F482394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 824 | 429 | 1648 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_1172536|Ga0436363_1172536_735_1163 |
| Length | 142 |
| Sequence | MARVKRGVTTHARHKKVLEQAKGYVGRSSTNYRIALERLEKALRYAYRDRRQKKRDFRGLWIQRINAAVREHGITYSKFIGGLKRTGIELDRKVLAAIAYEEPAAFAAIVEQVKVVMSHHEGEDATVAQLNELTEHPAQIVT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 90 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 91 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 111 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 168 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 193 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 229 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 232 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 235 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 296 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 356 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 364 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 365 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 369 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 370 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 373 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 374 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 378 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 382 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 384 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 386 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 387 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 388 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 422 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 423 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 424 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 425 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 426 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 427 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 428 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 429 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.83 |
| Metatranscriptomes | 10.07 |
| Isolates | 1.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.52 |
| Nodule | 0 |
| Rhizoplane | 1.7 |
| Rhizosphere | 82.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436363_1172536 | 3300039450 | Bacteria | 1286 |
| 2 | JGI25153J46596_10048541 | 3300003215 | Bacteria | 1239 |
| 3 | rootH2_10084649 | 3300003320 | Bacteria | 1536 |
| 4 | JGI25407J50210_10100853 | 3300003373 | Bacteria | 714 |
| 5 | Ga0055542_1032123 | 3300003762 | Bacteria | 664 |
| 6 | Ga0055529_1005692 | 3300003763 | Bacteria | 1781 |
| 7 | Ga0065707_10529883 | 3300005295 | Bacteria | 735 |
| 8 | Ga0065707_10694543 | 3300005295 | Bacteria | 642 |
| 9 | Ga0070683_100734017 | 3300005329 | Bacteria | 946 |
| 10 | Ga0070690_100519084 | 3300005330 | Bacteria | 894 |
| 11 | Ga0070682_100375510 | 3300005337 | Bacteria | 1067 |
| 12 | Ga0070660_100019804 | 3300005339 | Bacteria | 4936 |
| 13 | Ga0070687_101317041 | 3300005343 | Bacteria | 537 |
| 14 | Ga0070661_100815827 | 3300005344 | Bacteria | 766 |
| 15 | Ga0070668_100633844 | 3300005347 | Bacteria | 938 |
| 16 | Ga0070668_101536345 | 3300005347 | Bacteria | 609 |
| 17 | Ga0070669_100019204 | 3300005353 | Bacteria | 4883 |
| 18 | Ga0070675_100235090 | 3300005354 | Bacteria | 1600 |
| 19 | Ga0070675_100342528 | 3300005354 | Unclassified | 1324 |
| 20 | Ga0070671_100032613 | 3300005355 | Bacteria | 4305 |
| 21 | Ga0070674_100045997 | 3300005356 | Bacteria | 2984 |
| 22 | Ga0070673_101509844 | 3300005364 | Bacteria | 634 |
| 23 | Ga0070667_100073717 | 3300005367 | Bacteria | 2911 |
| 24 | Ga0070667_101431013 | 3300005367 | Bacteria | 648 |
| 25 | Ga0070667_101904977 | 3300005367 | Bacteria | 560 |
| 26 | Ga0070709_10045263 | 3300005434 | Bacteria | 2730 |
| 27 | Ga0070709_10147261 | 3300005434 | Bacteria | 1623 |
| 28 | Ga0070709_11789089 | 3300005434 | Bacteria | 502 |
| 29 | Ga0070714_100018163 | 3300005435 | Bacteria | 5706 |
| 30 | Ga0070714_100060633 | 3300005435 | Bacteria | 3247 |
| 31 | Ga0070714_100665045 | 3300005435 | Bacteria | 1003 |
| 32 | Ga0070713_100027158 | 3300005436 | Bacteria | 4503 |
| 33 | Ga0070713_100171433 | 3300005436 | Bacteria | 1944 |
| 34 | Ga0070713_100621305 | 3300005436 | Bacteria | 1028 |
| 35 | Ga0070713_100816165 | 3300005436 | Bacteria | 895 |
| 36 | Ga0070713_101599296 | 3300005436 | Bacteria | 633 |
| 37 | Ga0070713_101748285 | 3300005436 | Bacteria | 604 |
| 38 | Ga0070713_102466554 | 3300005436 | Bacteria | 502 |
| 39 | Ga0070710_10109863 | 3300005437 | Bacteria | 1655 |
| 40 | Ga0070701_10780407 | 3300005438 | Bacteria | 650 |
| 41 | Ga0070711_100034702 | 3300005439 | Bacteria | 3366 |
| 42 | Ga0070711_100274012 | 3300005439 | Bacteria | 1332 |
| 43 | Ga0070711_100529858 | 3300005439 | Bacteria | 975 |
| 44 | Ga0070705_100336340 | 3300005440 | Bacteria | 1096 |
| 45 | Ga0070705_101078037 | 3300005440 | Bacteria | 656 |
| 46 | Ga0070700_100121321 | 3300005441 | Bacteria | 1752 |
| 47 | Ga0070708_100026636 | 3300005445 | Bacteria | 4951 |
| 48 | Ga0070663_101346564 | 3300005455 | Bacteria | 631 |
| 49 | Ga0070678_100034822 | 3300005456 | Bacteria | 3510 |
| 50 | Ga0070681_10247951 | 3300005458 | Bacteria | 1694 |
| 51 | Ga0070681_11100242 | 3300005458 | Bacteria | 716 |
| 52 | Ga0068867_100793578 | 3300005459 | Bacteria | 844 |
| 53 | Ga0068867_101749618 | 3300005459 | Bacteria | 584 |
| 54 | Ga0070706_100015780 | 3300005467 | Bacteria | 6974 |
| 55 | Ga0070706_100578738 | 3300005467 | Bacteria | 1044 |
| 56 | Ga0070707_100006963 | 3300005468 | Bacteria | 10480 |
| 57 | Ga0070707_100940494 | 3300005468 | Bacteria | 829 |
| 58 | Ga0070707_101132356 | 3300005468 | Bacteria | 748 |
| 59 | Ga0070698_100449258 | 3300005471 | Bacteria | 1224 |
| 60 | Ga0070699_100054969 | 3300005518 | Bacteria | 3448 |
| 61 | Ga0070699_100304552 | 3300005518 | Bacteria | 1430 |
| 62 | Ga0070699_101580583 | 3300005518 | Bacteria | 601 |
| 63 | Ga0070679_100440976 | 3300005530 | Bacteria | 1247 |
| 64 | Ga0070679_101238461 | 3300005530 | Bacteria | 692 |
| 65 | Ga0070684_100232170 | 3300005535 | Bacteria | 1685 |
| 66 | Ga0070697_101516784 | 3300005536 | Bacteria | 599 |
| 67 | Ga0070697_101657431 | 3300005536 | Bacteria | 572 |
| 68 | Ga0070672_101630081 | 3300005543 | Bacteria | 579 |
| 69 | Ga0070695_100544305 | 3300005545 | Bacteria | 904 |
| 70 | Ga0070695_101687877 | 3300005545 | Bacteria | 530 |
| 71 | Ga0070696_100190673 | 3300005546 | Bacteria | 1525 |
| 72 | Ga0070665_100279649 | 3300005548 | Bacteria | 1671 |
| 73 | Ga0070665_100532523 | 3300005548 | Bacteria | 1186 |
| 74 | Ga0070665_100541007 | 3300005548 | Bacteria | 1177 |
| 75 | Ga0068855_100219801 | 3300005563 | Bacteria | 2131 |
| 76 | Ga0070664_100869329 | 3300005564 | Bacteria | 845 |
| 77 | Ga0070664_101330305 | 3300005564 | Bacteria | 679 |
| 78 | Ga0068856_100203499 | 3300005614 | Bacteria | 1994 |
| 79 | Ga0068856_100475926 | 3300005614 | Bacteria | 1270 |
| 80 | Ga0068856_101129810 | 3300005614 | Bacteria | 800 |
| 81 | Ga0068852_100594612 | 3300005616 | Bacteria | 1110 |
| 82 | Ga0068859_100282132 | 3300005617 | Bacteria | 1754 |
| 83 | Ga0068864_100217683 | 3300005618 | Bacteria | 1761 |
| 84 | Ga0068864_100751039 | 3300005618 | Bacteria | 956 |
| 85 | Ga0068866_10031660 | 3300005718 | Bacteria | 2550 |
| 86 | Ga0068863_100483428 | 3300005841 | Bacteria | 1218 |
| 87 | Ga0068863_101960061 | 3300005841 | Bacteria | 596 |
| 88 | Ga0068860_101241949 | 3300005843 | Bacteria | 766 |
| 89 | Ga0068862_100016491 | 3300005844 | Bacteria | 6149 |
| 90 | Ga0068862_100054170 | 3300005844 | Bacteria | 3435 |
| 91 | Ga0081455_10069430 | 3300005937 | Bacteria | 2930 |
| 92 | Ga0081455_10428047 | 3300005937 | Bacteria | 911 |
| 93 | Ga0081538_10006607 | 3300005981 | Bacteria | 10169 |
| 94 | Ga0081540_1126213 | 3300005983 | Bacteria | 1052 |
| 95 | Ga0081540_1152538 | 3300005983 | Bacteria | 909 |
| 96 | Ga0081540_1210303 | 3300005983 | Bacteria | 700 |
| 97 | Ga0070717_10042502 | 3300006028 | Bacteria | 3707 |
| 98 | Ga0070717_10095123 | 3300006028 | Bacteria | 2521 |
| 99 | Ga0070717_10342238 | 3300006028 | Bacteria | 1336 |
| 100 | Ga0070717_10989273 | 3300006028 | Bacteria | 766 |
| 101 | Ga0070715_10764494 | 3300006163 | Bacteria | 583 |
| 102 | Ga0070716_100049627 | 3300006173 | Bacteria | 2379 |
| 103 | Ga0070716_101092380 | 3300006173 | Bacteria | 636 |
| 104 | Ga0070716_101185921 | 3300006173 | Bacteria | 613 |
| 105 | Ga0070712_100044274 | 3300006175 | Bacteria | 3068 |
| 106 | Ga0070712_100060927 | 3300006175 | Bacteria | 2664 |
| 107 | Ga0070712_100886571 | 3300006175 | Bacteria | 769 |
| 108 | Ga0070712_101312699 | 3300006175 | Bacteria | 631 |
| 109 | Ga0075362_10267291 | 3300006177 | Bacteria | 844 |
| 110 | Ga0075362_10377295 | 3300006177 | Bacteria | 713 |
| 111 | Ga0075369_10008204 | 3300006186 | Bacteria | 4010 |
| 112 | Ga0075369_10237625 | 3300006186 | Bacteria | 845 |
| 113 | Ga0075366_10128650 | 3300006195 | Bacteria | 1528 |
| 114 | Ga0075366_10249882 | 3300006195 | Bacteria | 1082 |
| 115 | Ga0075370_10214929 | 3300006353 | Bacteria | 1136 |
| 116 | Ga0075370_10282571 | 3300006353 | Bacteria | 986 |
| 117 | Ga0068871_100408671 | 3300006358 | Bacteria | 1210 |
| 118 | Ga0068871_101648894 | 3300006358 | Bacteria | 608 |
| 119 | Ga0075428_100341554 | 3300006844 | Bacteria | 1607 |
| 120 | Ga0075430_100259435 | 3300006846 | Bacteria | 1439 |
| 121 | Ga0075431_101521510 | 3300006847 | Bacteria | 627 |
| 122 | Ga0075431_101536099 | 3300006847 | Bacteria | 624 |
| 123 | Ga0075433_10734932 | 3300006852 | Bacteria | 864 |
| 124 | Ga0075434_100821982 | 3300006871 | Bacteria | 945 |
| 125 | Ga0075429_100796608 | 3300006880 | Bacteria | 827 |
| 126 | Ga0068865_100123262 | 3300006881 | Bacteria | 1931 |
| 127 | Ga0075436_100086444 | 3300006914 | Bacteria | 2177 |
| 128 | Ga0075436_100369524 | 3300006914 | Bacteria | 1036 |
