F458908

General Info

Members Datasets Scaffolds Average Seq Length
522 321 1044 140

Family's Representative Sequence

Representative Sequence 3300049668|Ga0501233_018555|Ga0501233_018555_731_1216
Length 161
Sequence LNPAAVRPASDRDNAVMKYLHTMVRVHDLDASLKFYRDALGLQEVKRSEHEAGRFTLVYLAAPGDEDAQVELTYNWPDADGNAETYTGGRNFGHLAYAVDDIYAACQKLMDHGVTINRPPRDGRMAFVRSPDGISIELLQAGAALAPARLSAQMFSAQPSA

Samples

Sample ID Description Type Environment
1 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
74 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
75 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
214 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
215 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
224 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
227 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
228 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
229 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
230 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
231 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
232 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
233 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
234 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
272 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
273 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
277 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
280 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
283 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
284 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
285 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
286 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
287 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
288 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
289 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
290 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
301 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
304 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
315 2643221585 Pelomonas sp. Root662 Isolate Unclassified
316 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
317 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
318 2643221656 Pelomonas sp. Root405 Isolate Unclassified
319 2831864461 Roseateles noduli HZ7 Isolate Nodule
320 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
321 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.4
Metatranscriptomes 3.07
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 0.19
Rhizoplane 1.34
Rhizosphere 86.78
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501233_018555 3300049668 Bacteria 1464
2 JGI24736J21556_1000860 3300001904 Bacteria 5586
3 JGI24740J21852_10049174 3300001979 Bacteria 1220
4 JGI24737J22298_10168430 3300001990 Bacteria 646
5 JGI25161J50226_1011069 3300003374 Bacteria 1157
6 Ga0055526_1001185 3300003771 Bacteria 18872
7 Ga0055524_1003848 3300003775 Bacteria 7126
8 Ga0055528_1030409 3300003790 Bacteria 1433
9 Ga0055531_10004199 3300003794 Bacteria 8886
10 Ga0065165_1000063 3300005262 Bacteria 176477
11 Ga0065165_1002456 3300005262 Bacteria 15665
12 Ga0065712_10008678 3300005290 Bacteria 2456
13 Ga0065715_10252866 3300005293 Bacteria 1135
14 Ga0065707_10082419 3300005295 Bacteria 15400
15 Ga0070670_100204467 3300005331 Bacteria 1716
16 Ga0070670_100293501 3300005331 Bacteria 1421
17 Ga0070666_10078769 3300005335 Bacteria 2250
18 Ga0070666_10356724 3300005335 Bacteria 1047
19 Ga0068868_100394449 3300005338 Bacteria 1193
20 Ga0068868_100569706 3300005338 Bacteria 1000
21 Ga0070689_100371826 3300005340 Bacteria 1203
22 Ga0070691_10407203 3300005341 Bacteria 768
23 Ga0070687_100522780 3300005343 Bacteria 803
24 Ga0070661_100075594 3300005344 Bacteria 2482
25 Ga0070661_101124329 3300005344 Bacteria 655
26 Ga0070668_100013502 3300005347 Bacteria 6097
27 Ga0070669_100672013 3300005353 Bacteria 873
28 Ga0070671_100052008 3300005355 Bacteria 3407
29 Ga0070671_100139910 3300005355 Bacteria 2042
30 Ga0070659_100004654 3300005366 Bacteria 9801
31 Ga0070659_100006211 3300005366 Bacteria 8630
32 Ga0070659_100980934 3300005366 Bacteria 741
33 Ga0070667_100000008 3300005367 Bacteria 285591
34 Ga0070667_100056644 3300005367 Bacteria 3312
35 Ga0070667_101632790 3300005367 Bacteria 606
36 Ga0070709_10703186 3300005434 Bacteria 786
37 Ga0070709_10775765 3300005434 Bacteria 751
38 Ga0070714_100055790 3300005435 Bacteria 3378
39 Ga0070714_100056838 3300005435 Bacteria 3347
40 Ga0070714_100133931 3300005435 Bacteria 2217
41 Ga0070714_100609834 3300005435 Bacteria 1048
42 Ga0070714_100681883 3300005435 Bacteria 991
43 Ga0070714_101757649 3300005435 Bacteria 606
44 Ga0070713_100001557 3300005436 Bacteria 14670
45 Ga0070713_100127430 3300005436 Bacteria 2241
46 Ga0070713_101944612 3300005436 Bacteria 570
47 Ga0070710_10192770 3300005437 Bacteria 1282
48 Ga0070711_100223807 3300005439 Bacteria 1464
49 Ga0070711_100526691 3300005439 Bacteria 977
50 Ga0070711_100656956 3300005439 Bacteria 879
51 Ga0070705_101036752 3300005440 Bacteria 668
