F482159
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 501 | 1638 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100602254|Ga0068868_1006022541 |
| Length | 114 |
| Sequence | MNKIRKGDQVIVTTGRDKGKRGTVAERVSEQLLIVEGINVVKKHVKPNPMKGTTGGVVDKTLPIHQSNIAIFNAATGKADRVGFKLLSEDEKKSRKTQERAVRVFRSSGAEIKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 29 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 30 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 32 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 119 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 246 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 253 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 256 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 257 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 258 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 261 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 262 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 265 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 266 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 267 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 268 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 269 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 270 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 271 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 272 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 273 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 274 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 275 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 276 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 279 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 280 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 283 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 284 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 285 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 289 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 292 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 298 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 299 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 300 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 349 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 350 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 351 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 352 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 353 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049555 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 386 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 387 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 388 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 389 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 390 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 391 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 392 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 393 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 394 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 397 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 398 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 399 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 400 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 401 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 402 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 403 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 404 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 405 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 407 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 408 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 411 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 412 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 413 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 414 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 415 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 416 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 417 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 418 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 419 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 428 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 429 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 434 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 435 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 436 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 437 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 438 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 442 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 443 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 444 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 445 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 494 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 495 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 496 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 497 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 498 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 499 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 500 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 501 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.16 |
| Metatranscriptomes | 26.86 |
| Isolates | 0.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.89 |
| Nodule | 0.12 |
| Rhizoplane | 2.56 |
| Rhizosphere | 81.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068868_100602254 | 3300005338 | Bacteria | 974 |
| 2 | JGI25156J39149_1025699 | 3300002705 | Bacteria | 942 |
| 3 | JGI25156J39149_1026157 | 3300002705 | Bacteria | 928 |
| 4 | JGI25156J39149_1039814 | 3300002705 | Bacteria | 654 |
| 5 | JGI25154J39366_1000593 | 3300002738 | Bacteria | 17447 |
| 6 | JGI25157J39369_1001522 | 3300002741 | Bacteria | 8421 |
| 7 | JGI25164J39214_1002084 | 3300002772 | Bacteria | 3435 |
| 8 | Ga0006765J45826_106373 | 3300003161 | Bacteria | 4293 |
| 9 | Ga0006778J45830_1009213 | 3300003162 | Bacteria | 15395 |
| 10 | Ga0006778J45830_1056528 | 3300003162 | Bacteria | 849 |
| 11 | Ga0006759J45824_1029126 | 3300003163 | Bacteria | 2169 |
| 12 | Ga0006759J45824_1055672 | 3300003163 | Bacteria | 1013 |
| 13 | Ga0006758J48902_1015144 | 3300003300 | Bacteria | 3291 |
| 14 | Ga0006758J48902_1021934 | 3300003300 | Bacteria | 1503 |
| 15 | Ga0006758J48902_1024929 | 3300003300 | Bacteria | 729 |
| 16 | Ga0006770J48903_1001899 | 3300003305 | Bacteria | 11120 |
| 17 | Ga0006770J48903_1044543 | 3300003305 | Bacteria | 710 |
| 18 | Ga0006777J48905_1014855 | 3300003308 | Bacteria | 5027 |
| 19 | Ga0007417J51691_1029545 | 3300003544 | Bacteria | 1076 |
| 20 | Ga0007417J51691_1043945 | 3300003544 | Bacteria | 2500 |
| 21 | Ga0007427J51700_105505 | 3300003559 | Bacteria | 995 |
| 22 | Ga0007427J51700_113549 | 3300003559 | Bacteria | 2002 |
| 23 | Ga0007410J51695_1005226 | 3300003574 | Bacteria | 5217 |
| 24 | Ga0007410J51695_1028665 | 3300003574 | Bacteria | 3145 |
| 25 | Ga0007410J51695_1032042 | 3300003574 | Bacteria | 2025 |
| 26 | Ga0007409J51694_1019841 | 3300003575 | Bacteria | 1451 |
| 27 | Ga0007409J51694_1020061 | 3300003575 | Bacteria | 1028 |
| 28 | Ga0007416J51690_1027279 | 3300003577 | Bacteria | 2389 |
| 29 | Ga0007416J51690_1051124 | 3300003577 | Bacteria | 2960 |
| 30 | Ga0007429J51699_1066463 | 3300003579 | Bacteria | 1310 |
| 31 | Ga0032354_1028740 | 3300003693 | Bacteria | 504 |
| 32 | Ga0032354_1037309 | 3300003693 | Bacteria | 2923 |
| 33 | Ga0032354_1044089 | 3300003693 | Bacteria | 947 |
| 34 | Ga0032354_1117171 | 3300003693 | Bacteria | 656 |
| 35 | Ga0055539_1037180 | 3300003752 | Bacteria | 534 |
| 36 | Ga0055533_1000043 | 3300003756 | Bacteria | 229262 |
| 37 | Ga0055525_1000161 | 3300003759 | Bacteria | 87478 |
| 38 | Ga0055525_1000641 | 3300003759 | Bacteria | 14040 |
| 39 | Ga0055535_1021794 | 3300003761 | Bacteria | 773 |
| 40 | Ga0055535_1023542 | 3300003761 | Bacteria | 719 |
| 41 | Ga0055529_1000322 | 3300003763 | Bacteria | 54232 |
| 42 | Ga0055540_1026414 | 3300003792 | Bacteria | 1406 |
| 43 | Ga0055531_10012516 | 3300003794 | Bacteria | 3983 |
| 44 | Ga0055531_10098547 | 3300003794 | Bacteria | 605 |
| 45 | Ga0055543_1027494 | 3300004625 | Bacteria | 1006 |
| 46 | Ga0058858_1003354 | 3300004785 | Bacteria | 575 |
| 47 | Ga0058858_1430617 | 3300004785 | Bacteria | 1242 |
| 48 | Ga0058859_10030919 | 3300004798 | Bacteria | 520 |
| 49 | Ga0058859_10055155 | 3300004798 | Bacteria | 1649 |
| 50 | Ga0058859_11825120 | 3300004798 | Bacteria | 1137 |
| 51 | Ga0058863_10044021 | 3300004799 | Bacteria | 920 |
| 52 | Ga0058861_10142005 | 3300004800 | Bacteria | 1459 |
| 53 | Ga0058861_10194247 | 3300004800 | Bacteria | 562 |
| 54 | Ga0058860_10052045 | 3300004801 | Bacteria | 1645 |
| 55 | Ga0058860_10096621 | 3300004801 | Bacteria | 1176 |
| 56 | Ga0058860_12116272 | 3300004801 | Bacteria | 823 |
| 57 | Ga0058862_10051180 | 3300004803 | Bacteria | 1484 |
| 58 | Ga0065165_1010518 | 3300005262 | Bacteria | 3983 |
| 59 | Ga0065165_1048431 | 3300005262 | Bacteria | 1220 |
| 60 | Ga0065707_10559059 | 3300005295 | Bacteria | 712 |
| 61 | Ga0070658_11148191 | 3300005327 | Bacteria | 675 |
| 62 | Ga0070658_11221121 | 3300005327 | Bacteria | 653 |
| 63 | Ga0070658_11468236 | 3300005327 | Bacteria | 591 |
| 64 | Ga0070676_10756527 | 3300005328 | Bacteria | 714 |
| 65 | Ga0070683_100352957 | 3300005329 | Bacteria | 1400 |
| 66 | Ga0070690_100134141 | 3300005330 | Bacteria | 1675 |
| 67 | Ga0068869_100012739 | 3300005334 | Bacteria | 5562 |
| 68 | Ga0070666_10109820 | 3300005335 | Bacteria | 1906 |
| 69 | Ga0070682_100066791 | 3300005337 | Bacteria | 2289 |
| 70 | Ga0068868_100831067 | 3300005338 | Bacteria | 835 |
| 71 | Ga0068868_101147186 | 3300005338 | Bacteria | 717 |
| 72 | Ga0070660_100320427 | 3300005339 | Bacteria | 1273 |
| 73 | Ga0070660_100371696 | 3300005339 | Bacteria | 1179 |
| 74 | Ga0070660_101462983 | 3300005339 | Bacteria | 581 |
| 75 | Ga0070691_10245118 | 3300005341 | Bacteria | 959 |
| 76 | Ga0070669_100343052 | 3300005353 | Bacteria | 1211 |
| 77 | Ga0070669_101564377 | 3300005353 | Bacteria | 574 |
| 78 | Ga0070675_100330914 | 3300005354 | Bacteria | 1347 |
| 79 | Ga0070675_100398807 | 3300005354 | Bacteria | 1227 |
