F482159

General Info

Members Datasets Scaffolds Average Seq Length
819 501 1638 105

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100602254|Ga0068868_1006022541
Length 114
Sequence MNKIRKGDQVIVTTGRDKGKRGTVAERVSEQLLIVEGINVVKKHVKPNPMKGTTGGVVDKTLPIHQSNIAIFNAATGKADRVGFKLLSEDEKKSRKTQERAVRVFRSSGAEIKA

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
32 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
232 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
246 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
253 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
254 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
255 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
256 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
257 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
258 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
261 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
262 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
266 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
267 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
268 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
269 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
270 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
271 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
272 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
273 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
276 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
279 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
280 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
285 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
286 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
289 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
298 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
299 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
300 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
306 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
348 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
349 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
350 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
351 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
352 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
353 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
386 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
387 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
388 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
389 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
390 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
391 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
392 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
393 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
394 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
395 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
396 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
397 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
398 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
399 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
400 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
401 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
402 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
403 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
404 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
405 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
406 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
407 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
408 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
409 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
410 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
411 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
412 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
413 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
414 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
415 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
416 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
417 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
418 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
419 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
423 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
424 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
429 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
430 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
431 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
434 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
435 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
436 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
437 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
438 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
439 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
440 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
441 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
442 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
443 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
444 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
445 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
494 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
495 2643221585 Pelomonas sp. Root662 Isolate Unclassified
496 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
497 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
498 2643221656 Pelomonas sp. Root405 Isolate Unclassified
499 2643221660 Methylibium sp. Root1272 Isolate Unclassified
500 2738541337 Pelomonas sp. BT06 Isolate Unclassified
501 2831864461 Roseateles noduli HZ7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.16
Metatranscriptomes 26.86
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.89
Nodule 0.12
Rhizoplane 2.56
Rhizosphere 81.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100602254 3300005338 Bacteria 974
2 JGI25156J39149_1025699 3300002705 Bacteria 942
3 JGI25156J39149_1026157 3300002705 Bacteria 928
4 JGI25156J39149_1039814 3300002705 Bacteria 654
5 JGI25154J39366_1000593 3300002738 Bacteria 17447
6 JGI25157J39369_1001522 3300002741 Bacteria 8421
7 JGI25164J39214_1002084 3300002772 Bacteria 3435
8 Ga0006765J45826_106373 3300003161 Bacteria 4293
9 Ga0006778J45830_1009213 3300003162 Bacteria 15395
10 Ga0006778J45830_1056528 3300003162 Bacteria 849
11 Ga0006759J45824_1029126 3300003163 Bacteria 2169
12 Ga0006759J45824_1055672 3300003163 Bacteria 1013
13 Ga0006758J48902_1015144 3300003300 Bacteria 3291
14 Ga0006758J48902_1021934 3300003300 Bacteria 1503
15 Ga0006758J48902_1024929 3300003300 Bacteria 729
16 Ga0006770J48903_1001899 3300003305 Bacteria 11120
17 Ga0006770J48903_1044543 3300003305 Bacteria 710
18 Ga0006777J48905_1014855 3300003308 Bacteria 5027
19 Ga0007417J51691_1029545 3300003544 Bacteria 1076
20 Ga0007417J51691_1043945 3300003544 Bacteria 2500
21 Ga0007427J51700_105505 3300003559 Bacteria 995
22 Ga0007427J51700_113549 3300003559 Bacteria 2002
23 Ga0007410J51695_1005226 3300003574 Bacteria 5217
24 Ga0007410J51695_1028665 3300003574 Bacteria 3145
25 Ga0007410J51695_1032042 3300003574 Bacteria 2025
26 Ga0007409J51694_1019841 3300003575 Bacteria 1451
27 Ga0007409J51694_1020061 3300003575 Bacteria 1028
28 Ga0007416J51690_1027279 3300003577 Bacteria 2389
29 Ga0007416J51690_1051124 3300003577 Bacteria 2960
30 Ga0007429J51699_1066463 3300003579 Bacteria 1310
31 Ga0032354_1028740 3300003693 Bacteria 504
32 Ga0032354_1037309 3300003693 Bacteria 2923
33 Ga0032354_1044089 3300003693 Bacteria 947
34 Ga0032354_1117171 3300003693 Bacteria 656
35 Ga0055539_1037180 3300003752 Bacteria 534
36 Ga0055533_1000043 3300003756 Bacteria 229262
37 Ga0055525_1000161 3300003759 Bacteria 87478
38 Ga0055525_1000641 3300003759 Bacteria 14040
39 Ga0055535_1021794 3300003761 Bacteria 773
40 Ga0055535_1023542 3300003761 Bacteria 719
41 Ga0055529_1000322 3300003763 Bacteria 54232
42 Ga0055540_1026414 3300003792 Bacteria 1406
43 Ga0055531_10012516 3300003794 Bacteria 3983