| 129 | Ga0097620_100282113 | 3300006931 | Bacteria | 1754 |
| 130 | Ga0075435_100342089 | 3300007076 | Bacteria | 1282 |
| 131 | Ga0075435_100589487 | 3300007076 | Bacteria | 964 |
| 132 | Ga0099795_10000803 | 3300007788 | Bacteria | 6202 |
| 133 | Ga0099795_10495156 | 3300007788 | Bacteria | 569 |
| 134 | Ga0105240_10485059 | 3300009093 | Bacteria | 1377 |
| 135 | Ga0111539_10003803 | 3300009094 | Bacteria | 19856 |
| 136 | Ga0111539_11642372 | 3300009094 | Bacteria | 745 |
| 137 | Ga0105245_10064936 | 3300009098 | Bacteria | 3300 |
| 138 | Ga0105245_10908256 | 3300009098 | Bacteria | 922 |
| 139 | Ga0105247_10804857 | 3300009101 | Bacteria | 717 |
| 140 | Ga0105247_11573037 | 3300009101 | Bacteria | 539 |
| 141 | Ga0114129_10908263 | 3300009147 | Bacteria | 1115 |
| 142 | Ga0114129_13101753 | 3300009147 | Bacteria | 543 |
| 143 | Ga0105241_11327988 | 3300009174 | Bacteria | 686 |
| 144 | Ga0105242_10468332 | 3300009176 | Bacteria | 1191 |
| 145 | Ga0105242_11919263 | 3300009176 | Bacteria | 633 |
| 146 | Ga0105248_10324678 | 3300009177 | Bacteria | 1734 |
| 147 | Ga0105248_10327506 | 3300009177 | Bacteria | 1725 |
| 148 | Ga0105248_11422592 | 3300009177 | Bacteria | 785 |
| 149 | Ga0105237_11473394 | 3300009545 | Bacteria | 687 |
| 150 | Ga0105237_12690082 | 3300009545 | Bacteria | 508 |
| 151 | Ga0105238_10392358 | 3300009551 | Bacteria | 1380 |
| 152 | Ga0105238_12408706 | 3300009551 | Bacteria | 562 |
| 153 | Ga0105249_10037396 | 3300009553 | Bacteria | 4405 |
| 154 | Ga0105035_108046 | 3300009988 | Bacteria | 896 |
| 155 | Ga0105028_106479 | 3300009993 | Bacteria | 1222 |
| 156 | Ga0099796_10025286 | 3300010159 | Bacteria | 1873 |
| 157 | Ga0105239_10244989 | 3300010375 | Bacteria | 2012 |
| 158 | Ga0105239_11146177 | 3300010375 | Bacteria | 895 |
| 159 | Ga0105239_11203086 | 3300010375 | Bacteria | 873 |
| 160 | Ga0105239_11604950 | 3300010375 | Bacteria | 752 |
| 161 | Ga0105239_11689715 | 3300010375 | Bacteria | 733 |
| 162 | Ga0105246_10096436 | 3300011119 | Bacteria | 2144 |
| 163 | Ga0105246_10819585 | 3300011119 | Bacteria | 827 |
| 164 | Ga0157373_10509888 | 3300013100 | Bacteria | 869 |
| 165 | Ga0157370_10183926 | 3300013104 | Bacteria | 1941 |
| 166 | Ga0157369_11435510 | 3300013105 | Bacteria | 702 |
| 167 | Ga0157374_10388192 | 3300013296 | Bacteria | 1391 |
| 168 | Ga0157374_10474522 | 3300013296 | Bacteria | 1254 |
| 169 | Ga0157374_12845414 | 3300013296 | Bacteria | 511 |
| 170 | Ga0157378_11210217 | 3300013297 | Bacteria | 795 |
| 171 | Ga0157378_11218879 | 3300013297 | Bacteria | 792 |
| 172 | Ga0163162_10706939 | 3300013306 | Bacteria | 1129 |
| 173 | Ga0163162_13236133 | 3300013306 | Bacteria | 522 |
| 174 | Ga0157375_11195325 | 3300013308 | Bacteria | 892 |
| 175 | Ga0157375_11619401 | 3300013308 | Bacteria | 766 |
| 176 | Ga0157375_12833046 | 3300013308 | Bacteria | 580 |
| 177 | Ga0163163_10015068 | 3300014325 | Bacteria | 7132 |
| 178 | Ga0163163_10226533 | 3300014325 | Bacteria | 1918 |
| 179 | Ga0163163_10999107 | 3300014325 | Bacteria | 900 |
| 180 | Ga0163163_13108434 | 3300014325 | Bacteria | 518 |
| 181 | Ga0157380_10037752 | 3300014326 | Bacteria | 3745 |
| 182 | Ga0157380_10259256 | 3300014326 | Bacteria | 1578 |
| 183 | Ga0157380_11861616 | 3300014326 | Bacteria | 662 |
| 184 | Ga0157380_13509407 | 3300014326 | Bacteria | 502 |
| 185 | Ga0182008_10014674 | 3300014497 | Bacteria | 4096 |
| 186 | Ga0182008_10296243 | 3300014497 | Bacteria | 845 |
| 187 | Ga0157379_10591840 | 3300014968 | Bacteria | 1035 |
| 188 | Ga0157379_11810498 | 3300014968 | Bacteria | 600 |
| 189 | Ga0157376_10877136 | 3300014969 | Bacteria | 914 |
| 190 | Ga0182007_10135177 | 3300015262 | Bacteria | 831 |
| 191 | Ga0163161_10475397 | 3300017792 | Bacteria | 1014 |
| 192 | Ga0163161_10711093 | 3300017792 | Bacteria | 837 |
| 193 | Ga0197907_11285424 | 3300020069 | Bacteria | 702 |
| 194 | Ga0206349_1228716 | 3300020075 | Bacteria | 572 |
| 195 | Ga0213872_10048000 | 3300021361 | Bacteria | 1941 |
| 196 | Ga0213872_10306093 | 3300021361 | Bacteria | 659 |
| 197 | Ga0213874_10026987 | 3300021377 | Bacteria | 1631 |
| 198 | Ga0213876_10006707 | 3300021384 | Bacteria | 6283 |
| 199 | Ga0213876_10078863 | 3300021384 | Bacteria | 1740 |
| 200 | Ga0213876_10257086 | 3300021384 | Bacteria | 928 |
| 201 | Ga0213876_10631536 | 3300021384 | Bacteria | 570 |
| 202 | Ga0213875_10003437 | 3300021388 | Bacteria | 9015 |
| 203 | Ga0213875_10005028 | 3300021388 | Bacteria | 7167 |
| 204 | Ga0213875_10007080 | 3300021388 | Bacteria | 5829 |
| 205 | Ga0213875_10046529 | 3300021388 | Bacteria | 2035 |
| 206 | Ga0213875_10108836 | 3300021388 | Bacteria | 1293 |
| 207 | Ga0213875_10376840 | 3300021388 | Bacteria | 675 |
| 208 | Ga0224712_10081686 | 3300022467 | Bacteria | 1335 |
| 209 | Ga0224712_10259722 | 3300022467 | Bacteria | 804 |
| 210 | Ga0224712_10286892 | 3300022467 | Bacteria | 767 |
| 211 | Ga0224712_10335249 | 3300022467 | Bacteria | 713 |
| 212 | Ga0224712_10375971 | 3300022467 | Bacteria | 674 |
| 213 | Ga0209258_105392 | 3300025242 | Bacteria | 2180 |
| 214 | Ga0209148_1009566 | 3300025254 | Bacteria | 1879 |
| 215 | Ga0209455_1000225 | 3300025272 | Bacteria | 76514 |
| 216 | Ga0209676_1013131 | 3300025292 | Bacteria | 3202 |
| 217 | Ga0207426_1019958 | 3300025302 | Bacteria | 2336 |
| 218 | Ga0209051_1018112 | 3300025303 | Bacteria | 3125 |
| 219 | Ga0209257_1000418 | 3300025304 | Bacteria | 82230 |
| 220 | Ga0207692_10156851 | 3300025898 | Bacteria | 1308 |
| 221 | Ga0207692_10177133 | 3300025898 | Bacteria | 1240 |
| 222 | Ga0207642_10018319 | 3300025899 | Bacteria | 2685 |
| 223 | Ga0207680_10541902 | 3300025903 | Bacteria | 830 |
| 224 | Ga0207699_10047885 | 3300025906 | Bacteria | 2508 |
| 225 | Ga0207699_10182763 | 3300025906 | Bacteria | 1410 |
| 226 | Ga0207705_10134644 | 3300025909 | Bacteria | 1841 |
| 227 | Ga0207684_10019438 | 3300025910 | Bacteria | 5813 |
| 228 | Ga0207707_10203394 | 3300025912 | Bacteria | 1726 |
| 229 | Ga0207707_10774416 | 3300025912 | Bacteria | 801 |
| 230 | Ga0207707_11249547 | 3300025912 | Bacteria | 599 |
| 231 | Ga0207693_10047418 | 3300025915 | Bacteria | 3376 |
| 232 | Ga0207693_10071832 | 3300025915 | Bacteria | 2709 |
| 233 | Ga0207693_10588720 | 3300025915 | Bacteria | 866 |
| 234 | Ga0207663_10034000 | 3300025916 | Bacteria | 3043 |
| 235 | Ga0207663_10089585 | 3300025916 | Bacteria | 2037 |
| 236 | Ga0207657_10039365 | 3300025919 | Bacteria | 4203 |
| 237 | Ga0207652_10458892 | 3300025921 | Bacteria | 1148 |
| 238 | Ga0207652_10972781 | 3300025921 | Bacteria | 747 |
| 239 | Ga0207646_10007590 | 3300025922 | Bacteria | 10989 |
| 240 | Ga0207646_11570618 | 3300025922 | Bacteria | 568 |
| 241 | Ga0207646_11824200 | 3300025922 | Bacteria | 520 |
| 242 | Ga0207681_10014928 | 3300025923 | Bacteria | 4838 |
| 243 | Ga0207687_10048204 | 3300025927 | Bacteria | 2956 |
| 244 | Ga0207700_10043368 | 3300025928 | Bacteria | 3303 |
| 245 | Ga0207700_10080960 | 3300025928 | Bacteria | 2534 |
| 246 | Ga0207700_10955032 | 3300025928 | Bacteria | 767 |
| 247 | Ga0207700_11490923 | 3300025928 | Bacteria | 600 |
| 248 | Ga0207664_10065453 | 3300025929 | Bacteria | 2910 |
| 249 | Ga0207664_11185994 | 3300025929 | Bacteria | 681 |
| 250 | Ga0207644_10060209 | 3300025931 | Bacteria | 2747 |
| 251 | Ga0207644_10527572 | 3300025931 | Bacteria | 976 |
| 252 | Ga0207686_10835432 | 3300025934 | Bacteria | 740 |
| 253 | Ga0207669_10292790 | 3300025937 | Bacteria | 1233 |
| 254 | Ga0207704_10237925 | 3300025938 | Bacteria | 1358 |
| 255 | Ga0207665_10026807 | 3300025939 | Bacteria | 3806 |
| 256 | Ga0207665_10083040 | 3300025939 | Bacteria | 2209 |
| 257 | Ga0207665_10246526 | 3300025939 | Bacteria | 1318 |
| 258 | Ga0207711_10503298 | 3300025941 | Bacteria | 1129 |
| 259 | Ga0207661_10991085 | 3300025944 | Bacteria | 774 |
| 260 | Ga0207679_11814986 | 3300025945 | Bacteria | 557 |
| 261 | Ga0207667_10376680 | 3300025949 | Bacteria | 1446 |
| 262 | Ga0207651_11195819 | 3300025960 | Bacteria | 682 |
| 263 | Ga0207712_10122040 | 3300025961 | Bacteria | 1973 |
| 264 | Ga0207658_10194173 | 3300025986 | Bacteria | 1690 |
| 265 | Ga0207677_11618997 | 3300026023 | Bacteria | 600 |
| 266 | Ga0207639_10162182 | 3300026041 | Bacteria | 1885 |
| 267 | Ga0207678_10982870 | 3300026067 | Bacteria | 747 |
| 268 | Ga0207678_11296227 | 3300026067 | Bacteria | 644 |
| 269 | Ga0207708_10134792 | 3300026075 | Bacteria | 1933 |
| 270 | Ga0207708_10840548 | 3300026075 | Bacteria | 792 |
| 271 | Ga0207702_10026622 | 3300026078 | Bacteria | 4801 |
| 272 | Ga0207702_10089326 | 3300026078 | Bacteria | 2694 |
| 273 | Ga0207702_10190629 | 3300026078 | Bacteria | 1894 |
| 274 | Ga0207702_10452085 | 3300026078 | Bacteria | 1246 |
| 275 | Ga0207702_10752497 | 3300026078 | Bacteria | 962 |
| 276 | Ga0207702_12341657 | 3300026078 | Bacteria | 522 |
| 277 | Ga0207641_10639871 | 3300026088 | Bacteria | 1044 |
| 278 | Ga0207648_10925085 | 3300026089 | Bacteria | 815 |
| 279 | Ga0207676_11022433 | 3300026095 | Bacteria | 815 |
| 280 | Ga0207675_100006475 | 3300026118 | Bacteria | 11082 |
| 281 | Ga0207683_10174477 | 3300026121 | Bacteria | 1948 |
| 282 | Ga0207683_10218865 | 3300026121 | Bacteria | 1735 |
| 283 | Ga0207698_10614494 | 3300026142 | Bacteria | 1073 |
| 284 | Ga0207698_11253984 | 3300026142 | Bacteria | 756 |
| 285 | Ga0209179_1003760 | 3300027512 | Bacteria | 2222 |
| 286 | Ga0207428_10000053 | 3300027907 | Bacteria | 175238 |
| 287 | Ga0268266_10458405 | 3300028379 | Bacteria | 1213 |
| 288 | Ga0268266_10501314 | 3300028379 | Bacteria | 1159 |
| 289 | Ga0268266_10996606 | 3300028379 | Bacteria | 811 |
| 290 | Ga0268265_10003331 | 3300028380 | Bacteria | 11621 |
| 291 | Ga0268265_10040950 | 3300028380 | Bacteria | 3424 |
| 292 | Ga0265318_10031391 | 3300028577 | Bacteria | 2060 |
| 293 | Ga0307517_10250422 | 3300028786 | Bacteria | 1040 |
| 294 | Ga0307512_10144489 | 3300030522 | Bacteria | 1444 |
| 295 | Ga0265766_1012132 | 3300030863 | Bacteria | 634 |
| 296 | Ga0265332_10332329 | 3300031238 | Bacteria | 627 |