| 80 | Ga0070671_100038207 | 3300005355 | Bacteria | 3985 |
| 81 | Ga0070671_100871948 | 3300005355 | Bacteria | 786 |
| 82 | Ga0070674_100683279 | 3300005356 | Bacteria | 876 |
| 83 | Ga0070674_101032674 | 3300005356 | Bacteria | 723 |
| 84 | Ga0070673_100002927 | 3300005364 | Bacteria | 10519 |
| 85 | Ga0070688_100254873 | 3300005365 | Bacteria | 1251 |
| 86 | Ga0070659_100057420 | 3300005366 | Bacteria | 3069 |
| 87 | Ga0070659_100120047 | 3300005366 | Bacteria | 2128 |
| 88 | Ga0070667_101780280 | 3300005367 | Bacteria | 580 |
| 89 | Ga0070678_100037760 | 3300005456 | Bacteria | 3394 |
| 90 | Ga0070678_100207105 | 3300005456 | Bacteria | 1623 |
| 91 | Ga0070678_100421211 | 3300005456 | Bacteria | 1164 |
| 92 | Ga0070662_100274312 | 3300005457 | Bacteria | 1363 |
| 93 | Ga0070681_10497103 | 3300005458 | Bacteria | 1133 |
| 94 | Ga0068867_100292475 | 3300005459 | Bacteria | 1340 |
| 95 | Ga0068867_100601767 | 3300005459 | Bacteria | 959 |
| 96 | Ga0070707_100461298 | 3300005468 | Bacteria | 1231 |
| 97 | Ga0070679_100375973 | 3300005530 | Bacteria | 1367 |
| 98 | Ga0070679_100834570 | 3300005530 | Bacteria | 865 |
| 99 | Ga0070684_100894602 | 3300005535 | Bacteria | 832 |
| 100 | Ga0068853_100345863 | 3300005539 | Bacteria | 1382 |
| 101 | Ga0068853_101067403 | 3300005539 | Bacteria | 778 |
| 102 | Ga0068853_101936437 | 3300005539 | Bacteria | 571 |
| 103 | Ga0068853_101988889 | 3300005539 | Bacteria | 564 |
| 104 | Ga0070672_100370305 | 3300005543 | Bacteria | 1224 |
| 105 | Ga0070686_100729464 | 3300005544 | Bacteria | 793 |
| 106 | Ga0070665_100525724 | 3300005548 | Bacteria | 1195 |
| 107 | Ga0070665_100551566 | 3300005548 | Bacteria | 1165 |
| 108 | Ga0068855_100961007 | 3300005563 | Bacteria | 899 |
| 109 | Ga0068855_101390928 | 3300005563 | Bacteria | 723 |
| 110 | Ga0070664_100452105 | 3300005564 | Bacteria | 1179 |
| 111 | Ga0068857_100387564 | 3300005577 | Bacteria | 1298 |
| 112 | Ga0068854_100273417 | 3300005578 | Bacteria | 1357 |
| 113 | Ga0068856_100033721 | 3300005614 | Bacteria | 5014 |
| 114 | Ga0068856_100231329 | 3300005614 | Bacteria | 1864 |
| 115 | Ga0068856_101792745 | 3300005614 | Bacteria | 625 |
| 116 | Ga0068852_100157329 | 3300005616 | Bacteria | 2118 |
| 117 | Ga0068852_100184567 | 3300005616 | Bacteria | 1964 |
| 118 | Ga0068852_100912756 | 3300005616 | Bacteria | 895 |
| 119 | Ga0068859_103056882 | 3300005617 | Bacteria | 511 |
| 120 | Ga0068864_100723641 | 3300005618 | Bacteria | 974 |
| 121 | Ga0068864_102061142 | 3300005618 | Bacteria | 577 |
| 122 | Ga0068866_10472692 | 3300005718 | Bacteria | 824 |
| 123 | Ga0068866_11466369 | 3300005718 | Bacteria | 501 |
| 124 | Ga0068861_100067654 | 3300005719 | Bacteria | 2758 |
| 125 | Ga0068861_100250877 | 3300005719 | Bacteria | 1510 |
| 126 | Ga0068851_10097792 | 3300005834 | Bacteria | 1553 |
| 127 | Ga0068851_10510819 | 3300005834 | Bacteria | 722 |
| 128 | Ga0068863_100182919 | 3300005841 | Bacteria | 2012 |
| 129 | Ga0068858_101935889 | 3300005842 | Bacteria | 583 |
| 130 | Ga0068862_100009442 | 3300005844 | Bacteria | 8069 |
| 131 | Ga0068862_100090240 | 3300005844 | Bacteria | 2667 |
| 132 | Ga0068862_100566589 | 3300005844 | Bacteria | 1086 |
| 133 | Ga0081455_10342025 | 3300005937 | Bacteria | 1058 |
| 134 | Ga0075363_100212774 | 3300006048 | Bacteria | 1107 |
| 135 | Ga0075363_100251023 | 3300006048 | Bacteria | 1019 |
| 136 | Ga0075364_10260140 | 3300006051 | Bacteria | 1180 |
| 137 | Ga0075362_10068048 | 3300006177 | Bacteria | 1621 |
| 138 | Ga0075362_10118078 | 3300006177 | Bacteria | 1254 |
| 139 | Ga0075362_10579705 | 3300006177 | Bacteria | 578 |
| 140 | Ga0075366_10000795 | 3300006195 | Bacteria | 15124 |
| 141 | Ga0075366_10021754 | 3300006195 | Bacteria | 3729 |
| 142 | Ga0075366_10075093 | 3300006195 | Bacteria | 2016 |
| 143 | Ga0075366_10102009 | 3300006195 | Bacteria | 1722 |
| 144 | Ga0075366_10111379 | 3300006195 | Bacteria | 1646 |
| 145 | Ga0075366_10214047 | 3300006195 | Bacteria | 1173 |
| 146 | Ga0075366_10281535 | 3300006195 | Bacteria | 1016 |
| 147 | Ga0075366_10979222 | 3300006195 | Bacteria | 527 |
| 148 | Ga0075370_10000701 | 3300006353 | Bacteria | 13221 |
| 149 | Ga0075370_10096809 | 3300006353 | Bacteria | 1706 |
| 150 | Ga0075370_10178238 | 3300006353 | Bacteria | 1250 |
| 151 | Ga0075370_10381414 | 3300006353 | Bacteria | 844 |
| 152 | Ga0075429_100409696 | 3300006880 | Bacteria | 1187 |
| 153 | Ga0097620_100993556 | 3300006931 | Bacteria | 921 |
| 154 | Ga0097620_103056690 | 3300006931 | Bacteria | 511 |
| 155 | Ga0105250_10211043 | 3300009092 | Bacteria | 821 |
| 156 | Ga0105240_10018079 | 3300009093 | Bacteria | 9478 |
| 157 | Ga0105240_10608637 | 3300009093 | Bacteria | 1202 |
| 158 | Ga0105240_10763734 | 3300009093 | Bacteria | 1050 |
| 159 | Ga0105240_11532248 | 3300009093 | Bacteria | 698 |
| 160 | Ga0105240_12384249 | 3300009093 | Bacteria | 548 |
| 161 | Ga0111539_10350927 | 3300009094 | Bacteria | 1717 |
| 162 | Ga0111539_11955632 | 3300009094 | Bacteria | 680 |
| 163 | Ga0111539_12890563 | 3300009094 | Bacteria | 556 |
| 164 | Ga0105245_10060455 | 3300009098 | Bacteria | 3412 |
| 165 | Ga0105245_12756675 | 3300009098 | Bacteria | 544 |
| 166 | Ga0114129_10176739 | 3300009147 | Bacteria | 2908 |
| 167 | Ga0105243_10001789 | 3300009148 | Bacteria | 18454 |
| 168 | Ga0105243_10030050 | 3300009148 | Bacteria | 4181 |
| 169 | Ga0105243_10177323 | 3300009148 | Bacteria | 1850 |
| 170 | Ga0105243_10252607 | 3300009148 | Bacteria | 1575 |
| 171 | Ga0105241_11260214 | 3300009174 | Bacteria | 702 |
| 172 | Ga0105242_10297878 | 3300009176 | Bacteria | 1471 |
| 173 | Ga0105248_10006768 | 3300009177 | Bacteria | 12569 |
| 174 | Ga0105248_11336448 | 3300009177 | Bacteria | 811 |
| 175 | Ga0105248_11371716 | 3300009177 | Bacteria | 800 |
| 176 | Ga0105237_10000668 | 3300009545 | Bacteria | 47303 |
| 177 | Ga0105238_10003926 | 3300009551 | Bacteria | 14752 |
| 178 | Ga0105238_10088675 | 3300009551 | Bacteria | 3080 |
| 179 | Ga0105238_11082143 | 3300009551 | Bacteria | 824 |
| 180 | Ga0105238_12840029 | 3300009551 | Bacteria | 521 |
| 181 | Ga0105249_10068515 | 3300009553 | Bacteria | 3273 |
| 182 | Ga0105249_10311041 | 3300009553 | Bacteria | 1584 |
| 183 | Ga0105239_10001255 | 3300010375 | Bacteria | 34466 |
| 184 | Ga0105239_11112547 | 3300010375 | Bacteria | 909 |
| 185 | Ga0105246_10060033 | 3300011119 | Bacteria | 2641 |
| 186 | Ga0157327_1015077 | 3300012512 | Bacteria | 799 |
| 187 | Ga0157373_10739528 | 3300013100 | Bacteria | 722 |
| 188 | Ga0157371_10867915 | 3300013102 | Bacteria | 683 |
| 189 | Ga0157370_10422778 | 3300013104 | Bacteria | 1226 |
| 190 | Ga0157369_10547096 | 3300013105 | Bacteria | 1197 |
| 191 | Ga0157374_10123485 | 3300013296 | Bacteria | 2501 |
| 192 | Ga0157374_11269982 | 3300013296 | Bacteria | 758 |
| 193 | Ga0157378_10029129 | 3300013297 | Bacteria | 4874 |
| 194 | Ga0157378_10873702 | 3300013297 | Bacteria | 929 |
| 195 | Ga0163162_10505539 | 3300013306 | Bacteria | 1339 |
| 196 | Ga0163162_12978772 | 3300013306 | Bacteria | 544 |
| 197 | Ga0157372_10373891 | 3300013307 | Bacteria | 1661 |
| 198 | Ga0157372_11082189 | 3300013307 | Bacteria | 928 |
| 199 | Ga0157375_10137647 | 3300013308 | Bacteria | 2567 |
| 200 | Ga0157375_10710210 | 3300013308 | Bacteria | 1159 |
| 201 | Ga0157375_12005957 | 3300013308 | Bacteria | 688 |
| 202 | Ga0157375_12740470 | 3300013308 | Bacteria | 589 |
| 203 | Ga0163163_11953739 | 3300014325 | Bacteria | 647 |
| 204 | Ga0157380_10821964 | 3300014326 | Bacteria | 948 |
| 205 | Ga0157377_10000368 | 3300014745 | Bacteria | 20109 |
| 206 | Ga0157379_10469488 | 3300014968 | Bacteria | 1164 |
| 207 | Ga0157376_10090219 | 3300014969 | Bacteria | 2652 |
| 208 | Ga0157376_11883744 | 3300014969 | Bacteria | 635 |
| 209 | Ga0182007_10077939 | 3300015262 | Bacteria | 1087 |
| 210 | Ga0182007_10374325 | 3300015262 | Bacteria | 539 |
| 211 | Ga0163161_10514817 | 3300017792 | Bacteria | 976 |
| 212 | Ga0197907_10761668 | 3300020069 | Bacteria | 1329 |
| 213 | Ga0206356_11223789 | 3300020070 | Bacteria | 1186 |
| 214 | Ga0206355_1548870 | 3300020076 | Bacteria | 1356 |
| 215 | Ga0206352_10258252 | 3300020078 | Bacteria | 960 |
| 216 | Ga0206352_10887797 | 3300020078 | Bacteria | 1031 |
| 217 | Ga0206352_10920041 | 3300020078 | Bacteria | 561 |
| 218 | Ga0206352_11007505 | 3300020078 | Bacteria | 3567 |
| 219 | Ga0206350_11041308 | 3300020080 | Bacteria | 1032 |
| 220 | Ga0213872_10000091 | 3300021361 | Bacteria | 83723 |
| 221 | Ga0213872_10002765 | 3300021361 | Bacteria | 10055 |
| 222 | Ga0213872_10004732 | 3300021361 | Bacteria | 7137 |
| 223 | Ga0209674_100067 | 3300025226 | Bacteria | 253824 |
| 224 | Ga0209674_109216 | 3300025226 | Bacteria | 1110 |
| 225 | Ga0209672_107040 | 3300025228 | Bacteria | 1770 |
| 226 | Ga0209563_100068 | 3300025230 | Bacteria | 254802 |
| 227 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 228 | Ga0207427_100260 | 3300025231 | Bacteria | 41435 |
| 229 | Ga0209258_102113 | 3300025242 | Bacteria | 5574 |
| 230 | Ga0209258_118229 | 3300025242 | Bacteria | 760 |
| 231 | Ga0209646_1000127 | 3300025246 | Bacteria | 131920 |
| 232 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 233 | Ga0209677_100201 | 3300025253 | Bacteria | 47899 |
| 234 | Ga0209148_1002904 | 3300025254 | Bacteria | 5228 |
| 235 | Ga0209759_1000129 | 3300025256 | Bacteria | 131961 |
| 236 | Ga0209759_1003759 | 3300025256 | Bacteria | 5926 |
| 237 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 238 | Ga0209673_1026632 | 3300025273 | Bacteria | 1894 |
| 239 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 240 | Ga0209050_1004273 | 3300025298 | Bacteria | 9808 |
| 241 | Ga0209256_1028202 | 3300025299 | Bacteria | 1588 |
| 242 | Ga0209051_1005321 | 3300025303 | Bacteria | 7574 |
| 243 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 244 | Ga0207656_10116353 | 3300025321 | Bacteria | 1240 |
| 245 | Ga0207642_10569245 | 3300025899 | Bacteria | 702 |
| 246 | Ga0207642_10591643 | 3300025899 | Bacteria | 689 |
| 247 | Ga0207680_10487657 | 3300025903 | Bacteria | 877 |
| 248 | Ga0207680_10523330 | 3300025903 | Bacteria | 846 |
| 249 | Ga0207647_10074272 | 3300025904 | Bacteria | 2048 |
| 250 | Ga0207645_10160739 | 3300025907 | Bacteria | 1469 |
| 251 | Ga0207645_10384444 | 3300025907 | Bacteria | 943 |
| 252 | Ga0207643_10312571 | 3300025908 | Bacteria | 980 |