44 Ga0055531_10098547 3300003794 Bacteria 605
45 Ga0055543_1027494 3300004625 Bacteria 1006
46 Ga0058858_1003354 3300004785 Bacteria 575
47 Ga0058858_1430617 3300004785 Bacteria 1242
48 Ga0058859_10030919 3300004798 Bacteria 520
49 Ga0058859_10055155 3300004798 Bacteria 1649
50 Ga0058859_11825120 3300004798 Bacteria 1137
51 Ga0058863_10044021 3300004799 Bacteria 920
52 Ga0058861_10142005 3300004800 Bacteria 1459
53 Ga0058861_10194247 3300004800 Bacteria 562
54 Ga0058860_10052045 3300004801 Bacteria 1645
55 Ga0058860_10096621 3300004801 Bacteria 1176
56 Ga0058860_12116272 3300004801 Bacteria 823
57 Ga0058862_10051180 3300004803 Bacteria 1484
58 Ga0065165_1010518 3300005262 Bacteria 3983
59 Ga0065165_1048431 3300005262 Bacteria 1220
60 Ga0065707_10559059 3300005295 Bacteria 712
61 Ga0070658_11148191 3300005327 Bacteria 675
62 Ga0070658_11221121 3300005327 Bacteria 653
63 Ga0070658_11468236 3300005327 Bacteria 591
64 Ga0070676_10756527 3300005328 Bacteria 714
65 Ga0070683_100352957 3300005329 Bacteria 1400
66 Ga0070690_100134141 3300005330 Bacteria 1675
67 Ga0068869_100012739 3300005334 Bacteria 5562
68 Ga0070666_10109820 3300005335 Bacteria 1906
69 Ga0070682_100066791 3300005337 Bacteria 2289
70 Ga0068868_100831067 3300005338 Bacteria 835
71 Ga0068868_101147186 3300005338 Bacteria 717
72 Ga0070660_100320427 3300005339 Bacteria 1273
73 Ga0070660_100371696 3300005339 Bacteria 1179
74 Ga0070660_101462983 3300005339 Bacteria 581
75 Ga0070691_10245118 3300005341 Bacteria 959
76 Ga0070669_100343052 3300005353 Bacteria 1211
77 Ga0070669_101564377 3300005353 Bacteria 574
78 Ga0070675_100330914 3300005354 Bacteria 1347
79 Ga0070675_100398807 3300005354 Bacteria 1227
80 Ga0070671_100038207 3300005355 Bacteria 3985
81 Ga0070671_100871948 3300005355 Bacteria 786
82 Ga0070674_100683279 3300005356 Bacteria 876
83 Ga0070674_101032674 3300005356 Bacteria 723
84 Ga0070673_100002927 3300005364 Bacteria 10519
85 Ga0070688_100254873 3300005365 Bacteria 1251
86 Ga0070659_100057420 3300005366 Bacteria 3069
87 Ga0070659_100120047 3300005366 Bacteria 2128
88 Ga0070667_101780280 3300005367 Bacteria 580
89 Ga0070678_100037760 3300005456 Bacteria 3394
90 Ga0070678_100207105 3300005456 Bacteria 1623
91 Ga0070678_100421211 3300005456 Bacteria 1164
92 Ga0070662_100274312 3300005457 Bacteria 1363
93 Ga0070681_10497103 3300005458 Bacteria 1133
94 Ga0068867_100292475 3300005459 Bacteria 1340
95 Ga0068867_100601767 3300005459 Bacteria 959
96 Ga0070707_100461298 3300005468 Bacteria 1231
97 Ga0070679_100375973 3300005530 Bacteria 1367
98 Ga0070679_100834570 3300005530 Bacteria 865
99 Ga0070684_100894602 3300005535 Bacteria 832
100 Ga0068853_100345863 3300005539 Bacteria 1382
101 Ga0068853_101067403 3300005539 Bacteria 778
102 Ga0068853_101936437 3300005539 Bacteria 571
103 Ga0068853_101988889 3300005539 Bacteria 564
104 Ga0070672_100370305 3300005543 Bacteria 1224
105 Ga0070686_100729464 3300005544 Bacteria 793
106 Ga0070665_100525724 3300005548 Bacteria 1195
107 Ga0070665_100551566 3300005548 Bacteria 1165
108 Ga0068855_100961007 3300005563 Bacteria 899
109 Ga0068855_101390928 3300005563 Bacteria 723
110 Ga0070664_100452105 3300005564 Bacteria 1179
111 Ga0068857_100387564 3300005577 Bacteria 1298
112 Ga0068854_100273417 3300005578 Bacteria 1357
113 Ga0068856_100033721 3300005614 Bacteria 5014
114 Ga0068856_100231329 3300005614 Bacteria 1864
115 Ga0068856_101792745 3300005614 Bacteria 625
116 Ga0068852_100157329 3300005616 Bacteria 2118
117 Ga0068852_100184567 3300005616 Bacteria 1964
118 Ga0068852_100912756 3300005616 Bacteria 895
119 Ga0068859_103056882 3300005617 Bacteria 511
120 Ga0068864_100723641 3300005618 Bacteria 974
121 Ga0068864_102061142 3300005618 Bacteria 577
122 Ga0068866_10472692 3300005718 Bacteria 824
123 Ga0068866_11466369 3300005718 Bacteria 501
124 Ga0068861_100067654 3300005719 Bacteria 2758
125 Ga0068861_100250877 3300005719 Bacteria 1510
126 Ga0068851_10097792 3300005834 Bacteria 1553
127 Ga0068851_10510819 3300005834 Bacteria 722
128 Ga0068863_100182919 3300005841 Bacteria 2012
129 Ga0068858_101935889 3300005842 Bacteria 583
130 Ga0068862_100009442 3300005844 Bacteria 8069
131 Ga0068862_100090240 3300005844 Bacteria 2667
132 Ga0068862_100566589 3300005844 Bacteria 1086
133 Ga0081455_10342025 3300005937 Bacteria 1058
134 Ga0075363_100212774 3300006048 Bacteria 1107
135 Ga0075363_100251023 3300006048 Bacteria 1019
136 Ga0075364_10260140 3300006051 Bacteria 1180
137 Ga0075362_10068048 3300006177 Bacteria 1621
138 Ga0075362_10118078 3300006177 Bacteria 1254
139 Ga0075362_10579705 3300006177 Bacteria 578
140 Ga0075366_10000795 3300006195 Bacteria 15124
141 Ga0075366_10021754 3300006195 Bacteria 3729
142 Ga0075366_10075093 3300006195 Bacteria 2016
143 Ga0075366_10102009 3300006195 Bacteria 1722
144 Ga0075366_10111379 3300006195 Bacteria 1646
145 Ga0075366_10214047 3300006195 Bacteria 1173
146 Ga0075366_10281535 3300006195 Bacteria 1016
147 Ga0075366_10979222 3300006195 Bacteria 527
148 Ga0075370_10000701 3300006353 Bacteria 13221
149 Ga0075370_10096809 3300006353 Bacteria 1706
150 Ga0075370_10178238 3300006353 Bacteria 1250
151 Ga0075370_10381414 3300006353 Bacteria 844
152 Ga0075429_100409696 3300006880 Bacteria 1187
153 Ga0097620_100993556 3300006931 Bacteria 921
154 Ga0097620_103056690 3300006931 Bacteria 511
155 Ga0105250_10211043 3300009092 Bacteria 821
156 Ga0105240_10018079 3300009093 Bacteria 9478
157 Ga0105240_10608637 3300009093 Bacteria 1202
158 Ga0105240_10763734 3300009093 Bacteria 1050
159 Ga0105240_11532248 3300009093 Bacteria 698
160 Ga0105240_12384249 3300009093 Bacteria 548
161 Ga0111539_10350927 3300009094 Bacteria 1717
162 Ga0111539_11955632 3300009094 Bacteria 680
163 Ga0111539_12890563 3300009094 Bacteria 556
164 Ga0105245_10060455 3300009098 Bacteria 3412
165 Ga0105245_12756675 3300009098 Bacteria 544
166 Ga0114129_10176739 3300009147 Bacteria 2908
167 Ga0105243_10001789 3300009148 Bacteria 18454
168 Ga0105243_10030050 3300009148 Bacteria 4181
169 Ga0105243_10177323 3300009148 Bacteria 1850
170 Ga0105243_10252607 3300009148 Bacteria 1575
171 Ga0105241_11260214 3300009174 Bacteria 702
172 Ga0105242_10297878 3300009176 Bacteria 1471
173 Ga0105248_10006768 3300009177 Bacteria 12569
174 Ga0105248_11336448 3300009177 Bacteria 811
175 Ga0105248_11371716 3300009177 Bacteria 800
176 Ga0105237_10000668 3300009545 Bacteria 47303
177 Ga0105238_10003926 3300009551 Bacteria 14752
178 Ga0105238_10088675 3300009551 Bacteria 3080
179 Ga0105238_11082143 3300009551 Bacteria 824
180 Ga0105238_12840029 3300009551 Bacteria 521
181 Ga0105249_10068515 3300009553 Bacteria 3273
182 Ga0105249_10311041 3300009553 Bacteria 1584
183 Ga0105239_10001255 3300010375 Bacteria 34466
184 Ga0105239_11112547 3300010375 Bacteria 909
185 Ga0105246_10060033 3300011119 Bacteria 2641
186 Ga0157327_1015077 3300012512 Bacteria 799
187 Ga0157373_10739528 3300013100 Bacteria 722
188 Ga0157371_10867915 3300013102 Bacteria 683
189 Ga0157370_10422778 3300013104 Bacteria 1226
190 Ga0157369_10547096 3300013105 Bacteria 1197
191 Ga0157374_10123485 3300013296 Bacteria 2501
192 Ga0157374_11269982 3300013296 Bacteria 758
193 Ga0157378_10029129 3300013297 Bacteria 4874
194 Ga0157378_10873702 3300013297 Bacteria 929
195 Ga0163162_10505539 3300013306 Bacteria 1339
196 Ga0163162_12978772 3300013306 Bacteria 544
197 Ga0157372_10373891 3300013307 Bacteria 1661
198 Ga0157372_11082189 3300013307 Bacteria 928
199 Ga0157375_10137647 3300013308 Bacteria 2567
200 Ga0157375_10710210 3300013308 Bacteria 1159
201 Ga0157375_12005957 3300013308 Bacteria 688
202 Ga0157375_12740470 3300013308 Bacteria 589
203 Ga0163163_11953739 3300014325 Bacteria 647
204 Ga0157380_10821964 3300014326 Bacteria 948
205 Ga0157377_10000368 3300014745 Bacteria 20109
206 Ga0157379_10469488 3300014968 Bacteria 1164
207 Ga0157376_10090219 3300014969 Bacteria 2652
208 Ga0157376_11883744 3300014969 Bacteria 635
209 Ga0182007_10077939 3300015262 Bacteria 1087
210 Ga0182007_10374325 3300015262 Bacteria 539
211 Ga0163161_10514817 3300017792 Bacteria 976
212 Ga0197907_10761668 3300020069 Bacteria 1329
213 Ga0206356_11223789 3300020070 Bacteria 1186
214 Ga0206355_1548870 3300020076 Bacteria 1356
215 Ga0206352_10258252 3300020078 Bacteria 960
