11824200 3300025922 Bacteria 520
242 Ga0207681_10014928 3300025923 Bacteria 4838
243 Ga0207687_10048204 3300025927 Bacteria 2956
244 Ga0207700_10043368 3300025928 Bacteria 3303
245 Ga0207700_10080960 3300025928 Bacteria 2534
246 Ga0207700_10955032 3300025928 Bacteria 767
247 Ga0207700_11490923 3300025928 Bacteria 600
248 Ga0207664_10065453 3300025929 Bacteria 2910
249 Ga0207664_11185994 3300025929 Bacteria 681
250 Ga0207644_10060209 3300025931 Bacteria 2747
251 Ga0207644_10527572 3300025931 Bacteria 976
252 Ga0207686_10835432 3300025934 Bacteria 740
253 Ga0207669_10292790 3300025937 Bacteria 1233
254 Ga0207704_10237925 3300025938 Bacteria 1358
255 Ga0207665_10026807 3300025939 Bacteria 3806
256 Ga0207665_10083040 3300025939 Bacteria 2209
257 Ga0207665_10246526 3300025939 Bacteria 1318
258 Ga0207711_10503298 3300025941 Bacteria 1129
259 Ga0207661_10991085 3300025944 Bacteria 774
260 Ga0207679_11814986 3300025945 Bacteria 557
261 Ga0207667_10376680 3300025949 Bacteria 1446
262 Ga0207651_11195819 3300025960 Bacteria 682
263 Ga0207712_10122040 3300025961 Bacteria 1973
264 Ga0207658_10194173 3300025986 Bacteria 1690
265 Ga0207677_11618997 3300026023 Bacteria 600
266 Ga0207639_10162182 3300026041 Bacteria 1885
267 Ga0207678_10982870 3300026067 Bacteria 747
268 Ga0207678_11296227 3300026067 Bacteria 644
269 Ga0207708_10134792 3300026075 Bacteria 1933
270 Ga0207708_10840548 3300026075 Bacteria 792
271 Ga0207702_10026622 3300026078 Bacteria 4801
272 Ga0207702_10089326 3300026078 Bacteria 2694
273 Ga0207702_10190629 3300026078 Bacteria 1894
274 Ga0207702_10452085 3300026078 Bacteria 1246
275 Ga0207702_10752497 3300026078 Bacteria 962
276 Ga0207702_12341657 3300026078 Bacteria 522
277 Ga0207641_10639871 3300026088 Bacteria 1044
278 Ga0207648_10925085 3300026089 Bacteria 815
279 Ga0207676_11022433 3300026095 Bacteria 815
280 Ga0207675_100006475 3300026118 Bacteria 11082
281 Ga0207683_10174477 3300026121 Bacteria 1948
282 Ga0207683_10218865 3300026121 Bacteria 1735
283 Ga0207698_10614494 3300026142 Bacteria 1073
284 Ga0207698_11253984 3300026142 Bacteria 756
285 Ga0209179_1003760 3300027512 Bacteria 2222
286 Ga0207428_10000053 3300027907 Bacteria 175238
287 Ga0268266_10458405 3300028379 Bacteria 1213
288 Ga0268266_10501314 3300028379 Bacteria 1159
289 Ga0268266_10996606 3300028379 Bacteria 811
290 Ga0268265_10003331 3300028380 Bacteria 11621
291 Ga0268265_10040950 3300028380 Bacteria 3424
292 Ga0265318_10031391 3300028577 Bacteria 2060
293 Ga0307517_10250422 3300028786 Bacteria 1040
294 Ga0307512_10144489 3300030522 Bacteria 1444
295 Ga0265766_1012132 3300030863 Bacteria 634
296 Ga0265332_10332329 3300031238 Bacteria 627
297 Ga0265320_10234008 3300031240 Bacteria 816
298 Ga0265331_10010519 3300031250 Bacteria 5117
299 Ga0265327_10022748 3300031251 Bacteria 3735
300 Ga0265327_10273164 3300031251 Bacteria 748
301 Ga0265316_10229326 3300031344 Bacteria 1368
302 Ga0307513_10011397 3300031456 Bacteria 11053
303 Ga0307513_10030928 3300031456 Bacteria 6071
304 Ga0307513_10331707 3300031456 Bacteria 1275
305 Ga0307408_100692684 3300031548 Bacteria 915
306 Ga0307408_100714472 3300031548 Bacteria 902
307 Ga0265313_10017033 3300031595 Bacteria 4150
308 Ga0265313_10277116 3300031595 Bacteria 678
309 Ga0307508_10203929 3300031616 Bacteria 1578
310 Ga0307508_10340192 3300031616 Bacteria 1092
311 Ga0307508_10435681 3300031616 Bacteria 903
312 Ga0316575_10249612 3300031665 Bacteria 744
313 Ga0265314_10006902 3300031711 Bacteria 9946
314 Ga0265314_10029014 3300031711 Unclassified 4117
315 Ga0307516_10413440 3300031730 Bacteria 1007
316 Ga0307516_10669122 3300031730 Bacteria 694
317 Ga0307413_10046659 3300031824 Bacteria 2578
318 Ga0307410_10014266 3300031852 Bacteria 4670
319 Ga0307410_10448709 3300031852 Bacteria 1052
320 Ga0307406_10816737 3300031901 Bacteria 788
321 Ga0307407_10231447 3300031903 Bacteria 1255
322 Ga0307412_10502348 3300031911 Bacteria 1010
323 Ga0307412_11160376 3300031911 Bacteria 690
324 Ga0307409_100084994 3300031995 Bacteria 2571
325 Ga0307416_100810765 3300032002 Bacteria 1032
326 Ga0307416_100940661 3300032002 Bacteria 966
327 Ga0307411_10005095 3300032005 Bacteria 6407
328 Ga0307415_100543113 3300032126 Bacteria 1024
329 Ga0307507_10319895 3300033179 Bacteria 935
330 Ga0307510_10387057 3300033180 Bacteria 843
331 Ga0373926_0041884 3300035083 Bacteria 1637
332 Ga0373926_0048800 3300035083 Bacteria 1523
333 Ga0373928_0012132 3300035084 Bacteria 1715
334 Ga0373934_0040650 3300035086 Bacteria 1835
335 Ga0373934_0113052 3300035086 Bacteria 1102
336 Ga0373934_0114513 3300035086 Bacteria 1095
337 Ga0373944_0066037 3300035089 Bacteria 1169
338 Ga0373944_0103556 3300035089 Bacteria 964
339 Ga0373944_0188343 3300035089 Bacteria 742
340 Ga0373949_0045409 3300035090 Bacteria 1092
341 Ga0373923_0019540 3300035111 Bacteria 2624
342 Ga0373923_0427864 3300035111 Bacteria 640
343 Ga0373932_0446280 3300035112 Bacteria 507
344 Ga0373936_0148156 3300035113 Bacteria 1016
345 Ga0373936_0452550 3300035113 Bacteria 594
346 Ga0373936_0457810 3300035113 Bacteria 590
347 Ga0373941_0265586 3300035115 Bacteria 674
348 Ga0373945_0548460 3300035116 Bacteria 519
349 Ga0373953_0124537 3300035117 Bacteria 1096
350 Ga0373956_0090446 3300035119 Bacteria 1412
351 Ga0373956_0193336 3300035119 Bacteria 964
352 Ga0373956_0626654 3300035119 Bacteria 513
353 Ga0373960_0163900 3300035121 Bacteria 767
354 Ga0373943_0024959 3300035170 Bacteria 2791
355 Ga0373943_0072968 3300035170 Bacteria 1742
356 Ga0373943_0150976 3300035170 Bacteria 1259
357 Ga0373943_0329416 3300035170 Bacteria 872
358 Ga0373943_0656291 3300035170 Bacteria 620
359 Ga0373946_0285749 3300035171 Bacteria 812
360 Ga0373946_0748392 3300035171 Bacteria 513
361 Ga0373955_0091080 3300035172 Bacteria 1738
362 Ga0373955_0688334 3300035172 Bacteria 627
363 Ga0373961_0097912 3300035241 Bacteria 946
364 Ga0373924_0148689 3300035410 Bacteria 1024
365 Ga0373924_0177433 3300035410 Bacteria 937
366 Ga0373931_0223938 3300035691 Bacteria 1134