| 297 | Ga0265320_10234008 | 3300031240 | Bacteria | 816 |
| 298 | Ga0265331_10010519 | 3300031250 | Bacteria | 5117 |
| 299 | Ga0265327_10022748 | 3300031251 | Bacteria | 3735 |
| 300 | Ga0265327_10273164 | 3300031251 | Bacteria | 748 |
| 301 | Ga0265316_10229326 | 3300031344 | Bacteria | 1368 |
| 302 | Ga0307513_10011397 | 3300031456 | Bacteria | 11053 |
| 303 | Ga0307513_10030928 | 3300031456 | Bacteria | 6071 |
| 304 | Ga0307513_10331707 | 3300031456 | Bacteria | 1275 |
| 305 | Ga0307408_100692684 | 3300031548 | Bacteria | 915 |
| 306 | Ga0307408_100714472 | 3300031548 | Bacteria | 902 |
| 307 | Ga0265313_10017033 | 3300031595 | Bacteria | 4150 |
| 308 | Ga0265313_10277116 | 3300031595 | Bacteria | 678 |
| 309 | Ga0307508_10203929 | 3300031616 | Bacteria | 1578 |
| 310 | Ga0307508_10340192 | 3300031616 | Bacteria | 1092 |
| 311 | Ga0307508_10435681 | 3300031616 | Bacteria | 903 |
| 312 | Ga0316575_10249612 | 3300031665 | Bacteria | 744 |
| 313 | Ga0265314_10006902 | 3300031711 | Bacteria | 9946 |
| 314 | Ga0265314_10029014 | 3300031711 | Unclassified | 4117 |
| 315 | Ga0307516_10413440 | 3300031730 | Bacteria | 1007 |
| 316 | Ga0307516_10669122 | 3300031730 | Bacteria | 694 |
| 317 | Ga0307413_10046659 | 3300031824 | Bacteria | 2578 |
| 318 | Ga0307410_10014266 | 3300031852 | Bacteria | 4670 |
| 319 | Ga0307410_10448709 | 3300031852 | Bacteria | 1052 |
| 320 | Ga0307406_10816737 | 3300031901 | Bacteria | 788 |
| 321 | Ga0307407_10231447 | 3300031903 | Bacteria | 1255 |
| 322 | Ga0307412_10502348 | 3300031911 | Bacteria | 1010 |
| 323 | Ga0307412_11160376 | 3300031911 | Bacteria | 690 |
| 324 | Ga0307409_100084994 | 3300031995 | Bacteria | 2571 |
| 325 | Ga0307416_100810765 | 3300032002 | Bacteria | 1032 |
| 326 | Ga0307416_100940661 | 3300032002 | Bacteria | 966 |
| 327 | Ga0307411_10005095 | 3300032005 | Bacteria | 6407 |
| 328 | Ga0307415_100543113 | 3300032126 | Bacteria | 1024 |
| 329 | Ga0307507_10319895 | 3300033179 | Bacteria | 935 |
| 330 | Ga0307510_10387057 | 3300033180 | Bacteria | 843 |
| 331 | Ga0373926_0041884 | 3300035083 | Bacteria | 1637 |
| 332 | Ga0373926_0048800 | 3300035083 | Bacteria | 1523 |
| 333 | Ga0373928_0012132 | 3300035084 | Bacteria | 1715 |
| 334 | Ga0373934_0040650 | 3300035086 | Bacteria | 1835 |
| 335 | Ga0373934_0113052 | 3300035086 | Bacteria | 1102 |
| 336 | Ga0373934_0114513 | 3300035086 | Bacteria | 1095 |
| 337 | Ga0373944_0066037 | 3300035089 | Bacteria | 1169 |
| 338 | Ga0373944_0103556 | 3300035089 | Bacteria | 964 |
| 339 | Ga0373944_0188343 | 3300035089 | Bacteria | 742 |
| 340 | Ga0373949_0045409 | 3300035090 | Bacteria | 1092 |
| 341 | Ga0373923_0019540 | 3300035111 | Bacteria | 2624 |
| 342 | Ga0373923_0427864 | 3300035111 | Bacteria | 640 |
| 343 | Ga0373932_0446280 | 3300035112 | Bacteria | 507 |
| 344 | Ga0373936_0148156 | 3300035113 | Bacteria | 1016 |
| 345 | Ga0373936_0452550 | 3300035113 | Bacteria | 594 |
| 346 | Ga0373936_0457810 | 3300035113 | Bacteria | 590 |
| 347 | Ga0373941_0265586 | 3300035115 | Bacteria | 674 |
| 348 | Ga0373945_0548460 | 3300035116 | Bacteria | 519 |
| 349 | Ga0373953_0124537 | 3300035117 | Bacteria | 1096 |
| 350 | Ga0373956_0090446 | 3300035119 | Bacteria | 1412 |
| 351 | Ga0373956_0193336 | 3300035119 | Bacteria | 964 |
| 352 | Ga0373956_0626654 | 3300035119 | Bacteria | 513 |
| 353 | Ga0373960_0163900 | 3300035121 | Bacteria | 767 |
| 354 | Ga0373943_0024959 | 3300035170 | Bacteria | 2791 |
| 355 | Ga0373943_0072968 | 3300035170 | Bacteria | 1742 |
| 356 | Ga0373943_0150976 | 3300035170 | Bacteria | 1259 |
| 357 | Ga0373943_0329416 | 3300035170 | Bacteria | 872 |
| 358 | Ga0373943_0656291 | 3300035170 | Bacteria | 620 |
| 359 | Ga0373946_0285749 | 3300035171 | Bacteria | 812 |
| 360 | Ga0373946_0748392 | 3300035171 | Bacteria | 513 |
| 361 | Ga0373955_0091080 | 3300035172 | Bacteria | 1738 |
| 362 | Ga0373955_0688334 | 3300035172 | Bacteria | 627 |
| 363 | Ga0373961_0097912 | 3300035241 | Bacteria | 946 |
| 364 | Ga0373924_0148689 | 3300035410 | Bacteria | 1024 |
| 365 | Ga0373924_0177433 | 3300035410 | Bacteria | 937 |
| 366 | Ga0373931_0223938 | 3300035691 | Bacteria | 1134 |
| 367 | Ga0373931_0926401 | 3300035691 | Bacteria | 587 |
| 368 | Ga0373935_0037551 | 3300035692 | Bacteria | 3032 |
| 369 | Ga0373935_0055364 | 3300035692 | Bacteria | 2527 |
| 370 | Ga0373935_0130502 | 3300035692 | Bacteria | 1688 |
| 371 | Ga0373935_0189961 | 3300035692 | Bacteria | 1414 |
| 372 | Ga0373927_0358260 | 3300035695 | Bacteria | 961 |
| 373 | Ga0373927_0855059 | 3300035695 | Bacteria | 601 |
| 374 | Ga0373933_0038954 | 3300035724 | Bacteria | 2795 |
| 375 | Ga0373933_0052453 | 3300035724 | Bacteria | 2441 |
| 376 | Ga0373933_0102790 | 3300035724 | Bacteria | 1774 |
| 377 | Ga0373947_0085242 | 3300035725 | Bacteria | 1962 |
| 378 | Ga0373947_0133015 | 3300035725 | Bacteria | 1589 |
| 379 | Ga0373947_0363468 | 3300035725 | Bacteria | 972 |
| 380 | Ga0373937_0004132 | 3300036401 | Bacteria | 12314 |
| 381 | Ga0373937_0043397 | 3300036401 | Bacteria | 4105 |
| 382 | Ga0373937_0068945 | 3300036401 | Bacteria | 3260 |
| 383 | Ga0373937_0285954 | 3300036401 | Bacteria | 1558 |
| 384 | Ga0373937_0533026 | 3300036401 | Bacteria | 1115 |
| 385 | Ga0373937_0943489 | 3300036401 | Bacteria | 811 |
| 386 | Ga0373937_1128736 | 3300036401 | Bacteria | 732 |
| 387 | Ga0265778_029150 | 3300036457 | Bacteria | 709 |
| 388 | Ga0373925_0019399 | 3300037068 | Bacteria | 4945 |
| 389 | Ga0373925_0049816 | 3300037068 | Bacteria | 3123 |
| 390 | Ga0395899_0005089 | 3300037312 | Bacteria | 10233 |
| 391 | Ga0395899_0007355 | 3300037312 | Bacteria | 8517 |
| 392 | Ga0395900_0001400 | 3300037418 | Bacteria | 28853 |
| 393 | Ga0395900_0018475 | 3300037418 | Bacteria | 7110 |
| 394 | Ga0395900_1035247 | 3300037418 | Bacteria | 740 |
| 395 | Ga0395898_0000900 | 3300037466 | Bacteria | 47837 |
| 396 | Ga0395898_0605545 | 3300037466 | Bacteria | 1038 |
| 397 | Ga0395905_0067084 | 3300037471 | Bacteria | 3360 |
| 398 | Ga0395905_0276935 | 3300037471 | Bacteria | 1564 |
| 399 | Ga0395905_0574467 | 3300037471 | Bacteria | 1029 |
| 400 | Ga0436364_0036184 | 3300037853 | Bacteria | 1186 |
| 401 | Ga0436364_0111974 | 3300037853 | Bacteria | 2540 |
| 402 | Ga0436364_0113231 | 3300037853 | Bacteria | 2434 |
| 403 | Ga0436364_0215514 | 3300037853 | Bacteria | 533 |
| 404 | Ga0436364_0411459 | 3300037853 | Bacteria | 10009 |
| 405 | Ga0436364_0477303 | 3300037853 | Bacteria | 13445 |
| 406 | Ga0436364_0672710 | 3300037853 | Bacteria | 2037 |
| 407 | Ga0436364_0885115 | 3300037853 | Bacteria | 2128 |
| 408 | Ga0436364_1081267 | 3300037853 | Bacteria | 917 |
| 409 | Ga0436364_1098413 | 3300037853 | Bacteria | 5173 |
| 410 | Ga0436364_1309888 | 3300037853 | Bacteria | 7461 |
| 411 | Ga0395901_0056651 | 3300038443 | Bacteria | 4078 |
| 412 | Ga0395901_0853428 | 3300038443 | Bacteria | 896 |
| 413 | Ga0436365_0467011 | 3300039437 | Bacteria | 988 |
| 414 | Ga0436365_0903003 | 3300039437 | Bacteria | 2538 |
| 415 | Ga0436365_1129065 | 3300039437 | Bacteria | 5253 |
| 416 | Ga0436365_1147776 | 3300039437 | Bacteria | 8467 |
| 417 | Ga0436365_1208761 | 3300039437 | Bacteria | 1010 |
| 418 | Ga0436365_1232053 | 3300039437 | Bacteria | 828 |
| 419 | Ga0436365_1314286 | 3300039437 | Bacteria | 917 |
| 420 | Ga0436365_1610296 | 3300039437 | Bacteria | 6219 |
| 421 | Ga0436365_1633210 | 3300039437 | Bacteria | 796 |
| 422 | Ga0436365_1888295 | 3300039437 | Bacteria | 2061 |
| 423 | Ga0436360_0374512 | 3300039438 | Bacteria | 724 |
| 424 | Ga0436360_0716050 | 3300039438 | Bacteria | 766 |
| 425 | Ga0436360_1248709 | 3300039438 | Bacteria | 1457 |
| 426 | Ga0436361_0312844 | 3300039447 | Bacteria | 1729 |
| 427 | Ga0436361_0432672 | 3300039447 | Bacteria | 770 |
| 428 | Ga0436361_0700345 | 3300039447 | Bacteria | 4383 |
| 429 | Ga0436363_0125784 | 3300039450 | Bacteria | 539 |
| 430 | Ga0436363_0237499 | 3300039450 | Bacteria | 510 |
| 431 | Ga0436363_0461717 | 3300039450 | Bacteria | 631 |
| 432 | Ga0436363_0492694 | 3300039450 | Bacteria | 4775 |
| 433 | Ga0436363_0721779 | 3300039450 | Bacteria | 1033 |
| 434 | Ga0436363_1167688 | 3300039450 | Bacteria | 588 |
| 435 | Ga0436363_1275384 | 3300039450 | Bacteria | 775 |
| 436 | Ga0436363_1319859 | 3300039450 | Bacteria | 658 |
| 437 | Ga0436363_1343244 | 3300039450 | Bacteria | 523 |
| 438 | Ga0436362_0315033 | 3300039453 | Bacteria | 1287 |
| 439 | Ga0436362_0353673 | 3300039453 | Unclassified | 926 |
| 440 | Ga0436362_0906723 | 3300039453 | Bacteria | 837 |
| 441 | Ga0439436_0103227 | 3300041404 | Bacteria | 795 |
| 442 | Ga0451789_0949761 | 3300041443 | Bacteria | 923 |
| 443 | Ga0451798_0574671 | 3300041458 | Bacteria | 608 |
| 444 | Ga0451847_0771257 | 3300041503 | Bacteria | 852 |
| 445 | Ga0451851_0172888 | 3300041507 | Bacteria | 850 |
| 446 | Ga0451853_0589475 | 3300041512 | Bacteria | 759 |
| 447 | Ga0439437_048427 | 3300042000 | Bacteria | 561 |
| 448 | Ga0439441_014360 | 3300042001 | Bacteria | 1388 |
| 449 | Ga0439434_0170936 | 3300042435 | Bacteria | 725 |
| 450 | Ga0466972_0196919 | 3300044658 | Bacteria | 944 |
| 451 | Ga0466963_0441152 | 3300044694 | Bacteria | 918 |
| 452 | Ga0466963_0443599 | 3300044694 | Bacteria | 916 |
| 453 | Ga0466963_1068187 | 3300044694 | Bacteria | 568 |
| 454 | Ga0453684_0021431 | 3300044712 | Bacteria | 9655 |
| 455 | Ga0466968_0581988 | 3300044735 | Bacteria | 564 |
| 456 | Ga0466957_0888659 | 3300044842 | Bacteria | 636 |
| 457 | Ga0466959_1051046 | 3300045049 | Bacteria | 542 |
| 458 | Ga0451576_0350215 | 3300045051 | Bacteria | 1546 |
| 459 | Ga0466967_0287263 | 3300045976 | Bacteria | 1579 |
| 460 | Ga0466967_1145058 | 3300045976 | Bacteria | 775 |
| 461 | Ga0466967_1449856 | 3300045976 | Bacteria | 684 |
| 462 | Ga0466967_1834762 | 3300045976 | Bacteria | 603 |
| 463 | Ga0495592_0103194 | 3300046454 | Bacteria | 2029 |
| 464 | Ga0495638_0208818 | 3300046460 | Bacteria | 1098 |
| 465 | Ga0495638_0258261 | 3300046460 | Bacteria | 957 |