216 Ga0206352_10887797 3300020078 Bacteria 1031
217 Ga0206352_10920041 3300020078 Bacteria 561
218 Ga0206352_11007505 3300020078 Bacteria 3567
219 Ga0206350_11041308 3300020080 Bacteria 1032
220 Ga0213872_10000091 3300021361 Bacteria 83723
221 Ga0213872_10002765 3300021361 Bacteria 10055
222 Ga0213872_10004732 3300021361 Bacteria 7137
223 Ga0209674_100067 3300025226 Bacteria 253824
224 Ga0209674_109216 3300025226 Bacteria 1110
225 Ga0209672_107040 3300025228 Bacteria 1770
226 Ga0209563_100068 3300025230 Bacteria 254802
227 Ga0209563_100088 3300025230 Bacteria 175375
228 Ga0207427_100260 3300025231 Bacteria 41435
229 Ga0209258_102113 3300025242 Bacteria 5574
230 Ga0209258_118229 3300025242 Bacteria 760
231 Ga0209646_1000127 3300025246 Bacteria 131920
232 Ga0209026_1000004 3300025250 Bacteria 949012
233 Ga0209677_100201 3300025253 Bacteria 47899
234 Ga0209148_1002904 3300025254 Bacteria 5228
235 Ga0209759_1000129 3300025256 Bacteria 131961
236 Ga0209759_1003759 3300025256 Bacteria 5926
237 Ga0209455_1000083 3300025272 Bacteria 255660
238 Ga0209673_1026632 3300025273 Bacteria 1894
239 Ga0209564_1000008 3300025295 Bacteria 953227
240 Ga0209050_1004273 3300025298 Bacteria 9808
241 Ga0209256_1028202 3300025299 Bacteria 1588
242 Ga0209051_1005321 3300025303 Bacteria 7574
243 Ga0209257_1000047 3300025304 Bacteria 460507
244 Ga0207656_10116353 3300025321 Bacteria 1240
245 Ga0207642_10569245 3300025899 Bacteria 702
246 Ga0207642_10591643 3300025899 Bacteria 689
247 Ga0207680_10487657 3300025903 Bacteria 877
248 Ga0207680_10523330 3300025903 Bacteria 846
249 Ga0207647_10074272 3300025904 Bacteria 2048
250 Ga0207645_10160739 3300025907 Bacteria 1469
251 Ga0207645_10384444 3300025907 Bacteria 943
252 Ga0207643_10312571 3300025908 Bacteria 980
253 Ga0207705_10053354 3300025909 Bacteria 2912
254 Ga0207654_10059196 3300025911 Bacteria 2233
255 Ga0207654_10797506 3300025911 Bacteria 682
256 Ga0207707_10417643 3300025912 Bacteria 1151
257 Ga0207695_10010589 3300025913 Bacteria 11272
258 Ga0207695_10103337 3300025913 Bacteria 2841
259 Ga0207671_10019707 3300025914 Bacteria 5152
260 Ga0207671_10047329 3300025914 Bacteria 3183
261 Ga0207660_11007987 3300025917 Bacteria 679
262 Ga0207660_11355730 3300025917 Bacteria 577
263 Ga0207662_10034330 3300025918 Bacteria 2960
264 Ga0207657_10152752 3300025919 Bacteria 1879
265 Ga0207657_10364651 3300025919 Bacteria 1138
266 Ga0207652_10202638 3300025921 Bacteria 1786
267 Ga0207652_10559555 3300025921 Bacteria 1027
268 Ga0207681_10187413 3300025923 Bacteria 1580
269 Ga0207694_10004619 3300025924 Bacteria 10727
270 Ga0207694_10026084 3300025924 Bacteria 4443
271 Ga0207694_11251446 3300025924 Bacteria 628
272 Ga0207694_11625111 3300025924 Bacteria 544
273 Ga0207650_11056631 3300025925 Bacteria 691
274 Ga0207650_11875865 3300025925 Bacteria 506
275 Ga0207659_10233696 3300025926 Bacteria 1484
276 Ga0207659_10365256 3300025926 Bacteria 1200
277 Ga0207659_10384923 3300025926 Bacteria 1170
278 Ga0207687_10072566 3300025927 Bacteria 2463
279 Ga0207687_10844263 3300025927 Bacteria 782
280 Ga0207644_10024978 3300025931 Bacteria 4105
281 Ga0207644_10834664 3300025931 Bacteria 771
282 Ga0207690_10039856 3300025932 Bacteria 3067
283 Ga0207706_10300451 3300025933 Bacteria 1399
284 Ga0207706_10738258 3300025933 Bacteria 839
285 Ga0207686_10232569 3300025934 Bacteria 1337
286 Ga0207709_10001005 3300025935 Bacteria 20902
287 Ga0207709_10207965 3300025935 Bacteria 1402
288 Ga0207709_10226741 3300025935 Bacteria 1351
289 Ga0207669_10191669 3300025937 Bacteria 1475
290 Ga0207691_10115353 3300025940 Bacteria 2385
291 Ga0207691_10230836 3300025940 Bacteria 1603
292 Ga0207711_10009541 3300025941 Bacteria 8096
293 Ga0207689_10028262 3300025942 Bacteria 4692
294 Ga0207661_10461940 3300025944 Bacteria 1157
295 Ga0207679_10497711 3300025945 Bacteria 1087
296 Ga0207667_10701744 3300025949 Bacteria 1014
297 Ga0207651_10077458 3300025960 Bacteria 2380
298 Ga0207712_10746934 3300025961 Bacteria 857
299 Ga0207712_11267320 3300025961 Bacteria 658
300 Ga0207640_10018588 3300025981 Bacteria 4087
301 Ga0207658_11146433 3300025986 Bacteria 710
302 Ga0207677_10348252 3300026023 Bacteria 1240
303 Ga0207639_11602510 3300026041 Bacteria 611
304 Ga0207639_11702829 3300026041 Bacteria 591
305 Ga0207702_10001875 3300026078 Bacteria 20626
306 Ga0207702_10098322 3300026078 Bacteria 2577
307 Ga0207641_10711953 3300026088 Bacteria 989
308 Ga0207641_11341182 3300026088 Bacteria 716
309 Ga0207648_10002176 3300026089 Bacteria 21281
310 Ga0207648_10111939 3300026089 Bacteria 2397
311 Ga0207648_10116151 3300026089 Bacteria 2352
312 Ga0207648_10300208 3300026089 Bacteria 1440
313 Ga0207648_10752815 3300026089 Bacteria 905
314 Ga0207648_12192688 3300026089 Bacteria 513
315 Ga0207676_10128448 3300026095 Bacteria 2151
316 Ga0207676_10946210 3300026095 Bacteria 847
317 Ga0207674_10004293 3300026116 Bacteria 17188
318 Ga0207674_11088992 3300026116 Bacteria 768
319 Ga0207675_100101603 3300026118 Bacteria 2709
320 Ga0207683_10032302 3300026121 Bacteria 4548
321 Ga0207683_10376795 3300026121 Bacteria 1304
322 Ga0207683_10430813 3300026121 Bacteria 1215
323 Ga0207698_10810285 3300026142 Bacteria 939
324 Ga0207698_12435571 3300026142 Bacteria 534
325 Ga0209973_1085997 3300027252 Bacteria 503
326 Ga0209969_1000889 3300027360 Bacteria 4040
327 Ga0209981_1007951 3300027378 Bacteria 1435
328 Ga0209996_1000729 3300027395 Bacteria 3938
329 Ga0209995_1000242 3300027471 Bacteria 8706
330 Ga0209968_1000130 3300027526 Bacteria 13315
331 Ga0209999_1001613 3300027543 Bacteria 3888
332 Ga0209999_1062698 3300027543 Bacteria 709
333 Ga0210002_1080391 3300027617 Bacteria 580
334 Ga0209971_1038388 3300027682 Bacteria 1153
335 Ga0209966_1000117 3300027695 Bacteria 35145
336 Ga0209998_10002530 3300027717 Bacteria 4163
337 Ga0209974_10010680 3300027876 Bacteria 3097
338 Ga0268266_11160331 3300028379 Bacteria 747
339 Ga0268265_10058401 3300028380 Bacteria 2945
340 Ga0268265_10354115 3300028380 Bacteria 1341
341 Ga0268264_10248432 3300028381 Bacteria 1651
342 Ga0268264_10916094 3300028381 Bacteria 880
343 Ga0265334_10073367 3300028573 Bacteria 1271
344 Ga0265336_10000028 3300028666 Bacteria 179201
345 Ga0307515_10108460 3300028794 Bacteria 3271
346 Ga0265324_10000286 3300029957 Bacteria 37420
347 Ga0307511_10070244 3300030521 Bacteria 2566
348 Ga0265766_1017267 3300030863 Bacteria 571
349 Ga0265769_101736 3300030888 Bacteria 1078
350 Ga0265328_10033426 3300031239 Bacteria 1907
351 Ga0265328_10238709 3300031239 Bacteria 694
352 Ga0265331_10115103 3300031250 Bacteria 1231
353 Ga0265327_10000020 3300031251 Bacteria 424552
354 Ga0265327_10000178 3300031251 Bacteria 135732
355 Ga0265327_10176722 3300031251 Bacteria 978
356 Ga0265316_10000201 3300031344 Bacteria 69415
357 Ga0307509_10322942 3300031507 Bacteria 1279
358 Ga0307408_100000089 3300031548 Bacteria 100712
359 Ga0307408_100173708 3300031548 Bacteria 1722
360 Ga0307408_100707218 3300031548 Bacteria 906
361 Ga0307508_10563692 3300031616 Bacteria 738
362 Ga0307514_10000339 3300031649 Bacteria 111130
363 Ga0307516_10026535 3300031730 Bacteria 5881
364 Ga0307516_10027941 3300031730 Bacteria 5714
365 Ga0307516_10040356 3300031730 Bacteria 4647
366 Ga0307516_10222839 3300031730 Bacteria 1594
367 Ga0307516_10671439 3300031730 Bacteria 692
368 Ga0307405_10558102 3300031731 Bacteria 928
369 Ga0307413_10520434 3300031824 Bacteria 959
370 Ga0307413_10964581 3300031824 Bacteria 728
371 Ga0307410_11073487 3300031852 Bacteria 697
372 Ga0307410_11892895 3300031852 Bacteria 531
373 Ga0307406_10513452 3300031901 Bacteria 974
374 Ga0307406_10738298 3300031901 Bacteria 825
375 Ga0307406_11549686 3300031901 Bacteria 584
376 Ga0307407_10845472 3300031903 Bacteria 699
377 Ga0307412_10532576 3300031911 Bacteria 983
378 Ga0307412_10846819 3300031911 Bacteria 797
379 Ga0307412_11147700 3300031911 Bacteria 693
380 Ga0307416_100714982 3300032002 Bacteria 1092
381 Ga0307416_100814110 3300032002 Bacteria 1030
382 Ga0307414_10057302 3300032004 Bacteria 2738
383 Ga0307414_10306607 3300032004 Bacteria 1346
384 Ga0307414_11731413 3300032004 Bacteria 583
385 Ga0307411_10000085 3300032005 Bacteria 28904
386 Ga0307411_10197371 3300032005 Bacteria 1542