367 Ga0373931_0926401 3300035691 Bacteria 587
368 Ga0373935_0037551 3300035692 Bacteria 3032
369 Ga0373935_0055364 3300035692 Bacteria 2527
370 Ga0373935_0130502 3300035692 Bacteria 1688
371 Ga0373935_0189961 3300035692 Bacteria 1414
372 Ga0373927_0358260 3300035695 Bacteria 961
373 Ga0373927_0855059 3300035695 Bacteria 601
374 Ga0373933_0038954 3300035724 Bacteria 2795
375 Ga0373933_0052453 3300035724 Bacteria 2441
376 Ga0373933_0102790 3300035724 Bacteria 1774
377 Ga0373947_0085242 3300035725 Bacteria 1962
378 Ga0373947_0133015 3300035725 Bacteria 1589
379 Ga0373947_0363468 3300035725 Bacteria 972
380 Ga0373937_0004132 3300036401 Bacteria 12314
381 Ga0373937_0043397 3300036401 Bacteria 4105
382 Ga0373937_0068945 3300036401 Bacteria 3260
383 Ga0373937_0285954 3300036401 Bacteria 1558
384 Ga0373937_0533026 3300036401 Bacteria 1115
385 Ga0373937_0943489 3300036401 Bacteria 811
386 Ga0373937_1128736 3300036401 Bacteria 732
387 Ga0265778_029150 3300036457 Bacteria 709
388 Ga0373925_0019399 3300037068 Bacteria 4945
389 Ga0373925_0049816 3300037068 Bacteria 3123
390 Ga0395899_0005089 3300037312 Bacteria 10233
391 Ga0395899_0007355 3300037312 Bacteria 8517
392 Ga0395900_0001400 3300037418 Bacteria 28853
393 Ga0395900_0018475 3300037418 Bacteria 7110
394 Ga0395900_1035247 3300037418 Bacteria 740
395 Ga0395898_0000900 3300037466 Bacteria 47837
396 Ga0395898_0605545 3300037466 Bacteria 1038
397 Ga0395905_0067084 3300037471 Bacteria 3360
398 Ga0395905_0276935 3300037471 Bacteria 1564
399 Ga0395905_0574467 3300037471 Bacteria 1029
400 Ga0436364_0036184 3300037853 Bacteria 1186
401 Ga0436364_0111974 3300037853 Bacteria 2540
402 Ga0436364_0113231 3300037853 Bacteria 2434
403 Ga0436364_0215514 3300037853 Bacteria 533
404 Ga0436364_0411459 3300037853 Bacteria 10009
405 Ga0436364_0477303 3300037853 Bacteria 13445
406 Ga0436364_0672710 3300037853 Bacteria 2037
407 Ga0436364_0885115 3300037853 Bacteria 2128
408 Ga0436364_1081267 3300037853 Bacteria 917
409 Ga0436364_1098413 3300037853 Bacteria 5173
410 Ga0436364_1309888 3300037853 Bacteria 7461
411 Ga0395901_0056651 3300038443 Bacteria 4078
412 Ga0395901_0853428 3300038443 Bacteria 896
413 Ga0436365_0467011 3300039437 Bacteria 988
414 Ga0436365_0903003 3300039437 Bacteria 2538
415 Ga0436365_1129065 3300039437 Bacteria 5253
416 Ga0436365_1147776 3300039437 Bacteria 8467
417 Ga0436365_1208761 3300039437 Bacteria 1010
418 Ga0436365_1232053 3300039437 Bacteria 828
419 Ga0436365_1314286 3300039437 Bacteria 917
420 Ga0436365_1610296 3300039437 Bacteria 6219
421 Ga0436365_1633210 3300039437 Bacteria 796
422 Ga0436365_1888295 3300039437 Bacteria 2061
423 Ga0436360_0374512 3300039438 Bacteria 724
424 Ga0436360_0716050 3300039438 Bacteria 766
425 Ga0436360_1248709 3300039438 Bacteria 1457
426 Ga0436361_0312844 3300039447 Bacteria 1729
427 Ga0436361_0432672 3300039447 Bacteria 770
428 Ga0436361_0700345 3300039447 Bacteria 4383
429 Ga0436363_0125784 3300039450 Bacteria 539
430 Ga0436363_0237499 3300039450 Bacteria 510
431 Ga0436363_0461717 3300039450 Bacteria 631
432 Ga0436363_0492694 3300039450 Bacteria 4775
433 Ga0436363_0721779 3300039450 Bacteria 1033
434 Ga0436363_1167688 3300039450 Bacteria 588
435 Ga0436363_1275384 3300039450 Bacteria 775
436 Ga0436363_1319859 3300039450 Bacteria 658
437 Ga0436363_1343244 3300039450 Bacteria 523
438 Ga0436362_0315033 3300039453 Bacteria 1287
439 Ga0436362_0353673 3300039453 Unclassified 926
440 Ga0436362_0906723 3300039453 Bacteria 837
441 Ga0439436_0103227 3300041404 Bacteria 795
442 Ga0451789_0949761 3300041443 Bacteria 923
443 Ga0451798_0574671 3300041458 Bacteria 608
444 Ga0451847_0771257 3300041503 Bacteria 852
445 Ga0451851_0172888 3300041507 Bacteria 850
446 Ga0451853_0589475 3300041512 Bacteria 759
447 Ga0439437_048427 3300042000 Bacteria 561
448 Ga0439441_014360 3300042001 Bacteria 1388
449 Ga0439434_0170936 3300042435 Bacteria 725
450 Ga0466972_0196919 3300044658 Bacteria 944
451 Ga0466963_0441152 3300044694 Bacteria 918
452 Ga0466963_0443599 3300044694 Bacteria 916
453 Ga0466963_1068187 3300044694 Bacteria 568
454 Ga0453684_0021431 3300044712 Bacteria 9655
455 Ga0466968_0581988 3300044735 Bacteria 564
456 Ga0466957_0888659 3300044842 Bacteria 636
457 Ga0466959_1051046 3300045049 Bacteria 542
458 Ga0451576_0350215 3300045051 Bacteria 1546
459 Ga0466967_0287263 3300045976 Bacteria 1579
460 Ga0466967_1145058 3300045976 Bacteria 775
461 Ga0466967_1449856 3300045976 Bacteria 684
462 Ga0466967_1834762 3300045976 Bacteria 603
463 Ga0495592_0103194 3300046454 Bacteria 2029
464 Ga0495638_0208818 3300046460 Bacteria 1098
465 Ga0495638_0258261 3300046460 Bacteria 957
466 Ga0495638_0406070 3300046460 Bacteria 706
467 Ga0495651_0015987 3300046462 Bacteria 5813
468 Ga0495651_0450842 3300046462 Bacteria 831
469 Ga0495653_0142116 3300046463 Bacteria 1687
470 Ga0495653_0301793 3300046463 Bacteria 1044
471 Ga0495653_0502247 3300046463 Bacteria 756
472 Ga0495650_0131912 3300046471 Bacteria 911
473 Ga0495650_0204465 3300046471 Bacteria 685
474 Ga0495580_0086028 3300046472 Bacteria 2189
475 Ga0495664_0007401 3300046477 Bacteria 6097
476 Ga0495664_0530502 3300046477 Bacteria 702
477 Ga0495594_0890618 3300046499 Bacteria 500
478 Ga0495608_0035794 3300046511 Bacteria 3346
479 Ga0495608_0164087 3300046511 Bacteria 1411
480 Ga0495608_0558150 3300046511 Bacteria 690
481 Ga0495616_0356645 3300046513 Bacteria 608
482 Ga0495618_0757864 3300046514 Bacteria 567
483 Ga0495628_0032249 3300046516 Bacteria 4231
484 Ga0495628_0218403 3300046516 Bacteria 1432
485 Ga0495628_0437910 3300046516 Bacteria 951
486 Ga0495628_0863169 3300046516 Bacteria 630
487 Ga0495630_0183191 3300046517 Bacteria 1597
488 Ga0495630_1376971 3300046517 Bacteria 531
489 Ga0495632_0270586 3300046519 Bacteria 758
490 Ga0495666_0164282 3300046526 Bacteria 1029
491 Ga0495652_0175705 3300046529 Bacteria 1649
492 Ga0495652_0548336 3300046529 Bacteria 795
493 Ga0495654_0160837 3300046530 Bacteria 986
494 Ga0495665_0065246 3300046531 Bacteria 1922