52 Ga0070708_100922786 3300005445 Bacteria 820
53 Ga0070663_100005111 3300005455 Bacteria 7764
54 Ga0070663_100992439 3300005455 Bacteria 730
55 Ga0070681_10509324 3300005458 Bacteria 1117
56 Ga0070681_10745588 3300005458 Bacteria 896
57 Ga0070681_11106763 3300005458 Bacteria 713
58 Ga0068867_100125563 3300005459 Bacteria 1988
59 Ga0070706_100869164 3300005467 Bacteria 833
60 Ga0070707_100209579 3300005468 Bacteria 1900
61 Ga0070698_101310161 3300005471 Bacteria 674
62 Ga0070699_100657813 3300005518 Bacteria 957
63 Ga0070679_100414930 3300005530 Bacteria 1292
64 Ga0070684_100114311 3300005535 Bacteria 2423
65 Ga0070684_101567553 3300005535 Bacteria 621
66 Ga0068853_100063845 3300005539 Bacteria 3191
67 Ga0068853_100367158 3300005539 Bacteria 1342
68 Ga0070695_101524656 3300005545 Bacteria 557
69 Ga0070693_100012117 3300005547 Bacteria 4357
70 Ga0070665_100190249 3300005548 Bacteria 2053
71 Ga0070665_100362211 3300005548 Bacteria 1456
72 Ga0068855_100561661 3300005563 Bacteria 1234
73 Ga0068857_101541144 3300005577 Bacteria 648
74 Ga0068856_100012085 3300005614 Bacteria 8362
75 Ga0068856_100168386 3300005614 Bacteria 2202
76 Ga0068856_100509109 3300005614 Bacteria 1225
77 Ga0068856_101054112 3300005614 Bacteria 831
78 Ga0068856_101303241 3300005614 Bacteria 742
79 Ga0068852_100495142 3300005616 Bacteria 1216
80 Ga0068852_100504586 3300005616 Bacteria 1205
81 Ga0068859_100000177 3300005617 Bacteria 62179
82 Ga0068859_100037956 3300005617 Bacteria 4834
83 Ga0068864_100083146 3300005618 Bacteria 2811
84 Ga0068864_100400473 3300005618 Bacteria 1304
85 Ga0068864_101025831 3300005618 Bacteria 819
86 Ga0068851_10396234 3300005834 Bacteria 811
87 Ga0068863_100023326 3300005841 Bacteria 5911
88 Ga0068863_100110799 3300005841 Bacteria 2614
89 Ga0068858_100686264 3300005842 Bacteria 996
90 Ga0068860_100916551 3300005843 Bacteria 893
91 Ga0070717_10039629 3300006028 Bacteria 3834
92 Ga0070717_10104852 3300006028 Bacteria 2405
93 Ga0070712_100075299 3300006175 Bacteria 2427
94 Ga0070712_100268946 3300006175 Bacteria 1368
95 Ga0075366_10002574 3300006195 Bacteria 9323
96 Ga0075370_10012143 3300006353 Bacteria 4545
97 Ga0075370_10077867 3300006353 Bacteria 1903
98 Ga0075370_10275318 3300006353 Bacteria 999
99 Ga0075434_101409800 3300006871 Bacteria 707
100 Ga0097620_100000177 3300006931 Bacteria 62179
101 Ga0097620_100037955 3300006931 Bacteria 4834
102 Ga0099795_10022063 3300007788 Bacteria 2097
103 Ga0105250_10065446 3300009092 Bacteria 1465
104 Ga0105240_10083460 3300009093 Bacteria 3920
105 Ga0105240_10167034 3300009093 Bacteria 2609
106 Ga0105240_10199702 3300009093 Bacteria 2344
107 Ga0105245_12442460 3300009098 Bacteria 576
108 Ga0105245_12567765 3300009098 Bacteria 563
109 Ga0105243_10229957 3300009148 Bacteria 1645
110 Ga0105243_11109158 3300009148 Bacteria 800
111 Ga0105241_10287025 3300009174 Bacteria 1407
112 Ga0105241_10340781 3300009174 Bacteria 1299
113 Ga0105241_10366969 3300009174 Bacteria 1254
114 Ga0105242_11171468 3300009176 Bacteria 786
115 Ga0105248_10020874 3300009177 Bacteria 7259
116 Ga0105248_10083049 3300009177 Bacteria 3604
117 Ga0105238_10396767 3300009551 Bacteria 1372
118 Ga0105238_11044999 3300009551 Bacteria 838
119 Ga0105238_11677705 3300009551 Bacteria 666
120 Ga0105249_11253315 3300009553 Bacteria 813
121 Ga0105249_12906128 3300009553 Bacteria 550
122 Ga0105239_10762946 3300010375 Bacteria 1107
123 Ga0105239_11527832 3300010375 Bacteria 772
124 Ga0157335_1022398 3300012492 Bacteria 610
125 Ga0157319_1000007 3300012497 Bacteria 318528
126 Ga0157314_1019325 3300012500 Bacteria 680
127 Ga0157373_10024739 3300013100 Bacteria 4348
128 Ga0157373_11057696 3300013100 Bacteria 607
129 Ga0157371_10157227 3300013102 Bacteria 1623
130 Ga0157369_10060077 3300013105 Bacteria 4099
131 Ga0157369_11145497 3300013105 Bacteria 794
132 Ga0157374_10174214 3300013296 Bacteria 2100
133 Ga0157374_10243932 3300013296 Bacteria 1767
134 Ga0157378_10096338 3300013297 Bacteria 2696
135 Ga0163162_10010178 3300013306 Bacteria 9134
136 Ga0163162_10362968 3300013306 Bacteria 1581
137 Ga0163162_10435845 3300013306 Bacteria 1443
138 Ga0157372_10112642 3300013307 Bacteria 3117
139 Ga0157372_11210203 3300013307 Bacteria 873
140 Ga0157375_10806087 3300013308 Bacteria 1087
141 Ga0163163_10004496 3300014325 Bacteria 11902
142 Ga0163163_10028471 3300014325 Bacteria 5365
143 Ga0163163_10070271 3300014325 Bacteria 3487
144 Ga0163163_10169286 3300014325 Bacteria 2231
145 Ga0163163_11561505 3300014325 Bacteria 721
146 Ga0157380_11154547 3300014326 Bacteria 816
147 Ga0182008_10434375 3300014497 Bacteria 711
148 Ga0157379_10005702 3300014968 Bacteria 10705
149 Ga0157379_10151218 3300014968 Bacteria 2094
150 Ga0157379_10623589 3300014968 Bacteria 1008
151 Ga0157379_10880816 3300014968 Bacteria 848
152 Ga0157376_10377862 3300014969 Bacteria 1364
153 Ga0157376_10848840 3300014969 Bacteria 928
154 Ga0182007_10081771 3300015262 Bacteria 1060
155 Ga0182007_10113674 3300015262 Bacteria 902
156 Ga0163161_11915364 3300017792 Bacteria 527
157 Ga0184603_130683 3300019192 Bacteria 551
158 Ga0206349_1941945 3300020075 Bacteria 725
159 Ga0206354_10273891 3300020081 Bacteria 620
160 Ga0206353_11421307 3300020082 Bacteria 753
161 Ga0213873_10208039 3300021358 Bacteria 609
162 Ga0213873_10230109 3300021358 Bacteria 583
163 Ga0213872_10007591 3300021361 Bacteria 5317
164 Ga0213872_10012011 3300021361 Bacteria 4086
165 Ga0213872_10045345 3300021361 Bacteria 2000
166 Ga0213872_10187060 3300021361 Bacteria 892
167 Ga0213875_10005651 3300021388 Bacteria 6672
168 Ga0224712_10317418 3300022467 Bacteria 731
169 Ga0228598_1019354 3300024227 Bacteria 1342
170 Ga0209673_1026581 3300025273 Bacteria 1897
171 Ga0209564_1000131 3300025295 Bacteria 192177
172 Ga0209256_1002972 3300025299 Bacteria 12671
173 Ga0209257_1002881 3300025304 Bacteria 15989
174 Ga0207656_10115821 3300025321 Bacteria 1243
175 Ga0207680_10079145 3300025903 Bacteria 2061
176 Ga0207680_10193730 3300025903 Bacteria 1381
177 Ga0207680_10553037 3300025903 Bacteria 822
178 Ga0207647_10005204 3300025904 Bacteria 9570
179 Ga0207647_10305842 3300025904 Bacteria 905
180 Ga0207699_10060518 3300025906 Bacteria 2274
181 Ga0207699_11300484 3300025906 Bacteria 538
182 Ga0207705_10000030 3300025909 Bacteria 239341
183 Ga0207684_10655028 3300025910 Bacteria 895
184 Ga0207684_11279340 3300025910 Bacteria 605
185 Ga0207654_10422901 3300025911 Bacteria 930
186 Ga0207654_10629702 3300025911 Bacteria 767
187 Ga0207707_10593034 3300025912 Bacteria 938
188 Ga0207695_10045960 3300025913 Bacteria 4630
189 Ga0207695_10159247 3300025913 Bacteria 2190
190 Ga0207671_11356506 3300025914 Bacteria 552
191 Ga0207693_10040434 3300025915 Bacteria 3673
192 Ga0207693_10136844 3300025915 Bacteria 1926
193 Ga0207693_10467966 3300025915 Bacteria 985
194 Ga0207663_10055699 3300025916 Bacteria 2483
195 Ga0207649_10008081 3300025920 Bacteria 5726
196 Ga0207652_10615707 3300025921 Bacteria 973
197 Ga0207646_10209942 3300025922 Bacteria 1758
198 Ga0207681_11777966 3300025923 Bacteria 514
199 Ga0207694_10250240 3300025924 Bacteria 1450
200 Ga0207694_10924777 3300025924 Bacteria 738
201 Ga0207694_11702793 3300025924 Bacteria 531
202 Ga0207650_10274799 3300025925 Bacteria 1370
203 Ga0207659_10101435 3300025926 Bacteria 2170
204 Ga0207687_10819136 3300025927 Bacteria 794
205 Ga0207700_10072202 3300025928 Bacteria 2660
206 Ga0207700_10073433 3300025928 Bacteria 2641
207 Ga0207700_10338778 3300025928 Bacteria 1307
208 Ga0207700_10853679 3300025928 Bacteria 815
209 Ga0207664_10063943 3300025929 Bacteria 2942
210 Ga0207664_10257177 3300025929 Bacteria 1526
211 Ga0207664_10735390 3300025929 Bacteria 887
212 Ga0207664_11563928 3300025929 Bacteria 581
213 Ga0207644_10032105 3300025931 Bacteria 3661
214 Ga0207644_10123840 3300025931 Bacteria 1971
215 Ga0207690_10007422 3300025932 Bacteria 6509
216 Ga0207690_10012238 3300025932 Bacteria 5133
217 Ga0207690_10826241 3300025932 Bacteria 766
218 Ga0207706_10048718 3300025933 Bacteria 3747
219 Ga0207709_10143816 3300025935 Bacteria 1643
220 Ga0207670_10739624 3300025936 Bacteria 816
221 Ga0207704_10415842 3300025938 Bacteria 1065
222 Ga0207665_10247412 3300025939 Bacteria 1316
223 Ga0207711_10083045 3300025941 Bacteria 2801
224 Ga0207711_10105863 3300025941 Bacteria 2495
225 Ga0207689_10195058 3300025942 Bacteria 1671
226 Ga0207661_10731164 3300025944 Bacteria 911
227 Ga0207679_12059063 3300025945 Bacteria 519
228 Ga0207667_10032089 3300025949 Bacteria 5662
229 Ga0207667_10150412 3300025949 Bacteria 2396
230 Ga0207667_11294569 3300025949 Bacteria 705
231 Ga0207667_11550992 3300025949 Bacteria 632
232 Ga0207712_10615875 3300025961 Bacteria 940
233 Ga0207668_10004311 3300025972 Bacteria 8351
234 Ga0207668_11970966 3300025972 Bacteria 526
235 Ga0207640_10001528 3300025981 Bacteria 12472
236 Ga0207640_10008226 3300025981 Bacteria 5783
237 Ga0207658_10000030 3300025986 Bacteria 168693
238 Ga0207658_10019457 3300025986 Bacteria 4696
239 Ga0207658_12092884 3300025986 Bacteria 514
240 Ga0207677_10929442 3300026023 Bacteria 785
241 Ga0207703_10066123 3300026035 Bacteria 2973
242 Ga0207703_10640488 3300026035 Bacteria 1008
243 Ga0207678_10009642 3300026067 Bacteria 8492
244 Ga0207678_10984688 3300026067 Bacteria 746
245 Ga0207678_11224603 3300026067 Bacteria 665
246 Ga0207702_10060585 3300026078 Bacteria 3226
247 Ga0207702_10191276 3300026078 Bacteria 1891
248 Ga0207702_10707051 3300026078 Bacteria 993
249 Ga0207702_10841238 3300026078 Bacteria 908
250 Ga0207702_10954933 3300026078 Bacteria 850
251 Ga0207702_11108627 3300026078 Bacteria 785
252 Ga0207702_11512521 3300026078 Bacteria 665
253 Ga0207641_10012862 3300026088 Bacteria 6864
254 Ga0207641_10160546 3300026088 Bacteria 2043
255 Ga0207641_10879893 3300026088 Bacteria 889
256 Ga0207641_11361034 3300026088 Bacteria 711
257 Ga0207648_10606244 3300026089 Bacteria 1009
258 Ga0207648_10781078 3300026089 Bacteria 888
259 Ga0207676_10015998 3300026095 Bacteria 5428
260 Ga0207676_10132189 3300026095 Bacteria 2124
261 Ga0207676_11620170 3300026095 Bacteria 645
262 Ga0207674_10079366 3300026116 Bacteria 3286
263 Ga0207683_10991415 3300026121 Bacteria 780
264 Ga0207698_10144724 3300026142 Bacteria 2054
265 Ga0207698_10380324 3300026142 Bacteria 1343
266 Ga0207698_10432261 3300026142 Bacteria 1266
267 Ga0209371_1028025 3300027312 Bacteria 1260
268 Ga0209974_10041851 3300027876 Bacteria 1526
269 Ga0268266_10298091 3300028379 Bacteria 1503
270 Ga0268266_12111016 3300028379 Bacteria 536
271 Ga0268264_10131400 3300028381 Bacteria 2220
272 Ga0265337_1035174 3300028556 Bacteria 1469
273 Ga0265323_10054814 3300028653 Bacteria 1404
274 Ga0307517_10005993 3300028786 Bacteria 18131
275 Ga0307515_10046798 3300028794 Bacteria 6600
276 Ga0265338_10009216 3300028800 Bacteria 11817
277 Ga0268256_1031923 3300030500 Bacteria 1260
278 Ga0265762_1044330 3300030760 Unclassified 878
279 Ga0265760_10207522 3300031090 Bacteria 664
280 Ga0265320_10080525 3300031240 Bacteria 1521
281 Ga0265340_10005216 3300031247 Bacteria 7215
282 Ga0265340_10071985 3300031247 Bacteria 1637
283 Ga0265339_10145335 3300031249 Bacteria 1203
284 Ga0265339_10237496 3300031249 Bacteria 886
285 Ga0265316_10021225 3300031344 Bacteria 5508
286 Ga0265316_10131669 3300031344 Bacteria 1883
287 Ga0307513_10000615 3300031456 Bacteria 50932
288 Ga0307513_10024061 3300031456 Bacteria 7093
289 Ga0307509_10426252 3300031507 Bacteria 1026
290 Ga0307408_100081368 3300031548 Bacteria 2421
291 Ga0307408_100275246 3300031548 Bacteria 1399
292 Ga0307408_100360379 3300031548 Bacteria 1237
293 Ga0307408_101050059 3300031548 Bacteria 753
294 Ga0307408_101289072 3300031548 Bacteria 684
295 Ga0265313_10229749 3300031595 Bacteria 762
296 Ga0265313_10297853 3300031595 Bacteria 648
297 Ga0307508_10246402 3300031616 Bacteria 1384
298 Ga0265314_10216049 3300031711 Bacteria 1122
299 Ga0307516_10056716 3300031730 Bacteria 3818
300 Ga0307405_10011538 3300031731 Bacteria 4639
301 Ga0307405_10037553 3300031731 Bacteria 2912
302 Ga0307405_10153293 3300031731 Bacteria 1623
303 Ga0307405_10768144 3300031731 Bacteria 804
304 Ga0307413_10048394 3300031824 Bacteria 2541
305 Ga0307413_10152461 3300031824 Bacteria 1612
306 Ga0307410_10286731 3300031852 Bacteria 1294
307 Ga0307410_10702301 3300031852 Bacteria 853
308 Ga0307406_10203512 3300031901 Bacteria 1459
309 Ga0307406_10623383 3300031901 Bacteria 892
310 Ga0307406_10817626 3300031901 Bacteria 787
311 Ga0307407_10017849 3300031903 Bacteria 3573
312 Ga0307412_10013806 3300031911 Bacteria 4747
313 Ga0307412_10939465 3300031911 Bacteria 760
314 Ga0307409_100034486 3300031995 Bacteria 3696
315 Ga0307409_100165264 3300031995 Bacteria 1941
316 Ga0307414_10044563 3300032004 Bacteria 3031
317 Ga0307414_10050064 3300032004 Bacteria 2892
318 Ga0307414_10334452 3300032004 Bacteria 1294
319 Ga0307414_10542451 3300032004 Bacteria 1035
320 Ga0307411_10000072 3300032005 Bacteria 30806
321 Ga0307411_10004634 3300032005 Bacteria 6622
322 Ga0307411_10218389 3300032005 Bacteria 1477
323 Ga0307411_10341327 3300032005 Bacteria 1217
324 Ga0307415_100006114 3300032126 Bacteria 6458
325 Ga0307415_100142372 3300032126 Bacteria 1833
326 Ga0307415_100907966 3300032126 Bacteria 812
327 Ga0307415_100923018 3300032126 Bacteria 806
328 Ga0307415_101526251 3300032126 Bacteria 640
329 Ga0307415_101930857 3300032126 Bacteria 574
330 Ga0307510_10000004 3300033180 Bacteria 654130
331 Ga0307510_10126242 3300033180 Bacteria 2247
332 Ga0373926_0033342 3300035083 Bacteria 1820
333 Ga0373934_0039391 3300035086 Bacteria 1863
334 Ga0373944_0074295 3300035089 Bacteria 1113
335 Ga0373944_0263899 3300035089 Bacteria 639
336 Ga0373936_0105205 3300035113 Bacteria 1194
337 Ga0373936_0176397 3300035113 Bacteria 936
338 Ga0373953_0022701 3300035117 Bacteria 2369
339 Ga0373957_0150711 3300035120 Bacteria 954
340 Ga0373955_0408700 3300035172 Bacteria 825
341 Ga0373955_0890641 3300035172 Bacteria 547
342 Ga0316574_0517155 3300035398 Bacteria 743
343 Ga0373924_0027078 3300035410 Bacteria 2278
344 Ga0373935_0154389 3300035692 Bacteria 1560
345 Ga0373935_0242753 3300035692 Bacteria 1258
346 Ga0373935_0465043 3300035692 Bacteria 915
347 Ga0373927_0154101 3300035695 Bacteria 1505
348 Ga0373927_0320417 3300035695 Bacteria 1021
349 Ga0373933_0021038 3300035724 Bacteria 3701
350 Ga0373933_0029763 3300035724 Bacteria 3159
351 Ga0373933_0150307 3300035724 Bacteria 1474
352 Ga0373933_0187951 3300035724 Bacteria 1319
353 Ga0373947_0010122 3300035725 Bacteria 5414
354 Ga0373937_0006596 3300036401 Bacteria 10023
355 Ga0373937_0006613 3300036401 Bacteria 10009
356 Ga0373937_0063607 3300036401 Bacteria 3394
357 Ga0265778_064727 3300036457 Bacteria 514
358 Ga0373925_0013214 3300037068 Bacteria 5976
359 Ga0373925_0404664 3300037068 Bacteria 1113
360 Ga0373925_0525477 3300037068 Bacteria 972
361 Ga0373925_1589890 3300037068 Bacteria 534
362 Ga0395899_0036397 3300037312 Bacteria 3692
363 Ga0395900_0615303 3300037418 Bacteria 1025
364 Ga0395900_0621295 3300037418 Bacteria 1019
365 Ga0395898_0073437 3300037466 Bacteria 3304
366 Ga0395898_0175957 3300037466 Bacteria 2045
367 Ga0395898_0385481 3300037466 Bacteria 1336
368 Ga0436364_0246265 3300037853 Bacteria 23283
369 Ga0436364_0394640 3300037853 Bacteria 945
370 Ga0395901_0492847 3300038443 Bacteria 1248
371 Ga0400483_252559 3300039062 Bacteria 1385
372 Ga0436365_0830076 3300039437 Bacteria 1017
373 Ga0436365_1738277 3300039437 Bacteria 645
374 Ga0436360_0669006 3300039438 Bacteria 959
375 Ga0436360_0883074 3300039438 Bacteria 732
376 Ga0436361_0015986 3300039447 Bacteria 604
377 Ga0436361_0203436 3300039447 Bacteria 725
378 Ga0436361_0423113 3300039447 Bacteria 932
379 Ga0436361_0437781 3300039447 Bacteria 768
380 Ga0436361_0480497 3300039447 Bacteria 1304
381 Ga0436361_0671832 3300039447 Bacteria 2537
382 Ga0436361_0778354 3300039447 Bacteria 2304
383 Ga0436363_0830703 3300039450 Bacteria 882
384 Ga0436363_1424342 3300039450 Bacteria 843
385 Ga0436362_0637889 3300039453 Bacteria 2260
386 Ga0436362_0724338 3300039453 Bacteria 741
387 Ga0436362_1105782 3300039453 Bacteria 880
388 Ga0439461_0206047 3300041410 Bacteria 531
389 Ga0451789_0666951 3300041443 Bacteria 927
390 Ga0451791_0267567 3300041451 Bacteria 2010
391 Ga0451793_1238794 3300041452 Bacteria 1338
392 Ga0451797_0709771 3300041453 Bacteria 793
393 Ga0451807_0393714 3300041486 Bacteria 1286
394 Ga0451807_0821659 3300041486 Bacteria 681
395 Ga0451845_0096827 3300041501 Bacteria 537
396 Ga0451849_1208437 3300041505 Bacteria 629
397 Ga0451851_0571669 3300041507 Bacteria 981
398 Ga0451853_0172748 3300041512 Bacteria 959
399 Ga0439437_003540 3300042000 Bacteria 1685
400 Ga0439441_038886 3300042001 Bacteria 947
401 Ga0439432_078523 3300042006 Bacteria 1001
402 Ga0450917_000813 3300042120 Bacteria 2303
403 Ga0450888_000429 3300042126 Bacteria 3952
404 Ga0450890_001939 3300042127 Bacteria 2923
405 Ga0450891_003681 3300042129 Bacteria 1464
406 Ga0450892_001371 3300042130 Bacteria 2422
407 Ga0450902_004685 3300042137 Bacteria 2040
408 Ga0450889_007438 3300042144 Bacteria 1105
409 Ga0439459_0002258 3300042438 Bacteria 2954
410 Ga0450916_009505 3300042530 Bacteria 1203
411 Ga0450916_048304 3300042530 Bacteria 665
412 Ga0451577_0225944 3300042876 Bacteria 1692
413 Ga0453683_0641275 3300044673 Bacteria 694
414 Ga0466963_0016446 3300044694 Bacteria 4600
415 Ga0466963_0775810 3300044694 Bacteria 676
416 Ga0453684_0198529 3300044712 Bacteria 2340
417 Ga0453684_1932347 3300044712 Bacteria 596
418 Ga0451576_0167300 3300045051 Bacteria 2294
419 Ga0451576_0316374 3300045051 Bacteria 1633
420 Ga0466967_0642462 3300045976 Bacteria 1049
421 Ga0495592_0016058 3300046454 Bacteria 5683
422 Ga0495651_0028736 3300046462 Bacteria 4333
423 Ga0495651_0030127 3300046462 Bacteria 4231
424 Ga0495653_0888380 3300046463 Bacteria 531
425 Ga0495580_0611338 3300046472 Bacteria 720
426 Ga0495639_0145923 3300046475 Bacteria 1140
427 Ga0495664_0009281 3300046477 Bacteria 5502
428 Ga0495608_0010111 3300046511 Bacteria 6582
429 Ga0495608_0033073 3300046511 Bacteria 3497
430 Ga0495618_0064764 3300046514 Bacteria 2323
431 Ga0495618_0404234 3300046514 Bacteria 835
432 Ga0495652_0222373 3300046529 Bacteria 1418
433 Ga0495587_0112258 3300046536 Bacteria 1565
434 Ga0495587_0300585 3300046536 Bacteria 898
435 Ga0495621_0079144 3300046539 Bacteria 1223
436 Ga0495645_0003413 3300046543 Bacteria 10767
437 Ga0495667_0007715 3300046559 Bacteria 7293
438 Ga0495667_0010635 3300046559 Bacteria 6221
439 Ga0495667_0180820 3300046559 Bacteria 1353
440 Ga0495625_0253980 3300046660 Bacteria 1140
441 Ga0495635_0091822 3300046663 Bacteria 2076
442 Ga0495659_0012990 3300046664 Bacteria 2707
443 Ga0495657_0256964 3300046675 Bacteria 1050
444 Ga0495599_0033467 3300046678 Bacteria 3230
445 Ga0495599_0049303 3300046678 Bacteria 2639
446 Ga0495623_0520130 3300046679 Bacteria 626
447 Ga0495669_0000001 3300046684 Bacteria 291866
448 Ga0495669_0035748 3300046684 Bacteria 2194
449 Ga0495600_0036559 3300046809 Bacteria 3192
450 Ga0495674_0440368 3300047319 Bacteria 1048
451 Ga0495674_0589414 3300047319 Bacteria 882
452 Ga0495680_0054952 3300047322 Bacteria 3089
453 Ga0495675_0038840 3300047444 Bacteria 3031
454 Ga0495675_0185905 3300047444 Bacteria 1270
455 Ga0495684_0035226 3300047471 Bacteria 3839
456 Ga0495684_0077734 3300047471 Bacteria 2519
457 Ga0495602_0004890 3300048088 Bacteria 14033
458 Ga0495602_0195293 3300048088 Bacteria 1548
459 Ga0496100_0666041 3300048903 Bacteria 811
460 Ga0496119_0007175 3300048922 Bacteria 10098
461 Ga0496119_0010668 3300048922 Bacteria 7698
462 Ga0496120_0000987 3300048923 Bacteria 38632
463 Ga0496126_0202573 3300048929 Bacteria 1675
464 Ga0501294_006837 3300049517 Bacteria 1098
465 Ga0501297_049884 3300049520 Bacteria 613
466 Ga0501300_091105 3300049523 Bacteria 511
467 Ga0501034_0648821 3300049571 Bacteria 957
468 Ga0501072_0087595 3300049588 Bacteria 2471
469 Ga0501211_004208 3300049658 Bacteria 1471
470 Ga0501222_000607 3300049662 Bacteria 5255
471 Ga0501223_005469 3300049663 Bacteria 2668
472 Ga0501227_010999 3300049665 Bacteria 1968
473 Ga0501236_000625 3300049670 Bacteria 3916
474 Ga0501249_108065 3300049679 Bacteria 670
475 Ga0501252_097117 3300049682 Bacteria 506
476 Ga0501255_024293 3300049684 Bacteria 806
477 Ga0501258_037494 3300049687 Bacteria 636
478 Ga0501259_079592 3300049688 Bacteria 718
479 Ga0501221_002860 3300049704 Bacteria 2841
480 Ga0501229_003802 3300049706 Bacteria 1821
481 Ga0501267_000935 3300049764 Bacteria 2398
482 Ga0501268_014622 3300049765 Bacteria 1281
483 Ga0501272_051103 3300049769 Bacteria 574
484 nmdc:mga0k408_5459_c1 3300050493 Bacteria 6768
485 nmdc:mga07m45_333979_c1 3300050496 Bacteria 881
486 nmdc:mga07m45_34556_c1 3300050496 Bacteria 2810
487 nmdc:mga07m45_381617_c1 3300050496 Bacteria 818
488 nmdc:mga07m45_5097_c1 3300050496 Bacteria 6502
489 Ga0495601_0001246 3300053077 Bacteria 13964
490 Ga0495601_0272674 3300053077 Bacteria 1104
491 Ga0495601_0430208 3300053077 Bacteria 854
492 Ga0495612_0000981 3300053078 Bacteria 11737
493 Ga0495595_0014380 3300053084 Bacteria 3357
494 Ga0495595_0494364 3300053084 Bacteria 623
495 Ga0495619_0142128 3300053085 Bacteria 1653
496 Ga0495619_0445917 3300053085 Bacteria 892
497 Ga0500583_0297336 3300053092 Bacteria 790
498 Ga0500651_0037548 3300053093 Bacteria 3053
499 Ga0500594_0148164 3300053118 Bacteria 753
500 Ga0500614_004186 3300053123 Bacteria 3062
501 Ga0500652_113674 3300053131 Bacteria 1132
502 Ga0500559_0012208 3300053136 Bacteria 3655
503 Ga0500564_059392 3300053138 Bacteria 1737
504 Ga0500590_002400 3300053148 Bacteria 8285
505 Ga0500622_0003822 3300053156 Bacteria 9803
506 Ga0500637_0482945 3300053178 Bacteria 619
507 Ga0587088_079451 3300059508 Bacteria 699
508 Ga0587101_045957 3300059623 Bacteria 736
509 Ga0587115_110825 3300059626 Bacteria 519
510 Ga0587062_049521 3300059639 Bacteria 707
511 Ga0587062_091852 3300059639 Bacteria 579
512 Ga0587067_028588 3300059640 Bacteria 1014
513 Ga0587075_099613 3300059644 Bacteria 578
514 Ga0587071_201279 3300060344 Bacteria 521
515 2643743945 2643221544 Bacteria 5886209
516 2643933915 2643221585 Bacteria 5812563
517 2644002068 2643221598 Bacteria 4578346
518 2644256907 2643221646 Bacteria 6433402
519 2644315402 2643221656 Bacteria 5809961
520 2831870177 2831864461 Bacteria 6502356
521 2886850053 2886848708 Bacteria 5632523
522 2899807511 2899803654 Bacteria 5577784
523 Ga0501233_018555
524 JGI24736J21556_1000860
525 JGI24740J21852_10049174
526 JGI24737J22298_10168430
527 JGI25161J50226_1011069
528 Ga0055526_1001185
529 Ga0055524_1003848
530 Ga0055528_1030409
531 Ga0055531_10004199
532 Ga0065165_1000063
533 Ga0065165_1002456
534 Ga0065712_10008678
535 Ga0065715_10252866
536 Ga0065707_10082419
537 Ga0070670_100204467
538 Ga0070670_100293501
539 Ga0070666_10078769
540 Ga0070666_10356724
541 Ga0068868_100394449
542 Ga0068868_100569706
543 Ga0070689_100371826
544 Ga0070691_10407203
545 Ga0070687_100522780
546 Ga0070661_100075594
547 Ga0070661_101124329
548 Ga0070668_100013502
549 Ga0070669_100672013
550 Ga0070671_100052008
551 Ga0070671_100139910
552 Ga0070659_100004654
553 Ga0070659_100006211
554 Ga0070659_100980934
555 Ga0070667_100000008
556 Ga0070667_100056644
557 Ga0070667_101632790
558 Ga0070709_10703186
559 Ga0070709_10775765
560 Ga0070714_100055790
561 Ga0070714_100056838
562 Ga0070714_100133931
563 Ga0070714_100609834
564 Ga0070714_100681883
565 Ga0070714_101757649
566 Ga0070713_100001557
567 Ga0070713_100127430
568 Ga0070713_101944612
569 Ga0070710_10192770
570 Ga0070711_100223807
571 Ga0070711_100526691
572 Ga0070711_100656956
573 Ga0070705_101036752
574 Ga0070708_100922786
575 Ga0070663_100005111
576 Ga0070663_100992439
577 Ga0070681_10509324
578 Ga0070681_10745588
579 Ga0070681_11106763
580 Ga0068867_100125563
581 Ga0070706_100869164
582 Ga0070707_100209579
583 Ga0070698_101310161
584 Ga0070699_100657813
585 Ga0070679_100414930
586 Ga0070684_100114311
587 Ga0070684_101567553
588 Ga0068853_100063845
589 Ga0068853_100367158
590 Ga0070695_101524656
591 Ga0070693_100012117
592 Ga0070665_100190249
593 Ga0070665_100362211
594 Ga0068855_100561661
595 Ga0068857_101541144
596 Ga0068856_100012085
597 Ga0068856_100168386
598 Ga0068856_100509109
599 Ga0068856_101054112
600 Ga0068856_101303241
601 Ga0068852_100495142
602 Ga0068852_100504586
603 Ga0068859_100000177
604 Ga0068859_100037956
605 Ga0068864_100083146
606 Ga0068864_100400473
607 Ga0068864_101025831
608 Ga0068851_10396234
609 Ga0068863_100023326
610 Ga0068863_100110799
611 Ga0068858_100686264
612 Ga0068860_100916551
613 Ga0070717_10039629
614 Ga0070717_10104852
615 Ga0070712_100075299
616 Ga0070712_100268946
617 Ga0075366_10002574
618 Ga0075370_10012143
619 Ga0075370_10077867
620 Ga0075370_10275318
621 Ga0075434_101409800
622 Ga0097620_100000177
623 Ga0097620_100037955
624 Ga0099795_10022063
625 Ga0105250_10065446
626 Ga0105240_10083460
627 Ga0105240_10167034
628 Ga0105240_10199702
629 Ga0105245_12442460
630 Ga0105245_12567765
631 Ga0105243_10229957
632 Ga0105243_11109158
633 Ga0105241_10287025
634 Ga0105241_10340781
635 Ga0105241_10366969
636 Ga0105242_11171468
637 Ga0105248_10020874
638 Ga0105248_10083049
639 Ga0105238_10396767
640 Ga0105238_11044999
641 Ga0105238_11677705
642 Ga0105249_11253315
643 Ga0105249_12906128
644 Ga0105239_10762946
645 Ga0105239_11527832
646 Ga0157335_1022398
647 Ga0157319_1000007
648 Ga0157314_1019325
649 Ga0157373_10024739
650 Ga0157373_11057696
651 Ga0157371_10157227
652 Ga0157369_10060077
653 Ga0157369_11145497
654 Ga0157374_10174214
655 Ga0157374_10243932
656 Ga0157378_10096338
657 Ga0163162_10010178
658 Ga0163162_10362968
659 Ga0163162_10435845
660 Ga0157372_10112642
661 Ga0157372_11210203
662 Ga0157375_10806087
663 Ga0163163_10004496
664 Ga0163163_10028471
665 Ga0163163_10070271
666 Ga0163163_10169286
667 Ga0163163_11561505
668 Ga0157380_11154547
669 Ga0182008_10434375
670 Ga0157379_10005702
671 Ga0157379_10151218
672 Ga0157379_10623589
673 Ga0157379_10880816
674 Ga0157376_10377862
675 Ga0157376_10848840
676 Ga0182007_10081771
677 Ga0182007_10113674
678 Ga0163161_11915364
679 Ga0184603_130683
680 Ga0206349_1941945
681 Ga0206354_10273891
682 Ga0206353_11421307
683 Ga0213873_10208039
684 Ga0213873_10230109
685 Ga0213872_10007591
686 Ga0213872_10012011
687 Ga0213872_10045345
688 Ga0213872_10187060
689 Ga0213875_10005651
690 Ga0224712_10317418
691 Ga0228598_1019354
692 Ga0209673_1026581
693 Ga0209564_1000131
694 Ga0209256_1002972
695 Ga0209257_1002881
696 Ga0207656_10115821
697 Ga0207680_10079145
698 Ga0207680_10193730
699 Ga0207680_10553037
700 Ga0207647_10005204
701 Ga0207647_10305842
702 Ga0207699_10060518
703 Ga0207699_11300484
704 Ga0207705_10000030
705 Ga0207684_10655028
706 Ga0207684_11279340
707 Ga0207654_10422901
708 Ga0207654_10629702
709 Ga0207707_10593034
710 Ga0207695_10045960
711 Ga0207695_10159247
712 Ga0207671_11356506
713 Ga0207693_10040434
714 Ga0207693_10136844
715 Ga0207693_10467966
716 Ga0207663_10055699
717 Ga0207649_10008081
718 Ga0207652_10615707
719 Ga0207646_10209942
720 Ga0207681_11777966
721 Ga0207694_10250240
722 Ga0207694_10924777
723 Ga0207694_11702793
724 Ga0207650_10274799
725 Ga0207659_10101435
726 Ga0207687_10819136
727 Ga0207700_10072202
728 Ga0207700_10073433
729 Ga0207700_10338778
730 Ga0207700_10853679
731 Ga0207664_10063943
732 Ga0207664_10257177
733 Ga0207664_10735390
734 Ga0207664_11563928
735 Ga0207644_10032105
736 Ga0207644_10123840
737 Ga0207690_10007422
738 Ga0207690_10012238
739 Ga0207690_10826241
740 Ga0207706_10048718
741 Ga0207709_10143816
742 Ga0207670_10739624
743 Ga0207704_10415842
744 Ga0207665_10247412
745 Ga0207711_10083045
746 Ga0207711_10105863
747 Ga0207689_10195058
748 Ga0207661_10731164
749 Ga0207679_12059063
750 Ga0207667_10032089
751 Ga0207667_10150412
752 Ga0207667_11294569
753 Ga0207667_11550992
754 Ga0207712_10615875
755 Ga0207668_10004311
756 Ga0207668_11970966
757 Ga0207640_10001528
758 Ga0207640_10008226
759 Ga0207658_10000030
760 Ga0207658_10019457
761 Ga0207658_12092884
762 Ga0207677_10929442
763 Ga0207703_10066123
764 Ga0207703_10640488
765 Ga0207678_10009642
766 Ga0207678_10984688
767 Ga0207678_11224603
768 Ga0207702_10060585
769 Ga0207702_10191276
770 Ga0207702_10707051
771 Ga0207702_10841238
772 Ga0207702_10954933
773 Ga0207702_11108627
774 Ga0207702_11512521
775 Ga0207641_10012862
776 Ga0207641_10160546
777 Ga0207641_10879893
778 Ga0207641_11361034
779 Ga0207648_10606244
780 Ga0207648_10781078
781 Ga0207676_10015998
782 Ga0207676_10132189
783 Ga0207676_11620170
784 Ga0207674_10079366
785 Ga0207683_10991415
786 Ga0207698_10144724
787 Ga0207698_10380324
788 Ga0207698_10432261
789 Ga0209371_1028025
790 Ga0209974_10041851
791 Ga0268266_10298091
792 Ga0268266_12111016
793 Ga0268264_10131400
794 Ga0265337_1035174
795 Ga0265323_10054814
796 Ga0307517_10005993
797 Ga0307515_10046798
798 Ga0265338_10009216
799 Ga0268256_1031923
800 Ga0265762_1044330
801 Ga0265760_10207522
802 Ga0265320_10080525
803 Ga0265340_10005216
804 Ga0265340_10071985
805 Ga0265339_10145335
806 Ga0265339_10237496
807 Ga0265316_10021225
808 Ga0265316_10131669
809 Ga0307513_10000615
810 Ga0307513_10024061
811 Ga0307509_10426252
812 Ga0307408_100081368
813 Ga0307408_100275246
814 Ga0307408_100360379
815 Ga0307408_101050059
816 Ga0307408_101289072
817 Ga0265313_10229749
818 Ga0265313_10297853
819 Ga0307508_10246402
820 Ga0265314_10216049
821 Ga0307516_10056716
822 Ga0307405_10011538
823 Ga0307405_10037553
824 Ga0307405_10153293
825 Ga0307405_10768144
826 Ga0307413_10048394
827 Ga0307413_10152461
828 Ga0307410_10286731
829 Ga0307410_10702301
830 Ga0307406_10203512
831 Ga0307406_10623383
832 Ga0307406_10817626
833 Ga0307407_10017849
834 Ga0307412_10013806
835 Ga0307412_10939465
836 Ga0307409_100034486
837 Ga0307409_100165264
838 Ga0307414_10044563
839 Ga0307414_10050064
840 Ga0307414_10334452
841 Ga0307414_10542451
842 Ga0307411_10000072
843 Ga0307411_10004634
844 Ga0307411_10218389
845 Ga0307411_10341327
846 Ga0307415_100006114
847 Ga0307415_100142372
848 Ga0307415_100907966
849 Ga0307415_100923018
850 Ga0307415_101526251
851 Ga0307415_101930857
852 Ga0307510_10000004
853 Ga0307510_10126242
854 Ga0373926_0033342
855 Ga0373934_0039391
856 Ga0373944_0074295
857 Ga0373944_0263899
858 Ga0373936_0105205
859 Ga0373936_0176397
860 Ga0373953_0022701
861 Ga0373957_0150711
862 Ga0373955_0408700
863 Ga0373955_0890641
864 Ga0316574_0517155
865 Ga0373924_0027078
866 Ga0373935_0154389
867 Ga0373935_0242753
868 Ga0373935_0465043
869 Ga0373927_0154101
870 Ga0373927_0320417
871 Ga0373933_0021038
872 Ga0373933_0029763
873 Ga0373933_0150307
874 Ga0373933_0187951
875 Ga0373947_0010122
876 Ga0373937_0006596
877 Ga0373937_0006613
878 Ga0373937_0063607
879 Ga0265778_064727
880 Ga0373925_0013214
881 Ga0373925_0404664
882 Ga0373925_0525477
883 Ga0373925_1589890
884 Ga0395899_0036397
885 Ga0395900_0615303
886 Ga0395900_0621295
887 Ga0395898_0073437
888 Ga0395898_0175957
889 Ga0395898_0385481
890 Ga0436364_0246265
891 Ga0436364_0394640
892 Ga0395901_0492847
893 Ga0400483_252559
894 Ga0436365_0830076
895 Ga0436365_1738277
896 Ga0436360_0669006
897 Ga0436360_0883074
898 Ga0436361_0015986
899 Ga0436361_0203436
900 Ga0436361_0423113
901 Ga0436361_0437781
902 Ga0436361_0480497
903 Ga0436361_0671832
904 Ga0436361_0778354
905 Ga0436363_0830703
906 Ga0436363_1424342
907 Ga0436362_0637889
908 Ga0436362_0724338
909 Ga0436362_1105782
910 Ga0439461_0206047
911 Ga0451789_0666951
912 Ga0451791_0267567
913 Ga0451793_1238794
914 Ga0451797_0709771
915 Ga0451807_0393714
916 Ga0451807_0821659
917 Ga0451845_0096827
918 Ga0451849_1208437
919 Ga0451851_0571669
920 Ga0451853_0172748
921 Ga0439437_003540
922 Ga0439441_038886
923 Ga0439432_078523
924 Ga0450917_000813
925 Ga0450888_000429
926 Ga0450890_001939
927 Ga0450891_003681
928 Ga0450892_001371
929 Ga0450902_004685
930 Ga0450889_007438
931 Ga0439459_0002258
932 Ga0450916_009505
933 Ga0450916_048304
934 Ga0451577_0225944
935 Ga0453683_0641275
936 Ga0466963_0016446
937 Ga0466963_0775810
938 Ga0453684_0198529
939 Ga0453684_1932347
940 Ga0451576_0167300
941 Ga0451576_0316374
942 Ga0466967_0642462
943 Ga0495592_0016058
944 Ga0495651_0028736
945 Ga0495651_0030127
946 Ga0495653_0888380
947 Ga0495580_0611338
948 Ga0495639_0145923
949 Ga0495664_0009281
950 Ga0495608_0010111
951 Ga0495608_0033073
952 Ga0495618_0064764
953 Ga0495618_0404234
954 Ga0495652_0222373
955 Ga0495587_0112258
956 Ga0495587_0300585
957 Ga0495621_0079144
958 Ga0495645_0003413
959 Ga0495667_0007715
960 Ga0495667_0010635
961 Ga0495667_0180820
962 Ga0495625_0253980
963 Ga0495635_0091822
964 Ga0495659_0012990
965 Ga0495657_0256964
966 Ga0495599_0033467
967 Ga0495599_0049303
968 Ga0495623_0520130
969 Ga0495669_0000001
970 Ga0495669_0035748
971 Ga0495600_0036559
972 Ga0495674_0440368
973 Ga0495674_0589414
974 Ga0495680_0054952
975 Ga0495675_0038840
976 Ga0495675_0185905
977 Ga0495684_0035226
978 Ga0495684_0077734
979 Ga0495602_0004890
980 Ga0495602_0195293
981 Ga0496100_0666041
982 Ga0496119_0007175
983 Ga0496119_0010668
984 Ga0496120_0000987
985 Ga0496126_0202573
986 Ga0501294_006837
987 Ga0501297_049884
988 Ga0501300_091105
989 Ga0501034_0648821
990 Ga0501072_0087595
991 Ga0501211_004208
992 Ga0501222_000607
993 Ga0501223_005469
994 Ga0501227_010999
995 Ga0501236_000625
996 Ga0501249_108065
997 Ga0501252_097117
998 Ga0501255_024293
999 Ga0501258_037494
1000 Ga0501259_079592
1001 Ga0501221_002860
1002 Ga0501229_003802
1003 Ga0501267_000935
1004 Ga0501268_014622
1005 Ga0501272_051103
1006 nmdc:mga0k408_5459_c1
1007 nmdc:mga07m45_333979_c1
1008 nmdc:mga07m45_34556_c1
1009 nmdc:mga07m45_381617_c1
1010 nmdc:mga07m45_5097_c1
1011 Ga0495601_0001246
1012 Ga0495601_0272674
1013 Ga0495601_0430208
1014 Ga0495612_0000981
1015 Ga0495595_0014380
1016 Ga0495595_0494364
1017 Ga0495619_0142128
1018 Ga0495619_0445917
1019 Ga0500583_0297336
1020 Ga0500651_0037548
1021 Ga0500594_0148164
1022 Ga0500614_004186
1023 Ga0500652_113674
1024 Ga0500559_0012208
1025 Ga0500564_059392
1026 Ga0500590_002400
1027 Ga0500622_0003822
1028 Ga0500637_0482945
1029 Ga0587088_079451
1030 Ga0587101_045957
1031 Ga0587115_110825
1032 Ga0587062_049521
1033 Ga0587062_091852
1034 Ga0587067_028588
1035 Ga0587075_099613
1036 Ga0587071_201279
1037 2643743945
1038 2643933915
1039 2644002068
1040 2644256907
1041 2644315402
1042 2831870177
1043 2886850053
1044 2899807511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

138

0.91

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

126

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8777 1 119
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.8772 1 118
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8706 1 119
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8642 1 120
4mts-assembly1.cif.gz_B ni- and zn-bound gloa2 at high resolution 0.859 1 119
ID Description Score Start End Superfamily
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8777 1 119 3.10.180.10
2c21D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8724 1 118 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8706 1 119 3.10.180.10
af_Q8IIM5_3_169_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8604 1 119 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8598 1 56 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.9921 80 137 GO:0016829
AF-A0A3C7W1R9-F1-model_v4 Lactoylglutathione lyase 0.9796 86 137 GO:0016829
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.9754 80 137 GO:0016829
AF-A0A3B8WFH9-F1-model_v4 Lactoylglutathione lyase 0.9664 83 137 GO:0016829
AF-A0A5Q4DWQ1-F1-model_v4 Lactoylglutathione lyase 0.9623 69 137 GO:0016829

Map