387 Ga0307411_10276119 3300032005 Bacteria 1335
388 Ga0307411_10703743 3300032005 Bacteria 880
389 Ga0373958_0010068 3300034819 Bacteria 1569
390 Ga0373944_0394484 3300035089 Bacteria 533
391 Ga0373923_0531387 3300035111 Bacteria 575
392 Ga0373939_0000348 3300035114 Bacteria 11798
393 Ga0373939_0099657 3300035114 Bacteria 995
394 Ga0373960_0026433 3300035121 Bacteria 1586
395 Ga0373946_0195619 3300035171 Bacteria 966
396 Ga0373961_0015414 3300035241 Bacteria 1954
397 Ga0373962_0113129 3300035242 Bacteria 858
398 Ga0373931_0000535 3300035691 Bacteria 15604
399 Ga0373931_0209811 3300035691 Bacteria 1167
400 Ga0373935_1008046 3300035692 Bacteria 619
401 Ga0373947_0666175 3300035725 Bacteria 710
402 Ga0265778_002283 3300036457 Bacteria 1835
403 Ga0310110_007052 3300036535 Bacteria 1643
404 Ga0395900_0289299 3300037418 Bacteria 1628
405 Ga0395898_0012209 3300037466 Bacteria 8885
406 Ga0395898_0395446 3300037466 Bacteria 1318
407 Ga0395905_0000084 3300037471 Bacteria 158046
408 Ga0395905_0002507 3300037471 Bacteria 20284
409 Ga0395905_0023115 3300037471 Bacteria 5877
410 Ga0395905_0038305 3300037471 Bacteria 4498
411 Ga0395905_0097413 3300037471 Bacteria 2761
412 Ga0395905_0187255 3300037471 Bacteria 1942
413 Ga0395905_0304457 3300037471 Bacteria 1481
414 Ga0395905_0604545 3300037471 Bacteria 998
415 Ga0395901_0001925 3300038443 Bacteria 21375
416 Ga0436360_0060872 3300039438 Bacteria 1190
417 Ga0436361_0114178 3300039447 Bacteria 1053
418 Ga0436361_0405071 3300039447 Bacteria 13061
419 Ga0436361_0570086 3300039447 Bacteria 6186
420 Ga0436361_0681463 3300039447 Bacteria 4154
421 Ga0436361_0714431 3300039447 Bacteria 79592
422 Ga0436361_1006874 3300039447 Bacteria 3836
423 Ga0436361_1203462 3300039447 Bacteria 704
424 Ga0436363_1307251 3300039450 Bacteria 966
425 Ga0439453_0019683 3300041408 Bacteria 1204
426 Ga0439461_0021772 3300041410 Bacteria 1279
427 Ga0439461_0224296 3300041410 Bacteria 513
428 Ga0439465_0021384 3300041413 Bacteria 2028
429 Ga0451793_0314072 3300041452 Bacteria 539
430 Ga0451802_2148803 3300041460 Bacteria 660
431 Ga0451805_014700 3300041461 Bacteria 874
432 Ga0451807_0659712 3300041486 Bacteria 513
433 Ga0451835_1219663 3300041492 Bacteria 524
434 Ga0451846_32730 3300041502 Bacteria 680
435 Ga0451849_1054469 3300041505 Bacteria 506
436 Ga0451850_41031 3300041506 Bacteria 540
437 Ga0451851_1340491 3300041507 Bacteria 828
438 Ga0451854_20387 3300041510 Bacteria 538
439 Ga0451855_0165355 3300041511 Bacteria 563
440 Ga0451853_3137514 3300041512 Bacteria 517
441 Ga0452271_43687 3300041916 Bacteria 569
442 Ga0439437_000716 3300042000 Bacteria 3345
443 Ga0439443_004303 3300042003 Bacteria 1845
444 Ga0439448_0158928 3300042005 Bacteria 786
445 Ga0439455_0002630 3300042012 Bacteria 3302
446 Ga0439455_0004568 3300042012 Bacteria 2751
447 Ga0439455_0027785 3300042012 Bacteria 1389
448 Ga0439455_0132201 3300042012 Bacteria 704
449 Ga0439456_037916 3300042013 Bacteria 1041
450 Ga0450913_000876 3300042117 Bacteria 1473
451 Ga0450917_000001 3300042120 Bacteria 12228
452 Ga0450888_000612 3300042126 Bacteria 3384
453 Ga0450890_000549 3300042127 Bacteria 5493
454 Ga0450890_068097 3300042127 Bacteria 566
455 Ga0450891_000262 3300042129 Bacteria 5316
456 Ga0450892_000236 3300042130 Bacteria 6630
457 Ga0450894_016349 3300042131 Bacteria 985
458 Ga0450898_035025 3300042134 Bacteria 934
459 Ga0450898_058258 3300042134 Bacteria 756
460 Ga0439446_0031377 3300042156 Bacteria 1538
461 Ga0439446_0118939 3300042156 Bacteria 849
462 Ga0439458_0043881 3300042157 Bacteria 1091
463 Ga0439458_0111076 3300042157 Bacteria 717
464 Ga0439459_0120503 3300042438 Bacteria 661
465 Ga0439464_0083749 3300042439 Bacteria 955
466 Ga0450916_000427 3300042530 Bacteria 3595
467 Ga0450893_0002832 3300042532 Bacteria 2720
468 Ga0450901_009585 3300042533 Bacteria 1001
469 Ga0451577_0039030 3300042876 Bacteria 4267
470 Ga0451577_0049877 3300042876 Bacteria 3737
471 Ga0466969_0000018 3300044656 Bacteria 102911
472 Ga0466969_0002589 3300044656 Bacteria 9661
473 Ga0466969_0012551 3300044656 Bacteria 4465
474 Ga0466972_0007374 3300044658 Bacteria 5527
475 Ga0453683_1220206 3300044673 Bacteria 504
476 Ga0466965_0008031 3300044683 Bacteria 4871
477 Ga0466966_0021693 3300044684 Bacteria 4215
478 Ga0466966_0026863 3300044684 Bacteria 3755
479 Ga0466966_0619618 3300044684 Bacteria 651
480 Ga0466961_0005561 3300044693 Bacteria 7954
481 Ga0466961_0166639 3300044693 Bacteria 1371
482 Ga0466963_0238605 3300044694 Bacteria 1274
483 Ga0466964_0000637 3300044706 Bacteria 11177
484 Ga0466964_0003200 3300044706 Bacteria 5954
485 Ga0453684_0218561 3300044712 Bacteria 2209
486 Ga0453684_1413847 3300044712 Bacteria 721
487 Ga0453684_2047433 3300044712 Bacteria 575
488 Ga0466971_0001482 3300044719 Bacteria 9910
489 Ga0466971_0002400 3300044719 Bacteria 7905
490 Ga0466968_0012515 3300044735 Bacteria 3324
491 Ga0466970_0030706 3300044765 Bacteria 2834
492 Ga0466970_0084292 3300044765 Bacteria 1720
493 Ga0466970_0132024 3300044765 Bacteria 1372
494 Ga0466957_0029622 3300044842 Bacteria 3265
495 Ga0466960_0549416 3300044901 Bacteria 681
496 Ga0466959_0000855 3300045049 Bacteria 17985
497 Ga0466959_0014533 3300045049 Bacteria 5725
498 Ga0466959_0057593 3300045049 Bacteria 2832
499 Ga0451576_0106671 3300045051 Bacteria 2915
500 Ga0451576_1269618 3300045051 Bacteria 768
501 Ga0451576_1643998 3300045051 Bacteria 666
502 Ga0466958_0002207 3300045836 Bacteria 9697
503 Ga0466967_0003037 3300045976 Bacteria 10770
504 Ga0466967_0876553 3300045976 Bacteria 892
505 Ga0495590_0004188 3300046457 Bacteria 5838
506 Ga0495651_0074163 3300046462 Bacteria 2582
507 Ga0495651_0422670 3300046462 Bacteria 866
508 Ga0495653_0258688 3300046463 Bacteria 1152
509 Ga0495650_0038857 3300046471 Bacteria 2058
510 Ga0495585_0010449 3300046492 Bacteria 5520
511 Ga0495583_0000510 3300046506 Bacteria 55787
512 Ga0495606_0003088 3300046507 Bacteria 18141
513 Ga0495606_0055743 3300046507 Bacteria 2555
514 Ga0495608_0596810 3300046511 Bacteria 663
515 Ga0495628_0560018 3300046516 Bacteria 820
516 Ga0495598_0168327 3300046537 Bacteria 775
517 Ga0495621_0004071 3300046539 Bacteria 4071
518 Ga0495633_0147305 3300046558 Bacteria 1088
519 Ga0495656_0532111 3300046615 Bacteria 625
520 Ga0495668_0190631 3300046616 Bacteria 1123
521 Ga0495634_0275487 3300046642 Bacteria 1023
522 Ga0495625_0081173 3300046660 Bacteria 2257
523 Ga0495623_0593288 3300046679 Bacteria 576
524 Ga0495658_0514873 3300046683 Bacteria 766
525 Ga0495670_0057727 3300046691 Bacteria 1949
526 Ga0495671_0264020 3300046692 Bacteria 830
527 Ga0495649_0000961 3300046694 Bacteria 22764
528 Ga0495589_0117162 3300046794 Bacteria 1283
529 Ga0495683_0299445 3300047323 Bacteria 691
530 Ga0495686_0067186 3300047472 Bacteria 2213
531 Ga0495602_0185169 3300048088 Bacteria 1602
532 Ga0496100_0718129 3300048903 Bacteria 780
533 Ga0496100_1282247 3300048903 Bacteria 578
534 Ga0496103_0553500 3300048906 Bacteria 734
535 Ga0496104_0317930 3300048907 Bacteria 1470
536 Ga0496105_0519140 3300048908 Bacteria 933
537 Ga0496106_0113183 3300048909 Bacteria 2115
538 Ga0496107_0711146 3300048910 Bacteria 739
539 Ga0496108_1651262 3300048911 Bacteria 529
540 Ga0496109_0188205 3300048912 Bacteria 1939
541 Ga0496109_0771054 3300048912 Bacteria 900
542 Ga0496109_0999229 3300048912 Bacteria 774
543 Ga0496110_0139203 3300048913 Bacteria 2194
544 Ga0496111_0388603 3300048914 Bacteria 1032
545 Ga0496111_0554912 3300048914 Bacteria 843
546 Ga0496111_0812262 3300048914 Bacteria 676
547 Ga0496112_0018422 3300048915 Bacteria 6573
548 Ga0496113_0089439 3300048916 Bacteria 2370
549 Ga0496123_0344823 3300048926 Bacteria 695
550 Ga0496125_0090638 3300048928 Bacteria 2294
551 Ga0496126_0071539 3300048929 Bacteria 3087
552 Ga0496126_1153802 3300048929 Bacteria 572
553 Ga0501306_000061 3300049127 Bacteria 5674
554 Ga0501306_001000 3300049127 Bacteria 2483
555 Ga0501306_004240 3300049127 Bacteria 1597
556 Ga0501308_001669 3300049128 Bacteria 1828
557 Ga0501308_003436 3300049128 Bacteria 1466
558 Ga0501308_009444 3300049128 Bacteria 1065
559 Ga0501308_019526 3300049128 Bacteria 837
560 Ga0501308_021321 3300049128 Bacteria 813
561 Ga0501309_000014 3300049129 Bacteria 8867