| 253 | Ga0207705_10053354 | 3300025909 | Bacteria | 2912 |
| 254 | Ga0207654_10059196 | 3300025911 | Bacteria | 2233 |
| 255 | Ga0207654_10797506 | 3300025911 | Bacteria | 682 |
| 256 | Ga0207707_10417643 | 3300025912 | Bacteria | 1151 |
| 257 | Ga0207695_10010589 | 3300025913 | Bacteria | 11272 |
| 258 | Ga0207695_10103337 | 3300025913 | Bacteria | 2841 |
| 259 | Ga0207671_10019707 | 3300025914 | Bacteria | 5152 |
| 260 | Ga0207671_10047329 | 3300025914 | Bacteria | 3183 |
| 261 | Ga0207660_11007987 | 3300025917 | Bacteria | 679 |
| 262 | Ga0207660_11355730 | 3300025917 | Bacteria | 577 |
| 263 | Ga0207662_10034330 | 3300025918 | Bacteria | 2960 |
| 264 | Ga0207657_10152752 | 3300025919 | Bacteria | 1879 |
| 265 | Ga0207657_10364651 | 3300025919 | Bacteria | 1138 |
| 266 | Ga0207652_10202638 | 3300025921 | Bacteria | 1786 |
| 267 | Ga0207652_10559555 | 3300025921 | Bacteria | 1027 |
| 268 | Ga0207681_10187413 | 3300025923 | Bacteria | 1580 |
| 269 | Ga0207694_10004619 | 3300025924 | Bacteria | 10727 |
| 270 | Ga0207694_10026084 | 3300025924 | Bacteria | 4443 |
| 271 | Ga0207694_11251446 | 3300025924 | Bacteria | 628 |
| 272 | Ga0207694_11625111 | 3300025924 | Bacteria | 544 |
| 273 | Ga0207650_11056631 | 3300025925 | Bacteria | 691 |
| 274 | Ga0207650_11875865 | 3300025925 | Bacteria | 506 |
| 275 | Ga0207659_10233696 | 3300025926 | Bacteria | 1484 |
| 276 | Ga0207659_10365256 | 3300025926 | Bacteria | 1200 |
| 277 | Ga0207659_10384923 | 3300025926 | Bacteria | 1170 |
| 278 | Ga0207687_10072566 | 3300025927 | Bacteria | 2463 |
| 279 | Ga0207687_10844263 | 3300025927 | Bacteria | 782 |
| 280 | Ga0207644_10024978 | 3300025931 | Bacteria | 4105 |
| 281 | Ga0207644_10834664 | 3300025931 | Bacteria | 771 |
| 282 | Ga0207690_10039856 | 3300025932 | Bacteria | 3067 |
| 283 | Ga0207706_10300451 | 3300025933 | Bacteria | 1399 |
| 284 | Ga0207706_10738258 | 3300025933 | Bacteria | 839 |
| 285 | Ga0207686_10232569 | 3300025934 | Bacteria | 1337 |
| 286 | Ga0207709_10001005 | 3300025935 | Bacteria | 20902 |
| 287 | Ga0207709_10207965 | 3300025935 | Bacteria | 1402 |
| 288 | Ga0207709_10226741 | 3300025935 | Bacteria | 1351 |
| 289 | Ga0207669_10191669 | 3300025937 | Bacteria | 1475 |
| 290 | Ga0207691_10115353 | 3300025940 | Bacteria | 2385 |
| 291 | Ga0207691_10230836 | 3300025940 | Bacteria | 1603 |
| 292 | Ga0207711_10009541 | 3300025941 | Bacteria | 8096 |
| 293 | Ga0207689_10028262 | 3300025942 | Bacteria | 4692 |
| 294 | Ga0207661_10461940 | 3300025944 | Bacteria | 1157 |
| 295 | Ga0207679_10497711 | 3300025945 | Bacteria | 1087 |
| 296 | Ga0207667_10701744 | 3300025949 | Bacteria | 1014 |
| 297 | Ga0207651_10077458 | 3300025960 | Bacteria | 2380 |
| 298 | Ga0207712_10746934 | 3300025961 | Bacteria | 857 |
| 299 | Ga0207712_11267320 | 3300025961 | Bacteria | 658 |
| 300 | Ga0207640_10018588 | 3300025981 | Bacteria | 4087 |
| 301 | Ga0207658_11146433 | 3300025986 | Bacteria | 710 |
| 302 | Ga0207677_10348252 | 3300026023 | Bacteria | 1240 |
| 303 | Ga0207639_11602510 | 3300026041 | Bacteria | 611 |
| 304 | Ga0207639_11702829 | 3300026041 | Bacteria | 591 |
| 305 | Ga0207702_10001875 | 3300026078 | Bacteria | 20626 |
| 306 | Ga0207702_10098322 | 3300026078 | Bacteria | 2577 |
| 307 | Ga0207641_10711953 | 3300026088 | Bacteria | 989 |
| 308 | Ga0207641_11341182 | 3300026088 | Bacteria | 716 |
| 309 | Ga0207648_10002176 | 3300026089 | Bacteria | 21281 |
| 310 | Ga0207648_10111939 | 3300026089 | Bacteria | 2397 |
| 311 | Ga0207648_10116151 | 3300026089 | Bacteria | 2352 |
| 312 | Ga0207648_10300208 | 3300026089 | Bacteria | 1440 |
| 313 | Ga0207648_10752815 | 3300026089 | Bacteria | 905 |
| 314 | Ga0207648_12192688 | 3300026089 | Bacteria | 513 |
| 315 | Ga0207676_10128448 | 3300026095 | Bacteria | 2151 |
| 316 | Ga0207676_10946210 | 3300026095 | Bacteria | 847 |
| 317 | Ga0207674_10004293 | 3300026116 | Bacteria | 17188 |
| 318 | Ga0207674_11088992 | 3300026116 | Bacteria | 768 |
| 319 | Ga0207675_100101603 | 3300026118 | Bacteria | 2709 |
| 320 | Ga0207683_10032302 | 3300026121 | Bacteria | 4548 |
| 321 | Ga0207683_10376795 | 3300026121 | Bacteria | 1304 |
| 322 | Ga0207683_10430813 | 3300026121 | Bacteria | 1215 |
| 323 | Ga0207698_10810285 | 3300026142 | Bacteria | 939 |
| 324 | Ga0207698_12435571 | 3300026142 | Bacteria | 534 |
| 325 | Ga0209973_1085997 | 3300027252 | Bacteria | 503 |
| 326 | Ga0209969_1000889 | 3300027360 | Bacteria | 4040 |
| 327 | Ga0209981_1007951 | 3300027378 | Bacteria | 1435 |
| 328 | Ga0209996_1000729 | 3300027395 | Bacteria | 3938 |
| 329 | Ga0209995_1000242 | 3300027471 | Bacteria | 8706 |
| 330 | Ga0209968_1000130 | 3300027526 | Bacteria | 13315 |
| 331 | Ga0209999_1001613 | 3300027543 | Bacteria | 3888 |
| 332 | Ga0209999_1062698 | 3300027543 | Bacteria | 709 |
| 333 | Ga0210002_1080391 | 3300027617 | Bacteria | 580 |
| 334 | Ga0209971_1038388 | 3300027682 | Bacteria | 1153 |
| 335 | Ga0209966_1000117 | 3300027695 | Bacteria | 35145 |
| 336 | Ga0209998_10002530 | 3300027717 | Bacteria | 4163 |
| 337 | Ga0209974_10010680 | 3300027876 | Bacteria | 3097 |
| 338 | Ga0268266_11160331 | 3300028379 | Bacteria | 747 |
| 339 | Ga0268265_10058401 | 3300028380 | Bacteria | 2945 |
| 340 | Ga0268265_10354115 | 3300028380 | Bacteria | 1341 |
| 341 | Ga0268264_10248432 | 3300028381 | Bacteria | 1651 |
| 342 | Ga0268264_10916094 | 3300028381 | Bacteria | 880 |
| 343 | Ga0265334_10073367 | 3300028573 | Bacteria | 1271 |
| 344 | Ga0265336_10000028 | 3300028666 | Bacteria | 179201 |
| 345 | Ga0307515_10108460 | 3300028794 | Bacteria | 3271 |
| 346 | Ga0265324_10000286 | 3300029957 | Bacteria | 37420 |
| 347 | Ga0307511_10070244 | 3300030521 | Bacteria | 2566 |
| 348 | Ga0265766_1017267 | 3300030863 | Bacteria | 571 |
| 349 | Ga0265769_101736 | 3300030888 | Bacteria | 1078 |
| 350 | Ga0265328_10033426 | 3300031239 | Bacteria | 1907 |
| 351 | Ga0265328_10238709 | 3300031239 | Bacteria | 694 |
| 352 | Ga0265331_10115103 | 3300031250 | Bacteria | 1231 |
| 353 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 354 | Ga0265327_10000178 | 3300031251 | Bacteria | 135732 |
| 355 | Ga0265327_10176722 | 3300031251 | Bacteria | 978 |
| 356 | Ga0265316_10000201 | 3300031344 | Bacteria | 69415 |
| 357 | Ga0307509_10322942 | 3300031507 | Bacteria | 1279 |
| 358 | Ga0307408_100000089 | 3300031548 | Bacteria | 100712 |
| 359 | Ga0307408_100173708 | 3300031548 | Bacteria | 1722 |
| 360 | Ga0307408_100707218 | 3300031548 | Bacteria | 906 |
| 361 | Ga0307508_10563692 | 3300031616 | Bacteria | 738 |
| 362 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 363 | Ga0307516_10026535 | 3300031730 | Bacteria | 5881 |
| 364 | Ga0307516_10027941 | 3300031730 | Bacteria | 5714 |
| 365 | Ga0307516_10040356 | 3300031730 | Bacteria | 4647 |
| 366 | Ga0307516_10222839 | 3300031730 | Bacteria | 1594 |
| 367 | Ga0307516_10671439 | 3300031730 | Bacteria | 692 |
| 368 | Ga0307405_10558102 | 3300031731 | Bacteria | 928 |
| 369 | Ga0307413_10520434 | 3300031824 | Bacteria | 959 |
| 370 | Ga0307413_10964581 | 3300031824 | Bacteria | 728 |
| 371 | Ga0307410_11073487 | 3300031852 | Bacteria | 697 |
| 372 | Ga0307410_11892895 | 3300031852 | Bacteria | 531 |
| 373 | Ga0307406_10513452 | 3300031901 | Bacteria | 974 |
| 374 | Ga0307406_10738298 | 3300031901 | Bacteria | 825 |
| 375 | Ga0307406_11549686 | 3300031901 | Bacteria | 584 |
| 376 | Ga0307407_10845472 | 3300031903 | Bacteria | 699 |
| 377 | Ga0307412_10532576 | 3300031911 | Bacteria | 983 |
| 378 | Ga0307412_10846819 | 3300031911 | Bacteria | 797 |
| 379 | Ga0307412_11147700 | 3300031911 | Bacteria | 693 |
| 380 | Ga0307416_100714982 | 3300032002 | Bacteria | 1092 |
| 381 | Ga0307416_100814110 | 3300032002 | Bacteria | 1030 |
| 382 | Ga0307414_10057302 | 3300032004 | Bacteria | 2738 |
| 383 | Ga0307414_10306607 | 3300032004 | Bacteria | 1346 |
| 384 | Ga0307414_11731413 | 3300032004 | Bacteria | 583 |
| 385 | Ga0307411_10000085 | 3300032005 | Bacteria | 28904 |
| 386 | Ga0307411_10197371 | 3300032005 | Bacteria | 1542 |
| 387 | Ga0307411_10276119 | 3300032005 | Bacteria | 1335 |
| 388 | Ga0307411_10703743 | 3300032005 | Bacteria | 880 |
| 389 | Ga0373958_0010068 | 3300034819 | Bacteria | 1569 |
| 390 | Ga0373944_0394484 | 3300035089 | Bacteria | 533 |
| 391 | Ga0373923_0531387 | 3300035111 | Bacteria | 575 |
| 392 | Ga0373939_0000348 | 3300035114 | Bacteria | 11798 |
| 393 | Ga0373939_0099657 | 3300035114 | Bacteria | 995 |
| 394 | Ga0373960_0026433 | 3300035121 | Bacteria | 1586 |
| 395 | Ga0373946_0195619 | 3300035171 | Bacteria | 966 |
| 396 | Ga0373961_0015414 | 3300035241 | Bacteria | 1954 |
| 397 | Ga0373962_0113129 | 3300035242 | Bacteria | 858 |
| 398 | Ga0373931_0000535 | 3300035691 | Bacteria | 15604 |
| 399 | Ga0373931_0209811 | 3300035691 | Bacteria | 1167 |
| 400 | Ga0373935_1008046 | 3300035692 | Bacteria | 619 |
| 401 | Ga0373947_0666175 | 3300035725 | Bacteria | 710 |
| 402 | Ga0265778_002283 | 3300036457 | Bacteria | 1835 |
| 403 | Ga0310110_007052 | 3300036535 | Bacteria | 1643 |
| 404 | Ga0395900_0289299 | 3300037418 | Bacteria | 1628 |
| 405 | Ga0395898_0012209 | 3300037466 | Bacteria | 8885 |
| 406 | Ga0395898_0395446 | 3300037466 | Bacteria | 1318 |
| 407 | Ga0395905_0000084 | 3300037471 | Bacteria | 158046 |
| 408 | Ga0395905_0002507 | 3300037471 | Bacteria | 20284 |
| 409 | Ga0395905_0023115 | 3300037471 | Bacteria | 5877 |
| 410 | Ga0395905_0038305 | 3300037471 | Bacteria | 4498 |
| 411 | Ga0395905_0097413 | 3300037471 | Bacteria | 2761 |
| 412 | Ga0395905_0187255 | 3300037471 | Bacteria | 1942 |
| 413 | Ga0395905_0304457 | 3300037471 | Bacteria | 1481 |
| 414 | Ga0395905_0604545 | 3300037471 | Bacteria | 998 |
| 415 | Ga0395901_0001925 | 3300038443 | Bacteria | 21375 |
| 416 | Ga0436360_0060872 | 3300039438 | Bacteria | 1190 |
| 417 | Ga0436361_0114178 | 3300039447 | Bacteria | 1053 |
| 418 | Ga0436361_0405071 | 3300039447 | Bacteria | 13061 |
| 419 | Ga0436361_0570086 | 3300039447 | Bacteria | 6186 |
| 420 | Ga0436361_0681463 | 3300039447 | Bacteria | 4154 |
| 421 | Ga0436361_0714431 | 3300039447 | Bacteria | 79592 |
| 422 | Ga0436361_1006874 | 3300039447 | Bacteria | 3836 |
| 423 | Ga0436361_1203462 | 3300039447 | Bacteria | 704 |
| 424 | Ga0436363_1307251 | 3300039450 | Bacteria | 966 |
| 425 | Ga0439453_0019683 | 3300041408 | Bacteria | 1204 |
| 426 | Ga0439461_0021772 | 3300041410 | Bacteria | 1279 |