495 Ga0495640_0071080 3300046533 Bacteria 2336
496 Ga0495586_0031962 3300046535 Bacteria 2822
497 Ga0495586_0106039 3300046535 Bacteria 1563
498 Ga0495586_0198906 3300046535 Bacteria 1136
499 Ga0495587_0092548 3300046536 Bacteria 1746
500 Ga0495587_0107762 3300046536 Bacteria 1602
501 Ga0495587_0157509 3300046536 Bacteria 1293
502 Ga0495587_0533868 3300046536 Bacteria 648
503 Ga0495621_0511443 3300046539 Bacteria 519
504 Ga0495645_0001048 3300046543 Bacteria 18835
505 Ga0495645_0094561 3300046543 Bacteria 2132
506 Ga0495645_0382056 3300046543 Bacteria 901
507 Ga0495667_0060660 3300046559 Bacteria 2480
508 Ga0495667_0066954 3300046559 Bacteria 2347
509 Ga0495667_0112423 3300046559 Bacteria 1760
510 Ga0495634_0339840 3300046642 Bacteria 901
511 Ga0495625_0291943 3300046660 Bacteria 1046
512 Ga0495635_0037350 3300046663 Bacteria 3363
513 Ga0495635_0102720 3300046663 Bacteria 1953
514 Ga0495635_0308530 3300046663 Bacteria 1060
515 Ga0495657_0032830 3300046675 Bacteria 3619
516 Ga0495657_0095624 3300046675 Bacteria 1899
517 Ga0495599_0018777 3300046678 Bacteria 4310
518 Ga0495599_0341109 3300046678 Bacteria 899
519 Ga0495646_0163046 3300046680 Bacteria 1233
520 Ga0495646_0199190 3300046680 Bacteria 1091
521 Ga0495646_0646767 3300046680 Bacteria 535
522 Ga0495658_0593598 3300046683 Bacteria 709
523 Ga0495658_0883977 3300046683 Bacteria 571
524 Ga0495649_0202213 3300046694 Bacteria 1031
525 Ga0495600_0055602 3300046809 Bacteria 2585
526 Ga0495600_0095128 3300046809 Bacteria 1942
527 Ga0495600_0358027 3300046809 Bacteria 913
528 Ga0495604_0020602 3300047317 Bacteria 5267
529 Ga0495674_0304641 3300047319 Bacteria 1301
530 Ga0495674_0599689 3300047319 Bacteria 873
531 Ga0495674_0670755 3300047319 Bacteria 816
532 Ga0495674_1199658 3300047319 Bacteria 574
533 Ga0495680_0019357 3300047322 Bacteria 5748
534 Ga0495680_0099966 3300047322 Bacteria 2162
535 Ga0495680_0157745 3300047322 Bacteria 1650
536 Ga0495680_0624315 3300047322 Bacteria 719
537 Ga0495675_0068351 3300047444 Bacteria 2244
538 Ga0495675_0516014 3300047444 Bacteria 685
539 Ga0495684_0239279 3300047471 Bacteria 1325
540 Ga0495684_0245718 3300047471 Bacteria 1304
541 Ga0495686_0130629 3300047472 Bacteria 1489
542 Ga0495593_0214911 3300047673 Bacteria 965
543 Ga0495602_0307176 3300048088 Bacteria 1159
544 Ga0495602_0908974 3300048088 Bacteria 585
545 Ga0496104_0322468 3300048907 Bacteria 1458
546 Ga0496104_1065118 3300048907 Bacteria 712
547 Ga0496105_0838251 3300048908 Bacteria 697
548 Ga0496107_0541015 3300048910 Bacteria 863
549 Ga0496108_0736049 3300048911 Bacteria 854
550 Ga0496108_1182249 3300048911 Bacteria 647
551 Ga0496109_0685978 3300048912 Bacteria 962
552 Ga0496110_0722519 3300048913 Bacteria 898
553 Ga0496112_0028084 3300048915 Bacteria 5428
554 Ga0496112_1124027 3300048915 Bacteria 703
555 Ga0496113_0313828 3300048916 Bacteria 1256
556 Ga0496115_1397876 3300048918 Bacteria 517
557 Ga0496119_0028935 3300048922 Bacteria 3769
558 Ga0496120_0065313 3300048923 Bacteria 2017
559 Ga0496121_0604692 3300048924 Bacteria 676
560 Ga0496122_0093714 3300048925 Bacteria 2036
561 Ga0496126_1042070 3300048929 Bacteria 611
562 Ga0501306_036639 3300049127 Bacteria 748
563 Ga0501308_017191 3300049128 Bacteria 873
564 Ga0501304_025981 3300049160 Bacteria 602
565 Ga0501305_026035 3300049161 Bacteria 890
566 Ga0501307_018192 3300049162 Bacteria 891
567 Ga0501312_030161 3300049528 Bacteria 847
568 Ga0501317_067791 3300049533 Bacteria 597
569 Ga0501320_018397 3300049536 Bacteria 789
570 Ga0501321_051496 3300049537 Bacteria 603
571 Ga0501330_008281 3300049546 Bacteria 711
572 Ga0501031_0000746 3300049568 Bacteria 19554
573 Ga0501031_0487647 3300049568 Bacteria 795
574 Ga0501031_0520995 3300049568 Bacteria 766
575 Ga0501031_0742931 3300049568 Bacteria 629
576 Ga0501032_0038762 3300049569 Bacteria 3243
577 Ga0501032_0231684 3300049569 Bacteria 1201
578 Ga0501032_0864718 3300049569 Bacteria 570
579 Ga0501033_0001088 3300049570 Bacteria 24589
580 Ga0501033_0191591 3300049570 Bacteria 1463
581 Ga0501033_0249090 3300049570 Bacteria 1259
582 Ga0501033_0371443 3300049570 Bacteria 1000
583 Ga0501033_0406435 3300049570 Bacteria 949
584 Ga0501034_0079145 3300049571 Bacteria 3290
585 Ga0501034_0634452 3300049571 Bacteria 971
586 Ga0501034_1038391 3300049571 Bacteria 702
587 Ga0501036_0009451 3300049572 Bacteria 8020
588 Ga0501036_0027538 3300049572 Bacteria 4802
589 Ga0501036_0287002 3300049572 Bacteria 1377
590 Ga0501036_0657439 3300049572 Bacteria 867
591 Ga0501037_0012673 3300049573 Bacteria 6213
592 Ga0501037_0021183 3300049573 Bacteria 4803
593 Ga0501037_0026225 3300049573 Bacteria 4306
594 Ga0501037_0631153 3300049573 Bacteria 717
595 Ga0501037_0682819 3300049573 Bacteria 684
596 Ga0501038_0036006 3300049574 Bacteria 4343
597 Ga0501038_0049072 3300049574 Bacteria 3650
598 Ga0501038_0113361 3300049574 Bacteria 2244
599 Ga0501038_0494069 3300049574 Bacteria 936
600 Ga0501038_0813965 3300049574 Bacteria 693
601 Ga0501038_0928379 3300049574 Bacteria 641
602 Ga0501038_1111254 3300049574 Bacteria 577
603 Ga0501039_0006574 3300049575 Bacteria 8827
604 Ga0501039_0122261 3300049575 Bacteria 2041
605 Ga0501039_0228384 3300049575 Bacteria 1463
606 Ga0501043_0021304 3300049579 Bacteria 5081
607 Ga0501043_0074121 3300049579 Bacteria 2673
608 Ga0501043_0467805 3300049579 Bacteria 945
609 Ga0501043_0571431 3300049579 Bacteria 838
610 Ga0501046_0017076 3300049580 Bacteria 6065
611 Ga0501046_0043408 3300049580 Bacteria 3580
612 Ga0501047_0018894 3300049581 Bacteria 6609
613 Ga0501047_0027283 3300049581 Bacteria 5501
614 Ga0501047_0079627 3300049581 Bacteria 3150
615 Ga0501047_0086631 3300049581 Bacteria 3009
616 Ga0501047_0475779 3300049581 Bacteria 1077
617 Ga0501047_0750137 3300049581 Bacteria 792
618 Ga0501048_0014974 3300049582 Bacteria 5735
619 Ga0501048_0831719 3300049582 Bacteria 664
620 Ga0501067_0029448 3300049583 Bacteria 3043
621 Ga0501067_0074591 3300049583 Bacteria 1880
622 Ga0501067_0140492 3300049583 Bacteria 1345