562 Ga0501309_022934 3300049129 Bacteria 885
563 Ga0501309_051013 3300049129 Bacteria 650
564 Ga0501310_000059 3300049130 Bacteria 10166
565 Ga0501304_000014 3300049160 Bacteria 8417
566 Ga0501304_005905 3300049160 Bacteria 973
567 Ga0501304_019806 3300049160 Bacteria 659
568 Ga0501304_031706 3300049160 Bacteria 564
569 Ga0501305_000004 3300049161 Bacteria 13267
570 Ga0501305_006370 3300049161 Bacteria 1464
571 Ga0501305_055313 3300049161 Bacteria 674
572 Ga0501305_067745 3300049161 Bacteria 624
573 Ga0501305_072789 3300049161 Bacteria 607
574 Ga0501305_087885 3300049161 Bacteria 566
575 Ga0501307_000029 3300049162 Bacteria 5210
576 Ga0501307_018101 3300049162 Bacteria 893
577 Ga0501307_081634 3300049162 Bacteria 529
578 Ga0501291_001472 3300049514 Bacteria 2738
579 Ga0501294_001835 3300049517 Bacteria 2074
580 Ga0501299_031053 3300049522 Bacteria 1031
581 Ga0501300_005983 3300049523 Bacteria 1791
582 Ga0501301_021010 3300049524 Bacteria 628
583 Ga0501302_010569 3300049525 Bacteria 666
584 Ga0501311_000038 3300049527 Bacteria 5334
585 Ga0501311_097973 3300049527 Bacteria 516
586 Ga0501311_098874 3300049527 Bacteria 514
587 Ga0501312_000016 3300049528 Bacteria 9244
588 Ga0501312_010213 3300049528 Bacteria 1252
589 Ga0501312_074929 3300049528 Bacteria 605
590 Ga0501312_084925 3300049528 Bacteria 577
591 Ga0501313_001124 3300049529 Bacteria 2195
592 Ga0501313_028382 3300049529 Bacteria 718
593 Ga0501313_041015 3300049529 Bacteria 622
594 Ga0501313_055230 3300049529 Bacteria 555
595 Ga0501314_000017 3300049530 Bacteria 8558
596 Ga0501314_002757 3300049530 Bacteria 1379
597 Ga0501314_004922 3300049530 Bacteria 1123
598 Ga0501314_007493 3300049530 Bacteria 969
599 Ga0501314_008987 3300049530 Bacteria 911
600 Ga0501314_045262 3300049530 Bacteria 521
601 Ga0501315_012519 3300049531 Bacteria 1051
602 Ga0501315_016123 3300049531 Bacteria 965
603 Ga0501315_025919 3300049531 Bacteria 818
604 Ga0501315_036047 3300049531 Bacteria 732
605 Ga0501315_092357 3300049531 Bacteria 526
606 Ga0501316_000872 3300049532 Bacteria 2338
607 Ga0501316_020750 3300049532 Bacteria 827
608 Ga0501316_074953 3300049532 Bacteria 517
609 Ga0501317_008287 3300049533 Bacteria 1194
610 Ga0501317_008982 3300049533 Bacteria 1164
611 Ga0501317_021103 3300049533 Bacteria 882
612 Ga0501317_037847 3300049533 Bacteria 726
613 Ga0501318_000131 3300049534 Bacteria 3541
614 Ga0501318_010198 3300049534 Bacteria 1038
615 Ga0501318_019255 3300049534 Bacteria 850
616 Ga0501318_027537 3300049534 Bacteria 756
617 Ga0501319_001099 3300049535 Bacteria 1496
618 Ga0501319_022755 3300049535 Bacteria 570
619 Ga0501320_000131 3300049536 Bacteria 3444
620 Ga0501320_048782 3300049536 Bacteria 572
621 Ga0501321_000120 3300049537 Bacteria 3982
622 Ga0501322_000921 3300049538 Bacteria 1530
623 Ga0501322_004105 3300049538 Bacteria 967
624 Ga0501323_010881 3300049539 Bacteria 1091
625 Ga0501323_015806 3300049539 Bacteria 956
626 Ga0501323_035279 3300049539 Bacteria 716
627 Ga0501324_000221 3300049540 Bacteria 2719
628 Ga0501325_000034 3300049541 Bacteria 3949
629 Ga0501325_002337 3300049541 Bacteria 1286
630 Ga0501325_002669 3300049541 Bacteria 1241
631 Ga0501325_020665 3300049541 Bacteria 692
632 Ga0501326_06457 3300049542 Bacteria 655
633 Ga0501327_17690 3300049543 Bacteria 517
634 Ga0501328_03299 3300049544 Bacteria 744
635 Ga0501330_007626 3300049546 Bacteria 729
636 Ga0501331_07702 3300049547 Bacteria 644
637 Ga0501333_001792 3300049549 Bacteria 1201
638 Ga0501335_004434 3300049551 Bacteria 1227
639 Ga0501336_009266 3300049552 Bacteria 773
640 Ga0501336_012604 3300049552 Bacteria 700
641 Ga0501337_005613 3300049553 Bacteria 843
642 Ga0501338_10616 3300049554 Bacteria 622
643 Ga0501339_00793 3300049555 Bacteria 715
644 Ga0501034_0812110 3300049571 Bacteria 827
645 Ga0501043_0000090 3300049579 Bacteria 81336
646 Ga0501046_0000126 3300049580 Bacteria 81334
647 Ga0501047_0000160 3300049581 Bacteria 81946
648 Ga0501048_0003429 3300049582 Bacteria 12039
649 Ga0501071_0873461 3300049587 Bacteria 694
650 Ga0501199_001069 3300049650 Bacteria 2460
651 Ga0501201_017474 3300049651 Bacteria 740
652 Ga0501202_000808 3300049652 Bacteria 4708
653 Ga0501202_154969 3300049652 Bacteria 602
654 Ga0501206_001738 3300049653 Bacteria 2732
655 Ga0501206_062249 3300049653 Bacteria 615
656 Ga0501207_009301 3300049654 Bacteria 1434
657 Ga0501207_060778 3300049654 Bacteria 692
658 Ga0501211_000022 3300049658 Bacteria 11753
659 Ga0501217_017765 3300049661 Bacteria 1643
660 Ga0501222_002187 3300049662 Bacteria 2713
661 Ga0501223_007701 3300049663 Bacteria 2200
662 Ga0501223_027094 3300049663 Bacteria 1115
663 Ga0501223_087912 3300049663 Bacteria 628
664 Ga0501227_018717 3300049665 Bacteria 1574
665 Ga0501233_002966 3300049668 Bacteria 3030
666 Ga0501235_001228 3300049669 Bacteria 5397
667 Ga0501239_081866 3300049672 Bacteria 519
668 Ga0501249_003813 3300049679 Bacteria 3043
669 Ga0501253_001536 3300049683 Bacteria 2379
670 Ga0501255_007217 3300049684 Bacteria 1171
671 Ga0501256_020904 3300049685 Bacteria 687
672 Ga0501258_000137 3300049687 Bacteria 4092
673 Ga0501259_014208 3300049688 Bacteria 1347
674 Ga0501221_001094 3300049704 Bacteria 4449
675 Ga0501225_0042192 3300049705 Bacteria 1259
676 Ga0501229_001006 3300049706 Bacteria 3217
677 Ga0501234_010360 3300049707 Bacteria 1452
678 Ga0501079_0537572 3300049741 Bacteria 919
679 Ga0501080_0517640 3300049742 Bacteria 1065
680 Ga0501232_001245 3300049757 Bacteria 1978
681 Ga0501262_000590 3300049759 Bacteria 4309
682 Ga0501264_003121 3300049761 Bacteria 1512
683 Ga0501266_038062 3300049763 Bacteria 707
684 Ga0501267_000666 3300049764 Bacteria 2729
685 Ga0501268_001964 3300049765 Bacteria 2639
686 Ga0501269_001030 3300049766 Bacteria 3942
687 Ga0501272_000713 3300049769 Bacteria 2990
688 Ga0501274_001433 3300049771 Bacteria 1821
689 Ga0501281_13953 3300049777 Bacteria 585
690 Ga0501035_0317635 3300049822 Bacteria 1309
691 Ga0501035_0985460 3300049822 Bacteria 663
692 Ga0501044_0057237 3300049823 Bacteria 4001
693 Ga0501045_0000882 3300049824 Bacteria 19499
694 nmdc:mga03683_137434_c1 3300050489 Bacteria 1097
695 nmdc:mga03683_40005_c1 3300050489 Bacteria 1921
696 nmdc:mga03683_586371_c1 3300050489 Bacteria 545
697 nmdc:mga03n38_394330_c1 3300050490 Bacteria 761
698 nmdc:mga03n38_412929_c1 3300050490 Bacteria 745
699 nmdc:mga00v17_638959_c1 3300050491 Bacteria 685
700 nmdc:mga0yw44_1138361_c1 3300050492 Bacteria 527
701 nmdc:mga0k408_106262_c1 3300050493 Bacteria 1024
702 nmdc:mga0k408_113462_c1 3300050493 Bacteria 1603
703 nmdc:mga0k408_118827_c1 3300050493 Bacteria 1565
704 nmdc:mga0k408_191365_c1 3300050493 Bacteria 1221
705 nmdc:mga0k408_219_c1 3300050493 Bacteria 23656
706 nmdc:mga0k408_269951_c1 3300050493 Bacteria 1016
707 nmdc:mga0k408_33936_c1 3300050493 Bacteria 555
708 nmdc:mga0k408_34945_c1 3300050493 Bacteria 2880
709 nmdc:mga07m45_16030_c1 3300050496 Bacteria 4011
710 nmdc:mga07m45_192519_c1 3300050496 Bacteria 1186
711 nmdc:mga07m45_341539_c1 3300050496 Bacteria 870
712 nmdc:mga07m45_398_c1 3300050496 Bacteria 17925
713 nmdc:mga07m45_44170_c1 3300050496 Bacteria 2500
714 nmdc:mga05p37_217522_c1 3300050507 Bacteria 2307
715 nmdc:mga09592_1698079_c1 3300050508 Bacteria 509
716 nmdc:mga09592_473801_c1 3300050508 Bacteria 1079
717 nmdc:mga08y16_591318_c1 3300050511 Bacteria 1119
718 nmdc:mga0a205_671858_c1 3300050515 Bacteria 886
719 Ga0500635_0000036 3300053080 Bacteria 94740
720 Ga0500578_0706483 3300053086 Bacteria 542
721 Ga0500651_0186189 3300053093 Bacteria 1231
722 Ga0500608_250479 3300053122 Bacteria 691
723 Ga0500652_320440 3300053131 Bacteria 594
724 Ga0500658_0421076 3300053134 Bacteria 610
725 Ga0500559_0045090 3300053136 Bacteria 1929
726 Ga0500564_314413 3300053138 Bacteria 595
727 Ga0500622_0001316 3300053156 Bacteria 20204
728 Ga0500638_090974 3300053162 Bacteria 1436
729 Ga0500636_0162502 3300053177 Bacteria 1215
730 Ga0500661_061146 3300055283 Bacteria 680
731 Ga0587084_000147 3300059477 Bacteria 4251
732 Ga0587093_000068 3300059478 Bacteria 4574
733 Ga0587093_026841 3300059478 Bacteria 807
734 Ga0587066_004510 3300059490 Bacteria 1719
735 Ga0587066_025106 3300059490 Bacteria 1019
736 Ga0587070_000065 3300059491 Bacteria 5371
737 Ga0587070_002116 3300059491 Bacteria 2196
738 Ga0587073_0000528 3300059492 Bacteria 3601
739 Ga0587073_0008893 3300059492 Bacteria 1640
740 Ga0587073_0012121 3300059492 Bacteria 1487
741 Ga0587077_000950 3300059493 Bacteria 2876
742 Ga0587077_001041 3300059493 Bacteria 2802
743 Ga0587077_009175 3300059493 Bacteria 1494
744 Ga0587077_024961 3300059493 Bacteria 1092
745 Ga0587080_004865 3300059503 Bacteria 1772
746 Ga0587080_026133 3300059503 Bacteria 990
747 Ga0587082_002352 3300059504 Bacteria 2123
748 Ga0587082_065061 3300059504 Bacteria 728
749 Ga0587083_0000260 3300059505 Bacteria 4088
750 Ga0587085_144850 3300059506 Bacteria 543
751 Ga0587086_033945 3300059507 Bacteria 763
752 Ga0587088_000741 3300059508 Bacteria 2965
753 Ga0587088_006778 3300059508 Bacteria 1560
754 Ga0587088_170751 3300059508 Bacteria 539
755 Ga0587089_008079 3300059509 Bacteria 1264
756 Ga0587090_030499 3300059510 Bacteria 899
757 Ga0587091_091666 3300059511 Bacteria 699
758 Ga0587092_041567 3300059512 Bacteria 802
759 Ga0587092_057351 3300059512 Bacteria 721
760 Ga0587094_018487 3300059513 Bacteria 992
761 Ga0587094_024327 3300059513 Bacteria 901
762 Ga0587094_128531 3300059513 Bacteria 514
763 Ga0587106_029929 3300059605 Bacteria 868
764 Ga0587106_165957 3300059605 Bacteria 501
765 Ga0587125_000700 3300059607 Bacteria 2137
766 Ga0587129_000468 3300059608 Bacteria 1815
767 Ga0587099_000652 3300059622 Bacteria 2125
768 Ga0587101_000448 3300059623 Bacteria 2910
769 Ga0587101_004507 3300059623 Bacteria 1492
770 Ga0587101_104843 3300059623 Bacteria 567
771 Ga0587109_036579 3300059624 Bacteria 956
772 Ga0587113_008179 3300059625 Bacteria 924
773 Ga0587115_001117 3300059626 Bacteria 2323
774 Ga0587127_000506 3300059629 Bacteria 1817
775 Ga0587128_001730 3300059630 Bacteria 2132
776 Ga0587130_021759 3300059631 Bacteria 698
777 Ga0587130_052286 3300059631 Bacteria 514
778 Ga0587062_000400 3300059639 Bacteria 2970
779 Ga0587062_012649 3300059639 Bacteria 1086
780 Ga0587062_138679 3300059639 Bacteria 506
781 Ga0587067_002743 3300059640 Bacteria 2128
782 Ga0587068_001309 3300059641 Bacteria 2740
783 Ga0587068_024456 3300059641 Bacteria 1012
784 Ga0587068_066467 3300059641 Bacteria 703
785 Ga0587068_071828 3300059641 Bacteria 684
786 Ga0587068_078370 3300059641 Bacteria 663
787 Ga0587069_010834 3300059642 Bacteria 1207
788 Ga0587069_076465 3300059642 Bacteria 645
789 Ga0587072_001392 3300059643 Bacteria 2980
790 Ga0587072_008796 3300059643 Bacteria 1606
791 Ga0587076_002043 3300059645 Bacteria 2197
792 Ga0587076_002122 3300059645 Bacteria 2173
793 Ga0587079_003155 3300059647 Bacteria 2119
794 Ga0587079_046494 3300059647 Bacteria 896
795 Ga0587100_000850 3300059648 Bacteria 1621
796 Ga0587100_024483 3300059648 Bacteria 609
797 Ga0587102_000785 3300059649 Bacteria 1981
798 Ga0587104_004540 3300059650 Bacteria 891
799 Ga0587105_000221 3300059651 Bacteria 2056
800 Ga0587107_000989 3300059652 Bacteria 2150
801 Ga0587108_008141 3300059653 Bacteria 845
802 Ga0587114_002480 3300059655 Bacteria 1723
803 Ga0587118_00289 3300059657 Bacteria 2380
804 Ga0587119_021596 3300059658 Bacteria 826
805 Ga0587124_001207 3300059660 Bacteria 1640
806 Ga0587096_00044 3300060247 Bacteria 2129
807 Ga0587071_026067 3300060344 Bacteria 1101
808 Ga0587111_0000186 3300060346 Bacteria 4817
809 Ga0587111_0000227 3300060346 Bacteria 4609
810 Ga0466962_0000718 3300061719 Bacteria 14786
811 Ga0466962_0014522 3300061719 Bacteria 3795
812 2643746689 2643221544 Bacteria 5886209
813 2643937419 2643221585 Bacteria 5812563
814 2644218755 2643221639 Bacteria 6649903
815 2644256842 2643221646 Bacteria 6433402
816 2644314957 2643221656 Bacteria 5809961
817 2644338008 2643221660 Bacteria 4208257
818 2739057970 2738541337 Bacteria 6183410
819 2831867512 2831864461 Bacteria 6502356
820 Ga0068868_100602254
821 JGI25156J39149_1025699
822 JGI25156J39149_1026157
823 JGI25156J39149_1039814
824 JGI25154J39366_1000593
825 JGI25157J39369_1001522
826 JGI25164J39214_1002084
827 Ga0006765J45826_106373
828 Ga0006778J45830_1009213
829 Ga0006778J45830_1056528
830 Ga0006759J45824_1029126
831 Ga0006759J45824_1055672
832 Ga0006758J48902_1015144
833 Ga0006758J48902_1021934
834 Ga0006758J48902_1024929
835 Ga0006770J48903_1001899
836 Ga0006770J48903_1044543
837 Ga0006777J48905_1014855
838 Ga0007417J51691_1029545
839 Ga0007417J51691_1043945
840 Ga0007427J51700_105505
841 Ga0007427J51700_113549
842 Ga0007410J51695_1005226
843 Ga0007410J51695_1028665
844 Ga0007410J51695_1032042
845 Ga0007409J51694_1019841
846 Ga0007409J51694_1020061
847 Ga0007416J51690_1027279
848 Ga0007416J51690_1051124
849 Ga0007429J51699_1066463
850 Ga0032354_1028740
851 Ga0032354_1037309
852 Ga0032354_1044089
853 Ga0032354_1117171
854 Ga0055539_1037180
855 Ga0055533_1000043
856 Ga0055525_1000161
857 Ga0055525_1000641
858 Ga0055535_1021794
859 Ga0055535_1023542
860 Ga0055529_1000322
861 Ga0055540_1026414
862 Ga0055531_10012516
863 Ga0055531_10098547
864 Ga0055543_1027494
865 Ga0058858_1003354
866 Ga0058858_1430617
867 Ga0058859_10030919
868 Ga0058859_10055155
869 Ga0058859_11825120
870 Ga0058863_10044021
871 Ga0058861_10142005
872 Ga0058861_10194247
873 Ga0058860_10052045
874 Ga0058860_10096621
875 Ga0058860_12116272
876 Ga0058862_10051180
877 Ga0065165_1010518
878 Ga0065165_1048431
879 Ga0065707_10559059
880 Ga0070658_11148191
881 Ga0070658_11221121
882 Ga0070658_11468236
883 Ga0070676_10756527
884 Ga0070683_100352957
885 Ga0070690_100134141
886 Ga0068869_100012739
887 Ga0070666_10109820
888 Ga0070682_100066791
889 Ga0068868_100831067
890 Ga0068868_101147186
891 Ga0070660_100320427
892 Ga0070660_100371696
893 Ga0070660_101462983
894 Ga0070691_10245118
895 Ga0070669_100343052
896 Ga0070669_101564377
897 Ga0070675_100330914
898 Ga0070675_100398807
899 Ga0070671_100038207
900 Ga0070671_100871948
901 Ga0070674_100683279
902 Ga0070674_101032674
903 Ga0070673_100002927
904 Ga0070688_100254873
905 Ga0070659_100057420
906 Ga0070659_100120047
907 Ga0070667_101780280
908 Ga0070678_100037760
909 Ga0070678_100207105
910 Ga0070678_100421211
911 Ga0070662_100274312
912 Ga0070681_10497103
913 Ga0068867_100292475
914 Ga0068867_100601767
915 Ga0070707_100461298
916 Ga0070679_100375973
917 Ga0070679_100834570
918 Ga0070684_100894602
919 Ga0068853_100345863
920 Ga0068853_101067403
921 Ga0068853_101936437
922 Ga0068853_101988889
923 Ga0070672_100370305
924 Ga0070686_100729464
925 Ga0070665_100525724
926 Ga0070665_100551566
927 Ga0068855_100961007
928 Ga0068855_101390928
929 Ga0070664_100452105
930 Ga0068857_100387564
931 Ga0068854_100273417
932 Ga0068856_100033721
933 Ga0068856_100231329
934 Ga0068856_101792745
935 Ga0068852_100157329
936 Ga0068852_100184567
937 Ga0068852_100912756
938 Ga0068859_103056882
939 Ga0068864_100723641
940 Ga0068864_102061142
941 Ga0068866_10472692
942 Ga0068866_11466369
943 Ga0068861_100067654
944 Ga0068861_100250877
945 Ga0068851_10097792
946 Ga0068851_10510819
947 Ga0068863_100182919
948 Ga0068858_101935889
949 Ga0068862_100009442
950 Ga0068862_100090240
951 Ga0068862_100566589
952 Ga0081455_10342025
953 Ga0075363_100212774
954 Ga0075363_100251023
955 Ga0075364_10260140
956 Ga0075362_10068048
957 Ga0075362_10118078
958 Ga0075362_10579705
959 Ga0075366_10000795
960 Ga0075366_10021754
961 Ga0075366_10075093
962 Ga0075366_10102009
963 Ga0075366_10111379
964 Ga0075366_10214047
965 Ga0075366_10281535
966 Ga0075366_10979222
967 Ga0075370_10000701
968 Ga0075370_10096809
969 Ga0075370_10178238
970 Ga0075370_10381414
971 Ga0075429_100409696
972 Ga0097620_100993556
973 Ga0097620_103056690
974 Ga0105250_10211043
975 Ga0105240_10018079
976 Ga0105240_10608637
977 Ga0105240_10763734
978 Ga0105240_11532248
979 Ga0105240_12384249
980 Ga0111539_10350927
981 Ga0111539_11955632
982 Ga0111539_12890563
983 Ga0105245_10060455
984 Ga0105245_12756675
985 Ga0114129_10176739
986 Ga0105243_10001789
987 Ga0105243_10030050
988 Ga0105243_10177323
989 Ga0105243_10252607
990 Ga0105241_11260214
991 Ga0105242_10297878
992 Ga0105248_10006768
993 Ga0105248_11336448
994 Ga0105248_11371716
995 Ga0105237_10000668
996 Ga0105238_10003926
997 Ga0105238_10088675
998 Ga0105238_11082143
999 Ga0105238_12840029
1000 Ga0105249_10068515
1001 Ga0105249_10311041
1002 Ga0105239_10001255
1003 Ga0105239_11112547
1004 Ga0105246_10060033
1005 Ga0157327_1015077
1006 Ga0157373_10739528
1007 Ga0157371_10867915
1008 Ga0157370_10422778
1009 Ga0157369_10547096
1010 Ga0157374_10123485
1011 Ga0157374_11269982
1012 Ga0157378_10029129
1013 Ga0157378_10873702
1014 Ga0163162_10505539
1015 Ga0163162_12978772
1016 Ga0157372_10373891
1017 Ga0157372_11082189
1018 Ga0157375_10137647
1019 Ga0157375_10710210
1020 Ga0157375_12005957
1021 Ga0157375_12740470
1022 Ga0163163_11953739
1023 Ga0157380_10821964
1024 Ga0157377_10000368
1025 Ga0157379_10469488
1026 Ga0157376_10090219
1027 Ga0157376_11883744
1028 Ga0182007_10077939
1029 Ga0182007_10374325
1030 Ga0163161_10514817
1031 Ga0197907_10761668
1032 Ga0206356_11223789
1033 Ga0206355_1548870
1034 Ga0206352_10258252
1035 Ga0206352_10887797
1036 Ga0206352_10920041
1037 Ga0206352_11007505
1038 Ga0206350_11041308
1039 Ga0213872_10000091
1040 Ga0213872_10002765
1041 Ga0213872_10004732
1042 Ga0209674_100067
1043 Ga0209674_109216
1044 Ga0209672_107040
1045 Ga0209563_100068
1046 Ga0209563_100088
1047 Ga0207427_100260
1048 Ga0209258_102113
1049 Ga0209258_118229
1050 Ga0209646_1000127
1051 Ga0209026_1000004
1052 Ga0209677_100201
1053 Ga0209148_1002904
1054 Ga0209759_1000129
1055 Ga0209759_1003759
1056 Ga0209455_1000083
1057 Ga0209673_1026632
1058 Ga0209564_1000008
1059 Ga0209050_1004273
1060 Ga0209256_1028202
1061 Ga0209051_1005321
1062 Ga0209257_1000047
1063 Ga0207656_10116353
1064 Ga0207642_10569245
1065 Ga0207642_10591643
1066 Ga0207680_10487657
1067 Ga0207680_10523330
1068 Ga0207647_10074272
1069 Ga0207645_10160739
1070 Ga0207645_10384444
1071 Ga0207643_10312571
1072 Ga0207705_10053354
1073 Ga0207654_10059196
1074 Ga0207654_10797506
1075 Ga0207707_10417643
1076 Ga0207695_10010589
1077 Ga0207695_10103337
1078 Ga0207671_10019707
1079 Ga0207671_10047329
1080 Ga0207660_11007987
1081 Ga0207660_11355730
1082 Ga0207662_10034330
1083 Ga0207657_10152752
1084 Ga0207657_10364651
1085 Ga0207652_10202638
1086 Ga0207652_10559555
1087 Ga0207681_10187413
1088 Ga0207694_10004619
1089 Ga0207694_10026084
1090 Ga0207694_11251446
1091 Ga0207694_11625111
1092 Ga0207650_11056631
1093 Ga0207650_11875865
1094 Ga0207659_10233696
1095 Ga0207659_10365256
1096 Ga0207659_10384923
1097 Ga0207687_10072566
1098 Ga0207687_10844263
1099 Ga0207644_10024978
1100 Ga0207644_10834664
1101 Ga0207690_10039856
1102 Ga0207706_10300451
1103 Ga0207706_10738258
1104 Ga0207686_10232569
1105 Ga0207709_10001005
1106 Ga0207709_10207965
1107 Ga0207709_10226741
1108 Ga0207669_10191669
1109 Ga0207691_10115353
1110 Ga0207691_10230836
1111 Ga0207711_10009541
1112 Ga0207689_10028262
1113 Ga0207661_10461940
1114 Ga0207679_10497711
1115 Ga0207667_10701744
1116 Ga0207651_10077458
1117 Ga0207712_10746934
1118 Ga0207712_11267320
1119 Ga0207640_10018588
1120 Ga0207658_11146433
1121 Ga0207677_10348252
1122 Ga0207639_11602510
1123 Ga0207639_11702829
1124 Ga0207702_10001875
1125 Ga0207702_10098322
1126 Ga0207641_10711953
1127 Ga0207641_11341182
1128 Ga0207648_10002176
1129 Ga0207648_10111939
1130 Ga0207648_10116151
1131 Ga0207648_10300208
1132 Ga0207648_10752815
1133 Ga0207648_12192688
1134 Ga0207676_10128448
1135 Ga0207676_10946210
1136 Ga0207674_10004293
1137 Ga0207674_11088992
1138 Ga0207675_100101603
1139 Ga0207683_10032302
1140 Ga0207683_10376795
1141 Ga0207683_10430813
1142 Ga0207698_10810285
1143 Ga0207698_12435571
1144 Ga0209973_1085997
1145 Ga0209969_1000889
1146 Ga0209981_1007951
1147 Ga0209996_1000729
1148 Ga0209995_1000242
1149 Ga0209968_1000130
1150 Ga0209999_1001613
1151 Ga0209999_1062698
1152 Ga0210002_1080391
1153 Ga0209971_1038388
1154 Ga0209966_1000117
1155 Ga0209998_10002530
1156 Ga0209974_10010680
1157 Ga0268266_11160331
1158 Ga0268265_10058401
1159 Ga0268265_10354115
1160 Ga0268264_10248432
1161 Ga0268264_10916094
1162 Ga0265334_10073367
1163 Ga0265336_10000028
1164 Ga0307515_10108460
1165 Ga0265324_10000286
1166 Ga0307511_10070244
1167 Ga0265766_1017267
1168 Ga0265769_101736
1169 Ga0265328_10033426
1170 Ga0265328_10238709
1171 Ga0265331_10115103
1172 Ga0265327_10000020
1173 Ga0265327_10000178
1174 Ga0265327_10176722
1175 Ga0265316_10000201
1176 Ga0307509_10322942
1177 Ga0307408_100000089
1178 Ga0307408_100173708
1179 Ga0307408_100707218
1180 Ga0307508_10563692
1181 Ga0307514_10000339
1182 Ga0307516_10026535
1183 Ga0307516_10027941
1184 Ga0307516_10040356
1185 Ga0307516_10222839
1186 Ga0307516_10671439
1187 Ga0307405_10558102
1188 Ga0307413_10520434
1189 Ga0307413_10964581
1190 Ga0307410_11073487
1191 Ga0307410_11892895
1192 Ga0307406_10513452
1193 Ga0307406_10738298
1194 Ga0307406_11549686
1195 Ga0307407_10845472
1196 Ga0307412_10532576
1197 Ga0307412_10846819
1198 Ga0307412_11147700
1199 Ga0307416_100714982
1200 Ga0307416_100814110
1201 Ga0307414_10057302
1202 Ga0307414_10306607
1203 Ga0307414_11731413
1204 Ga0307411_10000085
1205 Ga0307411_10197371
1206 Ga0307411_10276119
1207 Ga0307411_10703743
1208 Ga0373958_0010068
1209 Ga0373944_0394484
1210 Ga0373923_0531387
1211 Ga0373939_0000348
1212 Ga0373939_0099657
1213 Ga0373960_0026433
1214 Ga0373946_0195619
1215 Ga0373961_0015414
1216 Ga0373962_0113129
1217 Ga0373931_0000535
1218 Ga0373931_0209811
1219 Ga0373935_1008046
1220 Ga0373947_0666175
1221 Ga0265778_002283
1222 Ga0310110_007052
1223 Ga0395900_0289299
1224 Ga0395898_0012209
1225 Ga0395898_0395446
1226 Ga0395905_0000084
1227 Ga0395905_0002507
1228 Ga0395905_0023115
1229 Ga0395905_0038305
1230 Ga0395905_0097413
1231 Ga0395905_0187255
1232 Ga0395905_0304457
1233 Ga0395905_0604545
1234 Ga0395901_0001925
1235 Ga0436360_0060872
1236 Ga0436361_0114178
1237 Ga0436361_0405071
1238 Ga0436361_0570086
1239 Ga0436361_0681463
1240 Ga0436361_0714431
1241 Ga0436361_1006874
1242 Ga0436361_1203462
1243 Ga0436363_1307251
1244 Ga0439453_0019683
1245 Ga0439461_0021772
1246 Ga0439461_0224296
1247 Ga0439465_0021384
1248 Ga0451793_0314072
1249 Ga0451802_2148803
1250 Ga0451805_014700
1251 Ga0451807_0659712
1252 Ga0451835_1219663
1253 Ga0451846_32730
1254 Ga0451849_1054469
1255 Ga0451850_41031
1256 Ga0451851_1340491
1257 Ga0451854_20387
1258 Ga0451855_0165355
1259 Ga0451853_3137514
1260 Ga0452271_43687
1261 Ga0439437_000716
1262 Ga0439443_004303
1263 Ga0439448_0158928
1264 Ga0439455_0002630
1265 Ga0439455_0004568
1266 Ga0439455_0027785
1267 Ga0439455_0132201
1268 Ga0439456_037916
1269 Ga0450913_000876
1270 Ga0450917_000001
1271 Ga0450888_000612
1272 Ga0450890_000549
1273 Ga0450890_068097
1274 Ga0450891_000262
1275 Ga0450892_000236
1276 Ga0450894_016349
1277 Ga0450898_035025
1278 Ga0450898_058258
1279 Ga0439446_0031377
1280 Ga0439446_0118939
1281 Ga0439458_0043881
1282 Ga0439458_0111076
1283 Ga0439459_0120503
1284 Ga0439464_0083749
1285 Ga0450916_000427
1286 Ga0450893_0002832
1287 Ga0450901_009585
1288 Ga0451577_0039030
1289 Ga0451577_0049877
1290 Ga0466969_0000018
1291 Ga0466969_0002589
1292 Ga0466969_0012551
1293 Ga0466972_0007374
1294 Ga0453683_1220206
1295 Ga0466965_0008031
1296 Ga0466966_0021693
1297 Ga0466966_0026863
1298 Ga0466966_0619618
1299 Ga0466961_0005561
1300 Ga0466961_0166639
1301 Ga0466963_0238605
1302 Ga0466964_0000637
1303 Ga0466964_0003200
1304 Ga0453684_0218561
1305 Ga0453684_1413847
1306 Ga0453684_2047433
1307 Ga0466971_0001482
1308 Ga0466971_0002400
1309 Ga0466968_0012515
1310 Ga0466970_0030706
1311 Ga0466970_0084292
1312 Ga0466970_0132024
1313 Ga0466957_0029622
1314 Ga0466960_0549416
1315 Ga0466959_0000855
1316 Ga0466959_0014533
1317 Ga0466959_0057593
1318 Ga0451576_0106671
1319 Ga0451576_1269618
1320 Ga0451576_1643998
1321 Ga0466958_0002207
1322 Ga0466967_0003037
1323 Ga0466967_0876553
1324 Ga0495590_0004188
1325 Ga0495651_0074163
1326 Ga0495651_0422670
1327 Ga0495653_0258688
1328 Ga0495650_0038857
1329 Ga0495585_0010449
1330 Ga0495583_0000510
1331 Ga0495606_0003088
1332 Ga0495606_0055743
1333 Ga0495608_0596810
1334 Ga0495628_0560018
1335 Ga0495598_0168327
1336 Ga0495621_0004071
1337 Ga0495633_0147305
1338 Ga0495656_0532111
1339 Ga0495668_0190631
1340 Ga0495634_0275487
1341 Ga0495625_0081173
1342 Ga0495623_0593288
1343 Ga0495658_0514873
1344 Ga0495670_0057727
1345 Ga0495671_0264020
1346 Ga0495649_0000961
1347 Ga0495589_0117162
1348 Ga0495683_0299445
1349 Ga0495686_0067186
1350 Ga0495602_0185169
1351 Ga0496100_0718129
1352 Ga0496100_1282247
1353 Ga0496103_0553500
1354 Ga0496104_0317930
1355 Ga0496105_0519140
1356 Ga0496106_0113183
1357 Ga0496107_0711146
1358 Ga0496108_1651262
1359 Ga0496109_0188205
1360 Ga0496109_0771054
1361 Ga0496109_0999229
1362 Ga0496110_0139203
1363 Ga0496111_0388603
1364 Ga0496111_0554912
1365 Ga0496111_0812262
1366 Ga0496112_0018422
1367 Ga0496113_0089439
1368 Ga0496123_0344823
1369 Ga0496125_0090638
1370 Ga0496126_0071539
1371 Ga0496126_1153802
1372 Ga0501306_000061
1373 Ga0501306_001000
1374 Ga0501306_004240
1375 Ga0501308_001669
1376 Ga0501308_003436
1377 Ga0501308_009444
1378 Ga0501308_019526
1379 Ga0501308_021321
1380 Ga0501309_000014
1381 Ga0501309_022934
1382 Ga0501309_051013
1383 Ga0501310_000059
1384 Ga0501304_000014
1385 Ga0501304_005905
1386 Ga0501304_019806
1387 Ga0501304_031706
1388 Ga0501305_000004
1389 Ga0501305_006370
1390 Ga0501305_055313
1391 Ga0501305_067745
1392 Ga0501305_072789
1393 Ga0501305_087885
1394 Ga0501307_000029
1395 Ga0501307_018101
1396 Ga0501307_081634
1397 Ga0501291_001472
1398 Ga0501294_001835
1399 Ga0501299_031053
1400 Ga0501300_005983
1401 Ga0501301_021010
1402 Ga0501302_010569
1403 Ga0501311_000038
1404 Ga0501311_097973
1405 Ga0501311_098874
1406 Ga0501312_000016
1407 Ga0501312_010213
1408 Ga0501312_074929
1409 Ga0501312_084925
1410 Ga0501313_001124
1411 Ga0501313_028382
1412 Ga0501313_041015
1413 Ga0501313_055230
1414 Ga0501314_000017
1415 Ga0501314_002757
1416 Ga0501314_004922
1417 Ga0501314_007493
1418 Ga0501314_008987
1419 Ga0501314_045262
1420 Ga0501315_012519
1421 Ga0501315_016123
1422 Ga0501315_025919
1423 Ga0501315_036047
1424 Ga0501315_092357
1425 Ga0501316_000872
1426 Ga0501316_020750
1427 Ga0501316_074953
1428 Ga0501317_008287
1429 Ga0501317_008982
1430 Ga0501317_021103
1431 Ga0501317_037847
1432 Ga0501318_000131
1433 Ga0501318_010198
1434 Ga0501318_019255
1435 Ga0501318_027537
1436 Ga0501319_001099
1437 Ga0501319_022755
1438 Ga0501320_000131
1439 Ga0501320_048782
1440 Ga0501321_000120
1441 Ga0501322_000921
1442 Ga0501322_004105
1443 Ga0501323_010881
1444 Ga0501323_015806
1445 Ga0501323_035279
1446 Ga0501324_000221
1447 Ga0501325_000034
1448 Ga0501325_002337
1449 Ga0501325_002669
1450 Ga0501325_020665
1451 Ga0501326_06457
1452 Ga0501327_17690
1453 Ga0501328_03299
1454 Ga0501330_007626
1455 Ga0501331_07702
1456 Ga0501333_001792
1457 Ga0501335_004434
1458 Ga0501336_009266
1459 Ga0501336_012604
1460 Ga0501337_005613
1461 Ga0501338_10616
1462 Ga0501339_00793
1463 Ga0501034_0812110
1464 Ga0501043_0000090
1465 Ga0501046_0000126
1466 Ga0501047_0000160
1467 Ga0501048_0003429
1468 Ga0501071_0873461
1469 Ga0501199_001069
1470 Ga0501201_017474
1471 Ga0501202_000808
1472 Ga0501202_154969
1473 Ga0501206_001738
1474 Ga0501206_062249
1475 Ga0501207_009301
1476 Ga0501207_060778
1477 Ga0501211_000022
1478 Ga0501217_017765
1479 Ga0501222_002187
1480 Ga0501223_007701
1481 Ga0501223_027094
1482 Ga0501223_087912
1483 Ga0501227_018717
1484 Ga0501233_002966
1485 Ga0501235_001228
1486 Ga0501239_081866
1487 Ga0501249_003813
1488 Ga0501253_001536
1489 Ga0501255_007217
1490 Ga0501256_020904
1491 Ga0501258_000137
1492 Ga0501259_014208
1493 Ga0501221_001094
1494 Ga0501225_0042192
1495 Ga0501229_001006
1496 Ga0501234_010360
1497 Ga0501079_0537572
1498 Ga0501080_0517640
1499 Ga0501232_001245
1500 Ga0501262_000590
1501 Ga0501264_003121
1502 Ga0501266_038062
1503 Ga0501267_000666
1504 Ga0501268_001964
1505 Ga0501269_001030
1506 Ga0501272_000713
1507 Ga0501274_001433
1508 Ga0501281_13953
1509 Ga0501035_0317635
1510 Ga0501035_0985460
1511 Ga0501044_0057237
1512 Ga0501045_0000882
1513 nmdc:mga03683_137434_c1
1514 nmdc:mga03683_40005_c1
1515 nmdc:mga03683_586371_c1
1516 nmdc:mga03n38_394330_c1
1517 nmdc:mga03n38_412929_c1
1518 nmdc:mga00v17_638959_c1
1519 nmdc:mga0yw44_1138361_c1
1520 nmdc:mga0k408_106262_c1
1521 nmdc:mga0k408_113462_c1
1522 nmdc:mga0k408_118827_c1
1523 nmdc:mga0k408_191365_c1
1524 nmdc:mga0k408_219_c1
1525 nmdc:mga0k408_269951_c1
1526 nmdc:mga0k408_33936_c1
1527 nmdc:mga0k408_34945_c1
1528 nmdc:mga07m45_16030_c1
1529 nmdc:mga07m45_192519_c1
1530 nmdc:mga07m45_341539_c1
1531 nmdc:mga07m45_398_c1
1532 nmdc:mga07m45_44170_c1
1533 nmdc:mga05p37_217522_c1
1534 nmdc:mga09592_1698079_c1
1535 nmdc:mga09592_473801_c1
1536 nmdc:mga08y16_591318_c1
1537 nmdc:mga0a205_671858_c1
1538 Ga0500635_0000036
1539 Ga0500578_0706483
1540 Ga0500651_0186189
1541 Ga0500608_250479
1542 Ga0500652_320440
1543 Ga0500658_0421076
1544 Ga0500559_0045090
1545 Ga0500564_314413
1546 Ga0500622_0001316
1547 Ga0500638_090974
1548 Ga0500636_0162502
1549 Ga0500661_061146
1550 Ga0587084_000147
1551 Ga0587093_000068
1552 Ga0587093_026841
1553 Ga0587066_004510
1554 Ga0587066_025106
1555 Ga0587070_000065
1556 Ga0587070_002116
1557 Ga0587073_0000528
1558 Ga0587073_0008893
1559 Ga0587073_0012121
1560 Ga0587077_000950
1561 Ga0587077_001041
1562 Ga0587077_009175
1563 Ga0587077_024961
1564 Ga0587080_004865
1565 Ga0587080_026133
1566 Ga0587082_002352
1567 Ga0587082_065061
1568 Ga0587083_0000260
1569 Ga0587085_144850
1570 Ga0587086_033945
1571 Ga0587088_000741
1572 Ga0587088_006778
1573 Ga0587088_170751
1574 Ga0587089_008079
1575 Ga0587090_030499
1576 Ga0587091_091666
1577 Ga0587092_041567
1578 Ga0587092_057351
1579 Ga0587094_018487
1580 Ga0587094_024327
1581 Ga0587094_128531
1582 Ga0587106_029929
1583 Ga0587106_165957
1584 Ga0587125_000700
1585 Ga0587129_000468
1586 Ga0587099_000652
1587 Ga0587101_000448
1588 Ga0587101_004507
1589 Ga0587101_104843
1590 Ga0587109_036579
1591 Ga0587113_008179
1592 Ga0587115_001117
1593 Ga0587127_000506
1594 Ga0587128_001730
1595 Ga0587130_021759
1596 Ga0587130_052286
1597 Ga0587062_000400
1598 Ga0587062_012649
1599 Ga0587062_138679
1600 Ga0587067_002743
1601 Ga0587068_001309
1602 Ga0587068_024456
1603 Ga0587068_066467
1604 Ga0587068_071828
1605 Ga0587068_078370
1606 Ga0587069_010834
1607 Ga0587069_076465
1608 Ga0587072_001392
1609 Ga0587072_008796
1610 Ga0587076_002043
1611 Ga0587076_002122
1612 Ga0587079_003155
1613 Ga0587079_046494
1614 Ga0587100_000850
1615 Ga0587100_024483
1616 Ga0587102_000785
1617 Ga0587104_004540
1618 Ga0587105_000221
1619 Ga0587107_000989
1620 Ga0587108_008141
1621 Ga0587114_002480
1622 Ga0587118_00289
1623 Ga0587119_021596
1624 Ga0587124_001207
1625 Ga0587096_00044
1626 Ga0587071_026067
1627 Ga0587111_0000186
1628 Ga0587111_0000227
1629 Ga0466962_0000718
1630 Ga0466962_0014522
1631 2643746689
1632 2643937419
1633 2644218755
1634 2644256842
1635 2644314957
1636 2644338008
1637 2739057970
1638 2831867512

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

6

36

0.86

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

38

112

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9453 1 103
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9355 1 103
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9145 3 103
8cgk-assembly1.cif.gz_t lincomycin and avilamycin bound to the 50s subunit 0.9107 3 103
7ug7-assembly1.cif.gz_LX 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.9067 3 103
ID Description Score Start End Superfamily
af_A0A0R0FMT8_1_78_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8997 4 71 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8571 4 101 2.30.30.30
af_O13936_718_779_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8481 7 73 2.30.30.30
af_P91353_98_211_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.835 4 101 2.30.30.30
af_Q96GW9_159_278_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.835 82 104 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7W4EBZ3-F1-model_v4 Large ribosomal subunit protein uL24 0.8931 1 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-J4D717-F1-model_v4 Large ribosomal subunit protein uL24c 0.8907 3 105 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7S1JQ18-F1-model_v4 KOW domain-containing protein 0.8888 3 103 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A7AUS1-F1-model_v4 Large ribosomal subunit protein uL24c 0.8883 3 105 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-H2YKH4-F1-model_v4 Large ribosomal subunit protein uL24m (39S ribosomal protein L24, mitochondrial) 0.8852 4 105 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map