| 427 | Ga0439461_0224296 | 3300041410 | Bacteria | 513 |
| 428 | Ga0439465_0021384 | 3300041413 | Bacteria | 2028 |
| 429 | Ga0451793_0314072 | 3300041452 | Bacteria | 539 |
| 430 | Ga0451802_2148803 | 3300041460 | Bacteria | 660 |
| 431 | Ga0451805_014700 | 3300041461 | Bacteria | 874 |
| 432 | Ga0451807_0659712 | 3300041486 | Bacteria | 513 |
| 433 | Ga0451835_1219663 | 3300041492 | Bacteria | 524 |
| 434 | Ga0451846_32730 | 3300041502 | Bacteria | 680 |
| 435 | Ga0451849_1054469 | 3300041505 | Bacteria | 506 |
| 436 | Ga0451850_41031 | 3300041506 | Bacteria | 540 |
| 437 | Ga0451851_1340491 | 3300041507 | Bacteria | 828 |
| 438 | Ga0451854_20387 | 3300041510 | Bacteria | 538 |
| 439 | Ga0451855_0165355 | 3300041511 | Bacteria | 563 |
| 440 | Ga0451853_3137514 | 3300041512 | Bacteria | 517 |
| 441 | Ga0452271_43687 | 3300041916 | Bacteria | 569 |
| 442 | Ga0439437_000716 | 3300042000 | Bacteria | 3345 |
| 443 | Ga0439443_004303 | 3300042003 | Bacteria | 1845 |
| 444 | Ga0439448_0158928 | 3300042005 | Bacteria | 786 |
| 445 | Ga0439455_0002630 | 3300042012 | Bacteria | 3302 |
| 446 | Ga0439455_0004568 | 3300042012 | Bacteria | 2751 |
| 447 | Ga0439455_0027785 | 3300042012 | Bacteria | 1389 |
| 448 | Ga0439455_0132201 | 3300042012 | Bacteria | 704 |
| 449 | Ga0439456_037916 | 3300042013 | Bacteria | 1041 |
| 450 | Ga0450913_000876 | 3300042117 | Bacteria | 1473 |
| 451 | Ga0450917_000001 | 3300042120 | Bacteria | 12228 |
| 452 | Ga0450888_000612 | 3300042126 | Bacteria | 3384 |
| 453 | Ga0450890_000549 | 3300042127 | Bacteria | 5493 |
| 454 | Ga0450890_068097 | 3300042127 | Bacteria | 566 |
| 455 | Ga0450891_000262 | 3300042129 | Bacteria | 5316 |
| 456 | Ga0450892_000236 | 3300042130 | Bacteria | 6630 |
| 457 | Ga0450894_016349 | 3300042131 | Bacteria | 985 |
| 458 | Ga0450898_035025 | 3300042134 | Bacteria | 934 |
| 459 | Ga0450898_058258 | 3300042134 | Bacteria | 756 |
| 460 | Ga0439446_0031377 | 3300042156 | Bacteria | 1538 |
| 461 | Ga0439446_0118939 | 3300042156 | Bacteria | 849 |
| 462 | Ga0439458_0043881 | 3300042157 | Bacteria | 1091 |
| 463 | Ga0439458_0111076 | 3300042157 | Bacteria | 717 |
| 464 | Ga0439459_0120503 | 3300042438 | Bacteria | 661 |
| 465 | Ga0439464_0083749 | 3300042439 | Bacteria | 955 |
| 466 | Ga0450916_000427 | 3300042530 | Bacteria | 3595 |
| 467 | Ga0450893_0002832 | 3300042532 | Bacteria | 2720 |
| 468 | Ga0450901_009585 | 3300042533 | Bacteria | 1001 |
| 469 | Ga0451577_0039030 | 3300042876 | Bacteria | 4267 |
| 470 | Ga0451577_0049877 | 3300042876 | Bacteria | 3737 |
| 471 | Ga0466969_0000018 | 3300044656 | Bacteria | 102911 |
| 472 | Ga0466969_0002589 | 3300044656 | Bacteria | 9661 |
| 473 | Ga0466969_0012551 | 3300044656 | Bacteria | 4465 |
| 474 | Ga0466972_0007374 | 3300044658 | Bacteria | 5527 |
| 475 | Ga0453683_1220206 | 3300044673 | Bacteria | 504 |
| 476 | Ga0466965_0008031 | 3300044683 | Bacteria | 4871 |
| 477 | Ga0466966_0021693 | 3300044684 | Bacteria | 4215 |
| 478 | Ga0466966_0026863 | 3300044684 | Bacteria | 3755 |
| 479 | Ga0466966_0619618 | 3300044684 | Bacteria | 651 |
| 480 | Ga0466961_0005561 | 3300044693 | Bacteria | 7954 |
| 481 | Ga0466961_0166639 | 3300044693 | Bacteria | 1371 |
| 482 | Ga0466963_0238605 | 3300044694 | Bacteria | 1274 |
| 483 | Ga0466964_0000637 | 3300044706 | Bacteria | 11177 |
| 484 | Ga0466964_0003200 | 3300044706 | Bacteria | 5954 |
| 485 | Ga0453684_0218561 | 3300044712 | Bacteria | 2209 |
| 486 | Ga0453684_1413847 | 3300044712 | Bacteria | 721 |
| 487 | Ga0453684_2047433 | 3300044712 | Bacteria | 575 |
| 488 | Ga0466971_0001482 | 3300044719 | Bacteria | 9910 |
| 489 | Ga0466971_0002400 | 3300044719 | Bacteria | 7905 |
| 490 | Ga0466968_0012515 | 3300044735 | Bacteria | 3324 |
| 491 | Ga0466970_0030706 | 3300044765 | Bacteria | 2834 |
| 492 | Ga0466970_0084292 | 3300044765 | Bacteria | 1720 |
| 493 | Ga0466970_0132024 | 3300044765 | Bacteria | 1372 |
| 494 | Ga0466957_0029622 | 3300044842 | Bacteria | 3265 |
| 495 | Ga0466960_0549416 | 3300044901 | Bacteria | 681 |
| 496 | Ga0466959_0000855 | 3300045049 | Bacteria | 17985 |
| 497 | Ga0466959_0014533 | 3300045049 | Bacteria | 5725 |
| 498 | Ga0466959_0057593 | 3300045049 | Bacteria | 2832 |
| 499 | Ga0451576_0106671 | 3300045051 | Bacteria | 2915 |
| 500 | Ga0451576_1269618 | 3300045051 | Bacteria | 768 |
| 501 | Ga0451576_1643998 | 3300045051 | Bacteria | 666 |
| 502 | Ga0466958_0002207 | 3300045836 | Bacteria | 9697 |
| 503 | Ga0466967_0003037 | 3300045976 | Bacteria | 10770 |
| 504 | Ga0466967_0876553 | 3300045976 | Bacteria | 892 |
| 505 | Ga0495590_0004188 | 3300046457 | Bacteria | 5838 |
| 506 | Ga0495651_0074163 | 3300046462 | Bacteria | 2582 |
| 507 | Ga0495651_0422670 | 3300046462 | Bacteria | 866 |
| 508 | Ga0495653_0258688 | 3300046463 | Bacteria | 1152 |
| 509 | Ga0495650_0038857 | 3300046471 | Bacteria | 2058 |
| 510 | Ga0495585_0010449 | 3300046492 | Bacteria | 5520 |
| 511 | Ga0495583_0000510 | 3300046506 | Bacteria | 55787 |
| 512 | Ga0495606_0003088 | 3300046507 | Bacteria | 18141 |
| 513 | Ga0495606_0055743 | 3300046507 | Bacteria | 2555 |
| 514 | Ga0495608_0596810 | 3300046511 | Bacteria | 663 |
| 515 | Ga0495628_0560018 | 3300046516 | Bacteria | 820 |
| 516 | Ga0495598_0168327 | 3300046537 | Bacteria | 775 |
| 517 | Ga0495621_0004071 | 3300046539 | Bacteria | 4071 |
| 518 | Ga0495633_0147305 | 3300046558 | Bacteria | 1088 |
| 519 | Ga0495656_0532111 | 3300046615 | Bacteria | 625 |
| 520 | Ga0495668_0190631 | 3300046616 | Bacteria | 1123 |
| 521 | Ga0495634_0275487 | 3300046642 | Bacteria | 1023 |
| 522 | Ga0495625_0081173 | 3300046660 | Bacteria | 2257 |
| 523 | Ga0495623_0593288 | 3300046679 | Bacteria | 576 |
| 524 | Ga0495658_0514873 | 3300046683 | Bacteria | 766 |
| 525 | Ga0495670_0057727 | 3300046691 | Bacteria | 1949 |
| 526 | Ga0495671_0264020 | 3300046692 | Bacteria | 830 |
| 527 | Ga0495649_0000961 | 3300046694 | Bacteria | 22764 |
| 528 | Ga0495589_0117162 | 3300046794 | Bacteria | 1283 |
| 529 | Ga0495683_0299445 | 3300047323 | Bacteria | 691 |
| 530 | Ga0495686_0067186 | 3300047472 | Bacteria | 2213 |
| 531 | Ga0495602_0185169 | 3300048088 | Bacteria | 1602 |
| 532 | Ga0496100_0718129 | 3300048903 | Bacteria | 780 |
| 533 | Ga0496100_1282247 | 3300048903 | Bacteria | 578 |
| 534 | Ga0496103_0553500 | 3300048906 | Bacteria | 734 |
| 535 | Ga0496104_0317930 | 3300048907 | Bacteria | 1470 |
| 536 | Ga0496105_0519140 | 3300048908 | Bacteria | 933 |
| 537 | Ga0496106_0113183 | 3300048909 | Bacteria | 2115 |
| 538 | Ga0496107_0711146 | 3300048910 | Bacteria | 739 |
| 539 | Ga0496108_1651262 | 3300048911 | Bacteria | 529 |
| 540 | Ga0496109_0188205 | 3300048912 | Bacteria | 1939 |
| 541 | Ga0496109_0771054 | 3300048912 | Bacteria | 900 |
| 542 | Ga0496109_0999229 | 3300048912 | Bacteria | 774 |
| 543 | Ga0496110_0139203 | 3300048913 | Bacteria | 2194 |
| 544 | Ga0496111_0388603 | 3300048914 | Bacteria | 1032 |
| 545 | Ga0496111_0554912 | 3300048914 | Bacteria | 843 |
| 546 | Ga0496111_0812262 | 3300048914 | Bacteria | 676 |
| 547 | Ga0496112_0018422 | 3300048915 | Bacteria | 6573 |
| 548 | Ga0496113_0089439 | 3300048916 | Bacteria | 2370 |
| 549 | Ga0496123_0344823 | 3300048926 | Bacteria | 695 |
| 550 | Ga0496125_0090638 | 3300048928 | Bacteria | 2294 |
| 551 | Ga0496126_0071539 | 3300048929 | Bacteria | 3087 |
| 552 | Ga0496126_1153802 | 3300048929 | Bacteria | 572 |
| 553 | Ga0501306_000061 | 3300049127 | Bacteria | 5674 |
| 554 | Ga0501306_001000 | 3300049127 | Bacteria | 2483 |
| 555 | Ga0501306_004240 | 3300049127 | Bacteria | 1597 |
| 556 | Ga0501308_001669 | 3300049128 | Bacteria | 1828 |
| 557 | Ga0501308_003436 | 3300049128 | Bacteria | 1466 |
| 558 | Ga0501308_009444 | 3300049128 | Bacteria | 1065 |
| 559 | Ga0501308_019526 | 3300049128 | Bacteria | 837 |
| 560 | Ga0501308_021321 | 3300049128 | Bacteria | 813 |
| 561 | Ga0501309_000014 | 3300049129 | Bacteria | 8867 |
| 562 | Ga0501309_022934 | 3300049129 | Bacteria | 885 |
| 563 | Ga0501309_051013 | 3300049129 | Bacteria | 650 |
| 564 | Ga0501310_000059 | 3300049130 | Bacteria | 10166 |
| 565 | Ga0501304_000014 | 3300049160 | Bacteria | 8417 |
| 566 | Ga0501304_005905 | 3300049160 | Bacteria | 973 |
| 567 | Ga0501304_019806 | 3300049160 | Bacteria | 659 |
| 568 | Ga0501304_031706 | 3300049160 | Bacteria | 564 |
| 569 | Ga0501305_000004 | 3300049161 | Bacteria | 13267 |
| 570 | Ga0501305_006370 | 3300049161 | Bacteria | 1464 |
| 571 | Ga0501305_055313 | 3300049161 | Bacteria | 674 |
| 572 | Ga0501305_067745 | 3300049161 | Bacteria | 624 |
| 573 | Ga0501305_072789 | 3300049161 | Bacteria | 607 |
| 574 | Ga0501305_087885 | 3300049161 | Bacteria | 566 |
| 575 | Ga0501307_000029 | 3300049162 | Bacteria | 5210 |
| 576 | Ga0501307_018101 | 3300049162 | Bacteria | 893 |
| 577 | Ga0501307_081634 | 3300049162 | Bacteria | 529 |
| 578 | Ga0501291_001472 | 3300049514 | Bacteria | 2738 |
| 579 | Ga0501294_001835 | 3300049517 | Bacteria | 2074 |
| 580 | Ga0501299_031053 | 3300049522 | Bacteria | 1031 |
| 581 | Ga0501300_005983 | 3300049523 | Bacteria | 1791 |
| 582 | Ga0501301_021010 | 3300049524 | Bacteria | 628 |
| 583 | Ga0501302_010569 | 3300049525 | Bacteria | 666 |
| 584 | Ga0501311_000038 | 3300049527 | Bacteria | 5334 |
| 585 | Ga0501311_097973 | 3300049527 | Bacteria | 516 |
| 586 | Ga0501311_098874 | 3300049527 | Bacteria | 514 |
| 587 | Ga0501312_000016 | 3300049528 | Bacteria | 9244 |
| 588 | Ga0501312_010213 | 3300049528 | Bacteria | 1252 |
| 589 | Ga0501312_074929 | 3300049528 | Bacteria | 605 |
| 590 | Ga0501312_084925 | 3300049528 | Bacteria | 577 |
| 591 | Ga0501313_001124 | 3300049529 | Bacteria | 2195 |
| 592 | Ga0501313_028382 | 3300049529 | Bacteria | 718 |
| 593 | Ga0501313_041015 | 3300049529 | Bacteria | 622 |
| 594 | Ga0501313_055230 | 3300049529 | Bacteria | 555 |
| 595 | Ga0501314_000017 | 3300049530 | Bacteria | 8558 |
| 596 | Ga0501314_002757 | 3300049530 | Bacteria | 1379 |
| 597 | Ga0501314_004922 | 3300049530 | Bacteria | 1123 |
| 598 | Ga0501314_007493 | 3300049530 | Bacteria | 969 |
| 599 | Ga0501314_008987 | 3300049530 | Bacteria | 911 |
| 600 | Ga0501314_045262 | 3300049530 | Bacteria | 521 |
| 601 | Ga0501315_012519 | 3300049531 | Bacteria | 1051 |
| 602 | Ga0501315_016123 | 3300049531 | Bacteria | 965 |
| 603 | Ga0501315_025919 | 3300049531 | Bacteria | 818 |
| 604 | Ga0501315_036047 | 3300049531 | Bacteria | 732 |
| 605 | Ga0501315_092357 | 3300049531 | Bacteria | 526 |