623 Ga0501067_0179860 3300049583 Bacteria 1178
624 Ga0501067_0663957 3300049583 Bacteria 585
625 Ga0501068_0198978 3300049584 Bacteria 1270
626 Ga0501068_1123870 3300049584 Bacteria 520
627 Ga0501069_0007311 3300049585 Bacteria 5794
628 Ga0501069_0308996 3300049585 Bacteria 928
629 Ga0501070_0002774 3300049586 Bacteria 15285
630 Ga0501070_0104191 3300049586 Bacteria 2346
631 Ga0501070_0189245 3300049586 Bacteria 1692
632 Ga0501070_0205040 3300049586 Bacteria 1619
633 Ga0501070_0253791 3300049586 Bacteria 1438
634 Ga0501070_0741632 3300049586 Bacteria 774
635 Ga0501070_1002957 3300049586 Bacteria 647
636 Ga0501071_0764430 3300049587 Bacteria 745
637 Ga0501071_0918175 3300049587 Bacteria 676
638 Ga0501072_1396897 3300049588 Bacteria 542
639 Ga0501073_0010974 3300049589 Bacteria 6627
640 Ga0501073_0069939 3300049589 Bacteria 2445
641 Ga0501073_0101137 3300049589 Bacteria 2001
642 Ga0501073_0288078 3300049589 Bacteria 1133
643 Ga0501073_0972516 3300049589 Bacteria 584
644 Ga0501074_0004909 3300049590 Bacteria 9586
645 Ga0501074_0206129 3300049590 Bacteria 1401
646 Ga0501074_0908769 3300049590 Bacteria 620
647 Ga0501076_0610968 3300049592 Bacteria 900
648 Ga0501076_1516660 3300049592 Bacteria 550
649 Ga0501077_0588232 3300049593 Bacteria 715
650 Ga0501079_0033209 3300049741 Bacteria 3969
651 Ga0501079_0877830 3300049741 Bacteria 706
652 Ga0501080_0057283 3300049742 Bacteria 3628
653 Ga0501080_0064237 3300049742 Bacteria 3415
654 Ga0501080_0078558 3300049742 Bacteria 3069
655 Ga0501080_0089615 3300049742 Bacteria 2857
656 Ga0501080_0251245 3300049742 Bacteria 1612
657 Ga0501080_1164738 3300049742 Bacteria 664
658 Ga0501081_0743548 3300049743 Bacteria 737
659 Ga0501083_0012062 3300049744 Bacteria 6051
660 Ga0501083_0014527 3300049744 Bacteria 5506
661 Ga0501083_0029520 3300049744 Bacteria 3770
662 Ga0501083_0059514 3300049744 Bacteria 2555
663 Ga0501083_0598309 3300049744 Bacteria 717
664 Ga0501035_0001712 3300049822 Bacteria 22167
665 Ga0501035_0040360 3300049822 Bacteria 4218
666 Ga0501044_0004509 3300049823 Bacteria 15571
667 Ga0501044_0010946 3300049823 Bacteria 9846
668 Ga0501044_0022918 3300049823 Bacteria 6649
669 Ga0501044_0183493 3300049823 Bacteria 2058
670 Ga0501044_1260952 3300049823 Bacteria 606
671 Ga0501044_1315779 3300049823 Bacteria 589
672 Ga0501044_1408738 3300049823 Bacteria 562
673 nmdc:mga03683_64894_c1 3300050489 Bacteria 1550
674 nmdc:mga0k408_182502_c1 3300050493 Bacteria 1252
675 nmdc:mga0k408_305274_c1 3300050493 Bacteria 950
676 nmdc:mga0k408_324352_c1 3300050493 Bacteria 919
677 nmdc:mga07m45_423858_c1 3300050496 Bacteria 772
678 nmdc:mga07m45_721526_c1 3300050496 Bacteria 573
679 nmdc:mga05p37_812908_c1 3300050507 Bacteria 1021
680 nmdc:mga09592_403757_c1 3300050508 Bacteria 1181
681 nmdc:mga0qj67_187086_c1 3300050509 Bacteria 1682
682 nmdc:mga06r32_469783_c1 3300050510 Unclassified 1236
683 nmdc:mga08y16_1094295_c1 3300050511 Bacteria 772
684 nmdc:mga08y16_1266855_c1 3300050511 Bacteria 705
685 nmdc:mga08y16_30_c1 3300050511 Bacteria 197110
686 nmdc:mga0rr50_1435071_c1 3300050513 Bacteria 584
687 nmdc:mga0rr50_334987_c1 3300050513 Bacteria 1271
688 nmdc:mga0rr50_926424_c1 3300050513 Bacteria 743
689 nmdc:mga08x19_1090557_c1 3300050514 Bacteria 567
690 nmdc:mga08x19_22108_c1 3300050514 Bacteria 3935
691 nmdc:mga08x19_372470_c1 3300050514 Bacteria 999
692 nmdc:mga08x19_869682_c1 3300050514 Bacteria 640
693 nmdc:mga0a205_469293_c1 3300050515 Bacteria 1117
694 Ga0495601_0017391 3300053077 Bacteria 4363
695 Ga0495601_0175711 3300053077 Bacteria 1400
696 Ga0495601_0430126 3300053077 Bacteria 854
697 Ga0495612_0001439 3300053078 Bacteria 9789
698 Ga0500635_0110166 3300053080 Bacteria 1022
699 Ga0495595_0006518 3300053084 Bacteria 4761
700 Ga0495595_0290741 3300053084 Bacteria 821
701 Ga0495619_0012325 3300053085 Bacteria 5381
702 Ga0495619_0022600 3300053085 Bacteria 4027
703 Ga0500578_0071339 3300053086 Bacteria 2214
704 Ga0500643_029329 3300053087 Bacteria 1693
705 Ga0500644_0241859 3300053088 Bacteria 758
706 Ga0500646_0020601 3300053090 Bacteria 1752
707 Ga0500651_0221104 3300053093 Bacteria 1110
708 Ga0500566_0097934 3300053094 Bacteria 1612
709 Ga0500566_0310063 3300053094 Bacteria 739
710 Ga0500641_0021232 3300053096 Bacteria 2472
711 Ga0500650_0518953 3300053098 Bacteria 505
712 Ga0500654_192900 3300053099 Bacteria 628
713 Ga0500562_076417 3300053108 Bacteria 905
714 Ga0500569_212279 3300053109 Bacteria 658
715 Ga0500592_043072 3300053116 Bacteria 731
716 Ga0500595_000373 3300053119 Bacteria 28891
717 Ga0500595_037370 3300053119 Bacteria 1584
718 Ga0500597_108159 3300053120 Bacteria 1208
719 Ga0500628_117338 3300053129 Bacteria 719
720 Ga0500642_0067165 3300053130 Bacteria 1624
721 Ga0500642_0074337 3300053130 Bacteria 1550
722 Ga0500658_0001902 3300053134 Bacteria 8191
723 Ga0500658_0137050 3300053134 Bacteria 1095
724 Ga0500559_0006760 3300053136 Bacteria 5148
725 Ga0500577_0006212 3300053142 Bacteria 3278
726 Ga0500577_0136330 3300053142 Bacteria 1032
727 Ga0500588_0008130 3300053146 Bacteria 2440
728 Ga0500588_0063235 3300053146 Bacteria 1192
729 Ga0500589_231312 3300053147 Bacteria 690
730 Ga0500616_0002311 3300053153 Bacteria 16127
731 Ga0500616_0158193 3300053153 Bacteria 1041
732 Ga0500622_0228975 3300053156 Bacteria 829
733 Ga0500633_0034246 3300053160 Bacteria 1664
734 Ga0500634_0196142 3300053161 Bacteria 892
735 Ga0500639_009208 3300053163 Bacteria 5159
736 Ga0500645_011365 3300053730 Bacteria 2911
737 Ga0500656_009172 3300053732 Bacteria 1060
738 Ga0500599_001851 3300053736 Bacteria 2492
739 Ga0500587_036418 3300053739 Bacteria 692
740 Ga0501084_0055666 3300054114 Bacteria 3309
741 Ga0501084_0166383 3300054114 Bacteria 1861
742 Ga0501084_0610348 3300054114 Bacteria 922
743 Ga0590071_005820 3300059421 Bacteria 2957
744 Ga0590074_006608 3300059423 Bacteria 1925
745 Ga0590075_074244 3300059424 Bacteria 879
746 Ga0590077_017261 3300059426 Bacteria 1517
747 Ga0587084_038845 3300059477 Bacteria 800