| 466 | Ga0495638_0406070 | 3300046460 | Bacteria | 706 |
| 467 | Ga0495651_0015987 | 3300046462 | Bacteria | 5813 |
| 468 | Ga0495651_0450842 | 3300046462 | Bacteria | 831 |
| 469 | Ga0495653_0142116 | 3300046463 | Bacteria | 1687 |
| 470 | Ga0495653_0301793 | 3300046463 | Bacteria | 1044 |
| 471 | Ga0495653_0502247 | 3300046463 | Bacteria | 756 |
| 472 | Ga0495650_0131912 | 3300046471 | Bacteria | 911 |
| 473 | Ga0495650_0204465 | 3300046471 | Bacteria | 685 |
| 474 | Ga0495580_0086028 | 3300046472 | Bacteria | 2189 |
| 475 | Ga0495664_0007401 | 3300046477 | Bacteria | 6097 |
| 476 | Ga0495664_0530502 | 3300046477 | Bacteria | 702 |
| 477 | Ga0495594_0890618 | 3300046499 | Bacteria | 500 |
| 478 | Ga0495608_0035794 | 3300046511 | Bacteria | 3346 |
| 479 | Ga0495608_0164087 | 3300046511 | Bacteria | 1411 |
| 480 | Ga0495608_0558150 | 3300046511 | Bacteria | 690 |
| 481 | Ga0495616_0356645 | 3300046513 | Bacteria | 608 |
| 482 | Ga0495618_0757864 | 3300046514 | Bacteria | 567 |
| 483 | Ga0495628_0032249 | 3300046516 | Bacteria | 4231 |
| 484 | Ga0495628_0218403 | 3300046516 | Bacteria | 1432 |
| 485 | Ga0495628_0437910 | 3300046516 | Bacteria | 951 |
| 486 | Ga0495628_0863169 | 3300046516 | Bacteria | 630 |
| 487 | Ga0495630_0183191 | 3300046517 | Bacteria | 1597 |
| 488 | Ga0495630_1376971 | 3300046517 | Bacteria | 531 |
| 489 | Ga0495632_0270586 | 3300046519 | Bacteria | 758 |
| 490 | Ga0495666_0164282 | 3300046526 | Bacteria | 1029 |
| 491 | Ga0495652_0175705 | 3300046529 | Bacteria | 1649 |
| 492 | Ga0495652_0548336 | 3300046529 | Bacteria | 795 |
| 493 | Ga0495654_0160837 | 3300046530 | Bacteria | 986 |
| 494 | Ga0495665_0065246 | 3300046531 | Bacteria | 1922 |
| 495 | Ga0495640_0071080 | 3300046533 | Bacteria | 2336 |
| 496 | Ga0495586_0031962 | 3300046535 | Bacteria | 2822 |
| 497 | Ga0495586_0106039 | 3300046535 | Bacteria | 1563 |
| 498 | Ga0495586_0198906 | 3300046535 | Bacteria | 1136 |
| 499 | Ga0495587_0092548 | 3300046536 | Bacteria | 1746 |
| 500 | Ga0495587_0107762 | 3300046536 | Bacteria | 1602 |
| 501 | Ga0495587_0157509 | 3300046536 | Bacteria | 1293 |
| 502 | Ga0495587_0533868 | 3300046536 | Bacteria | 648 |
| 503 | Ga0495621_0511443 | 3300046539 | Bacteria | 519 |
| 504 | Ga0495645_0001048 | 3300046543 | Bacteria | 18835 |
| 505 | Ga0495645_0094561 | 3300046543 | Bacteria | 2132 |
| 506 | Ga0495645_0382056 | 3300046543 | Bacteria | 901 |
| 507 | Ga0495667_0060660 | 3300046559 | Bacteria | 2480 |
| 508 | Ga0495667_0066954 | 3300046559 | Bacteria | 2347 |
| 509 | Ga0495667_0112423 | 3300046559 | Bacteria | 1760 |
| 510 | Ga0495634_0339840 | 3300046642 | Bacteria | 901 |
| 511 | Ga0495625_0291943 | 3300046660 | Bacteria | 1046 |
| 512 | Ga0495635_0037350 | 3300046663 | Bacteria | 3363 |
| 513 | Ga0495635_0102720 | 3300046663 | Bacteria | 1953 |
| 514 | Ga0495635_0308530 | 3300046663 | Bacteria | 1060 |
| 515 | Ga0495657_0032830 | 3300046675 | Bacteria | 3619 |
| 516 | Ga0495657_0095624 | 3300046675 | Bacteria | 1899 |
| 517 | Ga0495599_0018777 | 3300046678 | Bacteria | 4310 |
| 518 | Ga0495599_0341109 | 3300046678 | Bacteria | 899 |
| 519 | Ga0495646_0163046 | 3300046680 | Bacteria | 1233 |
| 520 | Ga0495646_0199190 | 3300046680 | Bacteria | 1091 |
| 521 | Ga0495646_0646767 | 3300046680 | Bacteria | 535 |
| 522 | Ga0495658_0593598 | 3300046683 | Bacteria | 709 |
| 523 | Ga0495658_0883977 | 3300046683 | Bacteria | 571 |
| 524 | Ga0495649_0202213 | 3300046694 | Bacteria | 1031 |
| 525 | Ga0495600_0055602 | 3300046809 | Bacteria | 2585 |
| 526 | Ga0495600_0095128 | 3300046809 | Bacteria | 1942 |
| 527 | Ga0495600_0358027 | 3300046809 | Bacteria | 913 |
| 528 | Ga0495604_0020602 | 3300047317 | Bacteria | 5267 |
| 529 | Ga0495674_0304641 | 3300047319 | Bacteria | 1301 |
| 530 | Ga0495674_0599689 | 3300047319 | Bacteria | 873 |
| 531 | Ga0495674_0670755 | 3300047319 | Bacteria | 816 |
| 532 | Ga0495674_1199658 | 3300047319 | Bacteria | 574 |
| 533 | Ga0495680_0019357 | 3300047322 | Bacteria | 5748 |
| 534 | Ga0495680_0099966 | 3300047322 | Bacteria | 2162 |
| 535 | Ga0495680_0157745 | 3300047322 | Bacteria | 1650 |
| 536 | Ga0495680_0624315 | 3300047322 | Bacteria | 719 |
| 537 | Ga0495675_0068351 | 3300047444 | Bacteria | 2244 |
| 538 | Ga0495675_0516014 | 3300047444 | Bacteria | 685 |
| 539 | Ga0495684_0239279 | 3300047471 | Bacteria | 1325 |
| 540 | Ga0495684_0245718 | 3300047471 | Bacteria | 1304 |
| 541 | Ga0495686_0130629 | 3300047472 | Bacteria | 1489 |
| 542 | Ga0495593_0214911 | 3300047673 | Bacteria | 965 |
| 543 | Ga0495602_0307176 | 3300048088 | Bacteria | 1159 |
| 544 | Ga0495602_0908974 | 3300048088 | Bacteria | 585 |
| 545 | Ga0496104_0322468 | 3300048907 | Bacteria | 1458 |
| 546 | Ga0496104_1065118 | 3300048907 | Bacteria | 712 |
| 547 | Ga0496105_0838251 | 3300048908 | Bacteria | 697 |
| 548 | Ga0496107_0541015 | 3300048910 | Bacteria | 863 |
| 549 | Ga0496108_0736049 | 3300048911 | Bacteria | 854 |
| 550 | Ga0496108_1182249 | 3300048911 | Bacteria | 647 |
| 551 | Ga0496109_0685978 | 3300048912 | Bacteria | 962 |
| 552 | Ga0496110_0722519 | 3300048913 | Bacteria | 898 |
| 553 | Ga0496112_0028084 | 3300048915 | Bacteria | 5428 |
| 554 | Ga0496112_1124027 | 3300048915 | Bacteria | 703 |
| 555 | Ga0496113_0313828 | 3300048916 | Bacteria | 1256 |
| 556 | Ga0496115_1397876 | 3300048918 | Bacteria | 517 |
| 557 | Ga0496119_0028935 | 3300048922 | Bacteria | 3769 |
| 558 | Ga0496120_0065313 | 3300048923 | Bacteria | 2017 |
| 559 | Ga0496121_0604692 | 3300048924 | Bacteria | 676 |
| 560 | Ga0496122_0093714 | 3300048925 | Bacteria | 2036 |
| 561 | Ga0496126_1042070 | 3300048929 | Bacteria | 611 |
| 562 | Ga0501306_036639 | 3300049127 | Bacteria | 748 |
| 563 | Ga0501308_017191 | 3300049128 | Bacteria | 873 |
| 564 | Ga0501304_025981 | 3300049160 | Bacteria | 602 |
| 565 | Ga0501305_026035 | 3300049161 | Bacteria | 890 |
| 566 | Ga0501307_018192 | 3300049162 | Bacteria | 891 |
| 567 | Ga0501312_030161 | 3300049528 | Bacteria | 847 |
| 568 | Ga0501317_067791 | 3300049533 | Bacteria | 597 |
| 569 | Ga0501320_018397 | 3300049536 | Bacteria | 789 |
| 570 | Ga0501321_051496 | 3300049537 | Bacteria | 603 |
| 571 | Ga0501330_008281 | 3300049546 | Bacteria | 711 |
| 572 | Ga0501031_0000746 | 3300049568 | Bacteria | 19554 |
| 573 | Ga0501031_0487647 | 3300049568 | Bacteria | 795 |
| 574 | Ga0501031_0520995 | 3300049568 | Bacteria | 766 |
| 575 | Ga0501031_0742931 | 3300049568 | Bacteria | 629 |
| 576 | Ga0501032_0038762 | 3300049569 | Bacteria | 3243 |
| 577 | Ga0501032_0231684 | 3300049569 | Bacteria | 1201 |
| 578 | Ga0501032_0864718 | 3300049569 | Bacteria | 570 |
| 579 | Ga0501033_0001088 | 3300049570 | Bacteria | 24589 |
| 580 | Ga0501033_0191591 | 3300049570 | Bacteria | 1463 |
| 581 | Ga0501033_0249090 | 3300049570 | Bacteria | 1259 |
| 582 | Ga0501033_0371443 | 3300049570 | Bacteria | 1000 |
| 583 | Ga0501033_0406435 | 3300049570 | Bacteria | 949 |
| 584 | Ga0501034_0079145 | 3300049571 | Bacteria | 3290 |
| 585 | Ga0501034_0634452 | 3300049571 | Bacteria | 971 |
| 586 | Ga0501034_1038391 | 3300049571 | Bacteria | 702 |
| 587 | Ga0501036_0009451 | 3300049572 | Bacteria | 8020 |
| 588 | Ga0501036_0027538 | 3300049572 | Bacteria | 4802 |
| 589 | Ga0501036_0287002 | 3300049572 | Bacteria | 1377 |
| 590 | Ga0501036_0657439 | 3300049572 | Bacteria | 867 |
| 591 | Ga0501037_0012673 | 3300049573 | Bacteria | 6213 |
| 592 | Ga0501037_0021183 | 3300049573 | Bacteria | 4803 |
| 593 | Ga0501037_0026225 | 3300049573 | Bacteria | 4306 |
| 594 | Ga0501037_0631153 | 3300049573 | Bacteria | 717 |
| 595 | Ga0501037_0682819 | 3300049573 | Bacteria | 684 |
| 596 | Ga0501038_0036006 | 3300049574 | Bacteria | 4343 |
| 597 | Ga0501038_0049072 | 3300049574 | Bacteria | 3650 |
| 598 | Ga0501038_0113361 | 3300049574 | Bacteria | 2244 |
| 599 | Ga0501038_0494069 | 3300049574 | Bacteria | 936 |
| 600 | Ga0501038_0813965 | 3300049574 | Bacteria | 693 |
| 601 | Ga0501038_0928379 | 3300049574 | Bacteria | 641 |
| 602 | Ga0501038_1111254 | 3300049574 | Bacteria | 577 |
| 603 | Ga0501039_0006574 | 3300049575 | Bacteria | 8827 |
| 604 | Ga0501039_0122261 | 3300049575 | Bacteria | 2041 |
| 605 | Ga0501039_0228384 | 3300049575 | Bacteria | 1463 |
| 606 | Ga0501043_0021304 | 3300049579 | Bacteria | 5081 |
| 607 | Ga0501043_0074121 | 3300049579 | Bacteria | 2673 |
| 608 | Ga0501043_0467805 | 3300049579 | Bacteria | 945 |
| 609 | Ga0501043_0571431 | 3300049579 | Bacteria | 838 |
| 610 | Ga0501046_0017076 | 3300049580 | Bacteria | 6065 |
| 611 | Ga0501046_0043408 | 3300049580 | Bacteria | 3580 |
| 612 | Ga0501047_0018894 | 3300049581 | Bacteria | 6609 |
| 613 | Ga0501047_0027283 | 3300049581 | Bacteria | 5501 |
| 614 | Ga0501047_0079627 | 3300049581 | Bacteria | 3150 |
| 615 | Ga0501047_0086631 | 3300049581 | Bacteria | 3009 |
| 616 | Ga0501047_0475779 | 3300049581 | Bacteria | 1077 |
| 617 | Ga0501047_0750137 | 3300049581 | Bacteria | 792 |
| 618 | Ga0501048_0014974 | 3300049582 | Bacteria | 5735 |
| 619 | Ga0501048_0831719 | 3300049582 | Bacteria | 664 |
| 620 | Ga0501067_0029448 | 3300049583 | Bacteria | 3043 |
| 621 | Ga0501067_0074591 | 3300049583 | Bacteria | 1880 |
| 622 | Ga0501067_0140492 | 3300049583 | Bacteria | 1345 |
| 623 | Ga0501067_0179860 | 3300049583 | Bacteria | 1178 |
| 624 | Ga0501067_0663957 | 3300049583 | Bacteria | 585 |
| 625 | Ga0501068_0198978 | 3300049584 | Bacteria | 1270 |
| 626 | Ga0501068_1123870 | 3300049584 | Bacteria | 520 |
| 627 | Ga0501069_0007311 | 3300049585 | Bacteria | 5794 |
| 628 | Ga0501069_0308996 | 3300049585 | Bacteria | 928 |
| 629 | Ga0501070_0002774 | 3300049586 | Bacteria | 15285 |
| 630 | Ga0501070_0104191 | 3300049586 | Bacteria | 2346 |
| 631 | Ga0501070_0189245 | 3300049586 | Bacteria | 1692 |
| 632 | Ga0501070_0205040 | 3300049586 | Bacteria | 1619 |
| 633 | Ga0501070_0253791 | 3300049586 | Bacteria | 1438 |
| 634 | Ga0501070_0741632 | 3300049586 | Bacteria | 774 |
| 635 | Ga0501070_1002957 | 3300049586 | Bacteria | 647 |