| 606 | Ga0501316_000872 | 3300049532 | Bacteria | 2338 |
| 607 | Ga0501316_020750 | 3300049532 | Bacteria | 827 |
| 608 | Ga0501316_074953 | 3300049532 | Bacteria | 517 |
| 609 | Ga0501317_008287 | 3300049533 | Bacteria | 1194 |
| 610 | Ga0501317_008982 | 3300049533 | Bacteria | 1164 |
| 611 | Ga0501317_021103 | 3300049533 | Bacteria | 882 |
| 612 | Ga0501317_037847 | 3300049533 | Bacteria | 726 |
| 613 | Ga0501318_000131 | 3300049534 | Bacteria | 3541 |
| 614 | Ga0501318_010198 | 3300049534 | Bacteria | 1038 |
| 615 | Ga0501318_019255 | 3300049534 | Bacteria | 850 |
| 616 | Ga0501318_027537 | 3300049534 | Bacteria | 756 |
| 617 | Ga0501319_001099 | 3300049535 | Bacteria | 1496 |
| 618 | Ga0501319_022755 | 3300049535 | Bacteria | 570 |
| 619 | Ga0501320_000131 | 3300049536 | Bacteria | 3444 |
| 620 | Ga0501320_048782 | 3300049536 | Bacteria | 572 |
| 621 | Ga0501321_000120 | 3300049537 | Bacteria | 3982 |
| 622 | Ga0501322_000921 | 3300049538 | Bacteria | 1530 |
| 623 | Ga0501322_004105 | 3300049538 | Bacteria | 967 |
| 624 | Ga0501323_010881 | 3300049539 | Bacteria | 1091 |
| 625 | Ga0501323_015806 | 3300049539 | Bacteria | 956 |
| 626 | Ga0501323_035279 | 3300049539 | Bacteria | 716 |
| 627 | Ga0501324_000221 | 3300049540 | Bacteria | 2719 |
| 628 | Ga0501325_000034 | 3300049541 | Bacteria | 3949 |
| 629 | Ga0501325_002337 | 3300049541 | Bacteria | 1286 |
| 630 | Ga0501325_002669 | 3300049541 | Bacteria | 1241 |
| 631 | Ga0501325_020665 | 3300049541 | Bacteria | 692 |
| 632 | Ga0501326_06457 | 3300049542 | Bacteria | 655 |
| 633 | Ga0501327_17690 | 3300049543 | Bacteria | 517 |
| 634 | Ga0501328_03299 | 3300049544 | Bacteria | 744 |
| 635 | Ga0501330_007626 | 3300049546 | Bacteria | 729 |
| 636 | Ga0501331_07702 | 3300049547 | Bacteria | 644 |
| 637 | Ga0501333_001792 | 3300049549 | Bacteria | 1201 |
| 638 | Ga0501335_004434 | 3300049551 | Bacteria | 1227 |
| 639 | Ga0501336_009266 | 3300049552 | Bacteria | 773 |
| 640 | Ga0501336_012604 | 3300049552 | Bacteria | 700 |
| 641 | Ga0501337_005613 | 3300049553 | Bacteria | 843 |
| 642 | Ga0501338_10616 | 3300049554 | Bacteria | 622 |
| 643 | Ga0501339_00793 | 3300049555 | Bacteria | 715 |
| 644 | Ga0501034_0812110 | 3300049571 | Bacteria | 827 |
| 645 | Ga0501043_0000090 | 3300049579 | Bacteria | 81336 |
| 646 | Ga0501046_0000126 | 3300049580 | Bacteria | 81334 |
| 647 | Ga0501047_0000160 | 3300049581 | Bacteria | 81946 |
| 648 | Ga0501048_0003429 | 3300049582 | Bacteria | 12039 |
| 649 | Ga0501071_0873461 | 3300049587 | Bacteria | 694 |
| 650 | Ga0501199_001069 | 3300049650 | Bacteria | 2460 |
| 651 | Ga0501201_017474 | 3300049651 | Bacteria | 740 |
| 652 | Ga0501202_000808 | 3300049652 | Bacteria | 4708 |
| 653 | Ga0501202_154969 | 3300049652 | Bacteria | 602 |
| 654 | Ga0501206_001738 | 3300049653 | Bacteria | 2732 |
| 655 | Ga0501206_062249 | 3300049653 | Bacteria | 615 |
| 656 | Ga0501207_009301 | 3300049654 | Bacteria | 1434 |
| 657 | Ga0501207_060778 | 3300049654 | Bacteria | 692 |
| 658 | Ga0501211_000022 | 3300049658 | Bacteria | 11753 |
| 659 | Ga0501217_017765 | 3300049661 | Bacteria | 1643 |
| 660 | Ga0501222_002187 | 3300049662 | Bacteria | 2713 |
| 661 | Ga0501223_007701 | 3300049663 | Bacteria | 2200 |
| 662 | Ga0501223_027094 | 3300049663 | Bacteria | 1115 |
| 663 | Ga0501223_087912 | 3300049663 | Bacteria | 628 |
| 664 | Ga0501227_018717 | 3300049665 | Bacteria | 1574 |
| 665 | Ga0501233_002966 | 3300049668 | Bacteria | 3030 |
| 666 | Ga0501235_001228 | 3300049669 | Bacteria | 5397 |
| 667 | Ga0501239_081866 | 3300049672 | Bacteria | 519 |
| 668 | Ga0501249_003813 | 3300049679 | Bacteria | 3043 |
| 669 | Ga0501253_001536 | 3300049683 | Bacteria | 2379 |
| 670 | Ga0501255_007217 | 3300049684 | Bacteria | 1171 |
| 671 | Ga0501256_020904 | 3300049685 | Bacteria | 687 |
| 672 | Ga0501258_000137 | 3300049687 | Bacteria | 4092 |
| 673 | Ga0501259_014208 | 3300049688 | Bacteria | 1347 |
| 674 | Ga0501221_001094 | 3300049704 | Bacteria | 4449 |
| 675 | Ga0501225_0042192 | 3300049705 | Bacteria | 1259 |
| 676 | Ga0501229_001006 | 3300049706 | Bacteria | 3217 |
| 677 | Ga0501234_010360 | 3300049707 | Bacteria | 1452 |
| 678 | Ga0501079_0537572 | 3300049741 | Bacteria | 919 |
| 679 | Ga0501080_0517640 | 3300049742 | Bacteria | 1065 |
| 680 | Ga0501232_001245 | 3300049757 | Bacteria | 1978 |
| 681 | Ga0501262_000590 | 3300049759 | Bacteria | 4309 |
| 682 | Ga0501264_003121 | 3300049761 | Bacteria | 1512 |
| 683 | Ga0501266_038062 | 3300049763 | Bacteria | 707 |
| 684 | Ga0501267_000666 | 3300049764 | Bacteria | 2729 |
| 685 | Ga0501268_001964 | 3300049765 | Bacteria | 2639 |
| 686 | Ga0501269_001030 | 3300049766 | Bacteria | 3942 |
| 687 | Ga0501272_000713 | 3300049769 | Bacteria | 2990 |
| 688 | Ga0501274_001433 | 3300049771 | Bacteria | 1821 |
| 689 | Ga0501281_13953 | 3300049777 | Bacteria | 585 |
| 690 | Ga0501035_0317635 | 3300049822 | Bacteria | 1309 |
| 691 | Ga0501035_0985460 | 3300049822 | Bacteria | 663 |
| 692 | Ga0501044_0057237 | 3300049823 | Bacteria | 4001 |
| 693 | Ga0501045_0000882 | 3300049824 | Bacteria | 19499 |
| 694 | nmdc:mga03683_137434_c1 | 3300050489 | Bacteria | 1097 |
| 695 | nmdc:mga03683_40005_c1 | 3300050489 | Bacteria | 1921 |
| 696 | nmdc:mga03683_586371_c1 | 3300050489 | Bacteria | 545 |
| 697 | nmdc:mga03n38_394330_c1 | 3300050490 | Bacteria | 761 |
| 698 | nmdc:mga03n38_412929_c1 | 3300050490 | Bacteria | 745 |
| 699 | nmdc:mga00v17_638959_c1 | 3300050491 | Bacteria | 685 |
| 700 | nmdc:mga0yw44_1138361_c1 | 3300050492 | Bacteria | 527 |
| 701 | nmdc:mga0k408_106262_c1 | 3300050493 | Bacteria | 1024 |
| 702 | nmdc:mga0k408_113462_c1 | 3300050493 | Bacteria | 1603 |
| 703 | nmdc:mga0k408_118827_c1 | 3300050493 | Bacteria | 1565 |
| 704 | nmdc:mga0k408_191365_c1 | 3300050493 | Bacteria | 1221 |
| 705 | nmdc:mga0k408_219_c1 | 3300050493 | Bacteria | 23656 |
| 706 | nmdc:mga0k408_269951_c1 | 3300050493 | Bacteria | 1016 |
| 707 | nmdc:mga0k408_33936_c1 | 3300050493 | Bacteria | 555 |
| 708 | nmdc:mga0k408_34945_c1 | 3300050493 | Bacteria | 2880 |
| 709 | nmdc:mga07m45_16030_c1 | 3300050496 | Bacteria | 4011 |
| 710 | nmdc:mga07m45_192519_c1 | 3300050496 | Bacteria | 1186 |
| 711 | nmdc:mga07m45_341539_c1 | 3300050496 | Bacteria | 870 |
| 712 | nmdc:mga07m45_398_c1 | 3300050496 | Bacteria | 17925 |
| 713 | nmdc:mga07m45_44170_c1 | 3300050496 | Bacteria | 2500 |
| 714 | nmdc:mga05p37_217522_c1 | 3300050507 | Bacteria | 2307 |
| 715 | nmdc:mga09592_1698079_c1 | 3300050508 | Bacteria | 509 |
| 716 | nmdc:mga09592_473801_c1 | 3300050508 | Bacteria | 1079 |
| 717 | nmdc:mga08y16_591318_c1 | 3300050511 | Bacteria | 1119 |
| 718 | nmdc:mga0a205_671858_c1 | 3300050515 | Bacteria | 886 |
| 719 | Ga0500635_0000036 | 3300053080 | Bacteria | 94740 |
| 720 | Ga0500578_0706483 | 3300053086 | Bacteria | 542 |
| 721 | Ga0500651_0186189 | 3300053093 | Bacteria | 1231 |
| 722 | Ga0500608_250479 | 3300053122 | Bacteria | 691 |
| 723 | Ga0500652_320440 | 3300053131 | Bacteria | 594 |
| 724 | Ga0500658_0421076 | 3300053134 | Bacteria | 610 |
| 725 | Ga0500559_0045090 | 3300053136 | Bacteria | 1929 |
| 726 | Ga0500564_314413 | 3300053138 | Bacteria | 595 |
| 727 | Ga0500622_0001316 | 3300053156 | Bacteria | 20204 |
| 728 | Ga0500638_090974 | 3300053162 | Bacteria | 1436 |
| 729 | Ga0500636_0162502 | 3300053177 | Bacteria | 1215 |
| 730 | Ga0500661_061146 | 3300055283 | Bacteria | 680 |
| 731 | Ga0587084_000147 | 3300059477 | Bacteria | 4251 |
| 732 | Ga0587093_000068 | 3300059478 | Bacteria | 4574 |
| 733 | Ga0587093_026841 | 3300059478 | Bacteria | 807 |
| 734 | Ga0587066_004510 | 3300059490 | Bacteria | 1719 |
| 735 | Ga0587066_025106 | 3300059490 | Bacteria | 1019 |
| 736 | Ga0587070_000065 | 3300059491 | Bacteria | 5371 |
| 737 | Ga0587070_002116 | 3300059491 | Bacteria | 2196 |
| 738 | Ga0587073_0000528 | 3300059492 | Bacteria | 3601 |
| 739 | Ga0587073_0008893 | 3300059492 | Bacteria | 1640 |
| 740 | Ga0587073_0012121 | 3300059492 | Bacteria | 1487 |
| 741 | Ga0587077_000950 | 3300059493 | Bacteria | 2876 |
| 742 | Ga0587077_001041 | 3300059493 | Bacteria | 2802 |
| 743 | Ga0587077_009175 | 3300059493 | Bacteria | 1494 |
| 744 | Ga0587077_024961 | 3300059493 | Bacteria | 1092 |
| 745 | Ga0587080_004865 | 3300059503 | Bacteria | 1772 |
| 746 | Ga0587080_026133 | 3300059503 | Bacteria | 990 |
| 747 | Ga0587082_002352 | 3300059504 | Bacteria | 2123 |
| 748 | Ga0587082_065061 | 3300059504 | Bacteria | 728 |
| 749 | Ga0587083_0000260 | 3300059505 | Bacteria | 4088 |
| 750 | Ga0587085_144850 | 3300059506 | Bacteria | 543 |
| 751 | Ga0587086_033945 | 3300059507 | Bacteria | 763 |
| 752 | Ga0587088_000741 | 3300059508 | Bacteria | 2965 |
| 753 | Ga0587088_006778 | 3300059508 | Bacteria | 1560 |
| 754 | Ga0587088_170751 | 3300059508 | Bacteria | 539 |
| 755 | Ga0587089_008079 | 3300059509 | Bacteria | 1264 |
| 756 | Ga0587090_030499 | 3300059510 | Bacteria | 899 |
| 757 | Ga0587091_091666 | 3300059511 | Bacteria | 699 |
| 758 | Ga0587092_041567 | 3300059512 | Bacteria | 802 |
| 759 | Ga0587092_057351 | 3300059512 | Bacteria | 721 |
| 760 | Ga0587094_018487 | 3300059513 | Bacteria | 992 |
| 761 | Ga0587094_024327 | 3300059513 | Bacteria | 901 |
| 762 | Ga0587094_128531 | 3300059513 | Bacteria | 514 |
| 763 | Ga0587106_029929 | 3300059605 | Bacteria | 868 |
| 764 | Ga0587106_165957 | 3300059605 | Bacteria | 501 |
| 765 | Ga0587125_000700 | 3300059607 | Bacteria | 2137 |
| 766 | Ga0587129_000468 | 3300059608 | Bacteria | 1815 |
| 767 | Ga0587099_000652 | 3300059622 | Bacteria | 2125 |
| 768 | Ga0587101_000448 | 3300059623 | Bacteria | 2910 |
| 769 | Ga0587101_004507 | 3300059623 | Bacteria | 1492 |
| 770 | Ga0587101_104843 | 3300059623 | Bacteria | 567 |
| 771 | Ga0587109_036579 | 3300059624 | Bacteria | 956 |
| 772 | Ga0587113_008179 | 3300059625 | Bacteria | 924 |
| 773 | Ga0587115_001117 | 3300059626 | Bacteria | 2323 |
| 774 | Ga0587127_000506 | 3300059629 | Bacteria | 1817 |
| 775 | Ga0587128_001730 | 3300059630 | Bacteria | 2132 |
| 776 | Ga0587130_021759 | 3300059631 | Bacteria | 698 |
| 777 | Ga0587130_052286 | 3300059631 | Bacteria | 514 |
| 778 | Ga0587062_000400 | 3300059639 | Bacteria | 2970 |
| 779 | Ga0587062_012649 | 3300059639 | Bacteria | 1086 |
| 780 | Ga0587062_138679 | 3300059639 | Bacteria | 506 |
| 781 | Ga0587067_002743 | 3300059640 | Bacteria | 2128 |