748 Ga0587066_050277 3300059490 Bacteria 818
749 Ga0587066_075098 3300059490 Bacteria 720
750 Ga0587070_054427 3300059491 Bacteria 809
751 Ga0587073_0038046 3300059492 Bacteria 1034
752 Ga0587073_0144482 3300059492 Bacteria 667
753 Ga0587077_009634 3300059493 Bacteria 1471
754 Ga0587077_093256 3300059493 Bacteria 711
755 Ga0587077_106665 3300059493 Bacteria 680
756 Ga0587077_265807 3300059493 Bacteria 502
757 Ga0587080_075426 3300059503 Bacteria 682
758 Ga0587082_054548 3300059504 Bacteria 772
759 Ga0587082_068418 3300059504 Bacteria 716
760 Ga0587082_081926 3300059504 Bacteria 674
761 Ga0587083_0037861 3300059505 Bacteria 994
762 Ga0587085_059392 3300059506 Bacteria 719
763 Ga0587085_154652 3300059506 Bacteria 532
764 Ga0587086_040383 3300059507 Bacteria 720
765 Ga0587086_044880 3300059507 Bacteria 696
766 Ga0587086_117437 3300059507 Bacteria 505
767 Ga0587088_030951 3300059508 Bacteria 956
768 Ga0587088_080223 3300059508 Bacteria 697
769 Ga0587090_041184 3300059510 Bacteria 814
770 Ga0587094_047792 3300059513 Bacteria 716
771 Ga0587098_032842 3300059604 Bacteria 722
772 Ga0587106_111428 3300059605 Bacteria 570
773 Ga0587101_006209 3300059623 Bacteria 1361
774 Ga0587101_056654 3300059623 Bacteria 690
775 Ga0587101_062328 3300059623 Bacteria 669
776 Ga0587101_062603 3300059623 Bacteria 668
777 Ga0587109_079391 3300059624 Bacteria 723
778 Ga0587115_045378 3300059626 Bacteria 699
779 Ga0587115_063508 3300059626 Bacteria 624
780 Ga0587117_033042 3300059627 Bacteria 790
781 Ga0587062_012627 3300059639 Bacteria 1087
782 Ga0587062_039152 3300059639 Bacteria 762
783 Ga0587062_051698 3300059639 Bacteria 698
784 Ga0587067_020751 3300059640 Bacteria 1127
785 Ga0587067_030304 3300059640 Bacteria 994
786 Ga0587067_055273 3300059640 Bacteria 816
787 Ga0587067_072911 3300059640 Bacteria 745
788 Ga0587068_019478 3300059641 Bacteria 1100
789 Ga0587068_042430 3300059641 Bacteria 827
790 Ga0587068_055252 3300059641 Bacteria 752
791 Ga0587068_072926 3300059641 Bacteria 680
792 Ga0587069_026259 3300059642 Bacteria 911
793 Ga0587069_056022 3300059642 Bacteria 714
794 Ga0587072_054357 3300059643 Bacteria 810
795 Ga0587072_058935 3300059643 Bacteria 786
796 Ga0587076_022183 3300059645 Bacteria 1058
797 Ga0587076_069642 3300059645 Bacteria 728
798 Ga0587076_081096 3300059645 Bacteria 692
799 Ga0587076_089574 3300059645 Bacteria 670
800 Ga0587078_030048 3300059646 Bacteria 729
801 Ga0587079_032114 3300059647 Bacteria 1015
802 Ga0587079_076846 3300059647 Bacteria 756
803 Ga0587104_006579 3300059650 Bacteria 791
804 Ga0587107_053498 3300059652 Bacteria 692
805 Ga0587071_079141 3300060344 Bacteria 729
806 Ga0587071_096965 3300060344 Bacteria 677
807 Ga0587071_100519 3300060344 Bacteria 668
808 Ga0587111_0003570 3300060346 Bacteria 2228
809 Ga0587111_0024432 3300060346 Bacteria 1189
810 Ga0587111_0093451 3300060346 Bacteria 738
811 Ga0501082_0022097 3300060353 Bacteria 5484
812 Ga0501082_0059868 3300060353 Bacteria 3281
813 Ga0501082_0221705 3300060353 Bacteria 1645
814 Ga0501082_0240115 3300060353 Bacteria 1577
815 Ga0501082_0850198 3300060353 Bacteria 798
816 2512032044 2511231221 Bacteria 6846400
817 2523103515 2522572158 Bacteria 6514390
818 2599102957 2597490356 Bacteria 7030811
819 2846952831 2846952575 Bacteria 6587527
820 2848858364 2848858292 Bacteria 7391279
821 2883292092 2883291878 Bacteria 5894118
822 2883355102 2883354860 Bacteria 5865246
823 2883580831 2883577096 Bacteria 4709178
824 8054003437 8054002106 Bacteria 7987183
825 Ga0436363_1172536
826 JGI25153J46596_10048541
827 rootH2_10084649
828 JGI25407J50210_10100853
829 Ga0055542_1032123
830 Ga0055529_1005692
831 Ga0065707_10529883
832 Ga0065707_10694543
833 Ga0070683_100734017
834 Ga0070690_100519084
835 Ga0070682_100375510
836 Ga0070660_100019804
837 Ga0070687_101317041
838 Ga0070661_100815827
839 Ga0070668_100633844
840 Ga0070668_101536345
841 Ga0070669_100019204
842 Ga0070675_100235090
843 Ga0070675_100342528
844 Ga0070671_100032613
845 Ga0070674_100045997
846 Ga0070673_101509844
847 Ga0070667_100073717
848 Ga0070667_101431013
849 Ga0070667_101904977
850 Ga0070709_10045263
851 Ga0070709_10147261
852 Ga0070709_11789089
853 Ga0070714_100018163
854 Ga0070714_100060633
855 Ga0070714_100665045
856 Ga0070713_100027158
857 Ga0070713_100171433
858 Ga0070713_100621305
859 Ga0070713_100816165
860 Ga0070713_101599296
861 Ga0070713_101748285
862 Ga0070713_102466554
863 Ga0070710_10109863
864 Ga0070701_10780407
865 Ga0070711_100034702
866 Ga0070711_100274012
867 Ga0070711_100529858
868 Ga0070705_100336340
869 Ga0070705_101078037
870 Ga0070700_100121321
871 Ga0070708_100026636
872 Ga0070663_101346564
873 Ga0070678_100034822
874 Ga0070681_10247951
875 Ga0070681_11100242
876 Ga0068867_100793578
877 Ga0068867_101749618
878 Ga0070706_100015780
879 Ga0070706_100578738
880 Ga0070707_100006963
881 Ga0070707_100940494
882 Ga0070707_101132356
883 Ga0070698_100449258
884 Ga0070699_100054969
885 Ga0070699_100304552
886 Ga0070699_101580583
887 Ga0070679_100440976
888 Ga0070679_101238461
889 Ga0070684_100232170
890 Ga0070697_101516784
891 Ga0070697_101657431
892 Ga0070672_101630081
893 Ga0070695_100544305
894 Ga0070695_101687877
895 Ga0070696_100190673
896 Ga0070665_100279649
897 Ga0070665_100532523
898 Ga0070665_100541007
899 Ga0068855_100219801
900 Ga0070664_100869329
901 Ga0070664_101330305
902 Ga0068856_100203499
903 Ga0068856_100475926
904 Ga0068856_101129810
905 Ga0068852_100594612
906 Ga0068859_100282132
907 Ga0068864_100217683
908 Ga0068864_100751039
909 Ga0068866_10031660
910 Ga0068863_100483428
911 Ga0068863_101960061
912 Ga0068860_101241949
913 Ga0068862_100016491
914 Ga0068862_100054170
915 Ga0081455_10069430
916 Ga0081455_10428047
917 Ga0081538_10006607
918 Ga0081540_1126213
919 Ga0081540_1152538
920 Ga0081540_1210303
921 Ga0070717_10042502
922 Ga0070717_10095123
923 Ga0070717_10342238
924 Ga0070717_10989273
925 Ga0070715_10764494
926 Ga0070716_100049627
927 Ga0070716_101092380
928 Ga0070716_101185921
929 Ga0070712_100044274
930 Ga0070712_100060927
931 Ga0070712_100886571
932 Ga0070712_101312699
933 Ga0075362_10267291
934 Ga0075362_10377295
935 Ga0075369_10008204
936 Ga0075369_10237625
937 Ga0075366_10128650
938 Ga0075366_10249882
939 Ga0075370_10214929
940 Ga0075370_10282571
941 Ga0068871_100408671
942 Ga0068871_101648894
943 Ga0075428_100341554
944 Ga0075430_100259435
945 Ga0075431_101521510
946 Ga0075431_101536099
947 Ga0075433_10734932
948 Ga0075434_100821982
949 Ga0075429_100796608
950 Ga0068865_100123262
951 Ga0075436_100086444
952 Ga0075436_100369524
953 Ga0097620_100282113
954 Ga0075435_100342089
955 Ga0075435_100589487
956 Ga0099795_10000803
957 Ga0099795_10495156
958 Ga0105240_10485059
959 Ga0111539_10003803
960 Ga0111539_11642372
961 Ga0105245_10064936
962 Ga0105245_10908256
963 Ga0105247_10804857
964 Ga0105247_11573037
965 Ga0114129_10908263
966 Ga0114129_13101753
967 Ga0105241_11327988
968 Ga0105242_10468332
969 Ga0105242_11919263
970 Ga0105248_10324678
971 Ga0105248_10327506
972 Ga0105248_11422592
973 Ga0105237_11473394
974 Ga0105237_12690082
975 Ga0105238_10392358
976 Ga0105238_12408706
977 Ga0105249_10037396
978 Ga0105035_108046
979 Ga0105028_106479
980 Ga0099796_10025286
981 Ga0105239_10244989
982 Ga0105239_11146177
983 Ga0105239_11203086
984 Ga0105239_11604950
985 Ga0105239_11689715
986 Ga0105246_10096436
987 Ga0105246_10819585
988 Ga0157373_10509888
989 Ga0157370_10183926
990 Ga0157369_11435510
991 Ga0157374_10388192
992 Ga0157374_10474522
993 Ga0157374_12845414
994 Ga0157378_11210217
995 Ga0157378_11218879
996 Ga0163162_10706939
997 Ga0163162_13236133
998 Ga0157375_11195325
999 Ga0157375_11619401
1000 Ga0157375_12833046
1001 Ga0163163_10015068
1002 Ga0163163_10226533
1003 Ga0163163_10999107
1004 Ga0163163_13108434
1005 Ga0157380_10037752
1006 Ga0157380_10259256
1007 Ga0157380_11861616
1008 Ga0157380_13509407
1009 Ga0182008_10014674
1010 Ga0182008_10296243
1011 Ga0157379_10591840
1012 Ga0157379_11810498
1013 Ga0157376_10877136
1014 Ga0182007_10135177
1015 Ga0163161_10475397
1016 Ga0163161_10711093
1017 Ga0197907_11285424
1018 Ga0206349_1228716
1019 Ga0213872_10048000
1020 Ga0213872_10306093
1021 Ga0213874_10026987
1022 Ga0213876_10006707
1023 Ga0213876_10078863
1024 Ga0213876_10257086
1025 Ga0213876_10631536
1026 Ga0213875_10003437
1027 Ga0213875_10005028
1028 Ga0213875_10007080
1029 Ga0213875_10046529
1030 Ga0213875_10108836
1031 Ga0213875_10376840
1032 Ga0224712_10081686
1033 Ga0224712_10259722
1034 Ga0224712_10286892
1035 Ga0224712_10335249
1036 Ga0224712_10375971
1037 Ga0209258_105392
1038 Ga0209148_1009566
1039 Ga0209455_1000225
1040 Ga0209676_1013131
1041 Ga0207426_1019958
1042 Ga0209051_1018112
1043 Ga0209257_1000418
1044 Ga0207692_10156851
1045 Ga0207692_10177133
1046 Ga0207642_10018319
1047 Ga0207680_10541902
1048 Ga0207699_10047885
1049 Ga0207699_10182763
1050 Ga0207705_10134644
1051 Ga0207684_10019438
1052 Ga0207707_10203394
1053 Ga0207707_10774416
1054 Ga0207707_11249547
1055 Ga0207693_10047418
1056 Ga0207693_10071832
1057 Ga0207693_10588720
1058 Ga0207663_10034000
1059 Ga0207663_10089585
1060 Ga0207657_10039365
1061 Ga0207652_10458892
1062 Ga0207652_10972781
1063 Ga0207646_10007590
1064 Ga0207646_11570618
1065 Ga0207646_11824200
1066 Ga0207681_10014928
1067 Ga0207687_10048204
1068 Ga0207700_10043368
1069 Ga0207700_10080960
1070 Ga0207700_10955032
1071 Ga0207700_11490923
1072 Ga0207664_10065453
1073 Ga0207664_11185994
1074 Ga0207644_10060209
1075 Ga0207644_10527572
1076 Ga0207686_10835432
1077 Ga0207669_10292790
1078 Ga0207704_10237925
1079 Ga0207665_10026807
1080 Ga0207665_10083040
1081 Ga0207665_10246526
1082 Ga0207711_10503298
1083 Ga0207661_10991085
1084 Ga0207679_11814986
1085 Ga0207667_10376680
1086 Ga0207651_11195819
1087 Ga0207712_10122040
1088 Ga0207658_10194173
1089 Ga0207677_11618997
1090 Ga0207639_10162182
1091 Ga0207678_10982870
1092 Ga0207678_11296227
1093 Ga0207708_10134792
1094 Ga0207708_10840548
1095 Ga0207702_10026622
1096 Ga0207702_10089326
1097 Ga0207702_10190629
1098 Ga0207702_10452085
1099 Ga0207702_10752497
1100 Ga0207702_12341657
1101 Ga0207641_10639871
1102 Ga0207648_10925085
1103 Ga0207676_11022433
1104 Ga0207675_100006475
1105 Ga0207683_10174477
1106 Ga0207683_10218865
1107 Ga0207698_10614494
1108 Ga0207698_11253984
1109 Ga0209179_1003760
1110 Ga0207428_10000053
1111 Ga0268266_10458405
1112 Ga0268266_10501314
1113 Ga0268266_10996606
1114 Ga0268265_10003331
1115 Ga0268265_10040950
1116 Ga0265318_10031391
1117 Ga0307517_10250422
1118 Ga0307512_10144489
1119 Ga0265766_1012132
1120 Ga0265332_10332329
1121 Ga0265320_10234008
1122 Ga0265331_10010519
1123 Ga0265327_10022748
1124 Ga0265327_10273164
1125 Ga0265316_10229326
1126 Ga0307513_10011397
1127 Ga0307513_10030928
1128 Ga0307513_10331707
1129 Ga0307408_100692684
1130 Ga0307408_100714472
1131 Ga0265313_10017033
1132 Ga0265313_10277116
1133 Ga0307508_10203929
1134 Ga0307508_10340192
1135 Ga0307508_10435681
1136 Ga0316575_10249612
1137 Ga0265314_10006902
1138 Ga0265314_10029014
1139 Ga0307516_10413440
1140 Ga0307516_10669122
1141 Ga0307413_10046659
1142 Ga0307410_10014266
1143 Ga0307410_10448709
1144 Ga0307406_10816737
1145 Ga0307407_10231447
1146 Ga0307412_10502348
1147 Ga0307412_11160376
1148 Ga0307409_100084994
1149 Ga0307416_100810765
1150 Ga0307416_100940661
1151 Ga0307411_10005095
1152 Ga0307415_100543113
1153 Ga0307507_10319895
1154 Ga0307510_10387057
1155 Ga0373926_0041884
1156 Ga0373926_0048800
1157 Ga0373928_0012132
1158 Ga0373934_0040650
1159 Ga0373934_0113052
1160 Ga0373934_0114513
1161 Ga0373944_0066037
1162 Ga0373944_0103556
1163 Ga0373944_0188343
1164 Ga0373949_0045409
1165 Ga0373923_0019540
1166 Ga0373923_0427864
1167 Ga0373932_0446280
1168 Ga0373936_0148156
1169 Ga0373936_0452550
1170 Ga0373936_0457810
1171 Ga0373941_0265586
1172 Ga0373945_0548460
1173 Ga0373953_0124537
1174 Ga0373956_0090446
1175 Ga0373956_0193336
1176 Ga0373956_0626654
1177 Ga0373960_0163900
1178 Ga0373943_0024959
1179 Ga0373943_0072968