| 636 | Ga0501071_0764430 | 3300049587 | Bacteria | 745 |
| 637 | Ga0501071_0918175 | 3300049587 | Bacteria | 676 |
| 638 | Ga0501072_1396897 | 3300049588 | Bacteria | 542 |
| 639 | Ga0501073_0010974 | 3300049589 | Bacteria | 6627 |
| 640 | Ga0501073_0069939 | 3300049589 | Bacteria | 2445 |
| 641 | Ga0501073_0101137 | 3300049589 | Bacteria | 2001 |
| 642 | Ga0501073_0288078 | 3300049589 | Bacteria | 1133 |
| 643 | Ga0501073_0972516 | 3300049589 | Bacteria | 584 |
| 644 | Ga0501074_0004909 | 3300049590 | Bacteria | 9586 |
| 645 | Ga0501074_0206129 | 3300049590 | Bacteria | 1401 |
| 646 | Ga0501074_0908769 | 3300049590 | Bacteria | 620 |
| 647 | Ga0501076_0610968 | 3300049592 | Bacteria | 900 |
| 648 | Ga0501076_1516660 | 3300049592 | Bacteria | 550 |
| 649 | Ga0501077_0588232 | 3300049593 | Bacteria | 715 |
| 650 | Ga0501079_0033209 | 3300049741 | Bacteria | 3969 |
| 651 | Ga0501079_0877830 | 3300049741 | Bacteria | 706 |
| 652 | Ga0501080_0057283 | 3300049742 | Bacteria | 3628 |
| 653 | Ga0501080_0064237 | 3300049742 | Bacteria | 3415 |
| 654 | Ga0501080_0078558 | 3300049742 | Bacteria | 3069 |
| 655 | Ga0501080_0089615 | 3300049742 | Bacteria | 2857 |
| 656 | Ga0501080_0251245 | 3300049742 | Bacteria | 1612 |
| 657 | Ga0501080_1164738 | 3300049742 | Bacteria | 664 |
| 658 | Ga0501081_0743548 | 3300049743 | Bacteria | 737 |
| 659 | Ga0501083_0012062 | 3300049744 | Bacteria | 6051 |
| 660 | Ga0501083_0014527 | 3300049744 | Bacteria | 5506 |
| 661 | Ga0501083_0029520 | 3300049744 | Bacteria | 3770 |
| 662 | Ga0501083_0059514 | 3300049744 | Bacteria | 2555 |
| 663 | Ga0501083_0598309 | 3300049744 | Bacteria | 717 |
| 664 | Ga0501035_0001712 | 3300049822 | Bacteria | 22167 |
| 665 | Ga0501035_0040360 | 3300049822 | Bacteria | 4218 |
| 666 | Ga0501044_0004509 | 3300049823 | Bacteria | 15571 |
| 667 | Ga0501044_0010946 | 3300049823 | Bacteria | 9846 |
| 668 | Ga0501044_0022918 | 3300049823 | Bacteria | 6649 |
| 669 | Ga0501044_0183493 | 3300049823 | Bacteria | 2058 |
| 670 | Ga0501044_1260952 | 3300049823 | Bacteria | 606 |
| 671 | Ga0501044_1315779 | 3300049823 | Bacteria | 589 |
| 672 | Ga0501044_1408738 | 3300049823 | Bacteria | 562 |
| 673 | nmdc:mga03683_64894_c1 | 3300050489 | Bacteria | 1550 |
| 674 | nmdc:mga0k408_182502_c1 | 3300050493 | Bacteria | 1252 |
| 675 | nmdc:mga0k408_305274_c1 | 3300050493 | Bacteria | 950 |
| 676 | nmdc:mga0k408_324352_c1 | 3300050493 | Bacteria | 919 |
| 677 | nmdc:mga07m45_423858_c1 | 3300050496 | Bacteria | 772 |
| 678 | nmdc:mga07m45_721526_c1 | 3300050496 | Bacteria | 573 |
| 679 | nmdc:mga05p37_812908_c1 | 3300050507 | Bacteria | 1021 |
| 680 | nmdc:mga09592_403757_c1 | 3300050508 | Bacteria | 1181 |
| 681 | nmdc:mga0qj67_187086_c1 | 3300050509 | Bacteria | 1682 |
| 682 | nmdc:mga06r32_469783_c1 | 3300050510 | Unclassified | 1236 |
| 683 | nmdc:mga08y16_1094295_c1 | 3300050511 | Bacteria | 772 |
| 684 | nmdc:mga08y16_1266855_c1 | 3300050511 | Bacteria | 705 |
| 685 | nmdc:mga08y16_30_c1 | 3300050511 | Bacteria | 197110 |
| 686 | nmdc:mga0rr50_1435071_c1 | 3300050513 | Bacteria | 584 |
| 687 | nmdc:mga0rr50_334987_c1 | 3300050513 | Bacteria | 1271 |
| 688 | nmdc:mga0rr50_926424_c1 | 3300050513 | Bacteria | 743 |
| 689 | nmdc:mga08x19_1090557_c1 | 3300050514 | Bacteria | 567 |
| 690 | nmdc:mga08x19_22108_c1 | 3300050514 | Bacteria | 3935 |
| 691 | nmdc:mga08x19_372470_c1 | 3300050514 | Bacteria | 999 |
| 692 | nmdc:mga08x19_869682_c1 | 3300050514 | Bacteria | 640 |
| 693 | nmdc:mga0a205_469293_c1 | 3300050515 | Bacteria | 1117 |
| 694 | Ga0495601_0017391 | 3300053077 | Bacteria | 4363 |
| 695 | Ga0495601_0175711 | 3300053077 | Bacteria | 1400 |
| 696 | Ga0495601_0430126 | 3300053077 | Bacteria | 854 |
| 697 | Ga0495612_0001439 | 3300053078 | Bacteria | 9789 |
| 698 | Ga0500635_0110166 | 3300053080 | Bacteria | 1022 |
| 699 | Ga0495595_0006518 | 3300053084 | Bacteria | 4761 |
| 700 | Ga0495595_0290741 | 3300053084 | Bacteria | 821 |
| 701 | Ga0495619_0012325 | 3300053085 | Bacteria | 5381 |
| 702 | Ga0495619_0022600 | 3300053085 | Bacteria | 4027 |
| 703 | Ga0500578_0071339 | 3300053086 | Bacteria | 2214 |
| 704 | Ga0500643_029329 | 3300053087 | Bacteria | 1693 |
| 705 | Ga0500644_0241859 | 3300053088 | Bacteria | 758 |
| 706 | Ga0500646_0020601 | 3300053090 | Bacteria | 1752 |
| 707 | Ga0500651_0221104 | 3300053093 | Bacteria | 1110 |
| 708 | Ga0500566_0097934 | 3300053094 | Bacteria | 1612 |
| 709 | Ga0500566_0310063 | 3300053094 | Bacteria | 739 |
| 710 | Ga0500641_0021232 | 3300053096 | Bacteria | 2472 |
| 711 | Ga0500650_0518953 | 3300053098 | Bacteria | 505 |
| 712 | Ga0500654_192900 | 3300053099 | Bacteria | 628 |
| 713 | Ga0500562_076417 | 3300053108 | Bacteria | 905 |
| 714 | Ga0500569_212279 | 3300053109 | Bacteria | 658 |
| 715 | Ga0500592_043072 | 3300053116 | Bacteria | 731 |
| 716 | Ga0500595_000373 | 3300053119 | Bacteria | 28891 |
| 717 | Ga0500595_037370 | 3300053119 | Bacteria | 1584 |
| 718 | Ga0500597_108159 | 3300053120 | Bacteria | 1208 |
| 719 | Ga0500628_117338 | 3300053129 | Bacteria | 719 |
| 720 | Ga0500642_0067165 | 3300053130 | Bacteria | 1624 |
| 721 | Ga0500642_0074337 | 3300053130 | Bacteria | 1550 |
| 722 | Ga0500658_0001902 | 3300053134 | Bacteria | 8191 |
| 723 | Ga0500658_0137050 | 3300053134 | Bacteria | 1095 |
| 724 | Ga0500559_0006760 | 3300053136 | Bacteria | 5148 |
| 725 | Ga0500577_0006212 | 3300053142 | Bacteria | 3278 |
| 726 | Ga0500577_0136330 | 3300053142 | Bacteria | 1032 |
| 727 | Ga0500588_0008130 | 3300053146 | Bacteria | 2440 |
| 728 | Ga0500588_0063235 | 3300053146 | Bacteria | 1192 |
| 729 | Ga0500589_231312 | 3300053147 | Bacteria | 690 |
| 730 | Ga0500616_0002311 | 3300053153 | Bacteria | 16127 |
| 731 | Ga0500616_0158193 | 3300053153 | Bacteria | 1041 |
| 732 | Ga0500622_0228975 | 3300053156 | Bacteria | 829 |
| 733 | Ga0500633_0034246 | 3300053160 | Bacteria | 1664 |
| 734 | Ga0500634_0196142 | 3300053161 | Bacteria | 892 |
| 735 | Ga0500639_009208 | 3300053163 | Bacteria | 5159 |
| 736 | Ga0500645_011365 | 3300053730 | Bacteria | 2911 |
| 737 | Ga0500656_009172 | 3300053732 | Bacteria | 1060 |
| 738 | Ga0500599_001851 | 3300053736 | Bacteria | 2492 |
| 739 | Ga0500587_036418 | 3300053739 | Bacteria | 692 |
| 740 | Ga0501084_0055666 | 3300054114 | Bacteria | 3309 |
| 741 | Ga0501084_0166383 | 3300054114 | Bacteria | 1861 |
| 742 | Ga0501084_0610348 | 3300054114 | Bacteria | 922 |
| 743 | Ga0590071_005820 | 3300059421 | Bacteria | 2957 |
| 744 | Ga0590074_006608 | 3300059423 | Bacteria | 1925 |
| 745 | Ga0590075_074244 | 3300059424 | Bacteria | 879 |
| 746 | Ga0590077_017261 | 3300059426 | Bacteria | 1517 |
| 747 | Ga0587084_038845 | 3300059477 | Bacteria | 800 |
| 748 | Ga0587066_050277 | 3300059490 | Bacteria | 818 |
| 749 | Ga0587066_075098 | 3300059490 | Bacteria | 720 |
| 750 | Ga0587070_054427 | 3300059491 | Bacteria | 809 |
| 751 | Ga0587073_0038046 | 3300059492 | Bacteria | 1034 |
| 752 | Ga0587073_0144482 | 3300059492 | Bacteria | 667 |
| 753 | Ga0587077_009634 | 3300059493 | Bacteria | 1471 |
| 754 | Ga0587077_093256 | 3300059493 | Bacteria | 711 |
| 755 | Ga0587077_106665 | 3300059493 | Bacteria | 680 |
| 756 | Ga0587077_265807 | 3300059493 | Bacteria | 502 |
| 757 | Ga0587080_075426 | 3300059503 | Bacteria | 682 |
| 758 | Ga0587082_054548 | 3300059504 | Bacteria | 772 |
| 759 | Ga0587082_068418 | 3300059504 | Bacteria | 716 |
| 760 | Ga0587082_081926 | 3300059504 | Bacteria | 674 |
| 761 | Ga0587083_0037861 | 3300059505 | Bacteria | 994 |
| 762 | Ga0587085_059392 | 3300059506 | Bacteria | 719 |
| 763 | Ga0587085_154652 | 3300059506 | Bacteria | 532 |
| 764 | Ga0587086_040383 | 3300059507 | Bacteria | 720 |
| 765 | Ga0587086_044880 | 3300059507 | Bacteria | 696 |
| 766 | Ga0587086_117437 | 3300059507 | Bacteria | 505 |
| 767 | Ga0587088_030951 | 3300059508 | Bacteria | 956 |
| 768 | Ga0587088_080223 | 3300059508 | Bacteria | 697 |
| 769 | Ga0587090_041184 | 3300059510 | Bacteria | 814 |
| 770 | Ga0587094_047792 | 3300059513 | Bacteria | 716 |
| 771 | Ga0587098_032842 | 3300059604 | Bacteria | 722 |
| 772 | Ga0587106_111428 | 3300059605 | Bacteria | 570 |
| 773 | Ga0587101_006209 | 3300059623 | Bacteria | 1361 |
| 774 | Ga0587101_056654 | 3300059623 | Bacteria | 690 |
| 775 | Ga0587101_062328 | 3300059623 | Bacteria | 669 |
| 776 | Ga0587101_062603 | 3300059623 | Bacteria | 668 |
| 777 | Ga0587109_079391 | 3300059624 | Bacteria | 723 |
| 778 | Ga0587115_045378 | 3300059626 | Bacteria | 699 |
| 779 | Ga0587115_063508 | 3300059626 | Bacteria | 624 |
| 780 | Ga0587117_033042 | 3300059627 | Bacteria | 790 |
| 781 | Ga0587062_012627 | 3300059639 | Bacteria | 1087 |
| 782 | Ga0587062_039152 | 3300059639 | Bacteria | 762 |
| 783 | Ga0587062_051698 | 3300059639 | Bacteria | 698 |
| 784 | Ga0587067_020751 | 3300059640 | Bacteria | 1127 |
| 785 | Ga0587067_030304 | 3300059640 | Bacteria | 994 |
| 786 | Ga0587067_055273 | 3300059640 | Bacteria | 816 |
| 787 | Ga0587067_072911 | 3300059640 | Bacteria | 745 |
| 788 | Ga0587068_019478 | 3300059641 | Bacteria | 1100 |
| 789 | Ga0587068_042430 | 3300059641 | Bacteria | 827 |
| 790 | Ga0587068_055252 | 3300059641 | Bacteria | 752 |
| 791 | Ga0587068_072926 | 3300059641 | Bacteria | 680 |
| 792 | Ga0587069_026259 | 3300059642 | Bacteria | 911 |
| 793 | Ga0587069_056022 | 3300059642 | Bacteria | 714 |
| 794 | Ga0587072_054357 | 3300059643 | Bacteria | 810 |
| 795 | Ga0587072_058935 | 3300059643 | Bacteria | 786 |
| 796 | Ga0587076_022183 | 3300059645 | Bacteria | 1058 |
| 797 | Ga0587076_069642 | 3300059645 | Bacteria | 728 |
| 798 | Ga0587076_081096 | 3300059645 | Bacteria | 692 |
| 799 | Ga0587076_089574 | 3300059645 | Bacteria | 670 |
| 800 | Ga0587078_030048 | 3300059646 | Bacteria | 729 |
| 801 | Ga0587079_032114 | 3300059647 | Bacteria | 1015 |
| 802 | Ga0587079_076846 | 3300059647 | Bacteria | 756 |
| 803 | Ga0587104_006579 | 3300059650 | Bacteria | 791 |
| 804 | Ga0587107_053498 | 3300059652 | Bacteria | 692 |
| 805 | Ga0587071_079141 | 3300060344 | Bacteria | 729 |
| 806 | Ga0587071_096965 | 3300060344 | Bacteria | 677 |
| 807 | Ga0587071_100519 | 3300060344 | Bacteria | 668 |
| 808 | Ga0587111_0003570 | 3300060346 | Bacteria | 2228 |
| 809 | Ga0587111_0024432 | 3300060346 | Bacteria | 1189 |
| 810 | Ga0587111_0093451 | 3300060346 | Bacteria | 738 |
| 811 | Ga0501082_0022097 | 3300060353 | Bacteria | 5484 |
| 812 | Ga0501082_0059868 | 3300060353 | Bacteria | 3281 |
| 813 | Ga0501082_0221705 | 3300060353 | Bacteria | 1645 |
| 814 | Ga0501082_0240115 | 3300060353 | Bacteria | 1577 |
| 815 | Ga0501082_0850198 | 3300060353 | Bacteria | 798 |
| 816 | 2512032044 | 2511231221 | Bacteria | 6846400 |
| 817 | 2523103515 | 2522572158 | Bacteria | 6514390 |
| 818 | 2599102957 | 2597490356 | Bacteria | 7030811 |
| 819 | 2846952831 | 2846952575 | Bacteria | 6587527 |
| 820 | 2848858364 | 2848858292 | Bacteria | 7391279 |
| 821 | 2883292092 | 2883291878 | Bacteria | 5894118 |
| 822 | 2883355102 | 2883354860 | Bacteria | 5865246 |
| 823 | 2883580831 | 2883577096 | Bacteria | 4709178 |
| 824 | 8054003437 | 8054002106 | Bacteria | 7987183 |
| 825 | Ga0436363_1172536 | |||
| 826 | JGI25153J46596_10048541 | |||
| 827 | rootH2_10084649 | |||
| 828 | JGI25407J50210_10100853 | |||
| 829 | Ga0055542_1032123 | |||
| 830 | Ga0055529_1005692 | |||
| 831 | Ga0065707_10529883 | |||
| 832 | Ga0065707_10694543 | |||
| 833 | Ga0070683_100734017 | |||
| 834 | Ga0070690_100519084 | |||
| 835 | Ga0070682_100375510 | |||
| 836 | Ga0070660_100019804 | |||
| 837 | Ga0070687_101317041 | |||
| 838 | Ga0070661_100815827 | |||
| 839 | Ga0070668_100633844 | |||
| 840 | Ga0070668_101536345 | |||
| 841 | Ga0070669_100019204 | |||
| 842 | Ga0070675_100235090 | |||
| 843 | Ga0070675_100342528 | |||
| 844 | Ga0070671_100032613 | |||
| 845 | Ga0070674_100045997 | |||
| 846 | Ga0070673_101509844 | |||
| 847 | Ga0070667_100073717 | |||
| 848 | Ga0070667_101431013 | |||
| 849 | Ga0070667_101904977 | |||
| 850 | Ga0070709_10045263 | |||
| 851 | Ga0070709_10147261 | |||
| 852 | Ga0070709_11789089 | |||
| 853 | Ga0070714_100018163 | |||
| 854 | Ga0070714_100060633 | |||
| 855 | Ga0070714_100665045 | |||
| 856 | Ga0070713_100027158 | |||
| 857 | Ga0070713_100171433 | |||
| 858 | Ga0070713_100621305 | |||
| 859 | Ga0070713_100816165 | |||
| 860 | Ga0070713_101599296 | |||
| 861 | Ga0070713_101748285 | |||
| 862 | Ga0070713_102466554 | |||
| 863 | Ga0070710_10109863 | |||
| 864 | Ga0070701_10780407 | |||
| 865 | Ga0070711_100034702 | |||
| 866 | Ga0070711_100274012 | |||
| 867 | Ga0070711_100529858 | |||
| 868 | Ga0070705_100336340 | |||
| 869 | Ga0070705_101078037 | |||
| 870 | Ga0070700_100121321 | |||
| 871 | Ga0070708_100026636 | |||
| 872 | Ga0070663_101346564 | |||
| 873 | Ga0070678_100034822 | |||
| 874 | Ga0070681_10247951 | |||
| 875 | Ga0070681_11100242 | |||
| 876 | Ga0068867_100793578 | |||
| 877 | Ga0068867_101749618 | |||
| 878 | Ga0070706_100015780 | |||
| 879 | Ga0070706_100578738 | |||
| 880 | Ga0070707_100006963 | |||
| 881 | Ga0070707_100940494 | |||
| 882 | Ga0070707_101132356 | |||
| 883 | Ga0070698_100449258 | |||
| 884 | Ga0070699_100054969 | |||
| 885 | Ga0070699_100304552 | |||
| 886 | Ga0070699_101580583 | |||
| 887 | Ga0070679_100440976 | |||
| 888 | Ga0070679_101238461 | |||
| 889 | Ga0070684_100232170 | |||
| 890 | Ga0070697_101516784 | |||
| 891 | Ga0070697_101657431 | |||
| 892 | Ga0070672_101630081 | |||
| 893 | Ga0070695_100544305 | |||
| 894 | Ga0070695_101687877 | |||
| 895 | Ga0070696_100190673 | |||
| 896 | Ga0070665_100279649 | |||
| 897 | Ga0070665_100532523 | |||
| 898 | Ga0070665_100541007 | |||
| 899 | Ga0068855_100219801 | |||
| 900 | Ga0070664_100869329 | |||
| 901 | Ga0070664_101330305 | |||
| 902 | Ga0068856_100203499 | |||
| 903 | Ga0068856_100475926 | |||
| 904 | Ga0068856_101129810 | |||
| 905 | Ga0068852_100594612 | |||
| 906 | Ga0068859_100282132 | |||
| 907 | Ga0068864_100217683 | |||
| 908 | Ga0068864_100751039 | |||
| 909 | Ga0068866_10031660 | |||
| 910 | Ga0068863_100483428 | |||
| 911 | Ga0068863_101960061 | |||
| 912 | Ga0068860_101241949 | |||
| 913 | Ga0068862_100016491 | |||
| 914 | Ga0068862_100054170 | |||
| 915 | Ga0081455_10069430 | |||
| 916 | Ga0081455_10428047 | |||
| 917 | Ga0081538_10006607 | |||
| 918 | Ga0081540_1126213 | |||
| 919 | Ga0081540_1152538 | |||
| 920 | Ga0081540_1210303 | |||
| 921 | Ga0070717_10042502 | |||
| 922 | Ga0070717_10095123 | |||
| 923 | Ga0070717_10342238 | |||
| 924 | Ga0070717_10989273 | |||
| 925 | Ga0070715_10764494 | |||
| 926 | Ga0070716_100049627 | |||
| 927 | Ga0070716_101092380 | |||
| 928 | Ga0070716_101185921 | |||
| 929 | Ga0070712_100044274 | |||
| 930 | Ga0070712_100060927 | |||
| 931 | Ga0070712_100886571 | |||
| 932 | Ga0070712_101312699 | |||
| 933 | Ga0075362_10267291 | |||
| 934 | Ga0075362_10377295 | |||
| 935 | Ga0075369_10008204 | |||
| 936 | Ga0075369_10237625 | |||
| 937 | Ga0075366_10128650 | |||
| 938 | Ga0075366_10249882 | |||
| 939 | Ga0075370_10214929 | |||
| 940 | Ga0075370_10282571 | |||
| 941 | Ga0068871_100408671 | |||
| 942 | Ga0068871_101648894 | |||
| 943 | Ga0075428_100341554 | |||
| 944 | Ga0075430_100259435 | |||
| 945 | Ga0075431_101521510 | |||
| 946 | Ga0075431_101536099 | |||
| 947 | Ga0075433_10734932 | |||
| 948 | Ga0075434_100821982 | |||
| 949 | Ga0075429_100796608 | |||
| 950 | Ga0068865_100123262 | |||
| 951 | Ga0075436_100086444 | |||
| 952 | Ga0075436_100369524 | |||
| 953 | Ga0097620_100282113 | |||
| 954 | Ga0075435_100342089 | |||
| 955 | Ga0075435_100589487 | |||
| 956 | Ga0099795_10000803 | |||
| 957 | Ga0099795_10495156 | |||
| 958 | Ga0105240_10485059 | |||
| 959 | Ga0111539_10003803 | |||
| 960 | Ga0111539_11642372 | |||
| 961 | Ga0105245_10064936 | |||
| 962 | Ga0105245_10908256 | |||
| 963 | Ga0105247_10804857 | |||
| 964 | Ga0105247_11573037 | |||
| 965 | Ga0114129_10908263 | |||
| 966 | Ga0114129_13101753 | |||
| 967 | Ga0105241_11327988 | |||
| 968 | Ga0105242_10468332 | |||
| 969 | Ga0105242_11919263 | |||
| 970 | Ga0105248_10324678 | |||
| 971 | Ga0105248_10327506 | |||
| 972 | Ga0105248_11422592 | |||
| 973 | Ga0105237_11473394 | |||
| 974 | Ga0105237_12690082 | |||
| 975 | Ga0105238_10392358 | |||
| 976 | Ga0105238_12408706 | |||
| 977 | Ga0105249_10037396 | |||
| 978 | Ga0105035_108046 | |||
| 979 | Ga0105028_106479 | |||
| 980 | Ga0099796_10025286 | |||
| 981 | Ga0105239_10244989 | |||
| 982 | Ga0105239_11146177 | |||
| 983 | Ga0105239_11203086 | |||
| 984 | Ga0105239_11604950 | |||
| 985 | Ga0105239_11689715 | |||
| 986 | Ga0105246_10096436 | |||
| 987 | Ga0105246_10819585 | |||
| 988 | Ga0157373_10509888 | |||
| 989 | Ga0157370_10183926 | |||
| 990 | Ga0157369_11435510 | |||
| 991 | Ga0157374_10388192 | |||
| 992 | Ga0157374_10474522 | |||
| 993 | Ga0157374_12845414 | |||
| 994 | Ga0157378_11210217 | |||
| 995 | Ga0157378_11218879 | |||
| 996 | Ga0163162_10706939 | |||
| 997 | Ga0163162_13236133 | |||
| 998 | Ga0157375_11195325 | |||
| 999 | Ga0157375_11619401 | |||
| 1000 | Ga0157375_12833046 | |||
| 1001 | Ga0163163_10015068 | |||
| 1002 | Ga0163163_10226533 | |||
| 1003 | Ga0163163_10999107 | |||
| 1004 | Ga0163163_13108434 | |||
| 1005 | Ga0157380_10037752 | |||
| 1006 | Ga0157380_10259256 | |||
| 1007 | Ga0157380_11861616 | |||
| 1008 | Ga0157380_13509407 | |||
| 1009 | Ga0182008_10014674 | |||
| 1010 | Ga0182008_10296243 | |||
| 1011 | Ga0157379_10591840 | |||
| 1012 | Ga0157379_11810498 | |||
| 1013 | Ga0157376_10877136 | |||
| 1014 | Ga0182007_10135177 | |||
| 1015 | Ga0163161_10475397 | |||
| 1016 | Ga0163161_10711093 | |||
| 1017 | Ga0197907_11285424 | |||
| 1018 | Ga0206349_1228716 | |||
| 1019 | Ga0213872_10048000 | |||
| 1020 | Ga0213872_10306093 | |||
| 1021 | Ga0213874_10026987 | |||
| 1022 | Ga0213876_10006707 | |||
| 1023 | Ga0213876_10078863 | |||
| 1024 | Ga0213876_10257086 | |||
| 1025 | Ga0213876_10631536 | |||
| 1026 | Ga0213875_10003437 | |||
| 1027 | Ga0213875_10005028 | |||
| 1028 | Ga0213875_10007080 | |||
| 1029 | Ga0213875_10046529 | |||
| 1030 | Ga0213875_10108836 | |||
| 1031 | Ga0213875_10376840 | |||
| 1032 | Ga0224712_10081686 | |||
| 1033 | Ga0224712_10259722 | |||
| 1034 | Ga0224712_10286892 | |||
| 1035 | Ga0224712_10335249 | |||
| 1036 | Ga0224712_10375971 | |||
| 1037 | Ga0209258_105392 | |||
| 1038 | Ga0209148_1009566 | |||
| 1039 | Ga0209455_1000225 | |||
| 1040 | Ga0209676_1013131 | |||
| 1041 | Ga0207426_1019958 | |||
| 1042 | Ga0209051_1018112 | |||
| 1043 | Ga0209257_1000418 | |||
| 1044 | Ga0207692_10156851 | |||
| 1045 | Ga0207692_10177133 | |||
| 1046 | Ga0207642_10018319 | |||
| 1047 | Ga0207680_10541902 | |||
| 1048 | Ga0207699_10047885 | |||
| 1049 | Ga0207699_10182763 | |||
| 1050 | Ga0207705_10134644 | |||
| 1051 | Ga0207684_10019438 | |||
| 1052 | Ga0207707_10203394 | |||
| 1053 | Ga0207707_10774416 | |||
| 1054 | Ga0207707_11249547 | |||
| 1055 | Ga0207693_10047418 | |||
| 1056 | Ga0207693_10071832 | |||
| 1057 | Ga0207693_10588720 | |||
| 1058 | Ga0207663_10034000 | |||
| 1059 | Ga0207663_10089585 | |||
| 1060 | Ga0207657_10039365 | |||
| 1061 | Ga0207652_10458892 | |||
| 1062 | Ga0207652_10972781 | |||
| 1063 | Ga0207646_10007590 | |||
| 1064 | Ga0207646_11570618 | |||
| 1065 | Ga0207646_11824200 | |||
| 1066 | Ga0207681_10014928 | |||
| 1067 | Ga0207687_10048204 | |||
| 1068 | Ga0207700_10043368 | |||
| 1069 | Ga0207700_10080960 | |||
| 1070 | Ga0207700_10955032 | |||
| 1071 | Ga0207700_11490923 | |||
| 1072 | Ga0207664_10065453 | |||
| 1073 | Ga0207664_11185994 | |||
| 1074 | Ga0207644_10060209 | |||
| 1075 | Ga0207644_10527572 | |||
| 1076 | Ga0207686_10835432 | |||
| 1077 | Ga0207669_10292790 | |||
| 1078 | Ga0207704_10237925 | |||
| 1079 | Ga0207665_10026807 | |||
| 1080 | Ga0207665_10083040 | |||
| 1081 | Ga0207665_10246526 | |||
| 1082 | Ga0207711_10503298 | |||
| 1083 | Ga0207661_10991085 | |||
| 1084 | Ga0207679_11814986 | |||
| 1085 | Ga0207667_10376680 | |||
| 1086 | Ga0207651_11195819 | |||
| 1087 | Ga0207712_10122040 | |||
| 1088 | Ga0207658_10194173 | |||
| 1089 | Ga0207677_11618997 | |||
| 1090 | Ga0207639_10162182 | |||
| 1091 | Ga0207678_10982870 | |||
| 1092 | Ga0207678_11296227 | |||
| 1093 | Ga0207708_10134792 | |||
| 1094 | Ga0207708_10840548 | |||
| 1095 | Ga0207702_10026622 | |||
| 1096 | Ga0207702_10089326 | |||
| 1097 | Ga0207702_10190629 | |||
| 1098 | Ga0207702_10452085 | |||
| 1099 | Ga0207702_10752497 | |||
| 1100 | Ga0207702_12341657 | |||
| 1101 | Ga0207641_10639871 | |||
| 1102 | Ga0207648_10925085 | |||
| 1103 | Ga0207676_11022433 | |||
| 1104 | Ga0207675_100006475 | |||
| 1105 | Ga0207683_10174477 | |||
| 1106 | Ga0207683_10218865 | |||
| 1107 | Ga0207698_10614494 | |||
| 1108 | Ga0207698_11253984 | |||
| 1109 | Ga0209179_1003760 | |||
| 1110 | Ga0207428_10000053 | |||
| 1111 | Ga0268266_10458405 | |||
| 1112 | Ga0268266_10501314 | |||
| 1113 | Ga0268266_10996606 | |||
| 1114 | Ga0268265_10003331 | |||
| 1115 | Ga0268265_10040950 | |||
| 1116 | Ga0265318_10031391 | |||
| 1117 | Ga0307517_10250422 | |||
| 1118 | Ga0307512_10144489 | |||
| 1119 | Ga0265766_1012132 | |||
| 1120 | Ga0265332_10332329 | |||
| 1121 | Ga0265320_10234008 | |||
| 1122 | Ga0265331_10010519 | |||
| 1123 | Ga0265327_10022748 | |||
| 1124 | Ga0265327_10273164 | |||
| 1125 | Ga0265316_10229326 | |||
| 1126 | Ga0307513_10011397 | |||
| 1127 | Ga0307513_10030928 | |||
| 1128 | Ga0307513_10331707 | |||
| 1129 | Ga0307408_100692684 | |||
| 1130 | Ga0307408_100714472 | |||
| 1131 | Ga0265313_10017033 | |||
| 1132 | Ga0265313_10277116 | |||
| 1133 | Ga0307508_10203929 | |||
| 1134 | Ga0307508_10340192 | |||
| 1135 | Ga0307508_10435681 | |||
| 1136 | Ga0316575_10249612 | |||
| 1137 | Ga0265314_10006902 | |||
| 1138 | Ga0265314_10029014 | |||
| 1139 | Ga0307516_10413440 | |||
| 1140 | Ga0307516_10669122 | |||
| 1141 | Ga0307413_10046659 | |||
| 1142 | Ga0307410_10014266 | |||
| 1143 | Ga0307410_10448709 | |||
| 1144 | Ga0307406_10816737 | |||
| 1145 | Ga0307407_10231447 | |||
| 1146 | Ga0307412_10502348 | |||
| 1147 | Ga0307412_11160376 | |||
| 1148 | Ga0307409_100084994 | |||
| 1149 | Ga0307416_100810765 | |||
| 1150 | Ga0307416_100940661 | |||
| 1151 | Ga0307411_10005095 | |||
| 1152 | Ga0307415_100543113 | |||
| 1153 | Ga0307507_10319895 | |||
| 1154 | Ga0307510_10387057 | |||
| 1155 | Ga0373926_0041884 | |||
| 1156 | Ga0373926_0048800 | |||
| 1157 | Ga0373928_0012132 | |||
| 1158 | Ga0373934_0040650 | |||
| 1159 | Ga0373934_0113052 | |||
| 1160 | Ga0373934_0114513 | |||
| 1161 | Ga0373944_0066037 | |||
| 1162 | Ga0373944_0103556 | |||
| 1163 | Ga0373944_0188343 | |||
| 1164 | Ga0373949_0045409 | |||
| 1165 | Ga0373923_0019540 | |||
| 1166 | Ga0373923_0427864 | |||
| 1167 | Ga0373932_0446280 | |||
| 1168 | Ga0373936_0148156 | |||
| 1169 | Ga0373936_0452550 | |||
| 1170 | Ga0373936_0457810 | |||
| 1171 | Ga0373941_0265586 | |||
| 1172 | Ga0373945_0548460 | |||
| 1173 | Ga0373953_0124537 | |||
| 1174 | Ga0373956_0090446 | |||
| 1175 | Ga0373956_0193336 | |||
| 1176 | Ga0373956_0626654 | |||
| 1177 | Ga0373960_0163900 | |||
| 1178 | Ga0373943_0024959 | |||
| 1179 | Ga0373943_0072968 | |||
| 1180 | Ga0373943_0150976 | |||
| 1181 | Ga0373943_0329416 | |||
| 1182 | Ga0373943_0656291 | |||
| 1183 | Ga0373946_0285749 | |||
| 1184 | Ga0373946_0748392 | |||
| 1185 | Ga0373955_0091080 | |||
| 1186 | Ga0373955_0688334 | |||
| 1187 | Ga0373961_0097912 | |||
| 1188 | Ga0373924_0148689 | |||
| 1189 | Ga0373924_0177433 | |||
| 1190 | Ga0373931_0223938 | |||
| 1191 | Ga0373931_0926401 | |||
| 1192 | Ga0373935_0037551 | |||
| 1193 | Ga0373935_0055364 | |||
| 1194 | Ga0373935_0130502 | |||
| 1195 | Ga0373935_0189961 | |||
| 1196 | Ga0373927_0358260 | |||
| 1197 | Ga0373927_0855059 | |||
| 1198 | Ga0373933_0038954 | |||
| 1199 | Ga0373933_0052453 | |||
| 1200 | Ga0373933_0102790 | |||
| 1201 | Ga0373947_0085242 | |||
| 1202 | Ga0373947_0133015 | |||
| 1203 | Ga0373947_0363468 | |||
| 1204 | Ga0373937_0004132 | |||
| 1205 | Ga0373937_0043397 | |||
| 1206 | Ga0373937_0068945 | |||
| 1207 | Ga0373937_0285954 | |||
| 1208 | Ga0373937_0533026 | |||
| 1209 | Ga0373937_0943489 | |||
| 1210 | Ga0373937_1128736 | |||
| 1211 | Ga0265778_029150 | |||
| 1212 | Ga0373925_0019399 | |||
| 1213 | Ga0373925_0049816 | |||
| 1214 | Ga0395899_0005089 | |||
| 1215 | Ga0395899_0007355 | |||
| 1216 | Ga0395900_0001400 | |||
| 1217 | Ga0395900_0018475 | |||
| 1218 | Ga0395900_1035247 | |||
| 1219 | Ga0395898_0000900 | |||
| 1220 | Ga0395898_0605545 | |||
| 1221 | Ga0395905_0067084 | |||
| 1222 | Ga0395905_0276935 | |||
| 1223 | Ga0395905_0574467 | |||
| 1224 | Ga0436364_0036184 | |||
| 1225 | Ga0436364_0111974 | |||
| 1226 | Ga0436364_0113231 | |||
| 1227 | Ga0436364_0215514 | |||
| 1228 | Ga0436364_0411459 | |||
| 1229 | Ga0436364_0477303 | |||
| 1230 | Ga0436364_0672710 | |||
| 1231 | Ga0436364_0885115 | |||
| 1232 | Ga0436364_1081267 | |||
| 1233 | Ga0436364_1098413 | |||
| 1234 | Ga0436364_1309888 | |||
| 1235 | Ga0395901_0056651 | |||
| 1236 | Ga0395901_0853428 | |||
| 1237 | Ga0436365_0467011 | |||
| 1238 | Ga0436365_0903003 | |||
| 1239 | Ga0436365_1129065 | |||
| 1240 | Ga0436365_1147776 | |||
| 1241 | Ga0436365_1208761 | |||
| 1242 | Ga0436365_1232053 | |||
| 1243 | Ga0436365_1314286 | |||
| 1244 | Ga0436365_1610296 | |||
| 1245 | Ga0436365_1633210 | |||
| 1246 | Ga0436365_1888295 | |||
| 1247 | Ga0436360_0374512 | |||
| 1248 | Ga0436360_0716050 | |||
| 1249 | Ga0436360_1248709 | |||
| 1250 | Ga0436361_0312844 | |||
| 1251 | Ga0436361_0432672 | |||
| 1252 | Ga0436361_0700345 | |||
| 1253 | Ga0436363_0125784 | |||
| 1254 | Ga0436363_0237499 | |||
| 1255 | Ga0436363_0461717 | |||
| 1256 | Ga0436363_0492694 | |||
| 1257 | Ga0436363_0721779 | |||
| 1258 | Ga0436363_1167688 | |||
| 1259 | Ga0436363_1275384 | |||
| 1260 | Ga0436363_1319859 | |||
| 1261 | Ga0436363_1343244 | |||
| 1262 | Ga0436362_0315033 | |||
| 1263 | Ga0436362_0353673 | |||
| 1264 | Ga0436362_0906723 | |||
| 1265 | Ga0439436_0103227 | |||
| 1266 | Ga0451789_0949761 | |||
| 1267 | Ga0451798_0574671 | |||
| 1268 | Ga0451847_0771257 | |||
| 1269 | Ga0451851_0172888 | |||
| 1270 | Ga0451853_0589475 | |||
| 1271 | Ga0439437_048427 | |||
| 1272 | Ga0439441_014360 | |||
| 1273 | Ga0439434_0170936 | |||
| 1274 | Ga0466972_0196919 | |||
| 1275 | Ga0466963_0441152 | |||
| 1276 | Ga0466963_0443599 | |||
| 1277 | Ga0466963_1068187 | |||
| 1278 | Ga0453684_0021431 | |||
| 1279 | Ga0466968_0581988 | |||
| 1280 | Ga0466957_0888659 | |||
| 1281 | Ga0466959_1051046 | |||
| 1282 | Ga0451576_0350215 | |||
| 1283 | Ga0466967_0287263 | |||
| 1284 | Ga0466967_1145058 | |||
| 1285 | Ga0466967_1449856 | |||
| 1286 | Ga0466967_1834762 | |||
| 1287 | Ga0495592_0103194 | |||
| 1288 | Ga0495638_0208818 | |||
| 1289 | Ga0495638_0258261 | |||
| 1290 | Ga0495638_0406070 | |||
| 1291 | Ga0495651_0015987 | |||
| 1292 | Ga0495651_0450842 | |||
| 1293 | Ga0495653_0142116 | |||
| 1294 | Ga0495653_0301793 | |||
| 1295 | Ga0495653_0502247 | |||
| 1296 | Ga0495650_0131912 | |||
| 1297 | Ga0495650_0204465 | |||
| 1298 | Ga0495580_0086028 | |||
| 1299 | Ga0495664_0007401 | |||
| 1300 | Ga0495664_0530502 | |||
| 1301 | Ga0495594_0890618 | |||
| 1302 | Ga0495608_0035794 | |||
| 1303 | Ga0495608_0164087 | |||
| 1304 | Ga0495608_0558150 | |||
| 1305 | Ga0495616_0356645 | |||
| 1306 | Ga0495618_0757864 | |||
| 1307 | Ga0495628_0032249 | |||
| 1308 | Ga0495628_0218403 | |||
| 1309 | Ga0495628_0437910 | |||
| 1310 | Ga0495628_0863169 | |||
| 1311 | Ga0495630_0183191 | |||
| 1312 | Ga0495630_1376971 | |||
| 1313 | Ga0495632_0270586 | |||
| 1314 | Ga0495666_0164282 | |||
| 1315 | Ga0495652_0175705 | |||
| 1316 | Ga0495652_0548336 | |||
| 1317 | Ga0495654_0160837 | |||
| 1318 | Ga0495665_0065246 | |||
| 1319 | Ga0495640_0071080 | |||
| 1320 | Ga0495586_0031962 | |||
| 1321 | Ga0495586_0106039 | |||
| 1322 | Ga0495586_0198906 | |||
| 1323 | Ga0495587_0092548 | |||
| 1324 | Ga0495587_0107762 | |||
| 1325 | Ga0495587_0157509 | |||
| 1326 | Ga0495587_0533868 | |||
| 1327 | Ga0495621_0511443 | |||
| 1328 | Ga0495645_0001048 | |||
| 1329 | Ga0495645_0094561 | |||
| 1330 | Ga0495645_0382056 | |||
| 1331 | Ga0495667_0060660 | |||
| 1332 | Ga0495667_0066954 | |||
| 1333 | Ga0495667_0112423 | |||
| 1334 | Ga0495634_0339840 | |||
| 1335 | Ga0495625_0291943 | |||
| 1336 | Ga0495635_0037350 | |||
| 1337 | Ga0495635_0102720 | |||
| 1338 | Ga0495635_0308530 | |||
| 1339 | Ga0495657_0032830 | |||
| 1340 | Ga0495657_0095624 | |||
| 1341 | Ga0495599_0018777 | |||
| 1342 | Ga0495599_0341109 | |||
| 1343 | Ga0495646_0163046 | |||
| 1344 | Ga0495646_0199190 | |||
| 1345 | Ga0495646_0646767 | |||
| 1346 | Ga0495658_0593598 | |||
| 1347 | Ga0495658_0883977 | |||
| 1348 | Ga0495649_0202213 | |||
| 1349 | Ga0495600_0055602 | |||
| 1350 | Ga0495600_0095128 | |||
| 1351 | Ga0495600_0358027 | |||
| 1352 | Ga0495604_0020602 | |||
| 1353 | Ga0495674_0304641 | |||
| 1354 | Ga0495674_0599689 | |||
| 1355 | Ga0495674_0670755 | |||
| 1356 | Ga0495674_1199658 | |||
| 1357 | Ga0495680_0019357 | |||
| 1358 | Ga0495680_0099966 | |||
| 1359 | Ga0495680_0157745 | |||
| 1360 | Ga0495680_0624315 | |||
| 1361 | Ga0495675_0068351 | |||
| 1362 | Ga0495675_0516014 | |||
| 1363 | Ga0495684_0239279 | |||
| 1364 | Ga0495684_0245718 | |||
| 1365 | Ga0495686_0130629 | |||
| 1366 | Ga0495593_0214911 | |||
| 1367 | Ga0495602_0307176 | |||
| 1368 | Ga0495602_0908974 | |||
| 1369 | Ga0496104_0322468 | |||
| 1370 | Ga0496104_1065118 | |||
| 1371 | Ga0496105_0838251 | |||
| 1372 | Ga0496107_0541015 | |||
| 1373 | Ga0496108_0736049 | |||
| 1374 | Ga0496108_1182249 | |||
| 1375 | Ga0496109_0685978 | |||
| 1376 | Ga0496110_0722519 | |||
| 1377 | Ga0496112_0028084 | |||
| 1378 | Ga0496112_1124027 | |||
| 1379 | Ga0496113_0313828 | |||
| 1380 | Ga0496115_1397876 | |||
| 1381 | Ga0496119_0028935 | |||
| 1382 | Ga0496120_0065313 | |||
| 1383 | Ga0496121_0604692 | |||
| 1384 | Ga0496122_0093714 | |||
| 1385 | Ga0496126_1042070 | |||
| 1386 | Ga0501306_036639 | |||
| 1387 | Ga0501308_017191 | |||
| 1388 | Ga0501304_025981 | |||
| 1389 | Ga0501305_026035 | |||
| 1390 | Ga0501307_018192 | |||
| 1391 | Ga0501312_030161 | |||
| 1392 | Ga0501317_067791 | |||
| 1393 | Ga0501320_018397 | |||
| 1394 | Ga0501321_051496 | |||
| 1395 | Ga0501330_008281 | |||
| 1396 | Ga0501031_0000746 | |||
| 1397 | Ga0501031_0487647 | |||
| 1398 | Ga0501031_0520995 | |||
| 1399 | Ga0501031_0742931 | |||
| 1400 | Ga0501032_0038762 | |||
| 1401 | Ga0501032_0231684 | |||
| 1402 | Ga0501032_0864718 | |||
| 1403 | Ga0501033_0001088 | |||
| 1404 | Ga0501033_0191591 | |||
| 1405 | Ga0501033_0249090 | |||
| 1406 | Ga0501033_0371443 | |||
| 1407 | Ga0501033_0406435 | |||
| 1408 | Ga0501034_0079145 | |||
| 1409 | Ga0501034_0634452 | |||
| 1410 | Ga0501034_1038391 | |||
| 1411 | Ga0501036_0009451 | |||
| 1412 | Ga0501036_0027538 | |||
| 1413 | Ga0501036_0287002 | |||
| 1414 | Ga0501036_0657439 | |||
| 1415 | Ga0501037_0012673 | |||
| 1416 | Ga0501037_0021183 | |||
| 1417 | Ga0501037_0026225 | |||
| 1418 | Ga0501037_0631153 | |||
| 1419 | Ga0501037_0682819 | |||
| 1420 | Ga0501038_0036006 | |||
| 1421 | Ga0501038_0049072 | |||
| 1422 | Ga0501038_0113361 | |||
| 1423 | Ga0501038_0494069 | |||
| 1424 | Ga0501038_0813965 | |||
| 1425 | Ga0501038_0928379 | |||
| 1426 | Ga0501038_1111254 | |||
| 1427 | Ga0501039_0006574 | |||
| 1428 | Ga0501039_0122261 | |||
| 1429 | Ga0501039_0228384 | |||
| 1430 | Ga0501043_0021304 | |||
| 1431 | Ga0501043_0074121 | |||
| 1432 | Ga0501043_0467805 | |||
| 1433 | Ga0501043_0571431 | |||
| 1434 | Ga0501046_0017076 | |||
| 1435 | Ga0501046_0043408 | |||
| 1436 | Ga0501047_0018894 | |||
| 1437 | Ga0501047_0027283 | |||
| 1438 | Ga0501047_0079627 | |||
| 1439 | Ga0501047_0086631 | |||
| 1440 | Ga0501047_0475779 | |||
| 1441 | Ga0501047_0750137 | |||
| 1442 | Ga0501048_0014974 | |||
| 1443 | Ga0501048_0831719 | |||
| 1444 | Ga0501067_0029448 | |||
| 1445 | Ga0501067_0074591 | |||
| 1446 | Ga0501067_0140492 | |||
| 1447 | Ga0501067_0179860 | |||
| 1448 | Ga0501067_0663957 | |||
| 1449 | Ga0501068_0198978 | |||
| 1450 | Ga0501068_1123870 | |||
| 1451 | Ga0501069_0007311 | |||
| 1452 | Ga0501069_0308996 | |||
| 1453 | Ga0501070_0002774 | |||
| 1454 | Ga0501070_0104191 | |||
| 1455 | Ga0501070_0189245 | |||
| 1456 | Ga0501070_0205040 | |||
| 1457 | Ga0501070_0253791 | |||
| 1458 | Ga0501070_0741632 | |||
| 1459 | Ga0501070_1002957 | |||
| 1460 | Ga0501071_0764430 | |||
| 1461 | Ga0501071_0918175 | |||
| 1462 | Ga0501072_1396897 | |||
| 1463 | Ga0501073_0010974 | |||
| 1464 | Ga0501073_0069939 | |||
| 1465 | Ga0501073_0101137 | |||
| 1466 | Ga0501073_0288078 | |||
| 1467 | Ga0501073_0972516 | |||
| 1468 | Ga0501074_0004909 | |||
| 1469 | Ga0501074_0206129 | |||
| 1470 | Ga0501074_0908769 | |||
| 1471 | Ga0501076_0610968 | |||
| 1472 | Ga0501076_1516660 | |||
| 1473 | Ga0501077_0588232 | |||
| 1474 | Ga0501079_0033209 | |||
| 1475 | Ga0501079_0877830 | |||
| 1476 | Ga0501080_0057283 | |||
| 1477 | Ga0501080_0064237 | |||
| 1478 | Ga0501080_0078558 | |||
| 1479 | Ga0501080_0089615 | |||
| 1480 | Ga0501080_0251245 | |||
| 1481 | Ga0501080_1164738 | |||
| 1482 | Ga0501081_0743548 | |||
| 1483 | Ga0501083_0012062 | |||
| 1484 | Ga0501083_0014527 | |||
| 1485 | Ga0501083_0029520 | |||
| 1486 | Ga0501083_0059514 | |||
| 1487 | Ga0501083_0598309 | |||
| 1488 | Ga0501035_0001712 | |||
| 1489 | Ga0501035_0040360 | |||
| 1490 | Ga0501044_0004509 | |||
| 1491 | Ga0501044_0010946 | |||
| 1492 | Ga0501044_0022918 | |||
| 1493 | Ga0501044_0183493 | |||
| 1494 | Ga0501044_1260952 | |||
| 1495 | Ga0501044_1315779 | |||
| 1496 | Ga0501044_1408738 | |||
| 1497 | nmdc:mga03683_64894_c1 | |||
| 1498 | nmdc:mga0k408_182502_c1 | |||
| 1499 | nmdc:mga0k408_305274_c1 | |||
| 1500 | nmdc:mga0k408_324352_c1 | |||
| 1501 | nmdc:mga07m45_423858_c1 | |||
| 1502 | nmdc:mga07m45_721526_c1 | |||
| 1503 | nmdc:mga05p37_812908_c1 | |||
| 1504 | nmdc:mga09592_403757_c1 | |||
| 1505 | nmdc:mga0qj67_187086_c1 | |||
| 1506 | nmdc:mga06r32_469783_c1 | |||
| 1507 | nmdc:mga08y16_1094295_c1 | |||
| 1508 | nmdc:mga08y16_1266855_c1 | |||
| 1509 | nmdc:mga08y16_30_c1 | |||
| 1510 | nmdc:mga0rr50_1435071_c1 | |||
| 1511 | nmdc:mga0rr50_334987_c1 | |||
| 1512 | nmdc:mga0rr50_926424_c1 | |||
| 1513 | nmdc:mga08x19_1090557_c1 | |||
| 1514 | nmdc:mga08x19_22108_c1 | |||
| 1515 | nmdc:mga08x19_372470_c1 | |||
| 1516 | nmdc:mga08x19_869682_c1 | |||
| 1517 | nmdc:mga0a205_469293_c1 | |||
| 1518 | Ga0495601_0017391 | |||
| 1519 | Ga0495601_0175711 | |||
| 1520 | Ga0495601_0430126 | |||
| 1521 | Ga0495612_0001439 | |||
| 1522 | Ga0500635_0110166 | |||
| 1523 | Ga0495595_0006518 | |||
| 1524 | Ga0495595_0290741 | |||
| 1525 | Ga0495619_0012325 | |||
| 1526 | Ga0495619_0022600 | |||
| 1527 | Ga0500578_0071339 | |||
| 1528 | Ga0500643_029329 | |||
| 1529 | Ga0500644_0241859 | |||
| 1530 | Ga0500646_0020601 | |||
| 1531 | Ga0500651_0221104 | |||
| 1532 | Ga0500566_0097934 | |||
| 1533 | Ga0500566_0310063 | |||
| 1534 | Ga0500641_0021232 | |||
| 1535 | Ga0500650_0518953 | |||
| 1536 | Ga0500654_192900 | |||
| 1537 | Ga0500562_076417 | |||
| 1538 | Ga0500569_212279 | |||
| 1539 | Ga0500592_043072 | |||
| 1540 | Ga0500595_000373 | |||
| 1541 | Ga0500595_037370 | |||
| 1542 | Ga0500597_108159 | |||
| 1543 | Ga0500628_117338 | |||
| 1544 | Ga0500642_0067165 | |||
| 1545 | Ga0500642_0074337 | |||
| 1546 | Ga0500658_0001902 | |||
| 1547 | Ga0500658_0137050 | |||
| 1548 | Ga0500559_0006760 | |||
| 1549 | Ga0500577_0006212 | |||
| 1550 | Ga0500577_0136330 | |||
| 1551 | Ga0500588_0008130 | |||
| 1552 | Ga0500588_0063235 | |||
| 1553 | Ga0500589_231312 | |||
| 1554 | Ga0500616_0002311 | |||
| 1555 | Ga0500616_0158193 | |||
| 1556 | Ga0500622_0228975 | |||
| 1557 | Ga0500633_0034246 | |||
| 1558 | Ga0500634_0196142 | |||
| 1559 | Ga0500639_009208 | |||
| 1560 | Ga0500645_011365 | |||
| 1561 | Ga0500656_009172 | |||
| 1562 | Ga0500599_001851 | |||
| 1563 | Ga0500587_036418 | |||
| 1564 | Ga0501084_0055666 | |||
| 1565 | Ga0501084_0166383 | |||
| 1566 | Ga0501084_0610348 | |||
| 1567 | Ga0590071_005820 | |||
| 1568 | Ga0590074_006608 | |||
| 1569 | Ga0590075_074244 | |||
| 1570 | Ga0590077_017261 | |||
| 1571 | Ga0587084_038845 | |||
| 1572 | Ga0587066_050277 | |||
| 1573 | Ga0587066_075098 | |||
| 1574 | Ga0587070_054427 | |||
| 1575 | Ga0587073_0038046 | |||
| 1576 | Ga0587073_0144482 | |||
| 1577 | Ga0587077_009634 | |||
| 1578 | Ga0587077_093256 | |||
| 1579 | Ga0587077_106665 | |||
| 1580 | Ga0587077_265807 | |||
| 1581 | Ga0587080_075426 | |||
| 1582 | Ga0587082_054548 | |||
| 1583 | Ga0587082_068418 | |||
| 1584 | Ga0587082_081926 | |||
| 1585 | Ga0587083_0037861 | |||
| 1586 | Ga0587085_059392 | |||
| 1587 | Ga0587085_154652 | |||
| 1588 | Ga0587086_040383 | |||
| 1589 | Ga0587086_044880 | |||
| 1590 | Ga0587086_117437 | |||
| 1591 | Ga0587088_030951 | |||
| 1592 | Ga0587088_080223 | |||
| 1593 | Ga0587090_041184 | |||
| 1594 | Ga0587094_047792 | |||
| 1595 | Ga0587098_032842 | |||
| 1596 | Ga0587106_111428 | |||
| 1597 | Ga0587101_006209 | |||
| 1598 | Ga0587101_056654 | |||
| 1599 | Ga0587101_062328 | |||
| 1600 | Ga0587101_062603 | |||
| 1601 | Ga0587109_079391 | |||
| 1602 | Ga0587115_045378 | |||
| 1603 | Ga0587115_063508 | |||
| 1604 | Ga0587117_033042 | |||
| 1605 | Ga0587062_012627 | |||
| 1606 | Ga0587062_039152 | |||
| 1607 | Ga0587062_051698 | |||
| 1608 | Ga0587067_020751 | |||
| 1609 | Ga0587067_030304 | |||
| 1610 | Ga0587067_055273 | |||
| 1611 | Ga0587067_072911 | |||
| 1612 | Ga0587068_019478 | |||
| 1613 | Ga0587068_042430 | |||
| 1614 | Ga0587068_055252 | |||
| 1615 | Ga0587068_072926 | |||
| 1616 | Ga0587069_026259 | |||
| 1617 | Ga0587069_056022 | |||
| 1618 | Ga0587072_054357 | |||
| 1619 | Ga0587072_058935 | |||
| 1620 | Ga0587076_022183 | |||
| 1621 | Ga0587076_069642 | |||
| 1622 | Ga0587076_081096 | |||
| 1623 | Ga0587076_089574 | |||
| 1624 | Ga0587078_030048 | |||
| 1625 | Ga0587079_032114 | |||
| 1626 | Ga0587079_076846 | |||
| 1627 | Ga0587104_006579 | |||
| 1628 | Ga0587107_053498 | |||
| 1629 | Ga0587071_079141 | |||
| 1630 | Ga0587071_096965 | |||
| 1631 | Ga0587071_100519 | |||
| 1632 | Ga0587111_0003570 | |||
| 1633 | Ga0587111_0024432 | |||
| 1634 | Ga0587111_0093451 | |||
| 1635 | Ga0501082_0022097 | |||
| 1636 | Ga0501082_0059868 | |||
| 1637 | Ga0501082_0221705 | |||
| 1638 | Ga0501082_0240115 | |||
| 1639 | Ga0501082_0850198 | |||
| 1640 | 2512032044 | |||
| 1641 | 2523103515 | |||
| 1642 | 2599102957 | |||
| 1643 | 2846952831 | |||
| 1644 | 2848858364 | |||
| 1645 | 2883292092 | |||
| 1646 | 2883355102 | |||
| 1647 | 2883580831 | |||
| 1648 | 8054003437 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8apo-assembly1.cif.gz_Ao | structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites | 0.931 | 14 | 113 |
| 7pkt-assembly1.cif.gz_o | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9165 | 14 | 114 |
| 6z1p-assembly1.cif.gz_Au | structure of the mitochondrial ribosome from tetrahymena thermophila | 0.9088 | 15 | 117 |
| 6xyw-assembly1.cif.gz_Aq | structure of the plant mitochondrial ribosome | 0.8913 | 13 | 114 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8784 | 50 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9693 | 52 | 116 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9095 | 57 | 117 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9011 | 52 | 116 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8723 | 60 | 118 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8472 | 60 | 118 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357L7L9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.006 | 60 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7Y7CN64-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.006 | 63 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2D8YKH1-F1-model_v4 | deleted | 1.004 | 57 | 117 |
|
| AF-A0A659UR08-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.004 | 55 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G9GV44-F1-model_v4 | deleted | 1.003 | 63 | 118 |
|