| 782 | Ga0587068_001309 | 3300059641 | Bacteria | 2740 |
| 783 | Ga0587068_024456 | 3300059641 | Bacteria | 1012 |
| 784 | Ga0587068_066467 | 3300059641 | Bacteria | 703 |
| 785 | Ga0587068_071828 | 3300059641 | Bacteria | 684 |
| 786 | Ga0587068_078370 | 3300059641 | Bacteria | 663 |
| 787 | Ga0587069_010834 | 3300059642 | Bacteria | 1207 |
| 788 | Ga0587069_076465 | 3300059642 | Bacteria | 645 |
| 789 | Ga0587072_001392 | 3300059643 | Bacteria | 2980 |
| 790 | Ga0587072_008796 | 3300059643 | Bacteria | 1606 |
| 791 | Ga0587076_002043 | 3300059645 | Bacteria | 2197 |
| 792 | Ga0587076_002122 | 3300059645 | Bacteria | 2173 |
| 793 | Ga0587079_003155 | 3300059647 | Bacteria | 2119 |
| 794 | Ga0587079_046494 | 3300059647 | Bacteria | 896 |
| 795 | Ga0587100_000850 | 3300059648 | Bacteria | 1621 |
| 796 | Ga0587100_024483 | 3300059648 | Bacteria | 609 |
| 797 | Ga0587102_000785 | 3300059649 | Bacteria | 1981 |
| 798 | Ga0587104_004540 | 3300059650 | Bacteria | 891 |
| 799 | Ga0587105_000221 | 3300059651 | Bacteria | 2056 |
| 800 | Ga0587107_000989 | 3300059652 | Bacteria | 2150 |
| 801 | Ga0587108_008141 | 3300059653 | Bacteria | 845 |
| 802 | Ga0587114_002480 | 3300059655 | Bacteria | 1723 |
| 803 | Ga0587118_00289 | 3300059657 | Bacteria | 2380 |
| 804 | Ga0587119_021596 | 3300059658 | Bacteria | 826 |
| 805 | Ga0587124_001207 | 3300059660 | Bacteria | 1640 |
| 806 | Ga0587096_00044 | 3300060247 | Bacteria | 2129 |
| 807 | Ga0587071_026067 | 3300060344 | Bacteria | 1101 |
| 808 | Ga0587111_0000186 | 3300060346 | Bacteria | 4817 |
| 809 | Ga0587111_0000227 | 3300060346 | Bacteria | 4609 |
| 810 | Ga0466962_0000718 | 3300061719 | Bacteria | 14786 |
| 811 | Ga0466962_0014522 | 3300061719 | Bacteria | 3795 |
| 812 | 2643746689 | 2643221544 | Bacteria | 5886209 |
| 813 | 2643937419 | 2643221585 | Bacteria | 5812563 |
| 814 | 2644218755 | 2643221639 | Bacteria | 6649903 |
| 815 | 2644256842 | 2643221646 | Bacteria | 6433402 |
| 816 | 2644314957 | 2643221656 | Bacteria | 5809961 |
| 817 | 2644338008 | 2643221660 | Bacteria | 4208257 |
| 818 | 2739057970 | 2738541337 | Bacteria | 6183410 |
| 819 | 2831867512 | 2831864461 | Bacteria | 6502356 |
| 820 | Ga0068868_100602254 | |||
| 821 | JGI25156J39149_1025699 | |||
| 822 | JGI25156J39149_1026157 | |||
| 823 | JGI25156J39149_1039814 | |||
| 824 | JGI25154J39366_1000593 | |||
| 825 | JGI25157J39369_1001522 | |||
| 826 | JGI25164J39214_1002084 | |||
| 827 | Ga0006765J45826_106373 | |||
| 828 | Ga0006778J45830_1009213 | |||
| 829 | Ga0006778J45830_1056528 | |||
| 830 | Ga0006759J45824_1029126 | |||
| 831 | Ga0006759J45824_1055672 | |||
| 832 | Ga0006758J48902_1015144 | |||
| 833 | Ga0006758J48902_1021934 | |||
| 834 | Ga0006758J48902_1024929 | |||
| 835 | Ga0006770J48903_1001899 | |||
| 836 | Ga0006770J48903_1044543 | |||
| 837 | Ga0006777J48905_1014855 | |||
| 838 | Ga0007417J51691_1029545 | |||
| 839 | Ga0007417J51691_1043945 | |||
| 840 | Ga0007427J51700_105505 | |||
| 841 | Ga0007427J51700_113549 | |||
| 842 | Ga0007410J51695_1005226 | |||
| 843 | Ga0007410J51695_1028665 | |||
| 844 | Ga0007410J51695_1032042 | |||
| 845 | Ga0007409J51694_1019841 | |||
| 846 | Ga0007409J51694_1020061 | |||
| 847 | Ga0007416J51690_1027279 | |||
| 848 | Ga0007416J51690_1051124 | |||
| 849 | Ga0007429J51699_1066463 | |||
| 850 | Ga0032354_1028740 | |||
| 851 | Ga0032354_1037309 | |||
| 852 | Ga0032354_1044089 | |||
| 853 | Ga0032354_1117171 | |||
| 854 | Ga0055539_1037180 | |||
| 855 | Ga0055533_1000043 | |||
| 856 | Ga0055525_1000161 | |||
| 857 | Ga0055525_1000641 | |||
| 858 | Ga0055535_1021794 | |||
| 859 | Ga0055535_1023542 | |||
| 860 | Ga0055529_1000322 | |||
| 861 | Ga0055540_1026414 | |||
| 862 | Ga0055531_10012516 | |||
| 863 | Ga0055531_10098547 | |||
| 864 | Ga0055543_1027494 | |||
| 865 | Ga0058858_1003354 | |||
| 866 | Ga0058858_1430617 | |||
| 867 | Ga0058859_10030919 | |||
| 868 | Ga0058859_10055155 | |||
| 869 | Ga0058859_11825120 | |||
| 870 | Ga0058863_10044021 | |||
| 871 | Ga0058861_10142005 | |||
| 872 | Ga0058861_10194247 | |||
| 873 | Ga0058860_10052045 | |||
| 874 | Ga0058860_10096621 | |||
| 875 | Ga0058860_12116272 | |||
| 876 | Ga0058862_10051180 | |||
| 877 | Ga0065165_1010518 | |||
| 878 | Ga0065165_1048431 | |||
| 879 | Ga0065707_10559059 | |||
| 880 | Ga0070658_11148191 | |||
| 881 | Ga0070658_11221121 | |||
| 882 | Ga0070658_11468236 | |||
| 883 | Ga0070676_10756527 | |||
| 884 | Ga0070683_100352957 | |||
| 885 | Ga0070690_100134141 | |||
| 886 | Ga0068869_100012739 | |||
| 887 | Ga0070666_10109820 | |||
| 888 | Ga0070682_100066791 | |||
| 889 | Ga0068868_100831067 | |||
| 890 | Ga0068868_101147186 | |||
| 891 | Ga0070660_100320427 | |||
| 892 | Ga0070660_100371696 | |||
| 893 | Ga0070660_101462983 | |||
| 894 | Ga0070691_10245118 | |||
| 895 | Ga0070669_100343052 | |||
| 896 | Ga0070669_101564377 | |||
| 897 | Ga0070675_100330914 | |||
| 898 | Ga0070675_100398807 | |||
| 899 | Ga0070671_100038207 | |||
| 900 | Ga0070671_100871948 | |||
| 901 | Ga0070674_100683279 | |||
| 902 | Ga0070674_101032674 | |||
| 903 | Ga0070673_100002927 | |||
| 904 | Ga0070688_100254873 | |||
| 905 | Ga0070659_100057420 | |||
| 906 | Ga0070659_100120047 | |||
| 907 | Ga0070667_101780280 | |||
| 908 | Ga0070678_100037760 | |||
| 909 | Ga0070678_100207105 | |||
| 910 | Ga0070678_100421211 | |||
| 911 | Ga0070662_100274312 | |||
| 912 | Ga0070681_10497103 | |||
| 913 | Ga0068867_100292475 | |||
| 914 | Ga0068867_100601767 | |||
| 915 | Ga0070707_100461298 | |||
| 916 | Ga0070679_100375973 | |||
| 917 | Ga0070679_100834570 | |||
| 918 | Ga0070684_100894602 | |||
| 919 | Ga0068853_100345863 | |||
| 920 | Ga0068853_101067403 | |||
| 921 | Ga0068853_101936437 | |||
| 922 | Ga0068853_101988889 | |||
| 923 | Ga0070672_100370305 | |||
| 924 | Ga0070686_100729464 | |||
| 925 | Ga0070665_100525724 | |||
| 926 | Ga0070665_100551566 | |||
| 927 | Ga0068855_100961007 | |||
| 928 | Ga0068855_101390928 | |||
| 929 | Ga0070664_100452105 | |||
| 930 | Ga0068857_100387564 | |||
| 931 | Ga0068854_100273417 | |||
| 932 | Ga0068856_100033721 | |||
| 933 | Ga0068856_100231329 | |||
| 934 | Ga0068856_101792745 | |||
| 935 | Ga0068852_100157329 | |||
| 936 | Ga0068852_100184567 | |||
| 937 | Ga0068852_100912756 | |||
| 938 | Ga0068859_103056882 | |||
| 939 | Ga0068864_100723641 | |||
| 940 | Ga0068864_102061142 | |||
| 941 | Ga0068866_10472692 | |||
| 942 | Ga0068866_11466369 | |||
| 943 | Ga0068861_100067654 | |||
| 944 | Ga0068861_100250877 | |||
| 945 | Ga0068851_10097792 | |||
| 946 | Ga0068851_10510819 | |||
| 947 | Ga0068863_100182919 | |||
| 948 | Ga0068858_101935889 | |||
| 949 | Ga0068862_100009442 | |||
| 950 | Ga0068862_100090240 | |||
| 951 | Ga0068862_100566589 | |||
| 952 | Ga0081455_10342025 | |||
| 953 | Ga0075363_100212774 | |||
| 954 | Ga0075363_100251023 | |||
| 955 | Ga0075364_10260140 | |||
| 956 | Ga0075362_10068048 | |||
| 957 | Ga0075362_10118078 | |||
| 958 | Ga0075362_10579705 | |||
| 959 | Ga0075366_10000795 | |||
| 960 | Ga0075366_10021754 | |||
| 961 | Ga0075366_10075093 | |||
| 962 | Ga0075366_10102009 | |||
| 963 | Ga0075366_10111379 | |||
| 964 | Ga0075366_10214047 | |||
| 965 | Ga0075366_10281535 | |||
| 966 | Ga0075366_10979222 | |||
| 967 | Ga0075370_10000701 | |||
| 968 | Ga0075370_10096809 | |||
| 969 | Ga0075370_10178238 | |||
| 970 | Ga0075370_10381414 | |||
| 971 | Ga0075429_100409696 | |||
| 972 | Ga0097620_100993556 | |||
| 973 | Ga0097620_103056690 | |||
| 974 | Ga0105250_10211043 | |||
| 975 | Ga0105240_10018079 | |||
| 976 | Ga0105240_10608637 | |||
| 977 | Ga0105240_10763734 | |||
| 978 | Ga0105240_11532248 | |||
| 979 | Ga0105240_12384249 | |||
| 980 | Ga0111539_10350927 | |||
| 981 | Ga0111539_11955632 | |||
| 982 | Ga0111539_12890563 | |||
| 983 | Ga0105245_10060455 | |||
| 984 | Ga0105245_12756675 | |||
| 985 | Ga0114129_10176739 | |||
| 986 | Ga0105243_10001789 | |||
| 987 | Ga0105243_10030050 | |||
| 988 | Ga0105243_10177323 | |||
| 989 | Ga0105243_10252607 | |||
| 990 | Ga0105241_11260214 | |||
| 991 | Ga0105242_10297878 | |||
| 992 | Ga0105248_10006768 | |||
| 993 | Ga0105248_11336448 | |||
| 994 | Ga0105248_11371716 | |||
| 995 | Ga0105237_10000668 | |||
| 996 | Ga0105238_10003926 | |||
| 997 | Ga0105238_10088675 | |||
| 998 | Ga0105238_11082143 | |||
| 999 | Ga0105238_12840029 | |||
| 1000 | Ga0105249_10068515 | |||
| 1001 | Ga0105249_10311041 | |||
| 1002 | Ga0105239_10001255 | |||
| 1003 | Ga0105239_11112547 | |||
| 1004 | Ga0105246_10060033 | |||
| 1005 | Ga0157327_1015077 | |||
| 1006 | Ga0157373_10739528 | |||
| 1007 | Ga0157371_10867915 | |||
| 1008 | Ga0157370_10422778 | |||
| 1009 | Ga0157369_10547096 | |||
| 1010 | Ga0157374_10123485 | |||
| 1011 | Ga0157374_11269982 | |||
| 1012 | Ga0157378_10029129 | |||
| 1013 | Ga0157378_10873702 | |||
| 1014 | Ga0163162_10505539 | |||
| 1015 | Ga0163162_12978772 | |||
| 1016 | Ga0157372_10373891 | |||
| 1017 | Ga0157372_11082189 | |||
| 1018 | Ga0157375_10137647 | |||
| 1019 | Ga0157375_10710210 | |||
| 1020 | Ga0157375_12005957 | |||
| 1021 | Ga0157375_12740470 | |||
| 1022 | Ga0163163_11953739 | |||
| 1023 | Ga0157380_10821964 | |||
| 1024 | Ga0157377_10000368 | |||
| 1025 | Ga0157379_10469488 | |||
| 1026 | Ga0157376_10090219 | |||
| 1027 | Ga0157376_11883744 | |||
| 1028 | Ga0182007_10077939 | |||
| 1029 | Ga0182007_10374325 | |||
| 1030 | Ga0163161_10514817 | |||
| 1031 | Ga0197907_10761668 | |||
| 1032 | Ga0206356_11223789 | |||
| 1033 | Ga0206355_1548870 | |||
| 1034 | Ga0206352_10258252 | |||
| 1035 | Ga0206352_10887797 | |||
| 1036 | Ga0206352_10920041 | |||
| 1037 | Ga0206352_11007505 | |||
| 1038 | Ga0206350_11041308 | |||
| 1039 | Ga0213872_10000091 | |||
| 1040 | Ga0213872_10002765 | |||
| 1041 | Ga0213872_10004732 | |||
| 1042 | Ga0209674_100067 | |||
| 1043 | Ga0209674_109216 | |||
| 1044 | Ga0209672_107040 | |||
| 1045 | Ga0209563_100068 | |||
| 1046 | Ga0209563_100088 | |||
| 1047 | Ga0207427_100260 | |||
| 1048 | Ga0209258_102113 | |||
| 1049 | Ga0209258_118229 | |||
| 1050 | Ga0209646_1000127 | |||
| 1051 | Ga0209026_1000004 | |||
| 1052 | Ga0209677_100201 | |||
| 1053 | Ga0209148_1002904 | |||
| 1054 | Ga0209759_1000129 | |||
| 1055 | Ga0209759_1003759 | |||
| 1056 | Ga0209455_1000083 | |||
| 1057 | Ga0209673_1026632 | |||
| 1058 | Ga0209564_1000008 | |||
| 1059 | Ga0209050_1004273 | |||
| 1060 | Ga0209256_1028202 | |||
| 1061 | Ga0209051_1005321 | |||