1180 Ga0373943_0150976
1181 Ga0373943_0329416
1182 Ga0373943_0656291
1183 Ga0373946_0285749
1184 Ga0373946_0748392
1185 Ga0373955_0091080
1186 Ga0373955_0688334
1187 Ga0373961_0097912
1188 Ga0373924_0148689
1189 Ga0373924_0177433
1190 Ga0373931_0223938
1191 Ga0373931_0926401
1192 Ga0373935_0037551
1193 Ga0373935_0055364
1194 Ga0373935_0130502
1195 Ga0373935_0189961
1196 Ga0373927_0358260
1197 Ga0373927_0855059
1198 Ga0373933_0038954
1199 Ga0373933_0052453
1200 Ga0373933_0102790
1201 Ga0373947_0085242
1202 Ga0373947_0133015
1203 Ga0373947_0363468
1204 Ga0373937_0004132
1205 Ga0373937_0043397
1206 Ga0373937_0068945
1207 Ga0373937_0285954
1208 Ga0373937_0533026
1209 Ga0373937_0943489
1210 Ga0373937_1128736
1211 Ga0265778_029150
1212 Ga0373925_0019399
1213 Ga0373925_0049816
1214 Ga0395899_0005089
1215 Ga0395899_0007355
1216 Ga0395900_0001400
1217 Ga0395900_0018475
1218 Ga0395900_1035247
1219 Ga0395898_0000900
1220 Ga0395898_0605545
1221 Ga0395905_0067084
1222 Ga0395905_0276935
1223 Ga0395905_0574467
1224 Ga0436364_0036184
1225 Ga0436364_0111974
1226 Ga0436364_0113231
1227 Ga0436364_0215514
1228 Ga0436364_0411459
1229 Ga0436364_0477303
1230 Ga0436364_0672710
1231 Ga0436364_0885115
1232 Ga0436364_1081267
1233 Ga0436364_1098413
1234 Ga0436364_1309888
1235 Ga0395901_0056651
1236 Ga0395901_0853428
1237 Ga0436365_0467011
1238 Ga0436365_0903003
1239 Ga0436365_1129065
1240 Ga0436365_1147776
1241 Ga0436365_1208761
1242 Ga0436365_1232053
1243 Ga0436365_1314286
1244 Ga0436365_1610296
1245 Ga0436365_1633210
1246 Ga0436365_1888295
1247 Ga0436360_0374512
1248 Ga0436360_0716050
1249 Ga0436360_1248709
1250 Ga0436361_0312844
1251 Ga0436361_0432672
1252 Ga0436361_0700345
1253 Ga0436363_0125784
1254 Ga0436363_0237499
1255 Ga0436363_0461717
1256 Ga0436363_0492694
1257 Ga0436363_0721779
1258 Ga0436363_1167688
1259 Ga0436363_1275384
1260 Ga0436363_1319859
1261 Ga0436363_1343244
1262 Ga0436362_0315033
1263 Ga0436362_0353673
1264 Ga0436362_0906723
1265 Ga0439436_0103227
1266 Ga0451789_0949761
1267 Ga0451798_0574671
1268 Ga0451847_0771257
1269 Ga0451851_0172888
1270 Ga0451853_0589475
1271 Ga0439437_048427
1272 Ga0439441_014360
1273 Ga0439434_0170936
1274 Ga0466972_0196919
1275 Ga0466963_0441152
1276 Ga0466963_0443599
1277 Ga0466963_1068187
1278 Ga0453684_0021431
1279 Ga0466968_0581988
1280 Ga0466957_0888659
1281 Ga0466959_1051046
1282 Ga0451576_0350215
1283 Ga0466967_0287263
1284 Ga0466967_1145058
1285 Ga0466967_1449856
1286 Ga0466967_1834762
1287 Ga0495592_0103194
1288 Ga0495638_0208818
1289 Ga0495638_0258261
1290 Ga0495638_0406070
1291 Ga0495651_0015987
1292 Ga0495651_0450842
1293 Ga0495653_0142116
1294 Ga0495653_0301793
1295 Ga0495653_0502247
1296 Ga0495650_0131912
1297 Ga0495650_0204465
1298 Ga0495580_0086028
1299 Ga0495664_0007401
1300 Ga0495664_0530502
1301 Ga0495594_0890618
1302 Ga0495608_0035794
1303 Ga0495608_0164087
1304 Ga0495608_0558150
1305 Ga0495616_0356645
1306 Ga0495618_0757864
1307 Ga0495628_0032249
1308 Ga0495628_0218403
1309 Ga0495628_0437910
1310 Ga0495628_0863169
1311 Ga0495630_0183191
1312 Ga0495630_1376971
1313 Ga0495632_0270586
1314 Ga0495666_0164282
1315 Ga0495652_0175705
1316 Ga0495652_0548336
1317 Ga0495654_0160837
1318 Ga0495665_0065246
1319 Ga0495640_0071080
1320 Ga0495586_0031962
1321 Ga0495586_0106039
1322 Ga0495586_0198906
1323 Ga0495587_0092548
1324 Ga0495587_0107762
1325 Ga0495587_0157509
1326 Ga0495587_0533868
1327 Ga0495621_0511443
1328 Ga0495645_0001048
1329 Ga0495645_0094561
1330 Ga0495645_0382056
1331 Ga0495667_0060660
1332 Ga0495667_0066954
1333 Ga0495667_0112423
1334 Ga0495634_0339840
1335 Ga0495625_0291943
1336 Ga0495635_0037350
1337 Ga0495635_0102720
1338 Ga0495635_0308530
1339 Ga0495657_0032830
1340 Ga0495657_0095624
1341 Ga0495599_0018777
1342 Ga0495599_0341109
1343 Ga0495646_0163046
1344 Ga0495646_0199190
1345 Ga0495646_0646767
1346 Ga0495658_0593598
1347 Ga0495658_0883977
1348 Ga0495649_0202213
1349 Ga0495600_0055602
1350 Ga0495600_0095128
1351 Ga0495600_0358027
1352 Ga0495604_0020602
1353 Ga0495674_0304641
1354 Ga0495674_0599689
1355 Ga0495674_0670755
1356 Ga0495674_1199658
1357 Ga0495680_0019357
1358 Ga0495680_0099966
1359 Ga0495680_0157745
1360 Ga0495680_0624315
1361 Ga0495675_0068351
1362 Ga0495675_0516014
1363 Ga0495684_0239279
1364 Ga0495684_0245718
1365 Ga0495686_0130629
1366 Ga0495593_0214911
1367 Ga0495602_0307176
1368 Ga0495602_0908974
1369 Ga0496104_0322468
1370 Ga0496104_1065118
1371 Ga0496105_0838251
1372 Ga0496107_0541015
1373 Ga0496108_0736049
1374 Ga0496108_1182249
1375 Ga0496109_0685978
1376 Ga0496110_0722519
1377 Ga0496112_0028084
1378 Ga0496112_1124027
1379 Ga0496113_0313828
1380 Ga0496115_1397876
1381 Ga0496119_0028935
1382 Ga0496120_0065313
1383 Ga0496121_0604692
1384 Ga0496122_0093714
1385 Ga0496126_1042070
1386 Ga0501306_036639
1387 Ga0501308_017191
1388 Ga0501304_025981
1389 Ga0501305_026035
1390 Ga0501307_018192
1391 Ga0501312_030161
1392 Ga0501317_067791
1393 Ga0501320_018397
1394 Ga0501321_051496
1395 Ga0501330_008281
1396 Ga0501031_0000746
1397 Ga0501031_0487647
1398 Ga0501031_0520995
1399 Ga0501031_0742931
1400 Ga0501032_0038762
1401 Ga0501032_0231684
1402 Ga0501032_0864718
1403 Ga0501033_0001088
1404 Ga0501033_0191591
1405 Ga0501033_0249090
1406 Ga0501033_0371443
1407 Ga0501033_0406435
1408 Ga0501034_0079145
1409 Ga0501034_0634452
1410 Ga0501034_1038391
1411 Ga0501036_0009451
1412 Ga0501036_0027538
1413 Ga0501036_0287002
1414 Ga0501036_0657439
1415 Ga0501037_0012673
1416 Ga0501037_0021183
1417 Ga0501037_0026225
1418 Ga0501037_0631153
1419 Ga0501037_0682819
1420 Ga0501038_0036006
1421 Ga0501038_0049072
1422 Ga0501038_0113361
1423 Ga0501038_0494069
1424 Ga0501038_0813965
1425 Ga0501038_0928379
1426 Ga0501038_1111254
1427 Ga0501039_0006574
1428 Ga0501039_0122261
1429 Ga0501039_0228384
1430 Ga0501043_0021304
1431 Ga0501043_0074121
1432 Ga0501043_0467805
1433 Ga0501043_0571431
1434 Ga0501046_0017076
1435 Ga0501046_0043408
1436 Ga0501047_0018894
1437 Ga0501047_0027283
1438 Ga0501047_0079627
1439 Ga0501047_0086631
1440 Ga0501047_0475779
1441 Ga0501047_0750137
1442 Ga0501048_0014974
1443 Ga0501048_0831719
1444 Ga0501067_0029448
1445 Ga0501067_0074591
1446 Ga0501067_0140492
1447 Ga0501067_0179860
1448 Ga0501067_0663957
1449 Ga0501068_0198978
1450 Ga0501068_1123870
1451 Ga0501069_0007311
1452 Ga0501069_0308996
1453 Ga0501070_0002774
1454 Ga0501070_0104191
1455 Ga0501070_0189245
1456 Ga0501070_0205040
1457 Ga0501070_0253791
1458 Ga0501070_0741632
1459 Ga0501070_1002957
1460 Ga0501071_0764430
1461 Ga0501071_0918175
1462 Ga0501072_1396897
1463 Ga0501073_0010974
1464 Ga0501073_0069939
1465 Ga0501073_0101137
1466 Ga0501073_0288078
1467 Ga0501073_0972516
1468 Ga0501074_0004909
1469 Ga0501074_0206129
1470 Ga0501074_0908769
1471 Ga0501076_0610968
1472 Ga0501076_1516660
1473 Ga0501077_0588232
1474 Ga0501079_0033209
1475 Ga0501079_0877830
1476 Ga0501080_0057283
1477 Ga0501080_0064237
1478 Ga0501080_0078558
1479 Ga0501080_0089615
1480 Ga0501080_0251245
1481 Ga0501080_1164738
1482 Ga0501081_0743548
1483 Ga0501083_0012062
1484 Ga0501083_0014527
1485 Ga0501083_0029520
1486 Ga0501083_0059514
1487 Ga0501083_0598309
1488 Ga0501035_0001712
1489 Ga0501035_0040360
1490 Ga0501044_0004509
1491 Ga0501044_0010946
1492 Ga0501044_0022918
1493 Ga0501044_0183493
1494 Ga0501044_1260952
1495 Ga0501044_1315779
1496 Ga0501044_1408738
1497 nmdc:mga03683_64894_c1
1498 nmdc:mga0k408_182502_c1
1499 nmdc:mga0k408_305274_c1
1500 nmdc:mga0k408_324352_c1
1501 nmdc:mga07m45_423858_c1
1502 nmdc:mga07m45_721526_c1
1503 nmdc:mga05p37_812908_c1
1504 nmdc:mga09592_403757_c1
1505 nmdc:mga0qj67_187086_c1
1506 nmdc:mga06r32_469783_c1
1507 nmdc:mga08y16_1094295_c1
1508 nmdc:mga08y16_1266855_c1
1509 nmdc:mga08y16_30_c1
1510 nmdc:mga0rr50_1435071_c1
1511 nmdc:mga0rr50_334987_c1
1512 nmdc:mga0rr50_926424_c1
1513 nmdc:mga08x19_1090557_c1
1514 nmdc:mga08x19_22108_c1
1515 nmdc:mga08x19_372470_c1
1516 nmdc:mga08x19_869682_c1
1517 nmdc:mga0a205_469293_c1
1518 Ga0495601_0017391
1519 Ga0495601_0175711
1520 Ga0495601_0430126
1521 Ga0495612_0001439
1522 Ga0500635_0110166
1523 Ga0495595_0006518
1524 Ga0495595_0290741
1525 Ga0495619_0012325
1526 Ga0495619_0022600
1527 Ga0500578_0071339
1528 Ga0500643_029329
1529 Ga0500644_0241859
1530 Ga0500646_0020601
1531 Ga0500651_0221104
1532 Ga0500566_0097934
1533 Ga0500566_0310063
1534 Ga0500641_0021232
1535 Ga0500650_0518953
1536 Ga0500654_192900
1537 Ga0500562_076417
1538 Ga0500569_212279
1539 Ga0500592_043072
1540 Ga0500595_000373
1541 Ga0500595_037370
1542 Ga0500597_108159
1543 Ga0500628_117338
1544 Ga0500642_0067165
1545 Ga0500642_0074337
1546 Ga0500658_0001902
1547 Ga0500658_0137050
1548 Ga0500559_0006760
1549 Ga0500577_0006212
1550 Ga0500577_0136330
1551 Ga0500588_0008130
1552 Ga0500588_0063235
1553 Ga0500589_231312
1554 Ga0500616_0002311
1555 Ga0500616_0158193
1556 Ga0500622_0228975
1557 Ga0500633_0034246
1558 Ga0500634_0196142
1559 Ga0500639_009208
1560 Ga0500645_011365
1561 Ga0500656_009172
1562 Ga0500599_001851
1563 Ga0500587_036418
1564 Ga0501084_0055666
1565 Ga0501084_0166383
1566 Ga0501084_0610348
1567 Ga0590071_005820
1568 Ga0590074_006608
1569 Ga0590075_074244
1570 Ga0590077_017261
1571 Ga0587084_038845
1572 Ga0587066_050277
1573 Ga0587066_075098
1574 Ga0587070_054427
1575 Ga0587073_0038046
1576 Ga0587073_0144482
1577 Ga0587077_009634
1578 Ga0587077_093256
1579 Ga0587077_106665
1580 Ga0587077_265807
1581 Ga0587080_075426
1582 Ga0587082_054548
1583 Ga0587082_068418
1584 Ga0587082_081926
1585 Ga0587083_0037861
1586 Ga0587085_059392
1587 Ga0587085_154652
1588 Ga0587086_040383
1589 Ga0587086_044880
1590 Ga0587086_117437
1591 Ga0587088_030951
1592 Ga0587088_080223
1593 Ga0587090_041184
1594 Ga0587094_047792
1595 Ga0587098_032842
1596 Ga0587106_111428
1597 Ga0587101_006209
1598 Ga0587101_056654
1599 Ga0587101_062328
1600 Ga0587101_062603
1601 Ga0587109_079391
1602 Ga0587115_045378
1603 Ga0587115_063508
1604 Ga0587117_033042
1605 Ga0587062_012627
1606 Ga0587062_039152
1607 Ga0587062_051698
1608 Ga0587067_020751
1609 Ga0587067_030304
1610 Ga0587067_055273
1611 Ga0587067_072911
1612 Ga0587068_019478
1613 Ga0587068_042430
1614 Ga0587068_055252
1615 Ga0587068_072926
1616 Ga0587069_026259
1617 Ga0587069_056022
1618 Ga0587072_054357
1619 Ga0587072_058935
1620 Ga0587076_022183
1621 Ga0587076_069642
1622 Ga0587076_081096
1623 Ga0587076_089574
1624 Ga0587078_030048
1625 Ga0587079_032114
1626 Ga0587079_076846
1627 Ga0587104_006579
1628 Ga0587107_053498
1629 Ga0587071_079141
1630 Ga0587071_096965
1631 Ga0587071_100519
1632 Ga0587111_0003570
1633 Ga0587111_0024432
1634 Ga0587111_0093451
1635 Ga0501082_0022097
1636 Ga0501082_0059868
1637 Ga0501082_0221705
1638 Ga0501082_0240115
1639 Ga0501082_0850198
1640 2512032044
1641 2523103515
1642 2599102957
1643 2846952831
1644 2848858364
1645 2883292092
1646 2883355102
1647 2883580831
1648 8054003437

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.931 14 113
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.9165 14 114
6z1p-assembly1.cif.gz_Au structure of the mitochondrial ribosome from tetrahymena thermophila 0.9088 15 117
6xyw-assembly1.cif.gz_Aq structure of the plant mitochondrial ribosome 0.8913 13 114
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8784 50 115
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9693 52 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9095 57 117 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9011 52 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8723 60 118 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8472 60 118 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.006 60 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y7CN64-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.006 63 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2D8YKH1-F1-model_v4 deleted 1.004 57 117
AF-A0A659UR08-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.004 55 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G9GV44-F1-model_v4 deleted 1.003 63 118

Map