| 1062 | Ga0209257_1000047 | |||
| 1063 | Ga0207656_10116353 | |||
| 1064 | Ga0207642_10569245 | |||
| 1065 | Ga0207642_10591643 | |||
| 1066 | Ga0207680_10487657 | |||
| 1067 | Ga0207680_10523330 | |||
| 1068 | Ga0207647_10074272 | |||
| 1069 | Ga0207645_10160739 | |||
| 1070 | Ga0207645_10384444 | |||
| 1071 | Ga0207643_10312571 | |||
| 1072 | Ga0207705_10053354 | |||
| 1073 | Ga0207654_10059196 | |||
| 1074 | Ga0207654_10797506 | |||
| 1075 | Ga0207707_10417643 | |||
| 1076 | Ga0207695_10010589 | |||
| 1077 | Ga0207695_10103337 | |||
| 1078 | Ga0207671_10019707 | |||
| 1079 | Ga0207671_10047329 | |||
| 1080 | Ga0207660_11007987 | |||
| 1081 | Ga0207660_11355730 | |||
| 1082 | Ga0207662_10034330 | |||
| 1083 | Ga0207657_10152752 | |||
| 1084 | Ga0207657_10364651 | |||
| 1085 | Ga0207652_10202638 | |||
| 1086 | Ga0207652_10559555 | |||
| 1087 | Ga0207681_10187413 | |||
| 1088 | Ga0207694_10004619 | |||
| 1089 | Ga0207694_10026084 | |||
| 1090 | Ga0207694_11251446 | |||
| 1091 | Ga0207694_11625111 | |||
| 1092 | Ga0207650_11056631 | |||
| 1093 | Ga0207650_11875865 | |||
| 1094 | Ga0207659_10233696 | |||
| 1095 | Ga0207659_10365256 | |||
| 1096 | Ga0207659_10384923 | |||
| 1097 | Ga0207687_10072566 | |||
| 1098 | Ga0207687_10844263 | |||
| 1099 | Ga0207644_10024978 | |||
| 1100 | Ga0207644_10834664 | |||
| 1101 | Ga0207690_10039856 | |||
| 1102 | Ga0207706_10300451 | |||
| 1103 | Ga0207706_10738258 | |||
| 1104 | Ga0207686_10232569 | |||
| 1105 | Ga0207709_10001005 | |||
| 1106 | Ga0207709_10207965 | |||
| 1107 | Ga0207709_10226741 | |||
| 1108 | Ga0207669_10191669 | |||
| 1109 | Ga0207691_10115353 | |||
| 1110 | Ga0207691_10230836 | |||
| 1111 | Ga0207711_10009541 | |||
| 1112 | Ga0207689_10028262 | |||
| 1113 | Ga0207661_10461940 | |||
| 1114 | Ga0207679_10497711 | |||
| 1115 | Ga0207667_10701744 | |||
| 1116 | Ga0207651_10077458 | |||
| 1117 | Ga0207712_10746934 | |||
| 1118 | Ga0207712_11267320 | |||
| 1119 | Ga0207640_10018588 | |||
| 1120 | Ga0207658_11146433 | |||
| 1121 | Ga0207677_10348252 | |||
| 1122 | Ga0207639_11602510 | |||
| 1123 | Ga0207639_11702829 | |||
| 1124 | Ga0207702_10001875 | |||
| 1125 | Ga0207702_10098322 | |||
| 1126 | Ga0207641_10711953 | |||
| 1127 | Ga0207641_11341182 | |||
| 1128 | Ga0207648_10002176 | |||
| 1129 | Ga0207648_10111939 | |||
| 1130 | Ga0207648_10116151 | |||
| 1131 | Ga0207648_10300208 | |||
| 1132 | Ga0207648_10752815 | |||
| 1133 | Ga0207648_12192688 | |||
| 1134 | Ga0207676_10128448 | |||
| 1135 | Ga0207676_10946210 | |||
| 1136 | Ga0207674_10004293 | |||
| 1137 | Ga0207674_11088992 | |||
| 1138 | Ga0207675_100101603 | |||
| 1139 | Ga0207683_10032302 | |||
| 1140 | Ga0207683_10376795 | |||
| 1141 | Ga0207683_10430813 | |||
| 1142 | Ga0207698_10810285 | |||
| 1143 | Ga0207698_12435571 | |||
| 1144 | Ga0209973_1085997 | |||
| 1145 | Ga0209969_1000889 | |||
| 1146 | Ga0209981_1007951 | |||
| 1147 | Ga0209996_1000729 | |||
| 1148 | Ga0209995_1000242 | |||
| 1149 | Ga0209968_1000130 | |||
| 1150 | Ga0209999_1001613 | |||
| 1151 | Ga0209999_1062698 | |||
| 1152 | Ga0210002_1080391 | |||
| 1153 | Ga0209971_1038388 | |||
| 1154 | Ga0209966_1000117 | |||
| 1155 | Ga0209998_10002530 | |||
| 1156 | Ga0209974_10010680 | |||
| 1157 | Ga0268266_11160331 | |||
| 1158 | Ga0268265_10058401 | |||
| 1159 | Ga0268265_10354115 | |||
| 1160 | Ga0268264_10248432 | |||
| 1161 | Ga0268264_10916094 | |||
| 1162 | Ga0265334_10073367 | |||
| 1163 | Ga0265336_10000028 | |||
| 1164 | Ga0307515_10108460 | |||
| 1165 | Ga0265324_10000286 | |||
| 1166 | Ga0307511_10070244 | |||
| 1167 | Ga0265766_1017267 | |||
| 1168 | Ga0265769_101736 | |||
| 1169 | Ga0265328_10033426 | |||
| 1170 | Ga0265328_10238709 | |||
| 1171 | Ga0265331_10115103 | |||
| 1172 | Ga0265327_10000020 | |||
| 1173 | Ga0265327_10000178 | |||
| 1174 | Ga0265327_10176722 | |||
| 1175 | Ga0265316_10000201 | |||
| 1176 | Ga0307509_10322942 | |||
| 1177 | Ga0307408_100000089 | |||
| 1178 | Ga0307408_100173708 | |||
| 1179 | Ga0307408_100707218 | |||
| 1180 | Ga0307508_10563692 | |||
| 1181 | Ga0307514_10000339 | |||
| 1182 | Ga0307516_10026535 | |||
| 1183 | Ga0307516_10027941 | |||
| 1184 | Ga0307516_10040356 | |||
| 1185 | Ga0307516_10222839 | |||
| 1186 | Ga0307516_10671439 | |||
| 1187 | Ga0307405_10558102 | |||
| 1188 | Ga0307413_10520434 | |||
| 1189 | Ga0307413_10964581 | |||
| 1190 | Ga0307410_11073487 | |||
| 1191 | Ga0307410_11892895 | |||
| 1192 | Ga0307406_10513452 | |||
| 1193 | Ga0307406_10738298 | |||
| 1194 | Ga0307406_11549686 | |||
| 1195 | Ga0307407_10845472 | |||
| 1196 | Ga0307412_10532576 | |||
| 1197 | Ga0307412_10846819 | |||
| 1198 | Ga0307412_11147700 | |||
| 1199 | Ga0307416_100714982 | |||
| 1200 | Ga0307416_100814110 | |||
| 1201 | Ga0307414_10057302 | |||
| 1202 | Ga0307414_10306607 | |||
| 1203 | Ga0307414_11731413 | |||
| 1204 | Ga0307411_10000085 | |||
| 1205 | Ga0307411_10197371 | |||
| 1206 | Ga0307411_10276119 | |||
| 1207 | Ga0307411_10703743 | |||
| 1208 | Ga0373958_0010068 | |||
| 1209 | Ga0373944_0394484 | |||
| 1210 | Ga0373923_0531387 | |||
| 1211 | Ga0373939_0000348 | |||
| 1212 | Ga0373939_0099657 | |||
| 1213 | Ga0373960_0026433 | |||
| 1214 | Ga0373946_0195619 | |||
| 1215 | Ga0373961_0015414 | |||
| 1216 | Ga0373962_0113129 | |||
| 1217 | Ga0373931_0000535 | |||
| 1218 | Ga0373931_0209811 | |||
| 1219 | Ga0373935_1008046 | |||
| 1220 | Ga0373947_0666175 | |||
| 1221 | Ga0265778_002283 | |||
| 1222 | Ga0310110_007052 | |||
| 1223 | Ga0395900_0289299 | |||
| 1224 | Ga0395898_0012209 | |||
| 1225 | Ga0395898_0395446 | |||
| 1226 | Ga0395905_0000084 | |||
| 1227 | Ga0395905_0002507 | |||
| 1228 | Ga0395905_0023115 | |||
| 1229 | Ga0395905_0038305 | |||
| 1230 | Ga0395905_0097413 | |||
| 1231 | Ga0395905_0187255 | |||
| 1232 | Ga0395905_0304457 | |||
| 1233 | Ga0395905_0604545 | |||
| 1234 | Ga0395901_0001925 | |||
| 1235 | Ga0436360_0060872 | |||
| 1236 | Ga0436361_0114178 | |||
| 1237 | Ga0436361_0405071 | |||
| 1238 | Ga0436361_0570086 | |||
| 1239 | Ga0436361_0681463 | |||
| 1240 | Ga0436361_0714431 | |||
| 1241 | Ga0436361_1006874 | |||
| 1242 | Ga0436361_1203462 | |||
| 1243 | Ga0436363_1307251 | |||
| 1244 | Ga0439453_0019683 | |||
| 1245 | Ga0439461_0021772 | |||
| 1246 | Ga0439461_0224296 | |||
| 1247 | Ga0439465_0021384 | |||
| 1248 | Ga0451793_0314072 | |||
| 1249 | Ga0451802_2148803 | |||
| 1250 | Ga0451805_014700 | |||
| 1251 | Ga0451807_0659712 | |||
| 1252 | Ga0451835_1219663 | |||
| 1253 | Ga0451846_32730 | |||
| 1254 | Ga0451849_1054469 | |||
| 1255 | Ga0451850_41031 | |||
| 1256 | Ga0451851_1340491 | |||
| 1257 | Ga0451854_20387 | |||
| 1258 | Ga0451855_0165355 | |||
| 1259 | Ga0451853_3137514 | |||
| 1260 | Ga0452271_43687 | |||
| 1261 | Ga0439437_000716 | |||
| 1262 | Ga0439443_004303 | |||
| 1263 | Ga0439448_0158928 | |||
| 1264 | Ga0439455_0002630 | |||
| 1265 | Ga0439455_0004568 | |||
| 1266 | Ga0439455_0027785 | |||
| 1267 | Ga0439455_0132201 | |||
| 1268 | Ga0439456_037916 | |||
| 1269 | Ga0450913_000876 | |||
| 1270 | Ga0450917_000001 | |||
| 1271 | Ga0450888_000612 | |||
| 1272 | Ga0450890_000549 | |||
| 1273 | Ga0450890_068097 | |||
| 1274 | Ga0450891_000262 | |||
| 1275 | Ga0450892_000236 | |||
| 1276 | Ga0450894_016349 | |||
| 1277 | Ga0450898_035025 | |||
| 1278 | Ga0450898_058258 | |||
| 1279 | Ga0439446_0031377 | |||
| 1280 | Ga0439446_0118939 | |||
| 1281 | Ga0439458_0043881 | |||
| 1282 | Ga0439458_0111076 | |||
| 1283 | Ga0439459_0120503 | |||
| 1284 | Ga0439464_0083749 | |||
| 1285 | Ga0450916_000427 | |||
| 1286 | Ga0450893_0002832 | |||
| 1287 | Ga0450901_009585 | |||
| 1288 | Ga0451577_0039030 | |||
| 1289 | Ga0451577_0049877 | |||
| 1290 | Ga0466969_0000018 | |||
| 1291 | Ga0466969_0002589 | |||
| 1292 | Ga0466969_0012551 | |||
| 1293 | Ga0466972_0007374 | |||
| 1294 | Ga0453683_1220206 | |||
| 1295 | Ga0466965_0008031 | |||
| 1296 | Ga0466966_0021693 | |||
| 1297 | Ga0466966_0026863 | |||
| 1298 | Ga0466966_0619618 | |||
| 1299 | Ga0466961_0005561 | |||
| 1300 | Ga0466961_0166639 | |||
| 1301 | Ga0466963_0238605 | |||
| 1302 | Ga0466964_0000637 | |||
| 1303 | Ga0466964_0003200 | |||
| 1304 | Ga0453684_0218561 | |||
| 1305 | Ga0453684_1413847 | |||
| 1306 | Ga0453684_2047433 | |||
| 1307 | Ga0466971_0001482 | |||
| 1308 | Ga0466971_0002400 | |||
| 1309 | Ga0466968_0012515 | |||
| 1310 | Ga0466970_0030706 | |||
| 1311 | Ga0466970_0084292 | |||
| 1312 | Ga0466970_0132024 | |||
| 1313 | Ga0466957_0029622 | |||
| 1314 | Ga0466960_0549416 | |||
| 1315 | Ga0466959_0000855 | |||
| 1316 | Ga0466959_0014533 | |||
| 1317 | Ga0466959_0057593 | |||
| 1318 | Ga0451576_0106671 | |||
| 1319 | Ga0451576_1269618 | |||
| 1320 | Ga0451576_1643998 | |||
| 1321 | Ga0466958_0002207 | |||
| 1322 | Ga0466967_0003037 | |||
| 1323 | Ga0466967_0876553 | |||
| 1324 | Ga0495590_0004188 | |||
| 1325 | Ga0495651_0074163 | |||
| 1326 | Ga0495651_0422670 | |||
| 1327 | Ga0495653_0258688 | |||
| 1328 | Ga0495650_0038857 | |||
| 1329 | Ga0495585_0010449 | |||
| 1330 | Ga0495583_0000510 | |||
| 1331 | Ga0495606_0003088 | |||
| 1332 | Ga0495606_0055743 | |||
| 1333 | Ga0495608_0596810 | |||
| 1334 | Ga0495628_0560018 | |||
| 1335 | Ga0495598_0168327 | |||
| 1336 | Ga0495621_0004071 | |||
| 1337 | Ga0495633_0147305 | |||
| 1338 | Ga0495656_0532111 | |||
| 1339 | Ga0495668_0190631 | |||
| 1340 | Ga0495634_0275487 | |||
| 1341 | Ga0495625_0081173 | |||
| 1342 | Ga0495623_0593288 | |||
| 1343 | Ga0495658_0514873 | |||
| 1344 | Ga0495670_0057727 | |||
| 1345 | Ga0495671_0264020 | |||
| 1346 | Ga0495649_0000961 | |||
| 1347 | Ga0495589_0117162 | |||
| 1348 | Ga0495683_0299445 | |||
| 1349 | Ga0495686_0067186 | |||
| 1350 | Ga0495602_0185169 | |||
| 1351 | Ga0496100_0718129 | |||
| 1352 | Ga0496100_1282247 | |||
| 1353 | Ga0496103_0553500 | |||
| 1354 | Ga0496104_0317930 | |||
| 1355 | Ga0496105_0519140 | |||
| 1356 | Ga0496106_0113183 | |||
| 1357 | Ga0496107_0711146 | |||
| 1358 | Ga0496108_1651262 | |||
| 1359 | Ga0496109_0188205 | |||
| 1360 | Ga0496109_0771054 | |||
| 1361 | Ga0496109_0999229 | |||
| 1362 | Ga0496110_0139203 | |||
| 1363 | Ga0496111_0388603 | |||
| 1364 | Ga0496111_0554912 | |||
| 1365 | Ga0496111_0812262 | |||
| 1366 | Ga0496112_0018422 | |||
| 1367 | Ga0496113_0089439 | |||
| 1368 | Ga0496123_0344823 | |||
| 1369 | Ga0496125_0090638 | |||
| 1370 | Ga0496126_0071539 | |||
| 1371 | Ga0496126_1153802 | |||
| 1372 | Ga0501306_000061 | |||
| 1373 | Ga0501306_001000 | |||
| 1374 | Ga0501306_004240 | |||
| 1375 | Ga0501308_001669 | |||
| 1376 | Ga0501308_003436 | |||
| 1377 | Ga0501308_009444 | |||
| 1378 | Ga0501308_019526 | |||
| 1379 | Ga0501308_021321 | |||
| 1380 | Ga0501309_000014 | |||
| 1381 | Ga0501309_022934 | |||
| 1382 | Ga0501309_051013 | |||
| 1383 | Ga0501310_000059 | |||
| 1384 | Ga0501304_000014 | |||
| 1385 | Ga0501304_005905 | |||
| 1386 | Ga0501304_019806 | |||
| 1387 | Ga0501304_031706 | |||
| 1388 | Ga0501305_000004 | |||
| 1389 | Ga0501305_006370 | |||
| 1390 | Ga0501305_055313 | |||
| 1391 | Ga0501305_067745 | |||
| 1392 | Ga0501305_072789 | |||
| 1393 | Ga0501305_087885 | |||
| 1394 | Ga0501307_000029 | |||
| 1395 | Ga0501307_018101 | |||
| 1396 | Ga0501307_081634 | |||
| 1397 | Ga0501291_001472 | |||
| 1398 | Ga0501294_001835 | |||
| 1399 | Ga0501299_031053 | |||
| 1400 | Ga0501300_005983 | |||
| 1401 | Ga0501301_021010 | |||
| 1402 | Ga0501302_010569 | |||
| 1403 | Ga0501311_000038 | |||
| 1404 | Ga0501311_097973 | |||
| 1405 | Ga0501311_098874 | |||
| 1406 | Ga0501312_000016 | |||
| 1407 | Ga0501312_010213 | |||
| 1408 | Ga0501312_074929 | |||
| 1409 | Ga0501312_084925 | |||
| 1410 | Ga0501313_001124 | |||
| 1411 | Ga0501313_028382 | |||
| 1412 | Ga0501313_041015 | |||
| 1413 | Ga0501313_055230 | |||
| 1414 | Ga0501314_000017 | |||
| 1415 | Ga0501314_002757 | |||
| 1416 | Ga0501314_004922 | |||
| 1417 | Ga0501314_007493 | |||
| 1418 | Ga0501314_008987 | |||
| 1419 | Ga0501314_045262 | |||
| 1420 | Ga0501315_012519 | |||
| 1421 | Ga0501315_016123 | |||
| 1422 | Ga0501315_025919 | |||
| 1423 | Ga0501315_036047 | |||
| 1424 | Ga0501315_092357 | |||
| 1425 | Ga0501316_000872 | |||
| 1426 | Ga0501316_020750 | |||
| 1427 | Ga0501316_074953 | |||
| 1428 | Ga0501317_008287 | |||
| 1429 | Ga0501317_008982 | |||
| 1430 | Ga0501317_021103 | |||
| 1431 | Ga0501317_037847 | |||
| 1432 | Ga0501318_000131 | |||
| 1433 | Ga0501318_010198 | |||
| 1434 | Ga0501318_019255 | |||
| 1435 | Ga0501318_027537 | |||
| 1436 | Ga0501319_001099 | |||
| 1437 | Ga0501319_022755 | |||
| 1438 | Ga0501320_000131 | |||
| 1439 | Ga0501320_048782 | |||
| 1440 | Ga0501321_000120 | |||
| 1441 | Ga0501322_000921 | |||
| 1442 | Ga0501322_004105 | |||
| 1443 | Ga0501323_010881 | |||
| 1444 | Ga0501323_015806 | |||
| 1445 | Ga0501323_035279 | |||
| 1446 | Ga0501324_000221 | |||
| 1447 | Ga0501325_000034 | |||
| 1448 | Ga0501325_002337 | |||
| 1449 | Ga0501325_002669 | |||
| 1450 | Ga0501325_020665 | |||
| 1451 | Ga0501326_06457 | |||
| 1452 | Ga0501327_17690 | |||
| 1453 | Ga0501328_03299 | |||
| 1454 | Ga0501330_007626 | |||
| 1455 | Ga0501331_07702 | |||
| 1456 | Ga0501333_001792 | |||
| 1457 | Ga0501335_004434 | |||
| 1458 | Ga0501336_009266 | |||
| 1459 | Ga0501336_012604 | |||
| 1460 | Ga0501337_005613 | |||
| 1461 | Ga0501338_10616 | |||
| 1462 | Ga0501339_00793 | |||
| 1463 | Ga0501034_0812110 | |||
| 1464 | Ga0501043_0000090 | |||
| 1465 | Ga0501046_0000126 | |||
| 1466 | Ga0501047_0000160 | |||
| 1467 | Ga0501048_0003429 | |||
| 1468 | Ga0501071_0873461 | |||
| 1469 | Ga0501199_001069 | |||
| 1470 | Ga0501201_017474 | |||
| 1471 | Ga0501202_000808 | |||
| 1472 | Ga0501202_154969 | |||
| 1473 | Ga0501206_001738 | |||
| 1474 | Ga0501206_062249 | |||
| 1475 | Ga0501207_009301 | |||
| 1476 | Ga0501207_060778 | |||
| 1477 | Ga0501211_000022 | |||
| 1478 | Ga0501217_017765 | |||
| 1479 | Ga0501222_002187 | |||
| 1480 | Ga0501223_007701 | |||
| 1481 | Ga0501223_027094 | |||
| 1482 | Ga0501223_087912 | |||
| 1483 | Ga0501227_018717 | |||
| 1484 | Ga0501233_002966 | |||
| 1485 | Ga0501235_001228 | |||
| 1486 | Ga0501239_081866 | |||
| 1487 | Ga0501249_003813 | |||
| 1488 | Ga0501253_001536 | |||
| 1489 | Ga0501255_007217 | |||
| 1490 | Ga0501256_020904 | |||
| 1491 | Ga0501258_000137 | |||
| 1492 | Ga0501259_014208 | |||
| 1493 | Ga0501221_001094 | |||
| 1494 | Ga0501225_0042192 | |||
| 1495 | Ga0501229_001006 | |||
| 1496 | Ga0501234_010360 | |||
| 1497 | Ga0501079_0537572 | |||
| 1498 | Ga0501080_0517640 | |||
| 1499 | Ga0501232_001245 | |||
| 1500 | Ga0501262_000590 | |||
| 1501 | Ga0501264_003121 | |||
| 1502 | Ga0501266_038062 | |||
| 1503 | Ga0501267_000666 | |||
| 1504 | Ga0501268_001964 | |||
| 1505 | Ga0501269_001030 | |||
| 1506 | Ga0501272_000713 | |||
| 1507 | Ga0501274_001433 | |||
| 1508 | Ga0501281_13953 | |||
| 1509 | Ga0501035_0317635 | |||
| 1510 | Ga0501035_0985460 | |||
| 1511 | Ga0501044_0057237 | |||
| 1512 | Ga0501045_0000882 | |||
| 1513 | nmdc:mga03683_137434_c1 | |||
| 1514 | nmdc:mga03683_40005_c1 | |||
| 1515 | nmdc:mga03683_586371_c1 | |||
| 1516 | nmdc:mga03n38_394330_c1 | |||
| 1517 | nmdc:mga03n38_412929_c1 | |||
| 1518 | nmdc:mga00v17_638959_c1 | |||
| 1519 | nmdc:mga0yw44_1138361_c1 | |||
| 1520 | nmdc:mga0k408_106262_c1 | |||
| 1521 | nmdc:mga0k408_113462_c1 | |||
| 1522 | nmdc:mga0k408_118827_c1 | |||
| 1523 | nmdc:mga0k408_191365_c1 | |||
| 1524 | nmdc:mga0k408_219_c1 | |||
| 1525 | nmdc:mga0k408_269951_c1 | |||
| 1526 | nmdc:mga0k408_33936_c1 | |||
| 1527 | nmdc:mga0k408_34945_c1 | |||
| 1528 | nmdc:mga07m45_16030_c1 | |||
| 1529 | nmdc:mga07m45_192519_c1 | |||
| 1530 | nmdc:mga07m45_341539_c1 | |||
| 1531 | nmdc:mga07m45_398_c1 | |||
| 1532 | nmdc:mga07m45_44170_c1 | |||
| 1533 | nmdc:mga05p37_217522_c1 | |||
| 1534 | nmdc:mga09592_1698079_c1 | |||
| 1535 | nmdc:mga09592_473801_c1 | |||
| 1536 | nmdc:mga08y16_591318_c1 | |||
| 1537 | nmdc:mga0a205_671858_c1 | |||
| 1538 | Ga0500635_0000036 | |||
| 1539 | Ga0500578_0706483 | |||
| 1540 | Ga0500651_0186189 | |||
| 1541 | Ga0500608_250479 | |||
| 1542 | Ga0500652_320440 | |||
| 1543 | Ga0500658_0421076 | |||
| 1544 | Ga0500559_0045090 | |||
| 1545 | Ga0500564_314413 | |||
| 1546 | Ga0500622_0001316 | |||
| 1547 | Ga0500638_090974 | |||
| 1548 | Ga0500636_0162502 | |||
| 1549 | Ga0500661_061146 | |||
| 1550 | Ga0587084_000147 | |||
| 1551 | Ga0587093_000068 | |||
| 1552 | Ga0587093_026841 | |||
| 1553 | Ga0587066_004510 | |||
| 1554 | Ga0587066_025106 | |||
| 1555 | Ga0587070_000065 | |||
| 1556 | Ga0587070_002116 | |||
| 1557 | Ga0587073_0000528 | |||
| 1558 | Ga0587073_0008893 | |||
| 1559 | Ga0587073_0012121 | |||
| 1560 | Ga0587077_000950 | |||
| 1561 | Ga0587077_001041 | |||
| 1562 | Ga0587077_009175 | |||
| 1563 | Ga0587077_024961 | |||
| 1564 | Ga0587080_004865 | |||
| 1565 | Ga0587080_026133 | |||
| 1566 | Ga0587082_002352 | |||
| 1567 | Ga0587082_065061 | |||
| 1568 | Ga0587083_0000260 | |||
| 1569 | Ga0587085_144850 | |||
| 1570 | Ga0587086_033945 | |||
| 1571 | Ga0587088_000741 | |||
| 1572 | Ga0587088_006778 | |||
| 1573 | Ga0587088_170751 | |||
| 1574 | Ga0587089_008079 | |||
| 1575 | Ga0587090_030499 | |||
| 1576 | Ga0587091_091666 | |||
| 1577 | Ga0587092_041567 | |||
| 1578 | Ga0587092_057351 | |||
| 1579 | Ga0587094_018487 | |||
| 1580 | Ga0587094_024327 | |||
| 1581 | Ga0587094_128531 | |||
| 1582 | Ga0587106_029929 | |||
| 1583 | Ga0587106_165957 | |||
| 1584 | Ga0587125_000700 | |||
| 1585 | Ga0587129_000468 | |||
| 1586 | Ga0587099_000652 | |||
| 1587 | Ga0587101_000448 | |||
| 1588 | Ga0587101_004507 | |||
| 1589 | Ga0587101_104843 | |||
| 1590 | Ga0587109_036579 | |||
| 1591 | Ga0587113_008179 | |||
| 1592 | Ga0587115_001117 | |||
| 1593 | Ga0587127_000506 | |||
| 1594 | Ga0587128_001730 | |||
| 1595 | Ga0587130_021759 | |||
| 1596 | Ga0587130_052286 | |||
| 1597 | Ga0587062_000400 | |||
| 1598 | Ga0587062_012649 | |||
| 1599 | Ga0587062_138679 | |||
| 1600 | Ga0587067_002743 | |||
| 1601 | Ga0587068_001309 | |||
| 1602 | Ga0587068_024456 | |||
| 1603 | Ga0587068_066467 | |||
| 1604 | Ga0587068_071828 | |||
| 1605 | Ga0587068_078370 | |||
| 1606 | Ga0587069_010834 | |||
| 1607 | Ga0587069_076465 | |||
| 1608 | Ga0587072_001392 | |||
| 1609 | Ga0587072_008796 | |||
| 1610 | Ga0587076_002043 | |||
| 1611 | Ga0587076_002122 | |||
| 1612 | Ga0587079_003155 | |||
| 1613 | Ga0587079_046494 | |||
| 1614 | Ga0587100_000850 | |||
| 1615 | Ga0587100_024483 | |||
| 1616 | Ga0587102_000785 | |||
| 1617 | Ga0587104_004540 | |||
| 1618 | Ga0587105_000221 | |||
| 1619 | Ga0587107_000989 | |||
| 1620 | Ga0587108_008141 | |||
| 1621 | Ga0587114_002480 | |||
| 1622 | Ga0587118_00289 | |||
| 1623 | Ga0587119_021596 | |||
| 1624 | Ga0587124_001207 | |||
| 1625 | Ga0587096_00044 | |||
| 1626 | Ga0587071_026067 | |||
| 1627 | Ga0587111_0000186 | |||
| 1628 | Ga0587111_0000227 | |||
| 1629 | Ga0466962_0000718 | |||
| 1630 | Ga0466962_0014522 | |||
| 1631 | 2643746689 | |||
| 1632 | 2643937419 | |||
| 1633 | 2644218755 | |||
| 1634 | 2644256842 | |||
| 1635 | 2644314957 | |||
| 1636 | 2644338008 | |||
| 1637 | 2739057970 | |||
| 1638 | 2831867512 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9453 | 1 | 103 |
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9355 | 1 | 103 |
| 8cgd-assembly1.cif.gz_t | clindamycin bound to the 50s subunit | 0.9145 | 3 | 103 |
| 8cgk-assembly1.cif.gz_t | lincomycin and avilamycin bound to the 50s subunit | 0.9107 | 3 | 103 |
| 7ug7-assembly1.cif.gz_LX | 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b | 0.9067 | 3 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0FMT8_1_78_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8997 | 4 | 71 | 2.30.30.30 |
| af_Q96A35_47_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8571 | 4 | 101 | 2.30.30.30 |
| af_O13936_718_779_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8481 | 7 | 73 | 2.30.30.30 |
| af_P91353_98_211_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.835 | 4 | 101 | 2.30.30.30 |
| af_Q96GW9_159_278_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.835 | 82 | 104 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W4EBZ3-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.8931 | 1 | 104 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-J4D717-F1-model_v4 | Large ribosomal subunit protein uL24c | 0.8907 | 3 | 105 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7S1JQ18-F1-model_v4 | KOW domain-containing protein | 0.8888 | 3 | 103 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A7AUS1-F1-model_v4 | Large ribosomal subunit protein uL24c | 0.8883 | 3 | 105 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-H2YKH4-F1-model_v4 | Large ribosomal subunit protein uL24m (39S ribosomal protein L24, mitochondrial) | 0.8852 | 4 | 105 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |