F497386

General Info

Members Datasets Scaffolds Average Seq Length
3833 1674 2802 369

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100053467|Ga0070674_1000534672
Length 445
Sequence VRASSANKKPAGKILAGHTCPRPFSYLFYVASKPAGSNDHEIDVVIRSDCLPVKAPKGYLVSASSWGAAEGRVSKDGRLQSVSMTTKGILPDYMIAELAKSGGIRPARDFASDQIQPASLDLRLGKVAYRVRASFLPGPQTTVAERIAELRLHEIALTDGAVLETNCVYIVPLLESLALPADVAAAANPKSSTGRIDVFTRVIADRTRGFDRINAGYQGPLYAEISPKTFPVLVREGSRLSQIRFRRGHAILDGAALRALHDKERLTDDVKADLADGIAVGVDLAGLGPNNFVGYRAKRHTGLIDVEKRDGHTVADFWEPIAARADKSLILDPDEFYILASKEAVQVPPDYAAEMVPFDPLVGEFRVHYAGFFDPGFGYEGAGGRGARAVLEVRSREVPFILEHGQIVGRLVYEKMIARPTTLYGMGIGSNYQAQGLKLSKHFRV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
4 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
5 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
6 2508501050 Microvirga lupini Lut6 Isolate Nodule
7 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
8 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
9 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
10 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
11 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
12 2509276019 Ensifer aridi TW10 Isolate Nodule
13 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
14 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
15 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
16 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
17 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
18 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
19 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
20 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
21 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
22 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
23 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
24 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
25 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
26 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
27 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
28 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
29 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
30 2512875024 Mesorhizobium loti R88b Isolate Nodule
31 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
32 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
33 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
34 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
35 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
36 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
37 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
38 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
39 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
40 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
41 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
42 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
43 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
44 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
45 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
46 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
47 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
48 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
49 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
50 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
51 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
52 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
53 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
54 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
55 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
56 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
57 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
58 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
59 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
60 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
61 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
62 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
63 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
64 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
65 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
66 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
67 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
68 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
69 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
70 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
71 2516143018 Ensifer sp. BR816 Isolate Nodule
72 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
73 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
74 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
75 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
76 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
77 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
78 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
79 2519899620 Rhizobium sp. Pop5 Isolate Nodule
80 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
81 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
82 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
83 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
84 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
85 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
86 2534681786 Brucella suis 92/29 Isolate Unclassified
87 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
88 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
89 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
90 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
91 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
92 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
93 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
94 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
95 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
96 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
97 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
98 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
99 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
100 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
101 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
102 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
103 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
104 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
105 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
106 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
107 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
108 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
109 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
110 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
111 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
112 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
113 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
114 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
115 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
116 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
117 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
118 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
119 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
120 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
121 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
122 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
123 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
124 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
125 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
126 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
127 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
128 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
129 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
130 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
131 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
132 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
133 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
134 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
135 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
136 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
137 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
138 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
139 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
140 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
141 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
142 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
143 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
144 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
145 2643221557 Ensifer sp. Root558 Isolate Unclassified
146 2643221558 Rhizobium sp. Root149 Isolate Unclassified
147 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
148 2643221568 Rhizobium sp. Root564 Isolate Unclassified
149 2643221580 Devosia sp. Root635 Isolate Unclassified
150 2643221582 Rhizobium sp. Root651 Isolate Unclassified
151 2643221591 Devosia sp. Root685 Isolate Unclassified
152 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
153 2643221599 Rhizobium sp. Root708 Isolate Unclassified
154 2643221607 Rhizobium sp. Root73 Isolate Unclassified
155 2643221610 Ensifer sp. Root74 Isolate Unclassified
156 2643221618 Ensifer sp. Root231 Isolate Unclassified
157 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
158 2643221626 Ensifer sp. Root31 Isolate Unclassified
159 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
160 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
161 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
162 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
163 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
164 2643221651 Afipia sp. Root123D2 Isolate Unclassified
165 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
166 2643221655 Ensifer sp. Root1252 Isolate Unclassified
167 2643221659 Ensifer sp. Root127 Isolate Unclassified
168 2643221668 Ensifer sp. Root423 Isolate Unclassified
169 2643221674 Devosia sp. Root436 Isolate Unclassified
170 2643221675 Ensifer sp. Root1298 Isolate Unclassified
171 2643221680 Ensifer sp. Root1312 Isolate Unclassified
172 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
173 2643221688 Rhizobium sp. Root482 Isolate Unclassified
174 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
175 2643221693 Rhizobium sp. Root491 Isolate Unclassified
176 2643221698 Ensifer sp. Root142 Isolate Unclassified
177 2643221712 Ensifer sp. Root258 Isolate Unclassified
178 2643221718 Rhizobium sp. Root268 Isolate Unclassified
179 2643221719 Rhizobium sp. Root274 Isolate Unclassified
180 2643221723 Ensifer sp. Root278 Isolate Unclassified
181 2643221726 Ensifer sp. Root954 Isolate Unclassified
182 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
183 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
184 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
185 2718217882 Rhizobium sp. N741 Isolate Nodule
186 2718217927 Rhizobium sp. N324 Isolate Nodule
187 2718218009 Rhizobium sp. N561 Isolate Nodule
188 2718218363 Rhizobium sp. N113 Isolate Nodule
189 2718218365 Rhizobium sp. N731 Isolate Nodule
190 2718218366 Rhizobium sp. N621 Isolate Nodule
191 2718218423 Rhizobium sp. N941 Isolate Nodule
192 2721755514 Rhizobium sp. N6212 Isolate Nodule
193 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
194 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
195 2721755809 Rhizobium sp. N541 Isolate Nodule
196 2721755810 Rhizobium sp. N871 Isolate Nodule
197 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
198 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
199 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
200 2728369365 Rhizobium sp. N1341 Isolate Nodule
201 2728369397 Rhizobium sp. N1314 Isolate Nodule
202 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
203 2738543024 Aminobacter sp. AP02 Isolate Unclassified
204 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
205 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
206 2751185800 Brucella pituitosa AA2 Isolate Unclassified
207 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
208 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
209 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
210 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
211 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
212 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
213 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
214 2773857925 Microvirga vignae BR3299 Isolate Unclassified
215 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
216 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
217 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
218 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
219 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
220 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
221 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
222 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
223 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
224 2791355199
225 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
226 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
227 2791355260 Rhizobium sp. L9 Isolate Nodule
228 2791355261 Rhizobium sp. J15 Isolate Nodule
229 2791355263 Rhizobium chutanense C5 Isolate Nodule
230 2791355264 Rhizobium sp. S9 Isolate Nodule
231 2791355265 Rhizobium sp. H4 Isolate Nodule
232 2791355266 Rhizobium sp. L43 Isolate Nodule
233 2791355267 Rhizobium sp. L18 Isolate Nodule
234 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
235 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
236 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
237 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
238 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
239 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
240 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
241 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
242 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
243 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
244 2802429633 Rhizobium anhuiense J3 Isolate Nodule
245 2802429634 Rhizobium anhuiense S10 Isolate Nodule
246 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
247 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
248 2802429637 Rhizobium anhuiense C15 Isolate Nodule
249 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
250 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
251 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
252 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
253 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
254 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
255 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
256 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
257 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
258 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
259 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
260 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
261 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
262 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
263 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
264 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
265 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
266 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
267 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
268 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
269 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
270 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
271 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
272 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
273 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
274 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
275 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
276 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
277 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
278 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
279 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
280 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
281 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
282 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
283 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
284 2838061910 Rhizobium phaseoli L15 Isolate Nodule
285 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
286 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
287 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
288 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
289 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
290 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
291 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
292 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
293 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
294 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
295 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
296 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
297 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
298 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
299 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
300 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
301 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
302 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
303 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
304 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
305 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
306 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
307 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
308 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
309 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
310 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
311 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
312 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
313 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
314 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
315 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
316 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
317 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
318 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
319 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
320 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
321 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
322 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
323 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
324 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
325 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
326 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
327 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
328 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
329 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
330 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
331 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
332 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
333 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
334 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
335 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
336 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
337 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
338 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
339 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
340 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
341 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
342 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
343 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
344 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
345 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
346 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
347 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
348 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
349 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
350 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
351 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
352 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
353 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
354 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
355 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
356 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
357 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
358 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
359 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
360 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
361 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
362 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
363 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
364 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
365 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
366 2844163670 Ensifer sp. 1H6 Isolate Unclassified
367 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
368 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
369 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
370 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
371 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
372 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
373 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
374 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
375 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
376 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
377 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
378 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
379 2854911287 Brucella lupini LUP21 Isolate Unclassified
380 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
381 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
382 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
383 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
384 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
385 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
386 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
387 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
388 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
389 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
390 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
391 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
392 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
393 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
394 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
395 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
396 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
397 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
398 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
399 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
400 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
401 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
402 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
403 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
404 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
405 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
406 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
407 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
408 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
409 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
410 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
411 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
412 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
413 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
414 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
415 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
416 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
417 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
418 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
419 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
420 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
421 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
422 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
423 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
424 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
425 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
426 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
427 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
428 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
429 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
430 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
431 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
432 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
433 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
434 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
435 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
436 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
437 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
438 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
439 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
440 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
441 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
442 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
443 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
444 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
445 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
446 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
447 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
448 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
449 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
450 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
451 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
452 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
453 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
454 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
455 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
456 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
457 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
458 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
459 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
460 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
461 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
462 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
463 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
464 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
465 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
466 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
467 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
468 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
469 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
470 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
471 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
472 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
473 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
474 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
475 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
476 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
477 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
478 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
479 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
480 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
481 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
482 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
483 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
484 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
485 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
486 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
487 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
488 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
489 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
490 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
491 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
492 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
493 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
494 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
495 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
496 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
497 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
498 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
499 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
500 2902330777 Methylobacterium sp. 2A Isolate Unclassified
501 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
502 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
503 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
504 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
505 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
506 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
507 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
508 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
509 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
510 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
511 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
512 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
513 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
514 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
515 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
516 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
517 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
518 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
519 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
520 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
521 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
522 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
523 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
524 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
525 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
526 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
527 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
528 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
529 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
530 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
531 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
532 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
533 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
534 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
535 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
536 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
537 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
538 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
539 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
540 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
541 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
542 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
543 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
544 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
545 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
546 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
547 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
548 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
549 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
550 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
551 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
552 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
553 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
554 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
555 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
556 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
557 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
558 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
559 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
560 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
561 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
562 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
563 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
564 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
565 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
566 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
567 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
568 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
569 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
570 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
571 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
572 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
573 2922368715
574 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
575 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
576 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
577 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
578 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
579 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
580 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
581 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
582 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
583 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
584 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
585 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
586 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
587 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
588 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
589 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
590 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
591 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
592 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
593 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
594 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
595 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
596 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
597 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
598 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
599 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
600 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
601 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
602 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
603 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
604 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
605 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
606 2932401849 Devosia sp. 2618 Isolate Rhizosphere
607 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
608 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
609 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
610 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
611 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
612 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
613 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
614 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
615 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
616 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
617 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
618 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
619 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
620 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
621 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
622 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
623 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
624 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
625 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
626 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
627 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
628 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
629 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
630 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
631 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
632 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
633 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
634 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
635 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
636 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
637 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
638 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
639 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
640 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
641 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
642 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
643 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
644 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
645 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
646 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
647 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
648 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
649 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
650 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
651 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
652 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
653 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
654 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
655 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
656 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
657 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
658 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
659 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
660 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
661 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
662 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
663 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
664 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
665 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
666 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
667 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
668 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
669 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
670 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
671 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
672 2936381700 Rhizobium chutanense C16 Isolate Unclassified
673 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
674 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
675 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
676 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
677 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
678 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
679 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
680 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
681 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
682 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
683 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
684 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
685 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
686 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
687 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
688 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
689 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
690 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
691 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
692 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
693 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
694 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
695 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
696 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
697 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
698 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
699 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
700 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
701 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
702 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
703 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
704 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
705 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
706 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
707 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
708 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
709 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
710 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
711 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
712 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
713 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
714 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
715 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
716 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
717 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
718 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
719 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
720 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
721 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
722 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
723 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
724 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
725 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
726 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
727 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
728 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
729 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
730 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
731 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
732 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
733 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
734 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
735 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
736 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
737 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
738 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
739 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
740 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
741 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
742 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
743 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
744 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
745 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
746 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
747 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
748 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
749 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
750 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
751 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
752 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
753 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
754 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
755 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
756 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
757 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
758 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
759 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
760 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
761 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
762 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
763 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
764 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
765 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
766 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
767 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
768 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
769 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
770 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
771 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
772 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
773 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
774 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
775 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
776 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
777 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
778 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
779 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
780 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
781 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
782 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
783 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
784 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
785 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
786 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
787 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
788 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
789 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
790 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
791 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
792 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
793 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
794 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
795 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
796 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
797 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
798 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
799 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
800 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
801 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
802 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
803 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
804 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
805 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
806 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
807 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
808 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
809 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
810 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
811 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
812 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
813 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
814 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
815 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
816 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
817 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
818 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
819 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
820 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
821 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
822 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
823 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
824 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
825 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
826 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
827 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
828 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
829 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
830 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
831 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
832 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
833 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
834 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
835 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
836 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
837 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
838 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
839 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
840 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
841 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
842 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
843 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
844 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
845 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
846 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
847 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
848 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
849 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
850 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
851 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
852 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
853 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
854 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
855 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
856 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
857 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
858 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
859 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
860 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
861 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
862 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
863 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
864 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
865 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
866 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
867 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
868 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
869 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
870 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
871 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
872 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
873 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
874 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
875 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
876 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
877 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
878 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
879 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
880 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
881 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
882 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
883 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
884 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
885 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
886 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
887 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
888 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
889 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
890 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
891 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
892 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
893 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
894 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
895 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
896 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
897 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
898 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
899 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
900 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
901 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
902 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
903 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
904 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
905 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
906 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
907 2996887358 Rhizobium sp. R711 Isolate Nodule
908 2996893221 Rhizobium sp. R635 Isolate Nodule
909 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
910 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
911 3004167301 Mesorhizobium loti 582 Isolate Unclassified
912 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
913 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
914 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
915 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
916 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
917 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
918 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
919 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
920 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
921 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
922 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
923 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
924 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
925 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
926 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
927 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
928 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
929 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
930 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
931 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
932 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
933 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
934 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
935 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
936 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
937 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
938 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
939 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
940 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
941 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
942 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
943 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
944 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
945 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
946 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
947 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
948 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
949 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
950 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
951 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
952 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
953 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
954 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
955 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
956 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
957 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
958 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
959 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
960 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
961 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
962 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
963 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
964 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
965 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
966 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
967 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
968 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
969 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
970 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
971 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
972 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
973 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
974 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
975 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
976 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
977 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
978 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
979 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
980 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
981 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
982 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
983 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
984 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
985 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
986 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
987 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
988 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
989 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
990 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
991 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
992 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
993 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
994 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
995 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
996 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
997 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
998 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
999 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
1000 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
1001 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
1002 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
1003 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
1004 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
1005 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
1006 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
1007 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
1008 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
1009 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
1010 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
1011 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
1012 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
1013 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
1014 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
1015 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
1016 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
1017 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
1018 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
1019 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
1020 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
1021 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
1022 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
1023 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
1024 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
1025 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
1026 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
1027 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
1028 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
1029 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
1030 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
1031 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
1032 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
1033 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
1034 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
1035 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
1036 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
1037 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
1038 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
1039 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
1040 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
1041 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
1042 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
1043 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
1044 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
1045 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
1046 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
1047 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
1048 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
1049 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
1050 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
1051 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
1052 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
1053 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
1054 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
1055 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
1056 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
1057 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
1058 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
1059 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
1060 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
1061 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
1062 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
1063 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
1064 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
1065 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
1066 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
1067 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
1068 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
1069 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
1070 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
1071 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
1072 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
1073 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
1074 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
1075 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
1076 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
1077 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
1078 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
1079 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
1080 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
1081 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
1082 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
1083 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
1084 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
1085 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
1086 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
1087 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
1088 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
1089 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
1090 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
1091 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
1092 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
1093 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
1094 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
1095 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
1096 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
1097 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
1098 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
1099 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
1100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
1101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
1102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
1103 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
1104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
1105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
1106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
1107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
1108 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
1109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
1110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
1111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
1112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
1113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
1114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
1115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
1116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
1117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
1118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
1119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
1120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1121 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
1122 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
1123 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
1124 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
1125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
1126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
1127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
1128 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1129 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
1131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1133 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
1136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1146 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
1147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1223 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
1224 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
1226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1228 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1229 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1230 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1231 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
1232 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1238 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
1239 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1240 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1241 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1242 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
1243 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1244 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
1245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1247 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1248 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1249 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1250 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1251 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1252 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1253 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1254 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1255 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1256 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1257 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1258 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1259 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1260 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1261 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1262 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1263 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1266 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1267 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1268 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1269 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1270 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1271 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1272 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1273 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1274 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1276 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1277 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1278 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
1279 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1280 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1281 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1282 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1283 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
1284 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
1285 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
1286 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
1287 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
1288 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1289 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
1290 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1291 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1292 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
1293 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
1294 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1295 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
1296 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1297 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1298 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1299 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1300 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1301 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1302 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1303 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1306 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1307 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
1308 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1309 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1310 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1311 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1312 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1313 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1314 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1315 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1316 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1317 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1318 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1319 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1320 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1321 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1322 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1323 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1324 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1325 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1326 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1327 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1329 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
1330 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1331 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1332 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1333 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1334 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1335 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1336 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1337 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
1338 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1339 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1340 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1341 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1342 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
1343 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
1344 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1345 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1346 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1347 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1348 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1349 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1350 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1351 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1352 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1353 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1354 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1355 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1356 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1357 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1358 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1359 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1360 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1362 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1363 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1364 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1365 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1366 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1367 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1368 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1369 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1370 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1371 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1372 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1373 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1374 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1375 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1376 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1377 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1378 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1379 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1380 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1381 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1382 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1383 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1384 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1385 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1386 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1387 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1388 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1389 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1390 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1391 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1392 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1393 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1394 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1395 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1396 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1397 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1398 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1399 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1400 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1402 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1404 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1405 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1406 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1407 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1408 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1409 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1410 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1411 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1412 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1413 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1414 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1415 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1416 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1417 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1418 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1421 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1422 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1423 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1424 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1425 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1426 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1427 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1428 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1429 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1430 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1431 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1432 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1433 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1434 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1435 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1437 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1438 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1444 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1445 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1446 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1447 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1448 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1452 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1455 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1456 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1458 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1459 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1460 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1461 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1462 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1463 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1464 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1465 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1466 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1467 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1468 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1469 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1470 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1471 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1472 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1473 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1474 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1475 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1476 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1477 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1478 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1479 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1480 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1481 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1482 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1483 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1484 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1485 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1486 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1487 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1488 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1489 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1490 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1491 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1492 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1493 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1494 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1495 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1496 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
1497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1499 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1500 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1501 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1502 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1503 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1504 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1505 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1506 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1507 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1508 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1509 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1510 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1511 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1512 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1513 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1514 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1515 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1516 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1517 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1518 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1519 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1520 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1521 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1522 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1523 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1524 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1525 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
1526 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1527 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1528 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1529 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1530 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
1531 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1532 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1533 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1534 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1535 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1536 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1537 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1538 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1539 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1540 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
1541 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
1542 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1543 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1544 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1545 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
1546 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1547 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1548 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1549 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1550 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1551 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1552 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
1553 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1554 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1555 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1556 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1557 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
1558 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1559 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1560 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
1561 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1562 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1563 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1564 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1565 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1566 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
1567 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
1568 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1569 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1570 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1571 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1572 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1573 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1574 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1575 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1576 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1577 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1578 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1579 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1580 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1581 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1582 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1583 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1584 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1585 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1586 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1587 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1588 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1589 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1590 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1591 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1592 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1593 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1594 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1595 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1596 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1597 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1598 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1599 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1600 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1601 8005258706 Rhizobium sp. R693 Isolate Nodule
1602 8005275841 Rhizobium sp. N4311 Isolate Nodule
1603 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1604 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1605 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1606 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1607 8005321885 Rhizobium sp. R72 Isolate Nodule
1608 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1609 8005382845 Rhizobium sp. R634 Isolate Nodule
1610 8005395548 Rhizobium sp. R339 Isolate Nodule
1611 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1612 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1613 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1614 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1615 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1616 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1617 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1618 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1619 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1620 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1621 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1622 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1623 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1624 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1625 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1626 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1627 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1628 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1629 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1630 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1631 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1632 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1633 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1634 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1635 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1636 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1637 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1638 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1639 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1640 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1641 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1642 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1643 8018176218 Rhizobium sp. N122 Isolate Nodule
1644 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1645 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1646 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1647 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1648 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1649 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1650 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1651 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1652 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1653 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1654 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1655 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1656 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1657 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1658 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1659 8024501048 Rhizobium sp. H4 Isolate Nodule
1660 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1661 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1662 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1663 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1664 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1665 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1666 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1667 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1668 8056382006 Rhizobium croatiense 13T Isolate Nodule
1669 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1670 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1671 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1672 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1673 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1674 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.06
Metatranscriptomes 0.08
Isolates 26.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 8.35
Nodule 20.48
Rhizoplane 3.78
Rhizosphere 57.74
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800759 2209111006 Bacteria 10903
2 ARcpr5oldR_c000105 3300000041 Bacteria 15306
3 ARSoilYngRDRAFT_c00092 3300000042 Bacteria 15326
4 ARcpr5yngRDRAFT_c000085 3300000043 Bacteria 15310
5 ARSoilOldRDRAFT_c000016 3300000044 Bacteria 39308
6 ARCol0yngRDRAFT_1000096 3300000652 Bacteria 16320
7 JGI24746J21847_1001644 3300001977 Bacteria 3581
8 JGI24740J21852_10000265 3300001979 Bacteria 21989
9 JGI24740J21852_10026361 3300001979 Bacteria 1948
10 JGI24739J22299_10003310 3300001989 Bacteria 6143
11 JGI24739J22299_10010953 3300001989 Bacteria 3353
12 JGI24737J22298_10000990 3300001990 Bacteria 10064
13 JGI24735J21928_10010073 3300002067 Bacteria 3022
14 JGI24750J21931_1001929 3300002070 Bacteria 2530
15 JGI24745J21846_1000039 3300002073 Bacteria 8901
16 JGI24738J21930_10000730 3300002075 Bacteria 9473
17 JGI24749J21850_1000343 3300002076 Bacteria 6984
18 JGI24749J21850_1006188 3300002076 Bacteria 1668
19 JGI24035J26624_1000058 3300002126 Bacteria 8751
20 JGI24033J26618_1000943 3300002155 Bacteria 2796
21 JGI24742J22300_10000198 3300002244 Bacteria 8911
22 JGI24751J29686_10000813 3300002459 Bacteria 7277
23 JGI25155J39150_1000013 3300002704 Bacteria 198215
24 JGI25156J39149_1000011 3300002705 Bacteria 198215
25 JGI25156J39149_1004689 3300002705 Bacteria 4107
26 JGI25162J39368_1004503 3300002737 Bacteria 3196
27 JGI25154J39366_1000030 3300002738 Bacteria 191444
28 JGI25158J39367_1000118 3300002739 Bacteria 18246
29 JGI25158J39367_1006442 3300002739 Bacteria 1681
30 JGI25157J39369_1000013 3300002741 Bacteria 198211
31 JGI25157J39369_1000297 3300002741 Bacteria 36233
32 JGI25152J39213_1003762 3300002773 Bacteria 5054
33 JGI25152J39213_1018273 3300002773 Bacteria 1300
34 JGI25152J39213_1018279 3300002773 Bacteria 1300
35 JGI25159J45721_1000003 3300002987 Bacteria 274069
36 JGI25159J45721_1000320 3300002987 Bacteria 22279
37 JGI25159J45721_1002223 3300002987 Bacteria 7511
38 JGI25151J46595_10000425 3300003187 Bacteria 42264
39 JGI25151J46595_10005036 3300003187 Bacteria 6877
40 JGI25151J46595_10009861 3300003187 Bacteria 4486
41 JGI25165J46597_1000008 3300003214 Bacteria 478603
42 JGI25165J46597_1010520 3300003214 Bacteria 1346
43 JGI25153J46596_10002490 3300003215 Bacteria 10574
44 JGI25153J46596_10008005 3300003215 Bacteria 5113
45 JGI25153J46596_10010701 3300003215 Bacteria 4125
46 JGI25153J46596_10041259 3300003215 Bacteria 1422
47 JGI25153J46596_10045849 3300003215 Bacteria 1300
48 JGI25153J46596_10045860 3300003215 Bacteria 1300
49 rootH2_10009083 3300003320 Bacteria 19934
50 rootH2_10019646 3300003320 Bacteria 2634
51 JGI25160J50197_1000003 3300003354 Bacteria 482719
52 JGI25160J50197_1000041 3300003354 Bacteria 152843
53 JGI25160J50197_1001749 3300003354 Bacteria 10525
54 JGI25160J50197_1006450 3300003354 Bacteria 4749
55 JGI25161J50226_1000002 3300003374 Bacteria 420324
56 JGI25161J50226_1000184 3300003374 Bacteria 41591
57 JGI25161J50226_1000315 3300003374 Bacteria 26611
58 JGI25161J50226_1006751 3300003374 Bacteria 2029
59 Ga0055542_1000770 3300003762 Bacteria 24249
60 Ga0055542_1011094 3300003762 Bacteria 1615
61 Ga0055529_1003107 3300003763 Bacteria 2884
62 Ga0055526_1000550 3300003771 Bacteria 29646
63 Ga0055526_1001211 3300003771 Bacteria 18589
64 Ga0055526_1004504 3300003771 Bacteria 8343
65 Ga0055524_1009975 3300003775 Bacteria 3816
66 Ga0055536_1001178 3300003781 Bacteria 16273
67 Ga0055536_1007448 3300003781 Bacteria 4897
68 Ga0055528_1000095 3300003790 Bacteria 70572
69 Ga0055528_1000618 3300003790 Bacteria 26522
70 Ga0055528_1017233 3300003790 Bacteria 2514
71 Ga0055528_1017349 3300003790 Bacteria 2501
72 Ga0055540_1000190 3300003792 Bacteria 59767
73 Ga0055540_1002438 3300003792 Bacteria 9806
74 Ga0055531_10005776 3300003794 Bacteria 7163
75 Ga0055531_10014246 3300003794 Bacteria 3596
76 Ga0055543_1000059 3300004625 Bacteria 100942
77 Ga0055543_1000203 3300004625 Bacteria 48554
78 Ga0055543_1000466 3300004625 Bacteria 23733
79 Ga0055543_1001741 3300004625 Bacteria 8153
80 Ga0065165_1000031 3300005262 Bacteria 216330
81 Ga0065165_1000084 3300005262 Bacteria 154822
82 Ga0065165_1001966 3300005262 Bacteria 19466
83 Ga0065165_1003663 3300005262 Bacteria 10488
84 Ga0065704_10156323 3300005289 Bacteria 1377
85 Ga0065712_10016440 3300005290 Bacteria 3460
86 Ga0065712_10071767 3300005290 Bacteria 5071
87 Ga0065715_10000443 3300005293 Bacteria 13431
88 Ga0065715_10089090 3300005293 Bacteria 14624
89 Ga0065715_10096504 3300005293 Bacteria 3868
90 Ga0070658_10010864 3300005327 Bacteria 7301
91 Ga0070658_10017911 3300005327 Bacteria 5666
92 Ga0070658_10018855 3300005327 Bacteria 5527
93 Ga0070658_10025416 3300005327 Bacteria 4747
94 Ga0070658_10043589 3300005327 Bacteria 3623
95 Ga0070658_10080193 3300005327 Bacteria 2681
96 Ga0070658_10090355 3300005327 Bacteria 2523
97 Ga0070676_10009033 3300005328 Bacteria 5393
98 Ga0070676_10133852 3300005328 Bacteria 1570
99 Ga0070683_100000585 3300005329 Bacteria 26003
100 Ga0070683_100026465 3300005329 Bacteria 5224
101 Ga0070690_100002968 3300005330 Bacteria 9179
102 Ga0070690_100011128 3300005330 Bacteria 5254
103 Ga0070670_100000230 3300005331 Bacteria 51494
104 Ga0070670_100019485 3300005331 Bacteria 5823
105 Ga0070670_100154118 3300005331 Bacteria 1989
106 Ga0070677_10000046 3300005333 Bacteria 38785
107 Ga0068869_100002768 3300005334 Bacteria 10622
108 Ga0070666_10001554 3300005335 Bacteria 13928
109 Ga0070666_10003904 3300005335 Bacteria 9057
110 Ga0070666_10094351 3300005335 Bacteria 2058
111 Ga0070680_100009595 3300005336 Bacteria 7439
112 Ga0070680_100019564 3300005336 Bacteria 5368
113 Ga0070680_100047915 3300005336 Bacteria 3481
114 Ga0070680_100077207 3300005336 Bacteria 2743
115 Ga0070680_100080661 3300005336 Bacteria 2684
116 Ga0070680_100153664 3300005336 Bacteria 1933
117 Ga0070682_100004765 3300005337 Bacteria 7543
118 Ga0070682_100034975 3300005337 Bacteria 3064
119 Ga0070682_100057287 3300005337 Bacteria 2454
120 Ga0068868_100018435 3300005338 Bacteria 5219
121 Ga0068868_100215163 3300005338 Bacteria 1607
122 Ga0068868_100276245 3300005338 Bacteria 1421
123 Ga0070660_100008052 3300005339 Bacteria 7367
124 Ga0070660_100015510 3300005339 Bacteria 5505
125 Ga0070660_100026290 3300005339 Bacteria 4332
126 Ga0070660_100032520 3300005339 Bacteria 3926
127 Ga0070660_100041455 3300005339 Bacteria 3509
128 Ga0070660_100247016 3300005339 Bacteria 1454
129 Ga0070689_100001712 3300005340 Bacteria 14020
130 Ga0070689_100003866 3300005340 Bacteria 10039
131 Ga0070689_100005254 3300005340 Bacteria 8823
132 Ga0070691_10002565 3300005341 Bacteria 8096
133 Ga0070691_10010936 3300005341 Bacteria 4144
134 Ga0070691_10026668 3300005341 Bacteria 2694
135 Ga0070687_100007739 3300005343 Bacteria 4504
136 Ga0070687_100007741 3300005343 Bacteria 4504
137 Ga0070687_100016014 3300005343 Bacteria 3406
138 Ga0070661_100000165 3300005344 Bacteria 54127
139 Ga0070661_100034109 3300005344 Bacteria 3691
140 Ga0070661_100047545 3300005344 Bacteria 3140
141 Ga0070692_10000631 3300005345 Bacteria 11126
142 Ga0070668_100029287 3300005347 Bacteria 4181
143 Ga0070668_100072026 3300005347 Bacteria 2692
144 Ga0070668_100136428 3300005347 Bacteria 1974
145 Ga0070669_100018363 3300005353 Bacteria 4998
146 Ga0070669_100031957 3300005353 Bacteria 3802
147 Ga0070669_100216628 3300005353 Bacteria 1513
148 Ga0070675_100002649 3300005354 Bacteria 13451
149 Ga0070675_100062309 3300005354 Bacteria 3082
150 Ga0070675_100176293 3300005354 Bacteria 1846
151 Ga0070675_100295408 3300005354 Bacteria 1426
152 Ga0070671_100003717 3300005355 Bacteria 11973
153 Ga0070671_100248925 3300005355 Bacteria 1509
154 Ga0070674_100001719 3300005356 Bacteria 11861
155 Ga0070674_100002656 3300005356 Bacteria 9903
156 Ga0070674_100053467 3300005356 Bacteria 2789
157 Ga0070673_100000632 3300005364 Bacteria 19293
158 Ga0070673_100007245 3300005364 Bacteria 7300
159 Ga0070673_100039899 3300005364 Bacteria 3598
160 Ga0070673_100071005 3300005364 Bacteria 2796
161 Ga0070673_100081143 3300005364 Bacteria 2630
162 Ga0070673_100155614 3300005364 Bacteria 1940
163 Ga0070688_100005511 3300005365 Bacteria 6675
164 Ga0070688_100011455 3300005365 Bacteria 4927
165 Ga0070688_100012378 3300005365 Bacteria 4778
166 Ga0070659_100019129 3300005366 Bacteria 5181
167 Ga0070659_100031682 3300005366 Bacteria 4096
168 Ga0070659_100062130 3300005366 Bacteria 2952
169 Ga0070659_100158851 3300005366 Bacteria 1847
170 Ga0070659_100250797 3300005366 Bacteria 1467
171 Ga0070667_100032864 3300005367 Bacteria 4330
172 Ga0070667_100053463 3300005367 Bacteria 3408
173 Ga0070667_100119569 3300005367 Bacteria 2291
174 Ga0070667_100136030 3300005367 Bacteria 2149
175 Ga0070703_10006667 3300005406 Bacteria 3235
176 Ga0070709_10001921 3300005434 Bacteria 11296
177 Ga0070709_10003452 3300005434 Bacteria 8480
178 Ga0070709_10095435 3300005434 Bacteria 1970
179 Ga0070709_10226942 3300005434 Bacteria 1334
180 Ga0070714_100009726 3300005435 Bacteria 7573
181 Ga0070714_100022956 3300005435 Bacteria 5120
182 Ga0070714_100050831 3300005435 Bacteria 3533
183 Ga0070714_100065295 3300005435 Bacteria 3134
184 Ga0070714_100068914 3300005435 Bacteria 3054
185 Ga0070714_100099155 3300005435 Bacteria 2563
186 Ga0070714_100180622 3300005435 Bacteria 1920
187 Ga0070714_100333164 3300005435 Bacteria 1422
188 Ga0070713_100000017 3300005436 Bacteria 120503
189 Ga0070713_100000386 3300005436 Bacteria 28227
190 Ga0070713_100009592 3300005436 Bacteria 6943
191 Ga0070713_100021511 3300005436 Bacteria 4964
192 Ga0070713_100154606 3300005436 Bacteria 2043
193 Ga0070713_100203852 3300005436 Bacteria 1787
194 Ga0070713_100232158 3300005436 Bacteria 1677
195 Ga0070713_100235813 3300005436 Bacteria 1664
196 Ga0070713_100246380 3300005436 Bacteria 1629
197 Ga0070710_10002057 3300005437 Bacteria 9532
198 Ga0070710_10010371 3300005437 Bacteria 4576
199 Ga0070710_10020638 3300005437 Bacteria 3421
200 Ga0070710_10043511 3300005437 Bacteria 2487
201 Ga0070701_10000116 3300005438 Bacteria 23157
202 Ga0070701_10014395 3300005438 Bacteria 3626
203 Ga0070701_10032960 3300005438 Bacteria 2585
204 Ga0070711_100000833 3300005439 Bacteria 16166
205 Ga0070711_100012063 3300005439 Bacteria 5388
206 Ga0070711_100014050 3300005439 Bacteria 5038
207 Ga0070711_100042650 3300005439 Bacteria 3068
208 Ga0070711_100062328 3300005439 Bacteria 2599
209 Ga0070711_100105954 3300005439 Bacteria 2054
210 Ga0070711_100149241 3300005439 Bacteria 1761
211 Ga0070711_100157768 3300005439 Bacteria 1717
212 Ga0070711_100194670 3300005439 Unclassified 1560
213 Ga0070711_100252231 3300005439 Bacteria 1385
214 Ga0070705_100002646 3300005440 Bacteria 8961
215 Ga0070705_100026217 3300005440 Bacteria 3171
216 Ga0070705_100096836 3300005440 Bacteria 1853
217 Ga0070700_100001202 3300005441 Bacteria 12834
218 Ga0070694_100084477 3300005444 Bacteria 2215
219 Ga0070708_100001838 3300005445 Bacteria 16278
220 Ga0070708_100041588 3300005445 Bacteria 4030
221 Ga0070708_100076015 3300005445 Bacteria 3032
222 Ga0070663_100013643 3300005455 Bacteria 5189
223 Ga0070663_100016660 3300005455 Bacteria 4780
224 Ga0070663_100023380 3300005455 Bacteria 4142
225 Ga0070663_100023489 3300005455 Bacteria 4134
226 Ga0070663_100106719 3300005455 Bacteria 2098
227 Ga0070663_100179899 3300005455 Bacteria 1640
228 Ga0070663_100240568 3300005455 Bacteria 1428
229 Ga0070663_100271808 3300005455 Bacteria 1348
230 Ga0070678_100004746 3300005456 Bacteria 7749
231 Ga0070678_100038617 3300005456 Bacteria 3363
232 Ga0070678_100046087 3300005456 Bacteria 3124
233 Ga0070678_100072036 3300005456 Bacteria 2589
234 Ga0070678_100110336 3300005456 Bacteria 2151
235 Ga0070678_100113375 3300005456 Bacteria 2125
236 Ga0070678_100192076 3300005456 Bacteria 1679
237 Ga0070662_100022584 3300005457 Bacteria 4309
238 Ga0070662_100098548 3300005457 Bacteria 2208
239 Ga0070662_100206953 3300005457 Bacteria 1559
240 Ga0070681_10002902 3300005458 Bacteria 15857
241 Ga0070681_10003135 3300005458 Bacteria 15358
242 Ga0070681_10017652 3300005458 Bacteria 7131
243 Ga0070681_10018751 3300005458 Bacteria 6925
244 Ga0070681_10027863 3300005458 Bacteria 5680
245 Ga0070681_10032008 3300005458 Bacteria 5279
246 Ga0070681_10034908 3300005458 Bacteria 5051
247 Ga0070681_10057211 3300005458 Bacteria 3880
248 Ga0070681_10078688 3300005458 Bacteria 3254
249 Ga0070681_10085272 3300005458 Bacteria 3111
250 Ga0070681_10215061 3300005458 Bacteria 1838
251 Ga0070681_10255850 3300005458 Bacteria 1663
252 Ga0068867_100000619 3300005459 Bacteria 23562
253 Ga0068867_100071366 3300005459 Bacteria 2597
254 Ga0068867_100076736 3300005459 Bacteria 2509
255 Ga0068867_100097733 3300005459 Bacteria 2237
256 Ga0068867_100109766 3300005459 Bacteria 2118
257 Ga0070685_10000856 3300005466 Bacteria 16575
258 Ga0070685_10005781 3300005466 Bacteria 6286
259 Ga0070685_10027271 3300005466 Bacteria 3155
260 Ga0070685_10046510 3300005466 Bacteria 2491
261 Ga0070706_100006876 3300005467 Bacteria 10737
262 Ga0070706_100053048 3300005467 Bacteria 3742
263 Ga0070707_100000816 3300005468 Bacteria 30839
264 Ga0070707_100012325 3300005468 Bacteria 7982
265 Ga0070698_100001667 3300005471 Bacteria 24784
266 Ga0070699_100001000 3300005518 Bacteria 26291
267 Ga0070699_100157075 3300005518 Bacteria 2012
268 Ga0070679_100010513 3300005530 Bacteria 8779
269 Ga0070679_100015294 3300005530 Bacteria 7373
270 Ga0070679_100020950 3300005530 Bacteria 6378
271 Ga0070679_100042239 3300005530 Bacteria 4540
272 Ga0070679_100049786 3300005530 Bacteria 4173
273 Ga0070679_100073230 3300005530 Bacteria 3418
274 Ga0070679_100080404 3300005530 Bacteria 3248
275 Ga0070679_100108843 3300005530 Bacteria 2757
276 Ga0070679_100111902 3300005530 Bacteria 2716
277 Ga0070679_100115768 3300005530 Bacteria 2666
278 Ga0070679_100154678 3300005530 Bacteria 2269
279 Ga0070679_100358068 3300005530 Bacteria 1407
280 Ga0070684_100003206 3300005535 Bacteria 12234
281 Ga0070684_100003951 3300005535 Bacteria 11230
282 Ga0070684_100040007 3300005535 Unclassified 4034
283 Ga0070684_100130887 3300005535 Bacteria 2263
284 Ga0070697_100001374 3300005536 Bacteria 18443
285 Ga0070697_100007054 3300005536 Bacteria 8734
286 Ga0068853_100002639 3300005539 Bacteria 13506
287 Ga0068853_100004569 3300005539 Bacteria 10736
288 Ga0068853_100010013 3300005539 Bacteria 7655
289 Ga0068853_100014282 3300005539 Bacteria 6500
290 Ga0068853_100040080 3300005539 Bacteria 3995
291 Ga0068853_100042194 3300005539 Bacteria 3899
292 Ga0068853_100061864 3300005539 Bacteria 3238
293 Ga0068853_100098833 3300005539 Bacteria 2577
294 Ga0068853_100213806 3300005539 Bacteria 1758
295 Ga0068853_100249092 3300005539 Bacteria 1629
296 Ga0070672_100000875 3300005543 Bacteria 18026
297 Ga0070672_100029161 3300005543 Bacteria 4136
298 Ga0070672_100087531 3300005543 Bacteria 2507
299 Ga0070672_100221370 3300005543 Bacteria 1587
300 Ga0070686_100000923 3300005544 Bacteria 16929
301 Ga0070686_100004747 3300005544 Bacteria 7495
302 Ga0070686_100031156 3300005544 Bacteria 3258
303 Ga0070686_100140152 3300005544 Bacteria 1682
304 Ga0070695_100000960 3300005545 Bacteria 15663
305 Ga0070695_100001125 3300005545 Bacteria 14655
306 Ga0070695_100039776 3300005545 Bacteria 2974
307 Ga0070696_100000661 3300005546 Bacteria 22083
308 Ga0070696_100022107 3300005546 Bacteria 4319
309 Ga0070693_100000844 3300005547 Bacteria 13649
310 Ga0070693_100011942 3300005547 Bacteria 4384
311 Ga0070693_100059190 3300005547 Bacteria 2220
312 Ga0070693_100167868 3300005547 Bacteria 1403
313 Ga0070665_100001523 3300005548 Bacteria 26862
314 Ga0070665_100004139 3300005548 Bacteria 15258
315 Ga0070665_100039789 3300005548 Bacteria 4726
316 Ga0070665_100077875 3300005548 Bacteria 3321
317 Ga0070665_100160054 3300005548 Bacteria 2253
318 Ga0070665_100181527 3300005548 Bacteria 2105
319 Ga0070665_100278762 3300005548 Bacteria 1673
320 Ga0070665_100315005 3300005548 Bacteria 1569
321 Ga0070704_100001223 3300005549 Bacteria 13515
322 Ga0070704_100030133 3300005549 Bacteria 3632
323 Ga0068855_100000752 3300005563 Bacteria 39805
324 Ga0068855_100001552 3300005563 Bacteria 28894
325 Ga0068855_100004638 3300005563 Bacteria 16774
326 Ga0068855_100013526 3300005563 Bacteria 9840
327 Ga0068855_100013658 3300005563 Bacteria 9794
328 Ga0068855_100055168 3300005563 Bacteria 4668
329 Ga0068855_100058095 3300005563 Bacteria 4532
330 Ga0068855_100061360 3300005563 Bacteria 4393
331 Ga0068855_100072529 3300005563 Unclassified 4002
332 Ga0068855_100142556 3300005563 Bacteria 2730
333 Ga0068855_100163974 3300005563 Bacteria 2520
334 Ga0068855_100178690 3300005563 Bacteria 2400
335 Ga0068855_100264575 3300005563 Bacteria 1914
336 Ga0068855_100303923 3300005563 Bacteria 1766
337 Ga0068855_100326385 3300005563 Bacteria 1695
338 Ga0068855_100329271 3300005563 Bacteria 1686
339 Ga0068855_100341706 3300005563 Bacteria 1650
340 Ga0070664_100032460 3300005564 Bacteria 4368
341 Ga0070664_100119954 3300005564 Bacteria 2302
342 Ga0068857_100007206 3300005577 Bacteria 9575
343 Ga0068857_100012323 3300005577 Bacteria 7441
344 Ga0068857_100020193 3300005577 Bacteria 5857
345 Ga0068857_100041296 3300005577 Bacteria 4091
346 Ga0068857_100082245 3300005577 Bacteria 2876
347 Ga0068857_100090038 3300005577 Bacteria 2745
348 Ga0068854_100002007 3300005578 Bacteria 12465
349 Ga0068854_100032752 3300005578 Bacteria 3618
350 Ga0068854_100066755 3300005578 Bacteria 2619
351 Ga0068854_100082819 3300005578 Bacteria 2372
352 Ga0068854_100272883 3300005578 Bacteria 1359
353 Ga0068856_100000511 3300005614 Bacteria 42929
354 Ga0068856_100002104 3300005614 Bacteria 20649
355 Ga0068856_100019343 3300005614 Bacteria 6611
356 Ga0068856_100052061 3300005614 Bacteria 4037
357 Ga0068856_100080662 3300005614 Bacteria 3227
358 Ga0068856_100118702 3300005614 Bacteria 2646
359 Ga0068856_100171814 3300005614 Bacteria 2180
360 Ga0068856_100187434 3300005614 Bacteria 2083
361 Ga0068856_100189629 3300005614 Bacteria 2070
362 Ga0068856_100270957 3300005614 Bacteria 1713
363 Ga0068852_100035319 3300005616 Bacteria 4168
364 Ga0068852_100035668 3300005616 Bacteria 4151
365 Ga0068852_100092017 3300005616 Unclassified 2715
366 Ga0068852_100097935 3300005616 Bacteria 2640
367 Ga0068852_100190583 3300005616 Bacteria 1934
368 Ga0068852_100292331 3300005616 Bacteria 1574
369 Ga0068859_100009773 3300005617 Bacteria 9689
370 Ga0068859_100057107 3300005617 Bacteria 3931
371 Ga0068859_100076574 3300005617 Bacteria 3386
372 Ga0068859_100089332 3300005617 Bacteria 3131
373 Ga0068859_100172234 3300005617 Unclassified 2246
374 Ga0068864_100000501 3300005618 Bacteria 33748
375 Ga0068864_100030762 3300005618 Bacteria 4552
376 Ga0068864_100044977 3300005618 Bacteria 3786
377 Ga0068864_100091303 3300005618 Bacteria 2686
378 Ga0068864_100118693 3300005618 Bacteria 2362
379 Ga0068864_100136675 3300005618 Bacteria 2207
380 Ga0068864_100157810 3300005618 Bacteria 2060
381 Ga0068866_10002984 3300005718 Bacteria 6980
382 Ga0068866_10060663 3300005718 Bacteria 1962
383 Ga0068866_10072236 3300005718 Bacteria 1828
384 Ga0068866_10168635 3300005718 Bacteria 1283
385 Ga0068861_100022277 3300005719 Bacteria 4563
386 Ga0068870_10000104 3300005840 Bacteria 28590
387 Ga0068870_10031475 3300005840 Bacteria 2689
388 Ga0068863_100006851 3300005841 Bacteria 11170
389 Ga0068863_100088638 3300005841 Bacteria 2932
390 Ga0068863_100186457 3300005841 Bacteria 1993
391 Ga0068863_100265150 3300005841 Bacteria 1661
392 Ga0068858_100007763 3300005842 Bacteria 10358
393 Ga0068858_100009333 3300005842 Bacteria 9368
394 Ga0068858_100009758 3300005842 Bacteria 9142
395 Ga0068858_100069324 3300005842 Bacteria 3269
396 Ga0068858_100082749 3300005842 Bacteria 2984
397 Ga0068858_100132899 3300005842 Bacteria 2334
398 Ga0068858_100380991 3300005842 Bacteria 1354
399 Ga0068860_100000629 3300005843 Bacteria 41623
400 Ga0068860_100002395 3300005843 Bacteria 19680
401 Ga0068860_100028984 3300005843 Bacteria 5326
402 Ga0068860_100064206 3300005843 Bacteria 3488
403 Ga0068862_100026173 3300005844 Bacteria 4904
404 Ga0068862_100030423 3300005844 Bacteria 4550
405 Ga0068862_100228426 3300005844 Bacteria 1687
406 Ga0081455_10000313 3300005937 Bacteria 63616
407 Ga0081455_10000957 3300005937 Bacteria 36896
408 Ga0081455_10014639 3300005937 Bacteria 7671
409 Ga0081455_10026809 3300005937 Bacteria 5292
410 Ga0081455_10046295 3300005937 Bacteria 3776
411 Ga0081455_10069108 3300005937 Bacteria 2938
412 Ga0081540_1000198 3300005983 Bacteria 62526
413 Ga0081540_1001004 3300005983 Bacteria 25337
414 Ga0081540_1004650 3300005983 Bacteria 10385
415 Ga0081540_1008018 3300005983 Bacteria 7431
416 Ga0081540_1010819 3300005983 Bacteria 6134
417 Ga0081540_1012538 3300005983 Bacteria 5570
418 Ga0081540_1025031 3300005983 Bacteria 3448
419 Ga0081540_1027031 3300005983 Bacteria 3260
420 Ga0081539_10000324 3300005985 Bacteria 106549
421 Ga0081539_10000902 3300005985 Bacteria 56412
422 Ga0081539_10001448 3300005985 Bacteria 40582
423 Ga0081539_10052721 3300005985 Bacteria 2282
424 Ga0070717_10000430 3300006028 Bacteria 26747
425 Ga0070717_10000871 3300006028 Bacteria 19955
426 Ga0070717_10040867 3300006028 Bacteria 3780
427 Ga0070717_10083274 3300006028 Bacteria 2689
428 Ga0070717_10091209 3300006028 Bacteria 2572
429 Ga0070717_10179552 3300006028 Bacteria 1844
430 Ga0075365_10000149 3300006038 Bacteria 22126
431 Ga0075365_10013644 3300006038 Bacteria 4870
432 Ga0075365_10013829 3300006038 Bacteria 4842
433 Ga0075365_10067986 3300006038 Bacteria 2393
434 Ga0075365_10138156 3300006038 Bacteria 1690
435 Ga0075365_10146435 3300006038 Bacteria 1641
436 Ga0075363_100004319 3300006048 Bacteria 6189
437 Ga0075363_100027529 3300006048 Bacteria 2915
438 Ga0075363_100047081 3300006048 Bacteria 2289
439 Ga0075363_100083445 3300006048 Bacteria 1751
440 Ga0075364_10022715 3300006051 Bacteria 3965
441 Ga0075364_10024859 3300006051 Bacteria 3808
442 Ga0075364_10077287 3300006051 Bacteria 2197
443 Ga0075364_10130075 3300006051 Bacteria 1689
444 Ga0070715_10002480 3300006163 Bacteria 5673
445 Ga0070716_100005496 3300006173 Bacteria 6143
446 Ga0070716_100078923 3300006173 Bacteria 1959
447 Ga0070712_100000368 3300006175 Bacteria 25505
448 Ga0070712_100000486 3300006175 Bacteria 22668
449 Ga0070712_100004941 3300006175 Bacteria 8250
450 Ga0070712_100006043 3300006175 Bacteria 7496
451 Ga0070712_100006276 3300006175 Bacteria 7364
452 Ga0070712_100020936 3300006175 Bacteria 4286
453 Ga0070712_100026120 3300006175 Bacteria 3887
454 Ga0075362_10000689 3300006177 Bacteria 9992
455 Ga0075362_10051166 3300006177 Bacteria 1848
456 Ga0075362_10098529 3300006177 Bacteria 1364
457 Ga0075367_10002265 3300006178 Bacteria 8713
458 Ga0075367_10061101 3300006178 Bacteria 2248
459 Ga0075367_10103705 3300006178 Bacteria 1740
460 Ga0075367_10104703 3300006178 Bacteria 1732
461 Ga0075367_10188069 3300006178 Bacteria 1288
462 Ga0075369_10003266 3300006186 Bacteria 5891
463 Ga0075369_10011527 3300006186 Bacteria 3480
464 Ga0075369_10025048 3300006186 Bacteria 2478
465 Ga0075369_10053803 3300006186 Bacteria 1747
466 Ga0075369_10092420 3300006186 Bacteria 1351
467 Ga0075366_10002943 3300006195 Bacteria 8861
468 Ga0075366_10003889 3300006195 Bacteria 7962
469 Ga0075366_10015692 3300006195 Bacteria 4347
470 Ga0075366_10021066 3300006195 Bacteria 3789
471 Ga0075366_10041793 3300006195 Bacteria 2714
472 Ga0075366_10103309 3300006195 Bacteria 1711
473 Ga0097621_100003326 3300006237 Bacteria 11060
474 Ga0097621_100011369 3300006237 Bacteria 6551
475 Ga0097621_100019283 3300006237 Bacteria 5232
476 Ga0097621_100024772 3300006237 Bacteria 4690
477 Ga0097621_100043293 3300006237 Bacteria 3629
478 Ga0097621_100093368 3300006237 Bacteria 2521
479 Ga0097621_100127601 3300006237 Bacteria 2162
480 Ga0097621_100156506 3300006237 Bacteria 1956
481 Ga0097621_100164442 3300006237 Bacteria 1909
482 Ga0097621_100167296 3300006237 Bacteria 1893
483 Ga0075370_10044774 3300006353 Bacteria 2502
484 Ga0075370_10049465 3300006353 Bacteria 2383
485 Ga0075370_10082888 3300006353 Bacteria 1844
486 Ga0075370_10160980 3300006353 Bacteria 1317
487 Ga0068871_100000061 3300006358 Bacteria 58884
488 Ga0068871_100000485 3300006358 Bacteria 27172
489 Ga0068871_100014511 3300006358 Bacteria 5878
490 Ga0068871_100017658 3300006358 Bacteria 5404
491 Ga0068871_100023111 3300006358 Bacteria 4802
492 Ga0068871_100062309 3300006358 Bacteria 3047
493 Ga0068871_100090359 3300006358 Bacteria 2550
494 Ga0075428_100053293 3300006844 Bacteria 4432
495 Ga0075428_100155722 3300006844 Bacteria 2482
496 Ga0075430_100001903 3300006846 Bacteria 17110
497 Ga0075430_100098984 3300006846 Bacteria 2436
498 Ga0075431_100001278 3300006847 Bacteria 22946
499 Ga0075431_100024699 3300006847 Bacteria 6162
500 Ga0075431_100031498 3300006847 Bacteria 5463
501 Ga0075431_100126059 3300006847 Bacteria 2642
502 Ga0075433_10010489 3300006852 Bacteria 7438
503 Ga0075434_100055250 3300006871 Bacteria 3945
504 Ga0075434_100107052 3300006871 Bacteria 2806
505 Ga0075434_100143083 3300006871 Bacteria 2412
506 Ga0075434_100153366 3300006871 Bacteria 2324
507 Ga0075434_100191292 3300006871 Bacteria 2067
508 Ga0075434_100267257 3300006871 Bacteria 1729
509 Ga0075434_100288356 3300006871 Bacteria 1661
510 Ga0075429_100097062 3300006880 Bacteria 2571
511 Ga0075429_100134858 3300006880 Bacteria 2160
512 Ga0075429_100309917 3300006880 Bacteria 1382
513 Ga0068865_100001815 3300006881 Bacteria 12539
514 Ga0068865_100023367 3300006881 Bacteria 4047
515 Ga0068865_100125533 3300006881 Bacteria 1915
516 Ga0068865_100137427 3300006881 Bacteria 1838
517 Ga0075436_100001554 3300006914 Bacteria 15658
518 Ga0075436_100002075 3300006914 Bacteria 13825
519 Ga0075436_100007642 3300006914 Bacteria 7386
520 Ga0075436_100019721 3300006914 Bacteria 4623
521 Ga0075436_100035085 3300006914 Bacteria 3460
522 Ga0097620_100009773 3300006931 Bacteria 9689
523 Ga0097620_100057110 3300006931 Bacteria 3931
524 Ga0097620_100076573 3300006931 Bacteria 3386
525 Ga0097620_100089333 3300006931 Bacteria 3131
526 Ga0097620_100172226 3300006931 Unclassified 2246
527 Ga0099824_1008958 3300006942 Bacteria 12537
528 Ga0099822_1009768 3300006943 Bacteria 12016
529 Ga0099823_1018580 3300006944 Bacteria 6697
530 Ga0079104_1000033 3300006946 Bacteria 202636
531 Ga0079104_1001143 3300006946 Bacteria 19316
532 Ga0079104_1008145 3300006946 Bacteria 3707
533 Ga0099826_10000779 3300006948 Bacteria 16911
534 Ga0075435_100007241 3300007076 Bacteria 7897
535 Ga0075435_100066599 3300007076 Bacteria 2931
536 Ga0075435_100189872 3300007076 Bacteria 1739
537 Ga0075435_100315049 3300007076 Bacteria 1339
538 Ga0099794_10096414 3300007265 Bacteria 1472
539 Ga0099795_10028222 3300007788 Bacteria 1906
540 Ga0105251_10024284 3300009011 Bacteria 3113
541 Ga0105244_10077255 3300009036 Bacteria 1652
542 Ga0105240_10000024 3300009093 Bacteria 375919
543 Ga0105240_10002869 3300009093 Bacteria 27260
544 Ga0105240_10011043 3300009093 Bacteria 12630
545 Ga0105240_10016217 3300009093 Bacteria 10096
546 Ga0105240_10053897 3300009093 Bacteria 5044
547 Ga0105240_10072534 3300009093 Bacteria 4255
548 Ga0105240_10079613 3300009093 Bacteria 4031
549 Ga0105240_10089708 3300009093 Bacteria 3760
550 Ga0105240_10163781 3300009093 Bacteria 2639
551 Ga0105240_10179760 3300009093 Bacteria 2498
552 Ga0105240_10226031 3300009093 Bacteria 2178
553 Ga0105240_10293692 3300009093 Bacteria 1862
554 Ga0105240_10338669 3300009093 Bacteria 1709
555 Ga0105240_10357197 3300009093 Bacteria 1656
556 Ga0105240_10360871 3300009093 Bacteria 1646
557 Ga0105240_10365347 3300009093 Bacteria 1633
558 Ga0105240_10402716 3300009093 Bacteria 1541
559 Ga0105240_10418023 3300009093 Bacteria 1507
560 Ga0105240_10425045 3300009093 Bacteria 1492
561 Ga0111539_10002680 3300009094 Bacteria 23585
562 Ga0111539_10004667 3300009094 Bacteria 17913
563 Ga0111539_10253735 3300009094 Bacteria 2048
564 Ga0111539_10466147 3300009094 Bacteria 1471
565 Ga0105245_10001701 3300009098 Bacteria 20027
566 Ga0105245_10004672 3300009098 Bacteria 12105
567 Ga0105245_10017943 3300009098 Bacteria 6180
568 Ga0105245_10035960 3300009098 Bacteria 4397
569 Ga0105245_10066365 3300009098 Bacteria 3265
570 Ga0105245_10130275 3300009098 Bacteria 2359
571 Ga0105245_10326443 3300009098 Bacteria 1513
572 Ga0105247_10017367 3300009101 Bacteria 4320
573 Ga0105247_10053939 3300009101 Bacteria 2481
574 Ga0105247_10222906 3300009101 Bacteria 1277
575 Ga0114129_10017061 3300009147 Bacteria 10336
576 Ga0114129_10053096 3300009147 Bacteria 5685
577 Ga0114129_10068914 3300009147 Bacteria 4931
578 Ga0114129_10170765 3300009147 Bacteria 2965
579 Ga0114129_10189279 3300009147 Bacteria 2795
580 Ga0114129_10268116 3300009147 Bacteria 2285
581 Ga0114129_10275130 3300009147 Bacteria 2252
582 Ga0105243_10002207 3300009148 Bacteria 16402
583 Ga0105243_10031631 3300009148 Bacteria 4080
584 Ga0105243_10083211 3300009148 Bacteria 2618
585 Ga0105243_10086915 3300009148 Bacteria 2565
586 Ga0105243_10178878 3300009148 Bacteria 1843
587 Ga0105243_10367631 3300009148 Bacteria 1326
588 Ga0105241_10000805 3300009174 Bacteria 23823
589 Ga0105241_10010945 3300009174 Bacteria 6653
590 Ga0105241_10037050 3300009174 Bacteria 3673
591 Ga0105241_10037412 3300009174 Bacteria 3656
592 Ga0105241_10076564 3300009174 Bacteria 2610
593 Ga0105241_10076763 3300009174 Bacteria 2606
594 Ga0105241_10127646 3300009174 Bacteria 2055
595 Ga0105241_10166729 3300009174 Bacteria 1816
596 Ga0105242_10004554 3300009176 Bacteria 10756
597 Ga0105242_10024314 3300009176 Bacteria 4783
598 Ga0105242_10044318 3300009176 Bacteria 3602
599 Ga0105242_10045683 3300009176 Bacteria 3550
600 Ga0105248_10000001 3300009177 Bacteria 1881304
601 Ga0105248_10003976 3300009177 Bacteria 16344
602 Ga0105248_10008356 3300009177 Bacteria 11372
603 Ga0105248_10009673 3300009177 Bacteria 10622
604 Ga0105248_10010458 3300009177 Bacteria 10218
605 Ga0105248_10120171 3300009177 Bacteria 2964
606 Ga0105248_10160514 3300009177 Bacteria 2536
607 Ga0105237_10000609 3300009545 Bacteria 49973
608 Ga0105237_10001005 3300009545 Bacteria 37989
609 Ga0105237_10024690 3300009545 Bacteria 6148
610 Ga0105237_10040819 3300009545 Bacteria 4679
611 Ga0105237_10105783 3300009545 Bacteria 2805
612 Ga0105237_10107765 3300009545 Bacteria 2778
613 Ga0105237_10123463 3300009545 Bacteria 2584
614 Ga0105237_10209001 3300009545 Bacteria 1952
615 Ga0105237_10329287 3300009545 Bacteria 1531
616 Ga0105237_10347199 3300009545 Bacteria 1488
617 Ga0105237_10375926 3300009545 Bacteria 1425
618 Ga0105237_10437364 3300009545 Bacteria 1314
619 Ga0105238_10007775 3300009551 Bacteria 10721
620 Ga0105238_10013449 3300009551 Bacteria 8260
621 Ga0105238_10031532 3300009551 Bacteria 5397
622 Ga0105238_10052112 3300009551 Bacteria 4114
623 Ga0105238_10077409 3300009551 Bacteria 3317
624 Ga0105238_10086980 3300009551 Unclassified 3113
625 Ga0105238_10169694 3300009551 Bacteria 2158
626 Ga0105238_10177712 3300009551 Bacteria 2105
627 Ga0105238_10258291 3300009551 Bacteria 1721
628 Ga0105238_10330648 3300009551 Bacteria 1511
629 Ga0105238_10341904 3300009551 Bacteria 1485
630 Ga0105249_10010582 3300009553 Bacteria 8106
631 Ga0105249_10012291 3300009553 Bacteria 7544
632 Ga0105249_10015216 3300009553 Bacteria 6808
633 Ga0105249_10048633 3300009553 Bacteria 3866
634 Ga0105249_10048821 3300009553 Bacteria 3859
635 Ga0105249_10112897 3300009553 Bacteria 2570
636 Ga0105249_10231661 3300009553 Bacteria 1822
637 Ga0105249_10412181 3300009553 Bacteria 1383
638 Ga0123342_1026828 3300009766 Bacteria 3294
639 Ga0105033_101895 3300009986 Bacteria 1727
640 Ga0099796_10016259 3300010159 Bacteria 2193
641 Ga0105239_10003536 3300010375 Bacteria 19113
642 Ga0105239_10007900 3300010375 Bacteria 12162
643 Ga0105239_10009412 3300010375 Bacteria 11018
644 Ga0105239_10014257 3300010375 Bacteria 8824
645 Ga0105239_10070177 3300010375 Bacteria 3849
646 Ga0105239_10071773 3300010375 Bacteria 3804
647 Ga0105239_10085636 3300010375 Bacteria 3473
648 Ga0105239_10092070 3300010375 Bacteria 3346
649 Ga0105239_10109291 3300010375 Bacteria 3064
650 Ga0105239_10175100 3300010375 Bacteria 2400
651 Ga0105239_10198109 3300010375 Bacteria 2250
652 Ga0105239_10210011 3300010375 Bacteria 2182
653 Ga0105239_10230087 3300010375 Bacteria 2080
654 Ga0105239_10293883 3300010375 Bacteria 1829
655 Ga0105239_10367891 3300010375 Bacteria 1624
656 Ga0105239_10493147 3300010375 Bacteria 1392
657 Ga0105239_10535351 3300010375 Bacteria 1333
658 Ga0105239_10623077 3300010375 Bacteria 1231
659 Ga0105246_10002092 3300011119 Bacteria 12025
660 Ga0105246_10012017 3300011119 Bacteria 5393
661 Ga0105246_10041896 3300011119 Bacteria 3098
662 Ga0105246_10064796 3300011119 Bacteria 2554
663 Ga0105246_10103054 3300011119 Bacteria 2082
664 Ga0105246_10116645 3300011119 Bacteria 1971
665 Ga0157314_1001419 3300012500 Bacteria 1723
666 Ga0157373_10008938 3300013100 Bacteria 7410
667 Ga0157373_10034908 3300013100 Bacteria 3611
668 Ga0157373_10154896 3300013100 Bacteria 1612
669 Ga0157371_10000004 3300013102 Bacteria 512593
670 Ga0157371_10003085 3300013102 Bacteria 15439
671 Ga0157371_10017626 3300013102 Bacteria 5298
672 Ga0157371_10032640 3300013102 Bacteria 3745
673 Ga0157370_10000185 3300013104 Bacteria 78153
674 Ga0157370_10003095 3300013104 Bacteria 19696
675 Ga0157370_10007220 3300013104 Bacteria 12125
676 Ga0157370_10014696 3300013104 Bacteria 7996
677 Ga0157370_10060828 3300013104 Bacteria 3585
678 Ga0157370_10064602 3300013104 Bacteria 3465
679 Ga0157370_10079982 3300013104 Bacteria 3078
680 Ga0157370_10350412 3300013104 Bacteria 1361
681 Ga0157369_10011139 3300013105 Bacteria 10224
682 Ga0157369_10011642 3300013105 Bacteria 9986
683 Ga0157369_10014944 3300013105 Bacteria 8762
684 Ga0157369_10069674 3300013105 Bacteria 3778
685 Ga0157369_10113374 3300013105 Bacteria 2880
686 Ga0157369_10123092 3300013105 Bacteria 2751
687 Ga0157369_10181635 3300013105 Bacteria 2213
688 Ga0157369_10233683 3300013105 Bacteria 1922
689 Ga0171463_1001 3300013249 Bacteria 1406070
690 Ga0157374_10006560 3300013296 Bacteria 9880
691 Ga0157374_10048025 3300013296 Bacteria 3960
692 Ga0157378_10011410 3300013297 Bacteria 7779
693 Ga0157378_10079622 3300013297 Unclassified 2958
694 Ga0157378_10140119 3300013297 Bacteria 2245
695 Ga0157378_10453416 3300013297 Bacteria 1273
696 Ga0163162_10004482 3300013306 Bacteria 13457
697 Ga0163162_10009997 3300013306 Bacteria 9227
698 Ga0163162_10068764 3300013306 Bacteria 3593
699 Ga0163162_10075923 3300013306 Bacteria 3422
700 Ga0163162_10094581 3300013306 Bacteria 3074
701 Ga0163162_10217030 3300013306 Bacteria 2043
702 Ga0163162_10319613 3300013306 Bacteria 1685
703 Ga0163162_10440011 3300013306 Bacteria 1436
704 Ga0163162_10557338 3300013306 Bacteria 1274
705 Ga0157372_10015370 3300013307 Bacteria 8202
706 Ga0157372_10016173 3300013307 Bacteria 8004
707 Ga0157372_10183099 3300013307 Bacteria 2425
708 Ga0157372_10284121 3300013307 Bacteria 1924
709 Ga0157372_10485852 3300013307 Bacteria 1440
710 Ga0157372_10658310 3300013307 Bacteria 1220
711 Ga0157375_10001699 3300013308 Bacteria 18899
712 Ga0157375_10029577 3300013308 Bacteria 5155
713 Ga0157375_10049620 3300013308 Bacteria 4113
714 Ga0157375_10062038 3300013308 Bacteria 3713
715 Ga0157375_10172782 3300013308 Bacteria 2309
716 Ga0163163_10000016 3300014325 Bacteria 213966
717 Ga0163163_10001518 3300014325 Bacteria 19614
718 Ga0163163_10005423 3300014325 Bacteria 11027
719 Ga0163163_10010700 3300014325 Bacteria 8270
720 Ga0163163_10039573 3300014325 Bacteria 4602
721 Ga0163163_10112471 3300014325 Bacteria 2752
722 Ga0163163_10145640 3300014325 Bacteria 2412
723 Ga0157380_10050097 3300014326 Bacteria 3297
724 Ga0157380_10062544 3300014326 Bacteria 2982
725 Ga0157380_10067319 3300014326 Bacteria 2883
726 Ga0157380_10188800 3300014326 Bacteria 1817
727 Ga0157379_10001175 3300014968 Bacteria 21338
728 Ga0157379_10004716 3300014968 Bacteria 11706
729 Ga0157379_10008135 3300014968 Bacteria 9109
730 Ga0157379_10047441 3300014968 Bacteria 3832
731 Ga0157379_10070553 3300014968 Bacteria 3126
732 Ga0157379_10138901 3300014968 Bacteria 2190
733 Ga0157379_10177524 3300014968 Bacteria 1923
734 Ga0157379_10191895 3300014968 Bacteria 1846
735 Ga0157379_10370992 3300014968 Bacteria 1312
736 Ga0157376_10000696 3300014969 Bacteria 21738
737 Ga0157376_10007981 3300014969 Bacteria 7596
738 Ga0157376_10012407 3300014969 Bacteria 6325
739 Ga0157376_10091886 3300014969 Bacteria 2630
740 Ga0182007_10005494 3300015262 Bacteria 5560
741 Ga0182005_1006513 3300015265 Bacteria 3559
742 Ga0182005_1006522 3300015265 Bacteria 3555
743 Ga0163161_10002208 3300017792 Bacteria 14038
744 Ga0163161_10037237 3300017792 Bacteria 3487
745 Ga0163161_10053334 3300017792 Bacteria 2932
746 Ga0163161_10152836 3300017792 Bacteria 1755
747 Ga0214544_1000003 3300021320 Bacteria 643752
748 Ga0214544_1002289 3300021320 Bacteria 40409
749 Ga0214542_1000003 3300021321 Bacteria 435700
750 Ga0214542_1001074 3300021321 Bacteria 54628
751 Ga0214545_1000004 3300021324 Bacteria 453352
752 Ga0214543_1000007 3300021327 Bacteria 414744
753 Ga0214543_1000897 3300021327 Bacteria 54534
754 Ga0213874_10003946 3300021377 Bacteria 3337
755 Ga0213874_10009062 3300021377 Bacteria 2447
756 Ga0213874_10010433 3300021377 Bacteria 2326
757 Ga0213876_10000162 3300021384 Bacteria 70123
758 Ga0213876_10000736 3300021384 Bacteria 22718
759 Ga0213876_10000956 3300021384 Bacteria 19001
760 Ga0213876_10002341 3300021384 Bacteria 11172
761 Ga0213876_10042416 3300021384 Bacteria 2404
762 Ga0213875_10000011 3300021388 Bacteria 332447
763 Ga0228711_1000041 3300022739 Bacteria 86591
764 Ga0228710_1000024 3300022740 Bacteria 106694
765 Ga0209435_100026 3300025206 Bacteria 198295
766 Ga0209436_100006 3300025208 Bacteria 150277
767 Ga0209436_100694 3300025208 Bacteria 14208
768 Ga0209436_107314 3300025208 Bacteria 2321
769 Ga0209672_104703 3300025228 Bacteria 2483
770 Ga0209437_100196 3300025233 Bacteria 121199
771 Ga0207425_1004254 3300025245 Bacteria 4343
772 Ga0209646_1000084 3300025246 Bacteria 198295
773 Ga0209026_1000013 3300025250 Bacteria 415633
774 Ga0209026_1000080 3300025250 Bacteria 198295
775 Ga0209677_100341 3300025253 Bacteria 29761
776 Ga0209677_104070 3300025253 Bacteria 4394
777 Ga0209148_1000210 3300025254 Bacteria 102885
778 Ga0209148_1000904 3300025254 Bacteria 20182
779 Ga0209148_1012713 3300025254 Bacteria 1531
780 Ga0209759_1000061 3300025256 Bacteria 198295
781 Ga0209759_1000149 3300025256 Bacteria 120932
782 Ga0209129_1000206 3300025258 Bacteria 68903
783 Ga0209129_1000999 3300025258 Bacteria 16857
784 Ga0209129_1001939 3300025258 Bacteria 10837
785 Ga0209129_1001947 3300025258 Bacteria 10816
786 Ga0209129_1002038 3300025258 Bacteria 10450
787 Ga0209129_1003662 3300025258 Bacteria 6542
788 Ga0209233_1000006 3300025261 Bacteria 1473685
789 Ga0209233_1000034 3300025261 Bacteria 578898
790 Ga0209233_1000037 3300025261 Bacteria 554620
791 Ga0209233_1000243 3300025261 Bacteria 90170
792 Ga0209233_1000347 3300025261 Bacteria 44128
793 Ga0209233_1001513 3300025261 Bacteria 9126
794 Ga0209233_1008280 3300025261 Bacteria 3230
795 Ga0209233_1024792 3300025261 Bacteria 1494
796 Ga0207666_1000245 3300025271 Bacteria 7999
797 Ga0209455_1000098 3300025272 Bacteria 213890
798 Ga0209673_1000024 3300025273 Bacteria 409632
799 Ga0209673_1000063 3300025273 Bacteria 256709
800 Ga0209673_1002616 3300025273 Bacteria 12098
801 Ga0209673_1004882 3300025273 Bacteria 6995
802 Ga0209673_1009839 3300025273 Bacteria 4094
803 Ga0209130_1000002 3300025284 Bacteria 722648
804 Ga0209130_1000005 3300025284 Bacteria 599620
805 Ga0209130_1000028 3300025284 Bacteria 325668
806 Ga0207673_1001360 3300025290 Bacteria 2654
807 Ga0209676_1005562 3300025292 Bacteria 6524
808 Ga0209676_1007284 3300025292 Bacteria 5238
809 Ga0209676_1013715 3300025292 Bacteria 3098
810 Ga0209025_1000037 3300025294 Bacteria 383429
811 Ga0209025_1000060 3300025294 Bacteria 305017
812 Ga0209025_1000479 3300025294 Bacteria 77489
813 Ga0209025_1001859 3300025294 Bacteria 24728
814 Ga0209025_1004322 3300025294 Bacteria 12420
815 Ga0209025_1009455 3300025294 Bacteria 6786
816 Ga0209025_1026074 3300025294 Bacteria 2948
817 Ga0209025_1045214 3300025294 Bacteria 1828
818 Ga0209025_1045621 3300025294 Bacteria 1814
819 Ga0209564_1000093 3300025295 Bacteria 245793
820 Ga0209564_1000316 3300025295 Bacteria 94849
821 Ga0209564_1001013 3300025295 Bacteria 34890
822 Ga0209564_1002417 3300025295 Bacteria 14822
823 Ga0209564_1004476 3300025295 Bacteria 8530
824 Ga0209564_1030254 3300025295 Bacteria 1680
825 Ga0209758_1000015 3300025297 Bacteria 851943
826 Ga0209758_1000032 3300025297 Bacteria 481623
827 Ga0209758_1000361 3300025297 Bacteria 81006
828 Ga0209758_1000389 3300025297 Bacteria 75919
829 Ga0209758_1000441 3300025297 Bacteria 69800
830 Ga0209758_1000499 3300025297 Bacteria 63732
831 Ga0209758_1000716 3300025297 Bacteria 48984
832 Ga0209758_1000994 3300025297 Bacteria 37824
833 Ga0209758_1001131 3300025297 Bacteria 34274
834 Ga0209758_1001467 3300025297 Bacteria 27671
835 Ga0209758_1005099 3300025297 Bacteria 10398
836 Ga0209758_1006317 3300025297 Bacteria 8595
837 Ga0209758_1008231 3300025297 Bacteria 6829
838 Ga0209758_1008275 3300025297 Bacteria 6803
839 Ga0209758_1050415 3300025297 Bacteria 1459
840 Ga0209050_1002860 3300025298 Bacteria 13672
841 Ga0209050_1015945 3300025298 Bacteria 3111
842 Ga0209050_1032075 3300025298 Bacteria 1623
843 Ga0209256_1000027 3300025299 Bacteria 423283
844 Ga0209256_1000880 3300025299 Bacteria 37115
845 Ga0209256_1000996 3300025299 Bacteria 33661
846 Ga0209256_1001570 3300025299 Bacteria 22473
847 Ga0209256_1006347 3300025299 Bacteria 6307
848 Ga0209256_1011131 3300025299 Bacteria 3643
849 Ga0209256_1018445 3300025299 Bacteria 2266
850 Ga0209256_1022145 3300025299 Bacteria 1932
851 Ga0209256_1027358 3300025299 Bacteria 1626
852 Ga0207426_1000012 3300025302 Bacteria 730942
853 Ga0207426_1000013 3300025302 Bacteria 721897
854 Ga0207426_1000015 3300025302 Bacteria 599316
855 Ga0207426_1000070 3300025302 Bacteria 331559
856 Ga0207426_1000380 3300025302 Bacteria 76046
857 Ga0207426_1000832 3300025302 Bacteria 32765
858 Ga0207426_1031005 3300025302 Bacteria 1748
859 Ga0209051_1000135 3300025303 Bacteria 138142
860 Ga0209051_1003098 3300025303 Bacteria 11215
861 Ga0209051_1004984 3300025303 Bacteria 7929
862 Ga0209257_1003856 3300025304 Bacteria 12259
863 Ga0209257_1004510 3300025304 Bacteria 10718
864 Ga0209257_1008097 3300025304 Bacteria 6113
865 Ga0209257_1008641 3300025304 Bacteria 5713
866 Ga0207697_10003263 3300025315 Bacteria 8062
867 Ga0207697_10017104 3300025315 Bacteria 2980
868 Ga0207713_1018221 3300025735 Bacteria 3482
869 Ga0207682_10000793 3300025893 Bacteria 14622
870 Ga0207682_10002657 3300025893 Bacteria 7958
871 Ga0207692_10000982 3300025898 Bacteria 10396
872 Ga0207692_10011557 3300025898 Bacteria 3762
873 Ga0207692_10018412 3300025898 Bacteria 3136
874 Ga0207710_10007749 3300025900 Bacteria 4543
875 Ga0207710_10017846 3300025900 Bacteria 3013
876 Ga0207710_10098202 3300025900 Bacteria 1378
877 Ga0207688_10000420 3300025901 Bacteria 19959
878 Ga0207688_10003340 3300025901 Bacteria 8770
879 Ga0207688_10029653 3300025901 Bacteria 3013
880 Ga0207688_10054535 3300025901 Bacteria 2243
881 Ga0207680_10001536 3300025903 Bacteria 10856
882 Ga0207680_10021195 3300025903 Bacteria 3513
883 Ga0207680_10026718 3300025903 Bacteria 3203
884 Ga0207680_10155174 3300025903 Bacteria 1530
885 Ga0207647_10004676 3300025904 Bacteria 10143
886 Ga0207685_10035749 3300025905 Bacteria 1815
887 Ga0207699_10000117 3300025906 Bacteria 56016
888 Ga0207699_10000580 3300025906 Bacteria 17999
889 Ga0207699_10003211 3300025906 Bacteria 7783
890 Ga0207699_10022340 3300025906 Bacteria 3426
891 Ga0207699_10043170 3300025906 Bacteria 2618
892 Ga0207699_10051356 3300025906 Bacteria 2436
893 Ga0207699_10082937 3300025906 Bacteria 1993
894 Ga0207699_10154436 3300025906 Bacteria 1522
895 Ga0207645_10000668 3300025907 Bacteria 28444
896 Ga0207645_10010809 3300025907 Bacteria 6255
897 Ga0207643_10000085 3300025908 Bacteria 61372
898 Ga0207643_10006188 3300025908 Bacteria 6405
899 Ga0207705_10000098 3300025909 Bacteria 104428
900 Ga0207705_10015487 3300025909 Bacteria 5471
901 Ga0207705_10053776 3300025909 Bacteria 2901
902 Ga0207705_10097660 3300025909 Bacteria 2157
903 Ga0207684_10000940 3300025910 Bacteria 32878
904 Ga0207684_10043573 3300025910 Bacteria 3805
905 Ga0207684_10104849 3300025910 Bacteria 2418
906 Ga0207684_10154836 3300025910 Bacteria 1973
907 Ga0207684_10195213 3300025910 Bacteria 1746
908 Ga0207654_10000373 3300025911 Bacteria 26098
909 Ga0207654_10042061 3300025911 Bacteria 2584
910 Ga0207707_10000712 3300025912 Bacteria 33048
911 Ga0207707_10001764 3300025912 Bacteria 19860
912 Ga0207707_10002643 3300025912 Bacteria 16011
913 Ga0207707_10003697 3300025912 Bacteria 13560
914 Ga0207707_10011682 3300025912 Bacteria 7643
915 Ga0207707_10021722 3300025912 Bacteria 5610
916 Ga0207707_10025948 3300025912 Bacteria 5123
917 Ga0207707_10076679 3300025912 Bacteria 2917
918 Ga0207707_10082304 3300025912 Bacteria 2810
919 Ga0207707_10115723 3300025912 Bacteria 2343
920 Ga0207695_10000036 3300025913 Bacteria 477897
921 Ga0207695_10000065 3300025913 Bacteria 336949
922 Ga0207695_10000463 3300025913 Bacteria 88316
923 Ga0207695_10010533 3300025913 Bacteria 11306
924 Ga0207695_10012494 3300025913 Bacteria 10187
925 Ga0207695_10017799 3300025913 Bacteria 8244
926 Ga0207695_10025904 3300025913 Bacteria 6555
927 Ga0207695_10028657 3300025913 Bacteria 6166
928 Ga0207695_10035315 3300025913 Bacteria 5424
929 Ga0207695_10087383 3300025913 Bacteria 3140
930 Ga0207695_10136948 3300025913 Bacteria 2401
931 Ga0207695_10351034 3300025913 Bacteria 1362
932 Ga0207695_10362944 3300025913 Bacteria 1335
933 Ga0207671_10000153 3300025914 Bacteria 107114
934 Ga0207671_10000368 3300025914 Bacteria 64246
935 Ga0207671_10006714 3300025914 Bacteria 10192
936 Ga0207671_10053437 3300025914 Bacteria 2993
937 Ga0207671_10149586 3300025914 Bacteria 1804
938 Ga0207671_10159338 3300025914 Bacteria 1747
939 Ga0207693_10000129 3300025915 Bacteria 67940
940 Ga0207693_10000331 3300025915 Bacteria 43711
941 Ga0207693_10004868 3300025915 Bacteria 11295
942 Ga0207693_10005739 3300025915 Bacteria 10302
943 Ga0207693_10006352 3300025915 Bacteria 9794
944 Ga0207693_10016937 3300025915 Bacteria 5820
945 Ga0207693_10031231 3300025915 Bacteria 4208
946 Ga0207693_10033231 3300025915 Bacteria 4071
947 Ga0207693_10049973 3300025915 Bacteria 3284
948 Ga0207693_10064475 3300025915 Bacteria 2870
949 Ga0207693_10149018 3300025915 Bacteria 1840
950 Ga0207693_10149408 3300025915 Bacteria 1837
951 Ga0207663_10003606 3300025916 Bacteria 7600
952 Ga0207663_10021388 3300025916 Bacteria 3682
953 Ga0207663_10045009 3300025916 Bacteria 2712
954 Ga0207663_10059389 3300025916 Bacteria 2419
955 Ga0207663_10138879 3300025916 Bacteria 1690
956 Ga0207663_10228171 3300025916 Bacteria 1359
957 Ga0207663_10237299 3300025916 Bacteria 1335
958 Ga0207660_10002189 3300025917 Bacteria 12932
959 Ga0207660_10024969 3300025917 Bacteria 4052
960 Ga0207660_10032656 3300025917 Bacteria 3594
961 Ga0207660_10050924 3300025917 Bacteria 2942
962 Ga0207660_10051959 3300025917 Bacteria 2916
963 Ga0207660_10102538 3300025917 Bacteria 2139
964 Ga0207660_10222624 3300025917 Bacteria 1481
965 Ga0207662_10000730 3300025918 Bacteria 15052
966 Ga0207662_10008274 3300025918 Bacteria 5693
967 Ga0207662_10021184 3300025918 Bacteria 3712
968 Ga0207657_10000153 3300025919 Bacteria 70479
969 Ga0207657_10004333 3300025919 Bacteria 15034
970 Ga0207657_10006720 3300025919 Bacteria 11881
971 Ga0207657_10007287 3300025919 Bacteria 11348
972 Ga0207657_10007870 3300025919 Bacteria 10880
973 Ga0207657_10007912 3300025919 Bacteria 10842
974 Ga0207657_10016322 3300025919 Bacteria 7164
975 Ga0207657_10045027 3300025919 Bacteria 3876
976 Ga0207657_10063022 3300025919 Bacteria 3172
977 Ga0207657_10092842 3300025919 Bacteria 2515
978 Ga0207657_10113800 3300025919 Bacteria 2232
979 Ga0207657_10175434 3300025919 Bacteria 1735
980 Ga0207649_10000036 3300025920 Bacteria 132545
981 Ga0207649_10000476 3300025920 Bacteria 28654
982 Ga0207649_10083231 3300025920 Bacteria 2076
983 Ga0207652_10003058 3300025921 Bacteria 13968
984 Ga0207652_10019464 3300025921 Bacteria 5584
985 Ga0207652_10023401 3300025921 Bacteria 5117
986 Ga0207652_10025482 3300025921 Bacteria 4918
987 Ga0207652_10030322 3300025921 Bacteria 4527
988 Ga0207652_10030811 3300025921 Bacteria 4496
989 Ga0207652_10032981 3300025921 Bacteria 4359
990 Ga0207652_10044187 3300025921 Bacteria 3795
991 Ga0207652_10081669 3300025921 Bacteria 2827
992 Ga0207652_10082331 3300025921 Bacteria 2816
993 Ga0207652_10086698 3300025921 Bacteria 2745
994 Ga0207652_10179247 3300025921 Bacteria 1903
995 Ga0207652_10185000 3300025921 Bacteria 1873
996 Ga0207652_10200219 3300025921 Unclassified 1797
997 Ga0207646_10001375 3300025922 Bacteria 30160
998 Ga0207681_10001971 3300025923 Bacteria 13167
999 Ga0207681_10022214 3300025923 Bacteria 4044
1000 Ga0207681_10115583 3300025923 Bacteria 1959
1001 Ga0207694_10000234 3300025924 Bacteria 53453
1002 Ga0207694_10005148 3300025924 Bacteria 10091
1003 Ga0207694_10008965 3300025924 Bacteria 7553
1004 Ga0207694_10020734 3300025924 Bacteria 4975
1005 Ga0207694_10071185 3300025924 Bacteria 2717
1006 Ga0207694_10072352 3300025924 Bacteria 2695
1007 Ga0207694_10117451 3300025924 Bacteria 2121
1008 Ga0207694_10215102 3300025924 Bacteria 1566
1009 Ga0207650_10030467 3300025925 Bacteria 3886
1010 Ga0207650_10081358 3300025925 Bacteria 2457
1011 Ga0207650_10139793 3300025925 Bacteria 1902
1012 Ga0207659_10014624 3300025926 Bacteria 5066
1013 Ga0207659_10151281 3300025926 Bacteria 1812
1014 Ga0207659_10185649 3300025926 Bacteria 1651
1015 Ga0207687_10001321 3300025927 Bacteria 16972
1016 Ga0207687_10006403 3300025927 Bacteria 7777
1017 Ga0207700_10000034 3300025928 Bacteria 120519
1018 Ga0207700_10001911 3300025928 Bacteria 11850
1019 Ga0207700_10042507 3300025928 Bacteria 3332
1020 Ga0207700_10046008 3300025928 Bacteria 3224
1021 Ga0207700_10056151 3300025928 Bacteria 2963
1022 Ga0207700_10084009 3300025928 Bacteria 2494
1023 Ga0207664_10002339 3300025929 Bacteria 12535
1024 Ga0207664_10008566 3300025929 Bacteria 7144
1025 Ga0207664_10024019 3300025929 Bacteria 4576
1026 Ga0207664_10032068 3300025929 Bacteria 4025
1027 Ga0207664_10037822 3300025929 Bacteria 3737
1028 Ga0207664_10041979 3300025929 Bacteria 3567
1029 Ga0207664_10055277 3300025929 Bacteria 3150
1030 Ga0207644_10000759 3300025931 Bacteria 20458
1031 Ga0207644_10013576 3300025931 Bacteria 5434
1032 Ga0207644_10115802 3300025931 Bacteria 2033
1033 Ga0207690_10004643 3300025932 Bacteria 8126
1034 Ga0207690_10028730 3300025932 Bacteria 3527
1035 Ga0207690_10083505 3300025932 Bacteria 2237
1036 Ga0207706_10006279 3300025933 Bacteria 11043
1037 Ga0207706_10013252 3300025933 Bacteria 7501
1038 Ga0207706_10023730 3300025933 Bacteria 5504
1039 Ga0207706_10064181 3300025933 Bacteria 3233
1040 Ga0207706_10081410 3300025933 Bacteria 2845
1041 Ga0207686_10000682 3300025934 Bacteria 21032
1042 Ga0207686_10019092 3300025934 Bacteria 3892
1043 Ga0207686_10019901 3300025934 Bacteria 3827
1044 Ga0207686_10194692 3300025934 Bacteria 1447
1045 Ga0207709_10001961 3300025935 Bacteria 13443
1046 Ga0207709_10119269 3300025935 Bacteria 1778
1047 Ga0207709_10122069 3300025935 Bacteria 1761
1048 Ga0207670_10000908 3300025936 Bacteria 15642
1049 Ga0207670_10001158 3300025936 Bacteria 13899
1050 Ga0207670_10046212 3300025936 Bacteria 2891
1051 Ga0207669_10000129 3300025937 Bacteria 37620
1052 Ga0207669_10002174 3300025937 Bacteria 8323
1053 Ga0207669_10042606 3300025937 Bacteria 2651
1054 Ga0207669_10099037 3300025937 Bacteria 1921
1055 Ga0207704_10000366 3300025938 Bacteria 20998
1056 Ga0207704_10065946 3300025938 Bacteria 2270
1057 Ga0207665_10001517 3300025939 Bacteria 15630
1058 Ga0207665_10010246 3300025939 Bacteria 6158
1059 Ga0207665_10014078 3300025939 Bacteria 5262
1060 Ga0207665_10108718 3300025939 Bacteria 1946
1061 Ga0207691_10009097 3300025940 Bacteria 9533
1062 Ga0207691_10010088 3300025940 Bacteria 9064
1063 Ga0207691_10032246 3300025940 Bacteria 4886
1064 Ga0207691_10108228 3300025940 Bacteria 2474
1065 Ga0207691_10123790 3300025940 Bacteria 2289
1066 Ga0207691_10149858 3300025940 Bacteria 2051
1067 Ga0207691_10240513 3300025940 Bacteria 1565
1068 Ga0207711_10000001 3300025941 Bacteria 1325674
1069 Ga0207711_10002466 3300025941 Bacteria 16510
1070 Ga0207711_10006567 3300025941 Bacteria 9792
1071 Ga0207711_10018280 3300025941 Bacteria 5826
1072 Ga0207711_10024942 3300025941 Bacteria 5015
1073 Ga0207711_10032756 3300025941 Bacteria 4395
1074 Ga0207711_10107637 3300025941 Bacteria 2475
1075 Ga0207711_10116431 3300025941 Bacteria 2383
1076 Ga0207711_10149547 3300025941 Bacteria 2106
1077 Ga0207711_10239961 3300025941 Unclassified 1662
1078 Ga0207689_10002200 3300025942 Bacteria 18279
1079 Ga0207689_10005044 3300025942 Bacteria 11901
1080 Ga0207689_10022709 3300025942 Bacteria 5271
1081 Ga0207689_10075138 3300025942 Bacteria 2777
1082 Ga0207661_10000373 3300025944 Bacteria 28733
1083 Ga0207661_10028645 3300025944 Bacteria 4268
1084 Ga0207661_10053290 3300025944 Bacteria 3236
1085 Ga0207679_10001125 3300025945 Bacteria 17047
1086 Ga0207679_10159017 3300025945 Bacteria 1848
1087 Ga0207667_10008754 3300025949 Bacteria 11993
1088 Ga0207667_10027939 3300025949 Bacteria 6131
1089 Ga0207667_10057349 3300025949 Bacteria 4088
1090 Ga0207667_10071532 3300025949 Bacteria 3606
1091 Ga0207667_10111808 3300025949 Bacteria 2817
1092 Ga0207667_10120347 3300025949 Bacteria 2705
1093 Ga0207667_10150877 3300025949 Bacteria 2392
1094 Ga0207667_10242720 3300025949 Bacteria 1843
1095 Ga0207667_10249845 3300025949 Bacteria 1814
1096 Ga0207667_10305416 3300025949 Bacteria 1625
1097 Ga0207651_10002032 3300025960 Bacteria 9512
1098 Ga0207651_10018513 3300025960 Bacteria 4147
1099 Ga0207651_10053932 3300025960 Bacteria 2751
1100 Ga0207651_10100407 3300025960 Bacteria 2145
1101 Ga0207651_10111583 3300025960 Bacteria 2054
1102 Ga0207651_10139475 3300025960 Bacteria 1870
1103 Ga0207712_10002238 3300025961 Bacteria 12597
1104 Ga0207712_10007235 3300025961 Bacteria 6999
1105 Ga0207712_10010612 3300025961 Bacteria 5847
1106 Ga0207668_10001143 3300025972 Bacteria 15797
1107 Ga0207668_10048012 3300025972 Bacteria 2927
1108 Ga0207640_10002628 3300025981 Bacteria 9626
1109 Ga0207640_10005345 3300025981 Bacteria 7001
1110 Ga0207640_10040970 3300025981 Bacteria 2943
1111 Ga0207640_10135178 3300025981 Bacteria 1789
1112 Ga0207640_10188810 3300025981 Bacteria 1551
1113 Ga0207658_10032342 3300025986 Bacteria 3723
1114 Ga0207658_10112104 3300025986 Bacteria 2158
1115 Ga0207658_10133906 3300025986 Bacteria 1995
1116 Ga0207658_10217747 3300025986 Bacteria 1604
1117 Ga0207677_10008931 3300026023 Bacteria 5620
1118 Ga0207677_10054654 3300026023 Bacteria 2726
1119 Ga0207703_10001627 3300026035 Bacteria 20231
1120 Ga0207703_10040942 3300026035 Bacteria 3710
1121 Ga0207703_10066189 3300026035 Bacteria 2972
1122 Ga0207703_10072186 3300026035 Bacteria 2853
1123 Ga0207703_10093312 3300026035 Bacteria 2535
1124 Ga0207703_10224192 3300026035 Unclassified 1682
1125 Ga0207703_10360406 3300026035 Bacteria 1341
1126 Ga0207639_10005334 3300026041 Bacteria 8683
1127 Ga0207639_10017709 3300026041 Bacteria 5052
1128 Ga0207639_10020276 3300026041 Bacteria 4756
1129 Ga0207639_10051471 3300026041 Bacteria 3132
1130 Ga0207639_10070142 3300026041 Bacteria 2737
1131 Ga0207639_10100102 3300026041 Bacteria 2340
1132 Ga0207639_10104697 3300026041 Bacteria 2294
1133 Ga0207678_10006198 3300026067 Bacteria 10623
1134 Ga0207678_10010758 3300026067 Bacteria 8039
1135 Ga0207678_10011656 3300026067 Bacteria 7720
1136 Ga0207678_10016458 3300026067 Bacteria 6492
1137 Ga0207678_10022779 3300026067 Bacteria 5485
1138 Ga0207678_10022967 3300026067 Bacteria 5458
1139 Ga0207678_10023304 3300026067 Bacteria 5415
1140 Ga0207678_10082104 3300026067 Bacteria 2758
1141 Ga0207678_10087885 3300026067 Bacteria 2656
1142 Ga0207678_10096372 3300026067 Bacteria 2528
1143 Ga0207678_10103124 3300026067 Bacteria 2435
1144 Ga0207678_10117401 3300026067 Bacteria 2270
1145 Ga0207678_10145785 3300026067 Bacteria 2021
1146 Ga0207678_10188826 3300026067 Bacteria 1760
1147 Ga0207708_10002247 3300026075 Bacteria 14219
1148 Ga0207708_10007573 3300026075 Bacteria 8033
1149 Ga0207708_10025846 3300026075 Bacteria 4443
1150 Ga0207708_10103915 3300026075 Bacteria 2201
1151 Ga0207702_10000007 3300026078 Bacteria 332551
1152 Ga0207702_10000355 3300026078 Bacteria 52521
1153 Ga0207702_10000936 3300026078 Bacteria 30149
1154 Ga0207702_10026745 3300026078 Unclassified 4790
1155 Ga0207702_10028018 3300026078 Bacteria 4680
1156 Ga0207702_10031870 3300026078 Bacteria 4397
1157 Ga0207702_10084328 3300026078 Bacteria 2766
1158 Ga0207702_10084880 3300026078 Bacteria 2758
1159 Ga0207702_10093888 3300026078 Bacteria 2632
1160 Ga0207702_10101943 3300026078 Unclassified 2536
1161 Ga0207702_10105447 3300026078 Bacteria 2496
1162 Ga0207702_10188967 3300026078 Bacteria 1902
1163 Ga0207702_10312098 3300026078 Bacteria 1495
1164 Ga0207702_10343354 3300026078 Bacteria 1427
1165 Ga0207702_10355669 3300026078 Bacteria 1402
1166 Ga0207641_10002374 3300026088 Bacteria 17373
1167 Ga0207641_10003773 3300026088 Bacteria 13304
1168 Ga0207641_10026025 3300026088 Bacteria 4827
1169 Ga0207641_10031833 3300026088 Bacteria 4376
1170 Ga0207641_10074215 3300026088 Bacteria 2933
1171 Ga0207641_10088023 3300026088 Bacteria 2711
1172 Ga0207648_10001362 3300026089 Bacteria 26996
1173 Ga0207648_10006107 3300026089 Bacteria 12010
1174 Ga0207648_10018074 3300026089 Bacteria 6386
1175 Ga0207648_10037140 3300026089 Bacteria 4290
1176 Ga0207648_10040603 3300026089 Bacteria 4088
1177 Ga0207648_10074288 3300026089 Bacteria 2963
1178 Ga0207648_10159654 3300026089 Bacteria 1991
1179 Ga0207648_10218661 3300026089 Bacteria 1693
1180 Ga0207676_10001403 3300026095 Bacteria 17929
1181 Ga0207676_10003182 3300026095 Bacteria 11695
1182 Ga0207676_10023801 3300026095 Bacteria 4525
1183 Ga0207676_10058371 3300026095 Bacteria 3044
1184 Ga0207676_10222121 3300026095 Bacteria 1683
1185 Ga0207674_10004202 3300026116 Bacteria 17377
1186 Ga0207674_10004213 3300026116 Bacteria 17355
1187 Ga0207674_10011327 3300026116 Bacteria 10022
1188 Ga0207674_10016802 3300026116 Bacteria 7998
1189 Ga0207674_10026278 3300026116 Bacteria 6189
1190 Ga0207674_10056468 3300026116 Bacteria 3987
1191 Ga0207674_10074504 3300026116 Bacteria 3406
1192 Ga0207674_10146451 3300026116 Bacteria 2320
1193 Ga0207675_100004955 3300026118 Bacteria 12836
1194 Ga0207675_100017703 3300026118 Bacteria 6647
1195 Ga0207675_100169149 3300026118 Bacteria 2088
1196 Ga0207675_100281719 3300026118 Bacteria 1615
1197 Ga0207683_10001220 3300026121 Bacteria 23334
1198 Ga0207683_10009326 3300026121 Bacteria 8361
1199 Ga0207683_10012626 3300026121 Bacteria 7206
1200 Ga0207683_10018919 3300026121 Bacteria 5876
1201 Ga0207683_10029203 3300026121 Bacteria 4773
1202 Ga0207683_10126281 3300026121 Bacteria 2299
1203 Ga0207683_10209087 3300026121 Bacteria 1775
1204 Ga0207683_10414056 3300026121 Bacteria 1241
1205 Ga0207698_10041448 3300026142 Bacteria 3431
1206 Ga0207698_10043189 3300026142 Bacteria 3376
1207 Ga0207698_10075079 3300026142 Unclassified 2700
1208 Ga0207698_10119895 3300026142 Bacteria 2224
1209 Ga0207698_10152076 3300026142 Bacteria 2010
1210 Ga0209281_1000043 3300027111 Bacteria 341543
1211 Ga0209281_1000409 3300027111 Bacteria 65132
1212 Ga0209281_1000520 3300027111 Bacteria 49942
1213 Ga0209389_1000168 3300027296 Bacteria 52990
1214 Ga0209389_1000180 3300027296 Bacteria 49331
1215 Ga0209371_1000009 3300027312 Bacteria 963030
1216 Ga0209371_1001907 3300027312 Bacteria 12757
1217 Ga0209589_1000015 3300027357 Bacteria 225913
1218 Ga0209589_1000570 3300027357 Bacteria 52985
1219 Ga0209489_100015 3300027361 Bacteria 225913
1220 Ga0209489_101190 3300027361 Bacteria 52985
1221 Ga0209489_101411 3300027361 Bacteria 49331
1222 Ga0209700_100025 3300027363 Bacteria 225913
1223 Ga0209700_101443 3300027363 Bacteria 49345
1224 Ga0209982_1001329 3300027552 Bacteria 3352
1225 Ga0210002_1000223 3300027617 Bacteria 7973
1226 Ga0209282_1000090 3300027666 Bacteria 65132
1227 Ga0209966_1000796 3300027695 Bacteria 6300
1228 Ga0209998_10001714 3300027717 Bacteria 5229
1229 Ga0209998_10010773 3300027717 Bacteria 1893
1230 Ga0209813_10052531 3300027866 Bacteria 1278
1231 Ga0207428_10000664 3300027907 Bacteria 40266
1232 Ga0207428_10000896 3300027907 Bacteria 33348
1233 Ga0207428_10163635 3300027907 Bacteria 1688
1234 Ga0268266_10000243 3300028379 Bacteria 92211
1235 Ga0268266_10000635 3300028379 Bacteria 47726
1236 Ga0268266_10004206 3300028379 Bacteria 13853
1237 Ga0268266_10005316 3300028379 Bacteria 12065
1238 Ga0268266_10009639 3300028379 Bacteria 8494
1239 Ga0268266_10018676 3300028379 Bacteria 5908
1240 Ga0268266_10092650 3300028379 Bacteria 2651
1241 Ga0268266_10099918 3300028379 Bacteria 2555
1242 Ga0268266_10100929 3300028379 Bacteria 2543
1243 Ga0268266_10213386 3300028379 Bacteria 1771
1244 Ga0268265_10005917 3300028380 Bacteria 8329
1245 Ga0268265_10010547 3300028380 Bacteria 6239
1246 Ga0268265_10065568 3300028380 Bacteria 2803
1247 Ga0268265_10309018 3300028380 Bacteria 1427
1248 Ga0268264_10000049 3300028381 Bacteria 329992
1249 Ga0268264_10001202 3300028381 Bacteria 24970
1250 Ga0268264_10005528 3300028381 Bacteria 10718
1251 Ga0268264_10042527 3300028381 Bacteria 3761
1252 Ga0268264_10075835 3300028381 Bacteria 2860
1253 Ga0268264_10385760 3300028381 Bacteria 1342
1254 Ga0265337_1000071 3300028556 Bacteria 47429
1255 Ga0265337_1030874 3300028556 Bacteria 1593
1256 Ga0265334_10002765 3300028573 Bacteria 8093
1257 Ga0265318_10000549 3300028577 Bacteria 26612
1258 Ga0265318_10004378 3300028577 Bacteria 6853
1259 Ga0265318_10014708 3300028577 Bacteria 3278
1260 Ga0265318_10023632 3300028577 Bacteria 2447
1261 Ga0265323_10000980 3300028653 Bacteria 14837
1262 Ga0265322_10034965 3300028654 Bacteria 1432
1263 Ga0265336_10000380 3300028666 Bacteria 28330
1264 Ga0307517_10002508 3300028786 Bacteria 29345
1265 Ga0307515_10035111 3300028794 Bacteria 8172
1266 Ga0307515_10070097 3300028794 Bacteria 4778
1267 Ga0265338_10000024 3300028800 Bacteria 297778
1268 Ga0265338_10018373 3300028800 Bacteria 7488
1269 Ga0265338_10028582 3300028800 Bacteria 5556
1270 Ga0265338_10048903 3300028800 Bacteria 3839
1271 Ga0265338_10061292 3300028800 Unclassified 3298
1272 Ga0265338_10064900 3300028800 Bacteria 3171
1273 Ga0265338_10066631 3300028800 Bacteria 3115
1274 Ga0265338_10106398 3300028800 Bacteria 2271
1275 Ga0265338_10145943 3300028800 Bacteria 1845
1276 Ga0265324_10006426 3300029957 Bacteria 4903
1277 Ga0268256_1000010 3300030500 Bacteria 963034
1278 Ga0268256_1003048 3300030500 Bacteria 7871
1279 Ga0268256_1004444 3300030500 Bacteria 5810
1280 Ga0307511_10126390 3300030521 Bacteria 1558
1281 Ga0316181_1158173 3300030744 Bacteria 2516
1282 Ga0265762_1001119 3300030760 Bacteria 4833
1283 Ga0265760_10005819 3300031090 Bacteria 3525
1284 Ga0265760_10016953 3300031090 Bacteria 2092
1285 Ga0265330_10009926 3300031235 Bacteria 4505
1286 Ga0265330_10013726 3300031235 Bacteria 3769
1287 Ga0265330_10018400 3300031235 Bacteria 3209
1288 Ga0265330_10023048 3300031235 Bacteria 2829
1289 Ga0265330_10023474 3300031235 Bacteria 2801
1290 Ga0265330_10023712 3300031235 Bacteria 2786
1291 Ga0265330_10056890 3300031235 Bacteria 1707
1292 Ga0265330_10072226 3300031235 Bacteria 1492
1293 Ga0265332_10017966 3300031238 Bacteria 3117
1294 Ga0265332_10022448 3300031238 Bacteria 2784
1295 Ga0265332_10047310 3300031238 Bacteria 1851
1296 Ga0265328_10000108 3300031239 Bacteria 39432
1297 Ga0265320_10001230 3300031240 Bacteria 18812
1298 Ga0265320_10009660 3300031240 Bacteria 5798
1299 Ga0265325_10000119 3300031241 Bacteria 54195
1300 Ga0265325_10001987 3300031241 Bacteria 14078
1301 Ga0265325_10014090 3300031241 Bacteria 4529
1302 Ga0265325_10014291 3300031241 Bacteria 4490
1303 Ga0265325_10016465 3300031241 Bacteria 4134
1304 Ga0265325_10017230 3300031241 Bacteria 4017
1305 Ga0265325_10021893 3300031241 Bacteria 3506
1306 Ga0265325_10056179 3300031241 Bacteria 2011
1307 Ga0265325_10060985 3300031241 Bacteria 1914
1308 Ga0265340_10000180 3300031247 Bacteria 32042
1309 Ga0265340_10000808 3300031247 Bacteria 17761
1310 Ga0265340_10004598 3300031247 Bacteria 7683
1311 Ga0265340_10006730 3300031247 Bacteria 6295
1312 Ga0265340_10008009 3300031247 Bacteria 5725
1313 Ga0265340_10008917 3300031247 Bacteria 5404
1314 Ga0265340_10015076 3300031247 Bacteria 4022
1315 Ga0265340_10025771 3300031247 Bacteria 2976
1316 Ga0265340_10028739 3300031247 Bacteria 2795
1317 Ga0265340_10032968 3300031247 Bacteria 2581
1318 Ga0265340_10034954 3300031247 Bacteria 2497
1319 Ga0265340_10072523 3300031247 Bacteria 1630
1320 Ga0265339_10000033 3300031249 Bacteria 130595
1321 Ga0265339_10000614 3300031249 Bacteria 27732
1322 Ga0265339_10002262 3300031249 Bacteria 13894
1323 Ga0265339_10023958 3300031249 Bacteria 3522
1324 Ga0265339_10029424 3300031249 Bacteria 3116
1325 Ga0265339_10031564 3300031249 Bacteria 2993
1326 Ga0265339_10048243 3300031249 Bacteria 2335
1327 Ga0265339_10075010 3300031249 Bacteria 1796
1328 Ga0265331_10000009 3300031250 Bacteria 314950
1329 Ga0265331_10003350 3300031250 Bacteria 10402
1330 Ga0265331_10004211 3300031250 Bacteria 9007
1331 Ga0265331_10004328 3300031250 Bacteria 8890
1332 Ga0265331_10011549 3300031250 Bacteria 4832
1333 Ga0265331_10022033 3300031250 Bacteria 3253
1334 Ga0265327_10000007 3300031251 Bacteria 678515
1335 Ga0265327_10084692 3300031251 Bacteria 1558
1336 Ga0265316_10006464 3300031344 Bacteria 11188
1337 Ga0265316_10048110 3300031344 Bacteria 3370
1338 Ga0265316_10058171 3300031344 Bacteria 3013
1339 Ga0265316_10066710 3300031344 Bacteria 2784
1340 Ga0265316_10095744 3300031344 Bacteria 2261
1341 Ga0265316_10097415 3300031344 Unclassified 2239
1342 Ga0265316_10122350 3300031344 Bacteria 1965
1343 Ga0307513_10159062 3300031456 Bacteria 2154
1344 Ga0307513_10181183 3300031456 Bacteria 1970
1345 Ga0307408_100064324 3300031548 Bacteria 2686
1346 Ga0307408_100120933 3300031548 Bacteria 2028
1347 Ga0307408_100180528 3300031548 Bacteria 1692
1348 Ga0265313_10000063 3300031595 Bacteria 104056
1349 Ga0265313_10000919 3300031595 Bacteria 29443
1350 Ga0265313_10001301 3300031595 Bacteria 23546
1351 Ga0265313_10004977 3300031595 Bacteria 9938
1352 Ga0265313_10006020 3300031595 Bacteria 8751
1353 Ga0265313_10008450 3300031595 Bacteria 6831
1354 Ga0265313_10016423 3300031595 Bacteria 4255
1355 Ga0265313_10042197 3300031595 Bacteria 2242
1356 Ga0265313_10043531 3300031595 Bacteria 2198
1357 Ga0307508_10027537 3300031616 Bacteria 5143
1358 Ga0307508_10049126 3300031616 Bacteria 3757
1359 Ga0307508_10130177 3300031616 Bacteria 2119
1360 Ga0316575_10070914 3300031665 Bacteria 1400
1361 Ga0265314_10005008 3300031711 Bacteria 12070
1362 Ga0265314_10005936 3300031711 Bacteria 10916
1363 Ga0265314_10007628 3300031711 Bacteria 9364
1364 Ga0265314_10009485 3300031711 Bacteria 8209
1365 Ga0265314_10010160 3300031711 Bacteria 7887
1366 Ga0265314_10011734 3300031711 Bacteria 7207
1367 Ga0265314_10012781 3300031711 Bacteria 6824
1368 Ga0265314_10015443 3300031711 Bacteria 6059
1369 Ga0265314_10015954 3300031711 Bacteria 5948
1370 Ga0265314_10019710 3300031711 Bacteria 5218
1371 Ga0265314_10030441 3300031711 Bacteria 3995
1372 Ga0265314_10032961 3300031711 Bacteria 3804
1373 Ga0265314_10038255 3300031711 Bacteria 3469
1374 Ga0265314_10100685 3300031711 Bacteria 1858
1375 Ga0265314_10152312 3300031711 Bacteria 1416
1376 Ga0265342_10000717 3300031712 Bacteria 34273
1377 Ga0265342_10002641 3300031712 Bacteria 15322
1378 Ga0265342_10005385 3300031712 Bacteria 9775
1379 Ga0265342_10007469 3300031712 Bacteria 7995
1380 Ga0265342_10010859 3300031712 Bacteria 6268
1381 Ga0265342_10018201 3300031712 Bacteria 4557
1382 Ga0265342_10047370 3300031712 Bacteria 2580
1383 Ga0265342_10062762 3300031712 Bacteria 2186
1384 Ga0265342_10082442 3300031712 Bacteria 1855
1385 Ga0307516_10016590 3300031730 Bacteria 7698
1386 Ga0307516_10032302 3300031730 Bacteria 5272
1387 Ga0307516_10042969 3300031730 Bacteria 4481
1388 Ga0307516_10049843 3300031730 Bacteria 4111
1389 Ga0307406_10091641 3300031901 Bacteria 2048
1390 Ga0307406_10184440 3300031901 Bacteria 1522
1391 Ga0307407_10029304 3300031903 Bacteria 2955
1392 Ga0307412_10182678 3300031911 Bacteria 1579
1393 Ga0307412_10195423 3300031911 Bacteria 1533
1394 Ga0315914_1000167 3300031967 Bacteria 65125
1395 Ga0307409_100163664 3300031995 Bacteria 1949
1396 Ga0307409_100224541 3300031995 Bacteria 1698
1397 Ga0307414_10038855 3300032004 Bacteria 3200
1398 Ga0307414_10042024 3300032004 Bacteria 3103
1399 Ga0307414_10056905 3300032004 Bacteria 2746
1400 Ga0307411_10093424 3300032005 Bacteria 2106
1401 Ga0316583_10000114 3300032133 Bacteria 18718
1402 Ga0307510_10042341 3300033180 Bacteria 4963
1403 Ga0307510_10183088 3300033180 Bacteria 1655
1404 Ga0307510_10239117 3300033180 Bacteria 1312
1405 Ga0315913_1000038 3300033430 Bacteria 64995
1406 Ga0315915_1000019 3300033464 Bacteria 129295
1407 Ga0373930_0000082 3300034816 Bacteria 9567
1408 Ga0373930_0006103 3300034816 Bacteria 2024
1409 Ga0373948_0000469 3300034817 Bacteria 5025
1410 Ga0373950_0001089 3300034818 Bacteria 3471
1411 Ga0373958_0000063 3300034819 Bacteria 10777
1412 Ga0373958_0002994 3300034819 Bacteria 2414
1413 Ga0373959_0000620 3300034820 Bacteria 6203
1414 Ga0373938_0001127 3300034957 Bacteria 4300
1415 Ga0373926_0021851 3300035083 Bacteria 2217
1416 Ga0373928_0000048 3300035084 Bacteria 20964
1417 Ga0373929_0000056 3300035085 Bacteria 20392
1418 Ga0373934_0050768 3300035086 Bacteria 1643
1419 Ga0373940_0000527 3300035088 Bacteria 6042
1420 Ga0373940_0013285 3300035088 Bacteria 1988
1421 Ga0373940_0038867 3300035088 Bacteria 1301
1422 Ga0373944_0000574 3300035089 Bacteria 8701
1423 Ga0373949_0000558 3300035090 Bacteria 12270
1424 Ga0373949_0008909 3300035090 Bacteria 2197
1425 Ga0373951_0000521 3300035091 Bacteria 10836
1426 Ga0373951_0000816 3300035091 Bacteria 8470
1427 Ga0373952_0000725 3300035092 Bacteria 5889
1428 Ga0373952_0002577 3300035092 Bacteria 3263
1429 Ga0373923_0005183 3300035111 Bacteria 4408
1430 Ga0373923_0014359 3300035111 Bacteria 2974
1431 Ga0373923_0044076 3300035111 Bacteria 1848
1432 Ga0373932_0002948 3300035112 Bacteria 4192
1433 Ga0373932_0004021 3300035112 Bacteria 3501
1434 Ga0373932_0007894 3300035112 Bacteria 2540
1435 Ga0373936_0000922 3300035113 Bacteria 10499
1436 Ga0373936_0005142 3300035113 Bacteria 4926
1437 Ga0373936_0015918 3300035113 Bacteria 2886
1438 Ga0373936_0029984 3300035113 Bacteria 2144
1439 Ga0373939_0004937 3300035114 Bacteria 3167
1440 Ga0373941_0000282 3300035115 Bacteria 9813
1441 Ga0373941_0002926 3300035115 Bacteria 3810
1442 Ga0373941_0005954 3300035115 Bacteria 2906
1443 Ga0373945_0005798 3300035116 Bacteria 3964
1444 Ga0373945_0009632 3300035116 Bacteria 3167
1445 Ga0373945_0014508 3300035116 Bacteria 2641
1446 Ga0373945_0020001 3300035116 Bacteria 2289
1447 Ga0373945_0024786 3300035116 Bacteria 2081
1448 Ga0373953_0003384 3300035117 Bacteria 4957
1449 Ga0373953_0056785 3300035117 Bacteria 1592
1450 Ga0373954_0000393 3300035118 Bacteria 16330
1451 Ga0373954_0004206 3300035118 Bacteria 6174
1452 Ga0373954_0007401 3300035118 Bacteria 4805
1453 Ga0373954_0017135 3300035118 Bacteria 3250
1454 Ga0373954_0054444 3300035118 Bacteria 1881
1455 Ga0373954_0103847 3300035118 Bacteria 1372
1456 Ga0373956_0011092 3300035119 Bacteria 3710
1457 Ga0373956_0021553 3300035119 Bacteria 2749
1458 Ga0373956_0033610 3300035119 Bacteria 2256
1459 Ga0373957_0006229 3300035120 Bacteria 3749
1460 Ga0373957_0011445 3300035120 Bacteria 2962
1461 Ga0373960_0000021 3300035121 Bacteria 20241
1462 Ga0373960_0000528 3300035121 Bacteria 7654
1463 Ga0373960_0004551 3300035121 Bacteria 3184
1464 Ga0373943_0003412 3300035170 Bacteria 7237
1465 Ga0373943_0003971 3300035170 Bacteria 6733
1466 Ga0373943_0015825 3300035170 Bacteria 3430
1467 Ga0373943_0022496 3300035170 Bacteria 2922
1468 Ga0373943_0033796 3300035170 Bacteria 2438
1469 Ga0373943_0060824 3300035170 Bacteria 1886
1470 Ga0373943_0067068 3300035170 Bacteria 1809
1471 Ga0373943_0109436 3300035170 Bacteria 1455
1472 Ga0373946_0001636 3300035171 Bacteria 7813
1473 Ga0373946_0004408 3300035171 Bacteria 5039
1474 Ga0373946_0004434 3300035171 Bacteria 5028
1475 Ga0373946_0024174 3300035171 Bacteria 2378
1476 Ga0373946_0061501 3300035171 Bacteria 1599
1477 Ga0373946_0070011 3300035171 Bacteria 1513
1478 Ga0373946_0089125 3300035171 Bacteria 1364
1479 Ga0373955_0000362 3300035172 Bacteria 19112
1480 Ga0373955_0181116 3300035172 Bacteria 1250
1481 Ga0373942_0000259 3300035207 Bacteria 14120
1482 Ga0373961_0000771 3300035241 Bacteria 10989
1483 Ga0373961_0008394 3300035241 Bacteria 2511
1484 Ga0373961_0026902 3300035241 Bacteria 1575
1485 Ga0373962_0003997 3300035242 Bacteria 3549
1486 Ga0373962_0009530 3300035242 Bacteria 2409
1487 Ga0316574_0000231 3300035398 Bacteria 20103
1488 Ga0316574_0166512 3300035398 Bacteria 1420
1489 Ga0373924_0000516 3300035410 Bacteria 11840
1490 Ga0373924_0006999 3300035410 Bacteria 4060
1491 Ga0373924_0029653 3300035410 Bacteria 2188
1492 Ga0373924_0041993 3300035410 Bacteria 1875
1493 Ga0373924_0053157 3300035410 Bacteria 1682
1494 Ga0373931_0002221 3300035691 Bacteria 8576
1495 Ga0373931_0006839 3300035691 Bacteria 5362
1496 Ga0373931_0008064 3300035691 Bacteria 4984
1497 Ga0373931_0054155 3300035691 Bacteria 2143
1498 Ga0373931_0057166 3300035691 Bacteria 2091
1499 Ga0373935_0000097 3300035692 Bacteria 38808
1500 Ga0373935_0000444 3300035692 Bacteria 21414
1501 Ga0373935_0043696 3300035692 Bacteria 2821
1502 Ga0373935_0044429 3300035692 Bacteria 2800
1503 Ga0373935_0050888 3300035692 Bacteria 2630
1504 Ga0373935_0052649 3300035692 Bacteria 2588
1505 Ga0373935_0070488 3300035692 Bacteria 2253
1506 Ga0373935_0071923 3300035692 Bacteria 2232
1507 Ga0373935_0083987 3300035692 Bacteria 2073
1508 Ga0373935_0100073 3300035692 Bacteria 1910
1509 Ga0373935_0185065 3300035692 Bacteria 1432
1510 Ga0373935_0189231 3300035692 Bacteria 1417
1511 Ga0373935_0251315 3300035692 Bacteria 1237
1512 Ga0373927_0000223 3300035695 Bacteria 44914
1513 Ga0373927_0002219 3300035695 Bacteria 14288
1514 Ga0373927_0003966 3300035695 Bacteria 10471
1515 Ga0373927_0007035 3300035695 Bacteria 7633
1516 Ga0373927_0010580 3300035695 Bacteria 6149
1517 Ga0373927_0012518 3300035695 Bacteria 5649
1518 Ga0373927_0031878 3300035695 Bacteria 3433
1519 Ga0373927_0036047 3300035695 Bacteria 3217
1520 Ga0373927_0051781 3300035695 Bacteria 2655
1521 Ga0373927_0068280 3300035695 Bacteria 2300
1522 Ga0373927_0103185 3300035695 Bacteria 1855
1523 Ga0373927_0127373 3300035695 Bacteria 1663
1524 Ga0373933_0000288 3300035724 Bacteria 32574
1525 Ga0373933_0000820 3300035724 Bacteria 18995
1526 Ga0373933_0001277 3300035724 Bacteria 14811
1527 Ga0373933_0044881 3300035724 Bacteria 2619
1528 Ga0373933_0051968 3300035724 Bacteria 2450
1529 Ga0373933_0076417 3300035724 Bacteria 2046
1530 Ga0373933_0130284 3300035724 Bacteria 1581
1531 Ga0373933_0209498 3300035724 Bacteria 1249
1532 Ga0373947_0000353 3300035725 Bacteria 26005
1533 Ga0373947_0006258 3300035725 Bacteria 6919
1534 Ga0373947_0017128 3300035725 Bacteria 4166
1535 Ga0373947_0025158 3300035725 Bacteria 3471
1536 Ga0373947_0049729 3300035725 Bacteria 2518
1537 Ga0373947_0066077 3300035725 Bacteria 2207
1538 Ga0373947_0122843 3300035725 Bacteria 1651
1539 Ga0373947_0178766 3300035725 Bacteria 1380
1540 Ga0373937_0000006 3300036401 Bacteria 194781
1541 Ga0373937_0000454 3300036401 Bacteria 37835
1542 Ga0373937_0009599 3300036401 Bacteria 8423
1543 Ga0373937_0011614 3300036401 Bacteria 7731
1544 Ga0373937_0019043 3300036401 Bacteria 6142
1545 Ga0373937_0032663 3300036401 Bacteria 4722
1546 Ga0373937_0038782 3300036401 Bacteria 4341
1547 Ga0373937_0042987 3300036401 Bacteria 4124
1548 Ga0373937_0056668 3300036401 Bacteria 3600
1549 Ga0373937_0070693 3300036401 Bacteria 3219
1550 Ga0373937_0080326 3300036401 Bacteria 3015
1551 Ga0373925_0000002 3300037068 Bacteria 368879
1552 Ga0373925_0004649 3300037068 Bacteria 10369
1553 Ga0373925_0007597 3300037068 Bacteria 7896
1554 Ga0373925_0012775 3300037068 Bacteria 6083
1555 Ga0373925_0030216 3300037068 Bacteria 3976
1556 Ga0373925_0034731 3300037068 Bacteria 3717
1557 Ga0373925_0067621 3300037068 Bacteria 2695
1558 Ga0373925_0090224 3300037068 Bacteria 2342
1559 Ga0373925_0113412 3300037068 Bacteria 2096
1560 Ga0373925_0195958 3300037068 Bacteria 1605
1561 Ga0373925_0196635 3300037068 Bacteria 1602
1562 Ga0395899_0000014 3300037312 Bacteria 488813
1563 Ga0395899_0032205 3300037312 Bacteria 3938
1564 Ga0395899_0134306 3300037312 Bacteria 1764
1565 Ga0395900_0000007 3300037418 Bacteria 488860
1566 Ga0395900_0000937 3300037418 Bacteria 38218
1567 Ga0395900_0001933 3300037418 Bacteria 23481
1568 Ga0395900_0011657 3300037418 Bacteria 8993
1569 Ga0395900_0025611 3300037418 Bacteria 6038
1570 Ga0395900_0085565 3300037418 Bacteria 3240
1571 Ga0395900_0164866 3300037418 Bacteria 2259
1572 Ga0395900_0182159 3300037418 Bacteria 2134
1573 Ga0395900_0402632 3300037418 Bacteria 1332
1574 Ga0395898_0000011 3300037466 Bacteria 488860
1575 Ga0395898_0005127 3300037466 Bacteria 14184
1576 Ga0395898_0093489 3300037466 Bacteria 2890
1577 Ga0395898_0095050 3300037466 Bacteria 2863
1578 Ga0395898_0101000 3300037466 Bacteria 2770
1579 Ga0395905_0000008 3300037471 Bacteria 488860
1580 Ga0395905_0003588 3300037471 Bacteria 16513
1581 Ga0395905_0026374 3300037471 Bacteria 5479
1582 Ga0395905_0040553 3300037471 Bacteria 4368
1583 Ga0395905_0045868 3300037471 Bacteria 4100
1584 Ga0395905_0126386 3300037471 Bacteria 2404
1585 Ga0436364_0232280 3300037853 Bacteria 88632
1586 Ga0436364_0309458 3300037853 Bacteria 1661
1587 Ga0436364_0312684 3300037853 Bacteria 1948
1588 Ga0436364_0583374 3300037853 Bacteria 2679
1589 Ga0436364_1217366 3300037853 Bacteria 48683
1590 Ga0436364_1298189 3300037853 Bacteria 1688
1591 Ga0436364_1373353 3300037853 Bacteria 1802
1592 Ga0395901_0000020 3300038443 Bacteria 314918
1593 Ga0395901_0006000 3300038443 Bacteria 12306
1594 Ga0395901_0013958 3300038443 Bacteria 8175
1595 Ga0395901_0062391 3300038443 Bacteria 3879
1596 Ga0395901_0134671 3300038443 Bacteria 2596
1597 Ga0395901_0378063 3300038443 Bacteria 1458
1598 Ga0395901_0419102 3300038443 Bacteria 1373
1599 Ga0400484_43756 3300038725 Bacteria 1545
1600 Ga0400483_109261 3300039062 Bacteria 7917
1601 Ga0400483_277787 3300039062 Bacteria 33179
1602 Ga0400483_284213 3300039062 Bacteria 5698
1603 Ga0436365_0487883 3300039437 Bacteria 1547
1604 Ga0436365_0569849 3300039437 Bacteria 3107
1605 Ga0436365_0841916 3300039437 Bacteria 3113
1606 Ga0436365_0879719 3300039437 Bacteria 1800
1607 Ga0436365_0900104 3300039437 Bacteria 1615
1608 Ga0436365_1117139 3300039437 Bacteria 26783
1609 Ga0436365_1168772 3300039437 Bacteria 186262
1610 Ga0436365_1202069 3300039437 Bacteria 38081
1611 Ga0436365_1290300 3300039437 Bacteria 1571
1612 Ga0436365_1478396 3300039437 Bacteria 2195
1613 Ga0436365_1540042 3300039437 Bacteria 70665
1614 Ga0436365_1751730 3300039437 Bacteria 10975
1615 Ga0436365_1850502 3300039437 Bacteria 1615
1616 Ga0436360_0019097 3300039438 Bacteria 4631
1617 Ga0436360_0320074 3300039438 Bacteria 3219
1618 Ga0436360_0611830 3300039438 Bacteria 2945
1619 Ga0436361_0631953 3300039447 Bacteria 3717
1620 Ga0436361_0893904 3300039447 Bacteria 1359
1621 Ga0436361_1034319 3300039447 Bacteria 6480
1622 Ga0436361_1079345 3300039447 Bacteria 1539
1623 Ga0436363_0476242 3300039450 Bacteria 14456
1624 Ga0436363_0612476 3300039450 Bacteria 2448
1625 Ga0436363_1033365 3300039450 Bacteria 15814
1626 Ga0436363_1169320 3300039450 Bacteria 13129
1627 Ga0436363_1381581 3300039450 Bacteria 9461
1628 Ga0436363_1405260 3300039450 Bacteria 8417
1629 Ga0436363_1666906 3300039450 Bacteria 2981
1630 Ga0436362_0929089 3300039453 Bacteria 23155
1631 Ga0436362_1056084 3300039453 Bacteria 3775
1632 Ga0439436_0017393 3300041404 Bacteria 2151
1633 Ga0439466_0040336 3300041411 Bacteria 1561
1634 Ga0439465_0011340 3300041413 Bacteria 2797
1635 Ga0439465_0013429 3300041413 Bacteria 2554
1636 Ga0451847_1021271 3300041503 Bacteria 2404
1637 Ga0451849_0681971 3300041505 Bacteria 1864
1638 Ga0439449_0018118 3300042007 Bacteria 2643
1639 Ga0439450_004952 3300042008 Bacteria 2312
1640 Ga0439435_0005326 3300042436 Bacteria 2824
1641 Ga0450918_002914 3300042531 Bacteria 3217
1642 Ga0451577_0108786 3300042876 Bacteria 2478
1643 Ga0466972_0000171 3300044658 Bacteria 50915
1644 Ga0466972_0009777 3300044658 Bacteria 4815
1645 Ga0466972_0018855 3300044658 Bacteria 3448
1646 Ga0466965_0035997 3300044683 Bacteria 2427
1647 Ga0466966_0001410 3300044684 Bacteria 15480
1648 Ga0466966_0035781 3300044684 Bacteria 3207
1649 Ga0466961_0000126 3300044693 Bacteria 51032
1650 Ga0466963_0011055 3300044694 Bacteria 5488
1651 Ga0466963_0035594 3300044694 Bacteria 3244
1652 Ga0453684_0088136 3300044712 Bacteria 3844
1653 Ga0466968_0031901 3300044735 Bacteria 2188
1654 Ga0466970_0069201 3300044765 Bacteria 1897
1655 Ga0466957_0110537 3300044842 Bacteria 1742
1656 Ga0466960_0007320 3300044901 Bacteria 4476
1657 Ga0466960_0045898 3300044901 Bacteria 2089
1658 Ga0466960_0123430 3300044901 Bacteria 1359
1659 Ga0466959_0024698 3300045049 Bacteria 4452
1660 Ga0466959_0026696 3300045049 Bacteria 4281
1661 Ga0466959_0180155 3300045049 Bacteria 1478
1662 Ga0451576_0022529 3300045051 Bacteria 6829
1663 Ga0451576_0028696 3300045051 Bacteria 5958
1664 Ga0466958_0014174 3300045836 Bacteria 4550
1665 Ga0466967_0010924 3300045976 Bacteria 6844
1666 Ga0466967_0285145 3300045976 Bacteria 1585
1667 Ga0495592_0000039 3300046454 Bacteria 124471
1668 Ga0495592_0005257 3300046454 Bacteria 9536
1669 Ga0495592_0008932 3300046454 Bacteria 7524
1670 Ga0495592_0013853 3300046454 Bacteria 6129
1671 Ga0495592_0027219 3300046454 Bacteria 4335
1672 Ga0495592_0038633 3300046454 Bacteria 3590
1673 Ga0495592_0122502 3300046454 Bacteria 1827
1674 Ga0495592_0162530 3300046454 Bacteria 1535
1675 Ga0495603_0000066 3300046455 Bacteria 45635
1676 Ga0495603_0010693 3300046455 Bacteria 5564
1677 Ga0495603_0029648 3300046455 Bacteria 3298
1678 Ga0495603_0169059 3300046455 Bacteria 1267
1679 Ga0495629_0000232 3300046459 Bacteria 49422
1680 Ga0495629_0000393 3300046459 Bacteria 36754
1681 Ga0495629_0000984 3300046459 Bacteria 22885
1682 Ga0495629_0005261 3300046459 Bacteria 9671
1683 Ga0495629_0012996 3300046459 Bacteria 6021
1684 Ga0495629_0022165 3300046459 Bacteria 4530
1685 Ga0495629_0037987 3300046459 Bacteria 3393
1686 Ga0495629_0088718 3300046459 Bacteria 2157
1687 Ga0495629_0123389 3300046459 Bacteria 1804
1688 Ga0495629_0154691 3300046459 Bacteria 1594
1689 Ga0495629_0162579 3300046459 Bacteria 1550
1690 Ga0495629_0176509 3300046459 Bacteria 1481
1691 Ga0495629_0216227 3300046459 Bacteria 1323
1692 Ga0495638_0007934 3300046460 Bacteria 7571
1693 Ga0495638_0024002 3300046460 Bacteria 3981
1694 Ga0495638_0025939 3300046460 Bacteria 3804
1695 Ga0495641_0006156 3300046461 Bacteria 7848
1696 Ga0495641_0016275 3300046461 Bacteria 3923
1697 Ga0495641_0046479 3300046461 Bacteria 1996
1698 Ga0495641_0051646 3300046461 Bacteria 1876
1699 Ga0495641_0093817 3300046461 Bacteria 1341
1700 Ga0495651_0002872 3300046462 Bacteria 13351
1701 Ga0495651_0002916 3300046462 Bacteria 13240
1702 Ga0495651_0012097 3300046462 Bacteria 6639
1703 Ga0495651_0019985 3300046462 Bacteria 5195
1704 Ga0495651_0040484 3300046462 Bacteria 3623
1705 Ga0495651_0043242 3300046462 Bacteria 3496
1706 Ga0495651_0069149 3300046462 Bacteria 2690
1707 Ga0495651_0101772 3300046462 Bacteria 2137
1708 Ga0495653_0000006 3300046463 Bacteria 363285
1709 Ga0495653_0000575 3300046463 Bacteria 28178
1710 Ga0495653_0003920 3300046463 Bacteria 12035
1711 Ga0495653_0005424 3300046463 Bacteria 10383
1712 Ga0495653_0026350 3300046463 Bacteria 4661
1713 Ga0495653_0096053 3300046463 Bacteria 2155
1714 Ga0495580_0000576 3300046472 Bacteria 30903
1715 Ga0495580_0009197 3300046472 Bacteria 7788
1716 Ga0495580_0012190 3300046472 Bacteria 6607
1717 Ga0495580_0039128 3300046472 Bacteria 3393
1718 Ga0495580_0072738 3300046472 Bacteria 2400
1719 Ga0495580_0169932 3300046472 Bacteria 1508
1720 Ga0495582_0001315 3300046473 Bacteria 13923
1721 Ga0495582_0011416 3300046473 Bacteria 4893
1722 Ga0495582_0050350 3300046473 Bacteria 2295
1723 Ga0495605_0003086 3300046474 Bacteria 10046
1724 Ga0495605_0065351 3300046474 Bacteria 1730
1725 Ga0495639_0002771 3300046475 Bacteria 7616
1726 Ga0495639_0010026 3300046475 Bacteria 4071
1727 Ga0495639_0064686 3300046475 Bacteria 1681
1728 Ga0495639_0100620 3300046475 Bacteria 1364
1729 Ga0495662_0000386 3300046476 Bacteria 19623
1730 Ga0495662_0001495 3300046476 Bacteria 11579
1731 Ga0495662_0032793 3300046476 Bacteria 2509
1732 Ga0495662_0033677 3300046476 Bacteria 2475
1733 Ga0495662_0058459 3300046476 Bacteria 1862
1734 Ga0495662_0083672 3300046476 Bacteria 1553
1735 Ga0495664_0000002 3300046477 Bacteria 625183
1736 Ga0495664_0000799 3300046477 Bacteria 16089
1737 Ga0495664_0006922 3300046477 Bacteria 6278
1738 Ga0495664_0052243 3300046477 Bacteria 2428
1739 Ga0495664_0054820 3300046477 Bacteria 2371
1740 Ga0495664_0054969 3300046477 Bacteria 2368
1741 Ga0495664_0085271 3300046477 Bacteria 1896
1742 Ga0495584_0046225 3300046491 Bacteria 2196
1743 Ga0495584_0054483 3300046491 Bacteria 2013
1744 Ga0495584_0064983 3300046491 Bacteria 1835
1745 Ga0495585_0006961 3300046492 Bacteria 6963
1746 Ga0495585_0021313 3300046492 Bacteria 3721
1747 Ga0495594_0001247 3300046499 Bacteria 13336
1748 Ga0495594_0045171 3300046499 Bacteria 2418
1749 Ga0495594_0145684 3300046499 Bacteria 1344
1750 Ga0495607_0032449 3300046501 Bacteria 3187
1751 Ga0495606_0000244 3300046507 Bacteria 95942
1752 Ga0495606_0012811 3300046507 Bacteria 6681
1753 Ga0495606_0037919 3300046507 Bacteria 3268
1754 Ga0495606_0049828 3300046507 Bacteria 2744
1755 Ga0495606_0081097 3300046507 Bacteria 2017
1756 Ga0495606_0124582 3300046507 Bacteria 1538
1757 Ga0495606_0139686 3300046507 Bacteria 1432
1758 Ga0495608_0000006 3300046511 Bacteria 324334
1759 Ga0495608_0001846 3300046511 Bacteria 15120
1760 Ga0495608_0005567 3300046511 Bacteria 8998
1761 Ga0495608_0024126 3300046511 Bacteria 4161
1762 Ga0495608_0032057 3300046511 Bacteria 3552
1763 Ga0495608_0071434 3300046511 Bacteria 2264
1764 Ga0495608_0083044 3300046511 Bacteria 2080
1765 Ga0495610_0100160 3300046512 Bacteria 1299
1766 Ga0495618_0000027 3300046514 Bacteria 112522
1767 Ga0495618_0001214 3300046514 Bacteria 17481
1768 Ga0495618_0002693 3300046514 Bacteria 11320
1769 Ga0495618_0013963 3300046514 Bacteria 4889
1770 Ga0495618_0072249 3300046514 Bacteria 2195
1771 Ga0495628_0000002 3300046516 Bacteria 589399
1772 Ga0495628_0013829 3300046516 Bacteria 6781
1773 Ga0495628_0040855 3300046516 Bacteria 3704
1774 Ga0495628_0230827 3300046516 Bacteria 1387
1775 Ga0495630_0003968 3300046517 Bacteria 10343
1776 Ga0495630_0005417 3300046517 Bacteria 9009
1777 Ga0495630_0007116 3300046517 Bacteria 7972
1778 Ga0495630_0022986 3300046517 Bacteria 4607
1779 Ga0495630_0063912 3300046517 Bacteria 2764
1780 Ga0495630_0174773 3300046517 Bacteria 1637
1781 Ga0495631_0023830 3300046518 Bacteria 2832
1782 Ga0495637_0047592 3300046520 Bacteria 1809
1783 Ga0495643_0071913 3300046522 Bacteria 1814
1784 Ga0495644_0003829 3300046523 Bacteria 5920
1785 Ga0495644_0075573 3300046523 Bacteria 1268
1786 Ga0495648_0003301 3300046524 Bacteria 14240
1787 Ga0495648_0005188 3300046524 Bacteria 10897
1788 Ga0495666_0081739 3300046526 Bacteria 1528
1789 Ga0495652_0000004 3300046529 Bacteria 588877
1790 Ga0495652_0011732 3300046529 Bacteria 7915
1791 Ga0495652_0015242 3300046529 Bacteria 6879
1792 Ga0495652_0027611 3300046529 Bacteria 5000
1793 Ga0495652_0041837 3300046529 Bacteria 3953
1794 Ga0495652_0069786 3300046529 Bacteria 2940
1795 Ga0495652_0081130 3300046529 Bacteria 2677
1796 Ga0495652_0183620 3300046529 Bacteria 1602
1797 Ga0495654_0017162 3300046530 Bacteria 3810
1798 Ga0495654_0024317 3300046530 Bacteria 3131
1799 Ga0495665_0007254 3300046531 Bacteria 5982
1800 Ga0495665_0013486 3300046531 Bacteria 4418
1801 Ga0495665_0037231 3300046531 Bacteria 2597
1802 Ga0495665_0060024 3300046531 Bacteria 2007
1803 Ga0495665_0121427 3300046531 Bacteria 1368
1804 Ga0495665_0143117 3300046531 Bacteria 1249
1805 Ga0495640_0000005 3300046533 Bacteria 318271
1806 Ga0495640_0005884 3300046533 Bacteria 9728
1807 Ga0495640_0014177 3300046533 Bacteria 6042
1808 Ga0495640_0029589 3300046533 Bacteria 3930
1809 Ga0495640_0032341 3300046533 Bacteria 3726
1810 Ga0495586_0084110 3300046535 Bacteria 1751
1811 Ga0495587_0000007 3300046536 Bacteria 290788
1812 Ga0495587_0001032 3300046536 Bacteria 18320
1813 Ga0495587_0005889 3300046536 Bacteria 7987
1814 Ga0495587_0018965 3300046536 Bacteria 4263
1815 Ga0495587_0022441 3300046536 Bacteria 3887
1816 Ga0495587_0048098 3300046536 Bacteria 2527
1817 Ga0495598_0004557 3300046537 Bacteria 3011
1818 Ga0495609_0081750 3300046538 Bacteria 1412
1819 Ga0495621_0061208 3300046539 Bacteria 1367
1820 Ga0495645_0000003 3300046543 Bacteria 570133
1821 Ga0495645_0000411 3300046543 Bacteria 29443
1822 Ga0495645_0004688 3300046543 Bacteria 9334
1823 Ga0495645_0006679 3300046543 Bacteria 8015
1824 Ga0495645_0019274 3300046543 Bacteria 4912
1825 Ga0495645_0023333 3300046543 Bacteria 4479
1826 Ga0495645_0154049 3300046543 Bacteria 1594
1827 Ga0495645_0252320 3300046543 Bacteria 1172
1828 Ga0495622_0005434 3300046557 Bacteria 5912
1829 Ga0495622_0005926 3300046557 Bacteria 5678
1830 Ga0495622_0018244 3300046557 Bacteria 3268
1831 Ga0495622_0026634 3300046557 Bacteria 2698
1832 Ga0495622_0050431 3300046557 Bacteria 1931
1833 Ga0495622_0080577 3300046557 Bacteria 1498
1834 Ga0495633_0011600 3300046558 Bacteria 4741
1835 Ga0495633_0034992 3300046558 Bacteria 2413
1836 Ga0495667_0000002 3300046559 Bacteria 437535
1837 Ga0495667_0001388 3300046559 Bacteria 15942
1838 Ga0495667_0004098 3300046559 Bacteria 9791
1839 Ga0495667_0004682 3300046559 Bacteria 9249
1840 Ga0495667_0005195 3300046559 Bacteria 8802
1841 Ga0495667_0008027 3300046559 Bacteria 7160
1842 Ga0495667_0030322 3300046559 Bacteria 3635
1843 Ga0495667_0165008 3300046559 Bacteria 1424
1844 Ga0495667_0175030 3300046559 Bacteria 1378
1845 Ga0495656_0007167 3300046615 Bacteria 3934
1846 Ga0495656_0017927 3300046615 Bacteria 2710
1847 Ga0495656_0066878 3300046615 Bacteria 1584
1848 Ga0495634_0002417 3300046642 Bacteria 15537
1849 Ga0495634_0002458 3300046642 Bacteria 15397
1850 Ga0495634_0005107 3300046642 Bacteria 10134
1851 Ga0495634_0075786 3300046642 Bacteria 2208
1852 Ga0495611_0012895 3300046648 Bacteria 3553
1853 Ga0495625_0063832 3300046660 Bacteria 2600
1854 Ga0495625_0144379 3300046660 Bacteria 1603
1855 Ga0495635_0000022 3300046663 Bacteria 160907
1856 Ga0495635_0002261 3300046663 Bacteria 13087
1857 Ga0495635_0003059 3300046663 Bacteria 11500
1858 Ga0495635_0003935 3300046663 Bacteria 10330
1859 Ga0495635_0004185 3300046663 Bacteria 10011
1860 Ga0495635_0008567 3300046663 Bacteria 7141
1861 Ga0495635_0010842 3300046663 Bacteria 6386
1862 Ga0495635_0021171 3300046663 Bacteria 4532
1863 Ga0495635_0029725 3300046663 Bacteria 3800
1864 Ga0495635_0046763 3300046663 Bacteria 2985
1865 Ga0495659_0013046 3300046664 Bacteria 2702
1866 Ga0495659_0017997 3300046664 Bacteria 2349
1867 Ga0495661_0034962 3300046665 Bacteria 3158
1868 Ga0495661_0119355 3300046665 Bacteria 1458
1869 Ga0495588_0000925 3300046674 Bacteria 12755
1870 Ga0495588_0002648 3300046674 Bacteria 7671
1871 Ga0495588_0009390 3300046674 Bacteria 4519
1872 Ga0495588_0042209 3300046674 Bacteria 2331
1873 Ga0495588_0107111 3300046674 Bacteria 1471
1874 Ga0495657_0000072 3300046675 Bacteria 91747
1875 Ga0495657_0002950 3300046675 Bacteria 14098
1876 Ga0495657_0004169 3300046675 Bacteria 11581
1877 Ga0495657_0046913 3300046675 Bacteria 2923
1878 Ga0495599_0000001 3300046678 Bacteria 537563
1879 Ga0495599_0006418 3300046678 Bacteria 7097
1880 Ga0495599_0020130 3300046678 Bacteria 4156
1881 Ga0495599_0027135 3300046678 Bacteria 3590
1882 Ga0495599_0054301 3300046678 Bacteria 2510
1883 Ga0495623_0000001 3300046679 Bacteria 313861
1884 Ga0495623_0004733 3300046679 Bacteria 8944
1885 Ga0495623_0019052 3300046679 Bacteria 4431
1886 Ga0495623_0024094 3300046679 Bacteria 3925
1887 Ga0495623_0172185 3300046679 Bacteria 1264
1888 Ga0495646_0000014 3300046680 Bacteria 143781
1889 Ga0495646_0010522 3300046680 Bacteria 5876
1890 Ga0495646_0055918 3300046680 Bacteria 2367
1891 Ga0495646_0093364 3300046680 Bacteria 1734
1892 Ga0495646_0098624 3300046680 Bacteria 1678
1893 Ga0495646_0129241 3300046680 Bacteria 1423
1894 Ga0495647_0001619 3300046681 Bacteria 6955
1895 Ga0495647_0007783 3300046681 Bacteria 3598
1896 Ga0495658_0003104 3300046683 Bacteria 8299
1897 Ga0495658_0013306 3300046683 Bacteria 4186
1898 Ga0495658_0044481 3300046683 Bacteria 2488
1899 Ga0495658_0093241 3300046683 Bacteria 1787
1900 Ga0495658_0139335 3300046683 Bacteria 1482
1901 Ga0495669_0005200 3300046684 Bacteria 5415
1902 Ga0495669_0022482 3300046684 Bacteria 2739
1903 Ga0495669_0038137 3300046684 Bacteria 2128
1904 Ga0495613_0012477 3300046689 Bacteria 6315
1905 Ga0495613_0015287 3300046689 Bacteria 5705
1906 Ga0495613_0059509 3300046689 Bacteria 2800
1907 Ga0495613_0118632 3300046689 Bacteria 1901
1908 Ga0495613_0155648 3300046689 Bacteria 1628
1909 Ga0495624_0009695 3300046690 Bacteria 6665
1910 Ga0495624_0019005 3300046690 Bacteria 4590
1911 Ga0495624_0025324 3300046690 Bacteria 3896
1912 Ga0495624_0038928 3300046690 Bacteria 3051
1913 Ga0495624_0100624 3300046690 Bacteria 1780
1914 Ga0495624_0187887 3300046690 Bacteria 1257
1915 Ga0495670_0000124 3300046691 Bacteria 33461
1916 Ga0495670_0009262 3300046691 Bacteria 4843
1917 Ga0495670_0012397 3300046691 Bacteria 4191
1918 Ga0495670_0042047 3300046691 Bacteria 2280
1919 Ga0495671_0001486 3300046692 Bacteria 15696
1920 Ga0495589_0102391 3300046794 Bacteria 1385
1921 Ga0495600_0000006 3300046809 Bacteria 151916
1922 Ga0495600_0002118 3300046809 Bacteria 11234
1923 Ga0495600_0004962 3300046809 Bacteria 7991
1924 Ga0495600_0006845 3300046809 Bacteria 6950
1925 Ga0495600_0011108 3300046809 Bacteria 5606
1926 Ga0495600_0011734 3300046809 Bacteria 5468
1927 Ga0495600_0074783 3300046809 Bacteria 2212
1928 Ga0495660_0024878 3300046810 Bacteria 3406
1929 Ga0495581_0005581 3300047315 Bacteria 7291
1930 Ga0495581_0022293 3300047315 Bacteria 3670
1931 Ga0495581_0034721 3300047315 Bacteria 2917
1932 Ga0495581_0096386 3300047315 Bacteria 1717
1933 Ga0495604_0000005 3300047317 Bacteria 424516
1934 Ga0495604_0003737 3300047317 Bacteria 12122
1935 Ga0495604_0006998 3300047317 Bacteria 8937
1936 Ga0495604_0013432 3300047317 Bacteria 6523
1937 Ga0495604_0016972 3300047317 Bacteria 5823
1938 Ga0495604_0025232 3300047317 Bacteria 4737
1939 Ga0495604_0045626 3300047317 Bacteria 3419
1940 Ga0495604_0074879 3300047317 Bacteria 2550
1941 Ga0495604_0099532 3300047317 Bacteria 2139
1942 Ga0495604_0101475 3300047317 Bacteria 2113
1943 Ga0495604_0119881 3300047317 Bacteria 1906
1944 Ga0495604_0136973 3300047317 Bacteria 1753
1945 Ga0495674_0000003 3300047319 Bacteria 562126
1946 Ga0495674_0000895 3300047319 Bacteria 28524
1947 Ga0495674_0003541 3300047319 Bacteria 15191
1948 Ga0495674_0005482 3300047319 Bacteria 12190
1949 Ga0495674_0006060 3300047319 Bacteria 11603
1950 Ga0495674_0030060 3300047319 Bacteria 4942
1951 Ga0495674_0032650 3300047319 Bacteria 4720
1952 Ga0495674_0090317 3300047319 Bacteria 2618
1953 Ga0495674_0098312 3300047319 Bacteria 2492
1954 Ga0495674_0135324 3300047319 Bacteria 2074
1955 Ga0495674_0272492 3300047319 Bacteria 1388
1956 Ga0495672_0072341 3300047320 Bacteria 1948
1957 Ga0495676_0092638 3300047321 Bacteria 2255
1958 Ga0495676_0098203 3300047321 Bacteria 2173
1959 Ga0495676_0125073 3300047321 Bacteria 1864
1960 Ga0495676_0249991 3300047321 Bacteria 1210
1961 Ga0495680_0000961 3300047322 Bacteria 31964
1962 Ga0495680_0001324 3300047322 Bacteria 27020
1963 Ga0495680_0005907 3300047322 Bacteria 11449
1964 Ga0495680_0006684 3300047322 Bacteria 10679
1965 Ga0495680_0009328 3300047322 Bacteria 8839
1966 Ga0495680_0026763 3300047322 Bacteria 4749
1967 Ga0495680_0056862 3300047322 Bacteria 3028
1968 Ga0495680_0084778 3300047322 Bacteria 2387
1969 Ga0495687_006634 3300047443 Bacteria 7036
1970 Ga0495687_078870 3300047443 Bacteria 1296
1971 Ga0495675_0000338 3300047444 Bacteria 33019
1972 Ga0495675_0006984 3300047444 Bacteria 6942
1973 Ga0495675_0009373 3300047444 Bacteria 6089
1974 Ga0495675_0024811 3300047444 Bacteria 3824
1975 Ga0495677_0063268 3300047445 Bacteria 1374
1976 Ga0495681_0094511 3300047470 Bacteria 1315
1977 Ga0495684_0000028 3300047471 Bacteria 123549
1978 Ga0495684_0004548 3300047471 Bacteria 10835
1979 Ga0495684_0012591 3300047471 Bacteria 6522
1980 Ga0495684_0027300 3300047471 Bacteria 4383
1981 Ga0495684_0027819 3300047471 Bacteria 4343
1982 Ga0495684_0031347 3300047471 Bacteria 4081
1983 Ga0495684_0078766 3300047471 Bacteria 2501
1984 Ga0495684_0083481 3300047471 Bacteria 2423
1985 Ga0495686_0091597 3300047472 Bacteria 1845
1986 Ga0495686_0116590 3300047472 Bacteria 1596
1987 Ga0495686_0136968 3300047472 Bacteria 1447
1988 Ga0495593_0015258 3300047673 Bacteria 4356
1989 Ga0495593_0022245 3300047673 Bacteria 3536
1990 Ga0495593_0035706 3300047673 Bacteria 2697
1991 Ga0495593_0053468 3300047673 Bacteria 2131
1992 Ga0495593_0113650 3300047673 Bacteria 1381
1993 Ga0495593_0174665 3300047673 Bacteria 1082
1994 Ga0495602_0000029 3300048088 Bacteria 142344
1995 Ga0495602_0000965 3300048088 Bacteria 27818
1996 Ga0495602_0018740 3300048088 Bacteria 6898
1997 Ga0495602_0023870 3300048088 Bacteria 5946
1998 Ga0495602_0033248 3300048088 Bacteria 4841
1999 Ga0495602_0164811 3300048088 Bacteria 1726
2000 Ga0495614_0014870 3300048089 Bacteria 3401
2001 Ga0495614_0100795 3300048089 Bacteria 1262
2002 Ga0496100_0008335 3300048903 Bacteria 5776
2003 Ga0496100_0229079 3300048903 Bacteria 1366
2004 Ga0496101_0002908 3300048904 Bacteria 10544
2005 Ga0496101_0018379 3300048904 Bacteria 4753
2006 Ga0496101_0045678 3300048904 Bacteria 3138
2007 Ga0496101_0050859 3300048904 Bacteria 2984
2008 Ga0496101_0114529 3300048904 Bacteria 2033
2009 Ga0496101_0190424 3300048904 Bacteria 1583
2010 Ga0496101_0216038 3300048904 Bacteria 1487
2011 Ga0496101_0258493 3300048904 Bacteria 1358
2012 Ga0496101_0272497 3300048904 Bacteria 1321
2013 Ga0496102_0001311 3300048905 Bacteria 22329
2014 Ga0496102_0019690 3300048905 Bacteria 5947
2015 Ga0496102_0080991 3300048905 Bacteria 2992
2016 Ga0496102_0151895 3300048905 Bacteria 2176
2017 Ga0496102_0207293 3300048905 Bacteria 1848
2018 Ga0496102_0353133 3300048905 Bacteria 1384
2019 Ga0496102_0361608 3300048905 Bacteria 1366
2020 Ga0496102_0399544 3300048905 Bacteria 1292
2021 Ga0496102_0448791 3300048905 Bacteria 1210
2022 Ga0496103_0005145 3300048906 Bacteria 7872
2023 Ga0496103_0016501 3300048906 Bacteria 4406
2024 Ga0496103_0030667 3300048906 Bacteria 3273
2025 Ga0496103_0063741 3300048906 Bacteria 2296
2026 Ga0496103_0127946 3300048906 Bacteria 1620
2027 Ga0496104_0000140 3300048907 Bacteria 67259
2028 Ga0496104_0004257 3300048907 Bacteria 12424
2029 Ga0496104_0004576 3300048907 Bacteria 12053
2030 Ga0496104_0023614 3300048907 Bacteria 5654
2031 Ga0496104_0044535 3300048907 Bacteria 4169
2032 Ga0496104_0052803 3300048907 Bacteria 3839
2033 Ga0496104_0100464 3300048907 Bacteria 2769
2034 Ga0496104_0131246 3300048907 Bacteria 2406
2035 Ga0496104_0138976 3300048907 Bacteria 2334
2036 Ga0496104_0140436 3300048907 Bacteria 2320
2037 Ga0496104_0206107 3300048907 Bacteria 1878
2038 Ga0496104_0271785 3300048907 Bacteria 1607
2039 Ga0496105_0000380 3300048908 Bacteria 29146
2040 Ga0496105_0000576 3300048908 Bacteria 24313
2041 Ga0496105_0034765 3300048908 Bacteria 4146
2042 Ga0496105_0092905 3300048908 Bacteria 2491
2043 Ga0496105_0114196 3300048908 Bacteria 2227
2044 Ga0496106_0000545 3300048909 Bacteria 26754
2045 Ga0496106_0017571 3300048909 Bacteria 5291
2046 Ga0496106_0031474 3300048909 Bacteria 3953
2047 Ga0496106_0035798 3300048909 Bacteria 3712
2048 Ga0496106_0038675 3300048909 Bacteria 3571
2049 Ga0496106_0103568 3300048909 Bacteria 2209
2050 Ga0496106_0140803 3300048909 Bacteria 1897
2051 Ga0496107_0004655 3300048910 Bacteria 9309
2052 Ga0496107_0056408 3300048910 Bacteria 2838
2053 Ga0496107_0065099 3300048910 Bacteria 2642
2054 Ga0496107_0157955 3300048910 Bacteria 1679
2055 Ga0496107_0178841 3300048910 Bacteria 1575
2056 Ga0496107_0239521 3300048910 Bacteria 1350
2057 Ga0496108_0003527 3300048911 Bacteria 12544
2058 Ga0496108_0006861 3300048911 Bacteria 9214
2059 Ga0496108_0033633 3300048911 Bacteria 4258
2060 Ga0496108_0033933 3300048911 Bacteria 4238
2061 Ga0496108_0038687 3300048911 Bacteria 3974
2062 Ga0496108_0072725 3300048911 Bacteria 2902
2063 Ga0496108_0116929 3300048911 Bacteria 2284
2064 Ga0496108_0185307 3300048911 Bacteria 1803
2065 Ga0496109_0000239 3300048912 Bacteria 53236
2066 Ga0496109_0005738 3300048912 Bacteria 10390
2067 Ga0496109_0027112 3300048912 Bacteria 5113
2068 Ga0496109_0061090 3300048912 Bacteria 3444
2069 Ga0496109_0172895 3300048912 Bacteria 2027
2070 Ga0496109_0290960 3300048912 Bacteria 1540
2071 Ga0496110_0019956 3300048913 Bacteria 5650
2072 Ga0496110_0022376 3300048913 Bacteria 5367
2073 Ga0496110_0023373 3300048913 Bacteria 5256
2074 Ga0496110_0033603 3300048913 Bacteria 4438
2075 Ga0496110_0060270 3300048913 Bacteria 3346
2076 Ga0496110_0168965 3300048913 Bacteria 1984
2077 Ga0496110_0262121 3300048913 Bacteria 1573
2078 Ga0496110_0263228 3300048913 Bacteria 1569
2079 Ga0496110_0343918 3300048913 Bacteria 1359
2080 Ga0496110_0355074 3300048913 Bacteria 1335
2081 Ga0496111_0000118 3300048914 Bacteria 34263
2082 Ga0496111_0003424 3300048914 Bacteria 9813
2083 Ga0496111_0011884 3300048914 Bacteria 5882
2084 Ga0496111_0046514 3300048914 Bacteria 3124
2085 Ga0496111_0061544 3300048914 Bacteria 2721
2086 Ga0496111_0078651 3300048914 Bacteria 2405
2087 Ga0496111_0179964 3300048914 Bacteria 1571
2088 Ga0496111_0193324 3300048914 Bacteria 1512
2089 Ga0496112_0000019 3300048915 Bacteria 185531
2090 Ga0496112_0002190 3300048915 Bacteria 15554
2091 Ga0496112_0004513 3300048915 Bacteria 11817
2092 Ga0496112_0005879 3300048915 Bacteria 10689
2093 Ga0496112_0018308 3300048915 Bacteria 6594
2094 Ga0496112_0059395 3300048915 Bacteria 3768
2095 Ga0496112_0090328 3300048915 Bacteria 3032
2096 Ga0496112_0096815 3300048915 Bacteria 2921
2097 Ga0496112_0108260 3300048915 Bacteria 2749
2098 Ga0496112_0172011 3300048915 Bacteria 2131
2099 Ga0496112_0179462 3300048915 Bacteria 2081
2100 Ga0496112_0181207 3300048915 Bacteria 2070
2101 Ga0496112_0183328 3300048915 Bacteria 2057
2102 Ga0496112_0251688 3300048915 Bacteria 1717
2103 Ga0496113_0002933 3300048916 Bacteria 10071
2104 Ga0496113_0005641 3300048916 Bacteria 7832
2105 Ga0496113_0007098 3300048916 Bacteria 7172
2106 Ga0496113_0014807 3300048916 Bacteria 5336
2107 Ga0496113_0019960 3300048916 Bacteria 4701
2108 Ga0496113_0021857 3300048916 Bacteria 4517
2109 Ga0496113_0037392 3300048916 Bacteria 3562
2110 Ga0496113_0107723 3300048916 Bacteria 2165
2111 Ga0496113_0206789 3300048916 Bacteria 1561
2112 Ga0496113_0238835 3300048916 Bacteria 1449
2113 Ga0496114_0002985 3300048917 Bacteria 12975
2114 Ga0496114_0004331 3300048917 Bacteria 10991
2115 Ga0496114_0007267 3300048917 Bacteria 8745
2116 Ga0496114_0028502 3300048917 Bacteria 4582
2117 Ga0496114_0036591 3300048917 Bacteria 4058
2118 Ga0496114_0131798 3300048917 Bacteria 2159
2119 Ga0496114_0142358 3300048917 Bacteria 2077
2120 Ga0496114_0148077 3300048917 Bacteria 2036
2121 Ga0496114_0285620 3300048917 Bacteria 1455
2122 Ga0496115_0001845 3300048918 Bacteria 15156
2123 Ga0496115_0008766 3300048918 Bacteria 7496
2124 Ga0496115_0010376 3300048918 Bacteria 6959
2125 Ga0496115_0014383 3300048918 Bacteria 5991
2126 Ga0496115_0027324 3300048918 Bacteria 4462
2127 Ga0496115_0048178 3300048918 Bacteria 3408
2128 Ga0496115_0048549 3300048918 Bacteria 3395
2129 Ga0496115_0051878 3300048918 Bacteria 3289
2130 Ga0496115_0083033 3300048918 Bacteria 2611
2131 Ga0496115_0090646 3300048918 Bacteria 2497
2132 Ga0496115_0097888 3300048918 Bacteria 2402
2133 Ga0496115_0219431 3300048918 Bacteria 1569
2134 Ga0496115_0250613 3300048918 Bacteria 1458
2135 Ga0496115_0278950 3300048918 Bacteria 1372
2136 Ga0496116_0000100 3300048919 Bacteria 194740
2137 Ga0496116_0003944 3300048919 Bacteria 14432
2138 Ga0496116_0030856 3300048919 Bacteria 3845
2139 Ga0496116_0088424 3300048919 Bacteria 1893
2140 Ga0496117_0000002 3300048920 Bacteria 2483758
2141 Ga0496117_0001819 3300048920 Bacteria 28947
2142 Ga0496117_0002714 3300048920 Bacteria 21769
2143 Ga0496117_0006487 3300048920 Bacteria 11810
2144 Ga0496117_0028580 3300048920 Bacteria 4315
2145 Ga0496117_0032581 3300048920 Bacteria 3957
2146 Ga0496117_0151466 3300048920 Bacteria 1372
2147 Ga0496118_0000776 3300048921 Bacteria 51291
2148 Ga0496118_0001431 3300048921 Bacteria 35926
2149 Ga0496118_0004149 3300048921 Bacteria 17505
2150 Ga0496118_0011970 3300048921 Bacteria 8385
2151 Ga0496118_0096524 3300048921 Bacteria 2014
2152 Ga0496118_0098707 3300048921 Bacteria 1982
2153 Ga0496119_0008983 3300048922 Bacteria 8675
2154 Ga0496119_0015551 3300048922 Bacteria 5847
2155 Ga0496119_0022495 3300048922 Bacteria 4510
2156 Ga0496119_0039112 3300048922 Bacteria 3051
2157 Ga0496119_0069459 3300048922 Bacteria 2070
2158 Ga0496119_0080368 3300048922 Bacteria 1880
2159 Ga0496119_0095880 3300048922 Bacteria 1675
2160 Ga0496119_0118282 3300048922 Bacteria 1460
2161 Ga0496120_0000034 3300048923 Bacteria 215228
2162 Ga0496120_0011789 3300048923 Bacteria 5983
2163 Ga0496120_0038187 3300048923 Bacteria 2843
2164 Ga0496120_0040356 3300048923 Bacteria 2743
2165 Ga0496120_0071472 3300048923 Bacteria 1905
2166 Ga0496120_0103800 3300048923 Bacteria 1497
2167 Ga0496121_0000001 3300048924 Bacteria 1830318
2168 Ga0496121_0000261 3300048924 Bacteria 110085
2169 Ga0496121_0000416 3300048924 Bacteria 84469
2170 Ga0496121_0000897 3300048924 Bacteria 53790
2171 Ga0496121_0002730 3300048924 Bacteria 26286
2172 Ga0496121_0002776 3300048924 Bacteria 25986
2173 Ga0496121_0003810 3300048924 Bacteria 21015
2174 Ga0496121_0017585 3300048924 Bacteria 7287
2175 Ga0496121_0026315 3300048924 Bacteria 5486
2176 Ga0496121_0084273 3300048924 Bacteria 2506
2177 Ga0496121_0121828 3300048924 Bacteria 1968
2178 Ga0496121_0128425 3300048924 Bacteria 1902
2179 Ga0496122_0000001 3300048925 Bacteria 1827766
2180 Ga0496122_0000018 3300048925 Bacteria 426350
2181 Ga0496122_0001117 3300048925 Bacteria 46254
2182 Ga0496122_0001480 3300048925 Bacteria 37788
2183 Ga0496122_0001783 3300048925 Bacteria 33000
2184 Ga0496122_0024803 3300048925 Bacteria 5237
2185 Ga0496122_0024811 3300048925 Bacteria 5235
2186 Ga0496122_0041225 3300048925 Bacteria 3654
2187 Ga0496122_0120324 3300048925 Bacteria 1695
2188 Ga0496122_0129620 3300048925 Bacteria 1606
2189 Ga0496123_0000001 3300048926 Bacteria 1831497
2190 Ga0496123_0000015 3300048926 Bacteria 426088
2191 Ga0496123_0000238 3300048926 Bacteria 111297
2192 Ga0496123_0008945 3300048926 Bacteria 9107
2193 Ga0496123_0021959 3300048926 Bacteria 4937
2194 Ga0496123_0035782 3300048926 Bacteria 3532
2195 Ga0496123_0075069 3300048926 Bacteria 2088
2196 Ga0496123_0123641 3300048926 Bacteria 1449
2197 Ga0496124_0000083 3300048927 Bacteria 207798
2198 Ga0496124_0001094 3300048927 Bacteria 42597
2199 Ga0496124_0004346 3300048927 Bacteria 16604
2200 Ga0496124_0036491 3300048927 Bacteria 4286
2201 Ga0496124_0040620 3300048927 Bacteria 4022
2202 Ga0496124_0049092 3300048927 Bacteria 3602
2203 Ga0496124_0082537 3300048927 Bacteria 2638
2204 Ga0496124_0126654 3300048927 Bacteria 2033
2205 Ga0496124_0199855 3300048927 Bacteria 1521
2206 Ga0496125_0000001 3300048928 Bacteria 1766138
2207 Ga0496125_0000299 3300048928 Bacteria 97532
2208 Ga0496125_0000420 3300048928 Bacteria 78930
2209 Ga0496125_0001021 3300048928 Bacteria 43477
2210 Ga0496125_0001161 3300048928 Bacteria 39899
2211 Ga0496125_0004611 3300048928 Bacteria 15750
2212 Ga0496125_0019636 3300048928 Bacteria 6365
2213 Ga0496125_0048935 3300048928 Bacteria 3518
2214 Ga0496125_0049688 3300048928 Bacteria 3481
2215 Ga0496125_0050516 3300048928 Bacteria 3442
2216 Ga0496125_0151414 3300048928 Bacteria 1592
2217 Ga0496126_0000311 3300048929 Bacteria 103353
2218 Ga0496126_0000406 3300048929 Bacteria 87599
2219 Ga0496126_0004026 3300048929 Bacteria 17896
2220 Ga0496126_0011809 3300048929 Bacteria 8988
2221 Ga0496126_0016551 3300048929 Bacteria 7370
2222 Ga0496126_0018156 3300048929 Bacteria 6979
2223 Ga0496126_0020204 3300048929 Bacteria 6536
2224 Ga0496126_0027661 3300048929 Bacteria 5413
2225 Ga0496126_0035842 3300048929 Bacteria 4644
2226 Ga0496126_0057931 3300048929 Bacteria 3494
2227 Ga0496126_0059982 3300048929 Bacteria 3424
2228 Ga0496126_0069766 3300048929 Bacteria 3133
2229 Ga0496126_0129344 3300048929 Bacteria 2183
2230 Ga0496126_0133780 3300048929 Bacteria 2140
2231 Ga0496126_0235206 3300048929 Bacteria 1533
2232 Ga0496126_0280838 3300048929 Bacteria 1379
2233 Ga0495682_0018103 3300049460 Bacteria 2653
2234 Ga0501031_0000003 3300049568 Bacteria 206821
2235 Ga0501031_0002158 3300049568 Bacteria 12412
2236 Ga0501031_0005866 3300049568 Bacteria 8003
2237 Ga0501031_0018296 3300049568 Bacteria 4560
2238 Ga0501031_0035636 3300049568 Bacteria 3246
2239 Ga0501031_0041845 3300049568 Bacteria 2991
2240 Ga0501031_0079654 3300049568 Bacteria 2135
2241 Ga0501032_0000001 3300049569 Bacteria 422097
2242 Ga0501032_0000010 3300049569 Bacteria 206795
2243 Ga0501032_0000172 3300049569 Bacteria 52773
2244 Ga0501032_0026384 3300049569 Bacteria 3995
2245 Ga0501032_0027935 3300049569 Bacteria 3877
2246 Ga0501032_0081469 3300049569 Bacteria 2153
2247 Ga0501032_0126055 3300049569 Bacteria 1691
2248 Ga0501032_0140369 3300049569 Bacteria 1591
2249 Ga0501032_0187049 3300049569 Bacteria 1354
2250 Ga0501032_0237890 3300049569 Bacteria 1183
2251 Ga0501033_0000017 3300049570 Bacteria 206819
2252 Ga0501033_0000193 3300049570 Bacteria 58649
2253 Ga0501033_0000230 3300049570 Bacteria 53911
2254 Ga0501033_0000830 3300049570 Bacteria 28206
2255 Ga0501033_0004882 3300049570 Bacteria 10679
2256 Ga0501033_0006388 3300049570 Bacteria 9231
2257 Ga0501033_0012923 3300049570 Bacteria 6368
2258 Ga0501033_0019512 3300049570 Bacteria 5125
2259 Ga0501033_0021419 3300049570 Bacteria 4877
2260 Ga0501033_0022248 3300049570 Bacteria 4784
2261 Ga0501033_0064718 3300049570 Bacteria 2690
2262 Ga0501033_0065023 3300049570 Bacteria 2683
2263 Ga0501033_0069587 3300049570 Bacteria 2586
2264 Ga0501033_0081561 3300049570 Bacteria 2372
2265 Ga0501033_0107452 3300049570 Bacteria 2032
2266 Ga0501033_0132678 3300049570 Bacteria 1803
2267 Ga0501033_0147117 3300049570 Bacteria 1701
2268 Ga0501033_0147999 3300049570 Bacteria 1695
2269 Ga0501033_0153613 3300049570 Bacteria 1659
2270 Ga0501033_0179206 3300049570 Bacteria 1519
2271 Ga0501033_0182930 3300049570 Bacteria 1502
2272 Ga0501033_0249176 3300049570 Bacteria 1259
2273 Ga0501034_0000036 3300049571 Bacteria 239274
2274 Ga0501034_0000053 3300049571 Bacteria 206821
2275 Ga0501034_0000270 3300049571 Bacteria 94119
2276 Ga0501034_0000676 3300049571 Bacteria 51758
2277 Ga0501034_0002063 3300049571 Bacteria 25112
2278 Ga0501034_0003680 3300049571 Bacteria 17330
2279 Ga0501034_0014182 3300049571 Bacteria 8214
2280 Ga0501034_0017446 3300049571 Bacteria 7361
2281 Ga0501034_0033715 3300049571 Bacteria 5191
2282 Ga0501034_0036811 3300049571 Bacteria 4956
2283 Ga0501034_0044021 3300049571 Bacteria 4515
2284 Ga0501034_0054374 3300049571 Bacteria 4030
2285 Ga0501034_0054954 3300049571 Bacteria 4007
2286 Ga0501034_0063691 3300049571 Bacteria 3701
2287 Ga0501034_0073745 3300049571 Bacteria 3422
2288 Ga0501034_0074311 3300049571 Bacteria 3407
2289 Ga0501034_0106224 3300049571 Bacteria 2800
2290 Ga0501034_0127860 3300049571 Bacteria 2525
2291 Ga0501034_0159981 3300049571 Bacteria 2223
2292 Ga0501034_0165049 3300049571 Bacteria 2183
2293 Ga0501034_0178346 3300049571 Bacteria 2090
2294 Ga0501034_0209763 3300049571 Bacteria 1903
2295 Ga0501034_0212309 3300049571 Bacteria 1890
2296 Ga0501034_0288505 3300049571 Bacteria 1579
2297 Ga0501034_0456782 3300049571 Bacteria 1194
2298 Ga0501034_0466808 3300049571 Bacteria 1178
2299 Ga0501036_0000009 3300049572 Bacteria 206821
2300 Ga0501036_0000325 3300049572 Bacteria 33156
2301 Ga0501036_0000431 3300049572 Bacteria 29800
2302 Ga0501036_0009263 3300049572 Bacteria 8091
2303 Ga0501036_0009265 3300049572 Bacteria 8090
2304 Ga0501036_0015408 3300049572 Bacteria 6385
2305 Ga0501036_0022933 3300049572 Bacteria 5256
2306 Ga0501036_0037190 3300049572 Bacteria 4118
2307 Ga0501036_0091015 3300049572 Bacteria 2577
2308 Ga0501036_0208228 3300049572 Bacteria 1643
2309 Ga0501037_0000008 3300049573 Bacteria 206812
2310 Ga0501037_0000017 3300049573 Bacteria 157276
2311 Ga0501037_0000168 3300049573 Bacteria 61484
2312 Ga0501037_0000755 3300049573 Bacteria 24430
2313 Ga0501037_0003704 3300049573 Bacteria 11097
2314 Ga0501037_0005653 3300049573 Bacteria 9112
2315 Ga0501037_0019304 3300049573 Bacteria 5026
2316 Ga0501037_0021833 3300049573 Bacteria 4737
2317 Ga0501037_0035626 3300049573 Bacteria 3669
2318 Ga0501037_0054212 3300049573 Bacteria 2932
2319 Ga0501037_0083035 3300049573 Bacteria 2321
2320 Ga0501037_0088441 3300049573 Bacteria 2242
2321 Ga0501037_0142987 3300049573 Bacteria 1711
2322 Ga0501037_0162294 3300049573 Bacteria 1593
2323 Ga0501037_0199783 3300049573 Bacteria 1413
2324 Ga0501038_0000008 3300049574 Bacteria 206821
2325 Ga0501038_0000036 3300049574 Bacteria 124766
2326 Ga0501038_0000089 3300049574 Bacteria 78009
2327 Ga0501038_0028255 3300049574 Bacteria 4984
2328 Ga0501038_0030612 3300049574 Bacteria 4760
2329 Ga0501038_0037797 3300049574 Bacteria 4231
2330 Ga0501038_0042764 3300049574 Bacteria 3945
2331 Ga0501038_0057515 3300049574 Bacteria 3338
2332 Ga0501038_0063535 3300049574 Bacteria 3150
2333 Ga0501038_0079564 3300049574 Bacteria 2763
2334 Ga0501038_0085329 3300049574 Bacteria 2655
2335 Ga0501038_0154863 3300049574 Bacteria 1867
2336 Ga0501038_0160582 3300049574 Bacteria 1826
2337 Ga0501038_0250123 3300049574 Bacteria 1404
2338 Ga0501039_0000011 3300049575 Bacteria 245124
2339 Ga0501039_0000021 3300049575 Bacteria 162552
2340 Ga0501039_0000559 3300049575 Bacteria 26920
2341 Ga0501039_0026996 3300049575 Bacteria 4414
2342 Ga0501039_0045634 3300049575 Bacteria 3386
2343 Ga0501039_0172423 3300049575 Bacteria 1701
2344 Ga0501039_0291581 3300049575 Bacteria 1283
2345 Ga0501039_0333710 3300049575 Bacteria 1191
2346 Ga0501040_0015158 3300049576 Bacteria 5093
2347 Ga0501040_0028523 3300049576 Bacteria 3763
2348 Ga0501042_0020346 3300049578 Bacteria 4619
2349 Ga0501043_0000005 3300049579 Bacteria 254466
2350 Ga0501043_0000105 3300049579 Bacteria 78189
2351 Ga0501043_0000279 3300049579 Bacteria 46075
2352 Ga0501043_0005921 3300049579 Bacteria 9832
2353 Ga0501043_0006222 3300049579 Bacteria 9588
2354 Ga0501043_0009335 3300049579 Bacteria 7707
2355 Ga0501043_0029255 3300049579 Bacteria 4327
2356 Ga0501043_0033851 3300049579 Bacteria 4020
2357 Ga0501043_0044072 3300049579 Bacteria 3507
2358 Ga0501043_0062354 3300049579 Bacteria 2927
2359 Ga0501043_0073242 3300049579 Bacteria 2690
2360 Ga0501043_0110782 3300049579 Bacteria 2155
2361 Ga0501043_0131128 3300049579 Bacteria 1964
2362 Ga0501043_0134713 3300049579 Bacteria 1935
2363 Ga0501046_0001949 3300049580 Bacteria 19609
2364 Ga0501046_0013725 3300049580 Bacteria 6849
2365 Ga0501046_0021790 3300049580 Bacteria 5282
2366 Ga0501046_0023228 3300049580 Bacteria 5103
2367 Ga0501046_0028623 3300049580 Bacteria 4536
2368 Ga0501046_0041200 3300049580 Bacteria 3686
2369 Ga0501046_0047408 3300049580 Bacteria 3406
2370 Ga0501046_0078424 3300049580 Bacteria 2555
2371 Ga0501046_0092649 3300049580 Bacteria 2323
2372 Ga0501046_0261036 3300049580 Bacteria 1273
2373 Ga0501047_0000126 3300049581 Bacteria 93841
2374 Ga0501047_0000161 3300049581 Bacteria 81928
2375 Ga0501047_0000594 3300049581 Bacteria 38494
2376 Ga0501047_0004095 3300049581 Bacteria 13716
2377 Ga0501047_0004487 3300049581 Bacteria 13134
2378 Ga0501047_0005429 3300049581 Bacteria 11993
2379 Ga0501047_0015068 3300049581 Bacteria 7358
2380 Ga0501047_0020365 3300049581 Bacteria 6370
2381 Ga0501047_0031408 3300049581 Bacteria 5122
2382 Ga0501047_0032423 3300049581 Bacteria 5043
2383 Ga0501047_0053817 3300049581 Bacteria 3893
2384 Ga0501047_0055349 3300049581 Bacteria 3837
2385 Ga0501047_0058693 3300049581 Bacteria 3716
2386 Ga0501047_0067367 3300049581 Bacteria 3450
2387 Ga0501047_0073578 3300049581 Bacteria 3290
2388 Ga0501047_0121207 3300049581 Bacteria 2497
2389 Ga0501047_0124409 3300049581 Bacteria 2459
2390 Ga0501047_0133998 3300049581 Bacteria 2357
2391 Ga0501047_0195711 3300049581 Bacteria 1884
2392 Ga0501047_0204100 3300049581 Bacteria 1836
2393 Ga0501047_0218742 3300049581 Bacteria 1761
2394 Ga0501047_0232755 3300049581 Bacteria 1695
2395 Ga0501047_0282107 3300049581 Bacteria 1505
2396 Ga0501048_0000030 3300049582 Bacteria 66042
2397 Ga0501048_0013422 3300049582 Bacteria 6080
2398 Ga0501048_0064543 3300049582 Bacteria 2589
2399 Ga0501048_0111085 3300049582 Bacteria 1935
2400 Ga0501048_0160784 3300049582 Bacteria 1590
2401 Ga0501067_0000445 3300049583 Bacteria 22645
2402 Ga0501067_0007751 3300049583 Bacteria 5973
2403 Ga0501067_0015697 3300049583 Bacteria 4190
2404 Ga0501067_0019608 3300049583 Bacteria 3744
2405 Ga0501067_0036634 3300049583 Bacteria 2724
2406 Ga0501067_0064647 3300049583 Bacteria 2025
2407 Ga0501068_0000286 3300049584 Bacteria 25165
2408 Ga0501068_0017894 3300049584 Bacteria 4102
2409 Ga0501068_0027634 3300049584 Bacteria 3351
2410 Ga0501068_0051627 3300049584 Bacteria 2488
2411 Ga0501068_0090490 3300049584 Bacteria 1887
2412 Ga0501069_0000011 3300049585 Bacteria 153214
2413 Ga0501069_0000915 3300049585 Bacteria 14102
2414 Ga0501069_0023739 3300049585 Bacteria 3343
2415 Ga0501069_0026908 3300049585 Bacteria 3150
2416 Ga0501069_0028278 3300049585 Bacteria 3074
2417 Ga0501069_0043862 3300049585 Bacteria 2476
2418 Ga0501069_0080127 3300049585 Bacteria 1838
2419 Ga0501069_0101520 3300049585 Bacteria 1633
2420 Ga0501069_0141878 3300049585 Bacteria 1378
2421 Ga0501070_0000031 3300049586 Bacteria 138137
2422 Ga0501070_0000055 3300049586 Bacteria 99156
2423 Ga0501070_0005933 3300049586 Bacteria 10415
2424 Ga0501070_0006547 3300049586 Bacteria 9907
2425 Ga0501070_0006643 3300049586 Bacteria 9847
2426 Ga0501070_0011687 3300049586 Bacteria 7414
2427 Ga0501070_0018187 3300049586 Bacteria 5895
2428 Ga0501070_0019925 3300049586 Bacteria 5625
2429 Ga0501070_0020096 3300049586 Bacteria 5601
2430 Ga0501070_0025105 3300049586 Bacteria 4996
2431 Ga0501070_0028804 3300049586 Bacteria 4656
2432 Ga0501070_0040426 3300049586 Bacteria 3887
2433 Ga0501070_0041477 3300049586 Bacteria 3834
2434 Ga0501070_0056572 3300049586 Bacteria 3251
2435 Ga0501070_0067218 3300049586 Bacteria 2968
2436 Ga0501070_0067515 3300049586 Bacteria 2961
2437 Ga0501070_0069113 3300049586 Bacteria 2924
2438 Ga0501070_0090375 3300049586 Bacteria 2534
2439 Ga0501070_0128874 3300049586 Bacteria 2090
2440 Ga0501070_0138616 3300049586 Bacteria 2008
2441 Ga0501070_0145593 3300049586 Bacteria 1955
2442 Ga0501070_0215017 3300049586 Bacteria 1577
2443 Ga0501070_0241222 3300049586 Bacteria 1479
2444 Ga0501071_0004100 3300049587 Bacteria 9215
2445 Ga0501071_0042246 3300049587 Bacteria 3266
2446 Ga0501071_0191197 3300049587 Bacteria 1535
2447 Ga0501072_0001354 3300049588 Bacteria 18378
2448 Ga0501072_0005386 3300049588 Bacteria 9740
2449 Ga0501072_0055521 3300049588 Bacteria 3122
2450 Ga0501072_0104025 3300049588 Bacteria 2257
2451 Ga0501072_0202314 3300049588 Bacteria 1583
2452 Ga0501072_0213477 3300049588 Bacteria 1538
2453 Ga0501072_0217356 3300049588 Bacteria 1523
2454 Ga0501073_0000055 3300049589 Bacteria 71726
2455 Ga0501073_0004806 3300049589 Bacteria 10140
2456 Ga0501073_0005414 3300049589 Bacteria 9557
2457 Ga0501073_0008803 3300049589 Bacteria 7464
2458 Ga0501073_0014419 3300049589 Bacteria 5743
2459 Ga0501073_0021793 3300049589 Bacteria 4616
2460 Ga0501073_0022155 3300049589 Bacteria 4578
2461 Ga0501073_0025861 3300049589 Bacteria 4205
2462 Ga0501073_0028980 3300049589 Bacteria 3955
2463 Ga0501073_0033513 3300049589 Bacteria 3657
2464 Ga0501073_0038611 3300049589 Bacteria 3385
2465 Ga0501073_0117951 3300049589 Bacteria 1839
2466 Ga0501073_0126953 3300049589 Bacteria 1768
2467 Ga0501073_0183010 3300049589 Bacteria 1450
2468 Ga0501073_0205376 3300049589 Bacteria 1362
2469 Ga0501074_0000039 3300049590 Bacteria 60866
2470 Ga0501074_0002024 3300049590 Bacteria 13983
2471 Ga0501074_0002060 3300049590 Bacteria 13892
2472 Ga0501074_0007017 3300049590 Bacteria 8131
2473 Ga0501074_0070376 3300049590 Bacteria 2515
2474 Ga0501074_0071048 3300049590 Bacteria 2502
2475 Ga0501074_0072948 3300049590 Bacteria 2465
2476 Ga0501074_0130577 3300049590 Bacteria 1797
2477 Ga0501074_0140812 3300049590 Bacteria 1725
2478 Ga0501075_0177777 3300049591 Bacteria 1624
2479 Ga0501076_0125059 3300049592 Bacteria 2084
2480 Ga0501077_0041742 3300049593 Bacteria 2919
2481 Ga0501077_0056811 3300049593 Bacteria 2485
2482 Ga0501077_0067049 3300049593 Bacteria 2276
2483 Ga0501077_0101761 3300049593 Bacteria 1821
2484 Ga0501077_0174451 3300049593 Bacteria 1366
2485 Ga0501079_0011896 3300049741 Bacteria 6641
2486 Ga0501079_0018135 3300049741 Bacteria 5375
2487 Ga0501079_0037919 3300049741 Bacteria 3716
2488 Ga0501079_0050088 3300049741 Bacteria 3224
2489 Ga0501079_0061077 3300049741 Bacteria 2907
2490 Ga0501079_0069758 3300049741 Bacteria 2713
2491 Ga0501079_0234013 3300049741 Bacteria 1435
2492 Ga0501080_0000181 3300049742 Bacteria 45949
2493 Ga0501080_0000217 3300049742 Bacteria 42758
2494 Ga0501080_0000841 3300049742 Bacteria 25074
2495 Ga0501080_0001044 3300049742 Bacteria 22786
2496 Ga0501080_0008361 3300049742 Bacteria 9370
2497 Ga0501080_0015456 3300049742 Bacteria 7037
2498 Ga0501080_0024721 3300049742 Bacteria 5570
2499 Ga0501080_0034630 3300049742 Bacteria 4716
2500 Ga0501080_0040727 3300049742 Bacteria 4332
2501 Ga0501080_0044725 3300049742 Bacteria 4121
2502 Ga0501080_0054823 3300049742 Bacteria 3712
2503 Ga0501080_0060616 3300049742 Bacteria 3522
2504 Ga0501080_0150348 3300049742 Bacteria 2152
2505 Ga0501080_0184075 3300049742 Bacteria 1921
2506 Ga0501080_0383002 3300049742 Bacteria 1267
2507 Ga0501081_0261904 3300049743 Bacteria 1264
2508 Ga0501083_0000180 3300049744 Bacteria 40737
2509 Ga0501083_0000423 3300049744 Bacteria 27160
2510 Ga0501083_0002306 3300049744 Bacteria 13049
2511 Ga0501083_0004517 3300049744 Bacteria 9833
2512 Ga0501083_0014019 3300049744 Bacteria 5602
2513 Ga0501083_0014147 3300049744 Bacteria 5580
2514 Ga0501083_0018025 3300049744 Bacteria 4922
2515 Ga0501083_0033040 3300049744 Bacteria 3544
2516 Ga0501083_0047911 3300049744 Bacteria 2886
2517 Ga0501083_0080105 3300049744 Bacteria 2166
2518 Ga0501083_0102106 3300049744 Bacteria 1890
2519 Ga0501083_0164512 3300049744 Bacteria 1450
2520 Ga0501241_001216 3300049758 Bacteria 5338
2521 Ga0501035_0000023 3300049822 Bacteria 206821
2522 Ga0501035_0000028 3300049822 Bacteria 179195
2523 Ga0501035_0000150 3300049822 Bacteria 85450
2524 Ga0501035_0000938 3300049822 Bacteria 30768
2525 Ga0501035_0000947 3300049822 Bacteria 30664
2526 Ga0501035_0001984 3300049822 Bacteria 20462
2527 Ga0501035_0002250 3300049822 Bacteria 19104
2528 Ga0501035_0004845 3300049822 Bacteria 12760
2529 Ga0501035_0005547 3300049822 Bacteria 11919
2530 Ga0501035_0011573 3300049822 Bacteria 8179
2531 Ga0501035_0015209 3300049822 Bacteria 7103
2532 Ga0501035_0020854 3300049822 Bacteria 6021
2533 Ga0501035_0020935 3300049822 Bacteria 6010
2534 Ga0501035_0034174 3300049822 Bacteria 4621
2535 Ga0501035_0037722 3300049822 Bacteria 4374
2536 Ga0501035_0041151 3300049822 Bacteria 4173
2537 Ga0501035_0046065 3300049822 Bacteria 3922
2538 Ga0501035_0061662 3300049822 Bacteria 3338
2539 Ga0501035_0069023 3300049822 Bacteria 3133
2540 Ga0501035_0076326 3300049822 Bacteria 2963
2541 Ga0501035_0083021 3300049822 Bacteria 2827
2542 Ga0501035_0089804 3300049822 Bacteria 2705
2543 Ga0501035_0140841 3300049822 Bacteria 2097
2544 Ga0501035_0146904 3300049822 Bacteria 2047
2545 Ga0501035_0147948 3300049822 Bacteria 2039
2546 Ga0501035_0148013 3300049822 Bacteria 2039
2547 Ga0501035_0175538 3300049822 Bacteria 1848
2548 Ga0501035_0189792 3300049822 Bacteria 1767
2549 Ga0501035_0206488 3300049822 Bacteria 1682
2550 Ga0501035_0207612 3300049822 Bacteria 1677
2551 Ga0501035_0371660 3300049822 Bacteria 1193
2552 Ga0501044_0000021 3300049823 Bacteria 206821
2553 Ga0501044_0000546 3300049823 Bacteria 45906
2554 Ga0501044_0001322 3300049823 Bacteria 29176
2555 Ga0501044_0003346 3300049823 Bacteria 18079
2556 Ga0501044_0003659 3300049823 Bacteria 17293
2557 Ga0501044_0005402 3300049823 Bacteria 14194
2558 Ga0501044_0010129 3300049823 Bacteria 10243
2559 Ga0501044_0020003 3300049823 Bacteria 7148
2560 Ga0501044_0036997 3300049823 Bacteria 5103
2561 Ga0501044_0043641 3300049823 Bacteria 4657
2562 Ga0501044_0054087 3300049823 Bacteria 4128
2563 Ga0501044_0061297 3300049823 Bacteria 3848
2564 Ga0501044_0086246 3300049823 Bacteria 3171
2565 Ga0501044_0093374 3300049823 Bacteria 3034
2566 Ga0501044_0098098 3300049823 Bacteria 2950
2567 Ga0501044_0108936 3300049823 Bacteria 2779
2568 Ga0501044_0115422 3300049823 Bacteria 2690
2569 Ga0501044_0134958 3300049823 Bacteria 2459
2570 Ga0501044_0138749 3300049823 Bacteria 2420
2571 Ga0501044_0157903 3300049823 Bacteria 2246
2572 Ga0501044_0168465 3300049823 Bacteria 2163
2573 Ga0501044_0175936 3300049823 Bacteria 2109
2574 Ga0501044_0242873 3300049823 Bacteria 1744
2575 Ga0501044_0278998 3300049823 Bacteria 1605
2576 Ga0501044_0306137 3300049823 Bacteria 1516
2577 Ga0501044_0380412 3300049823 Bacteria 1327
2578 Ga0501045_0024541 3300049824 Bacteria 4329
2579 Ga0501045_0051344 3300049824 Bacteria 3009
2580 Ga0501045_0174228 3300049824 Bacteria 1603
2581 nmdc:mga03683_5606_c1 3300050489 Bacteria 4245
2582 nmdc:mga03n38_13020_c1 3300050490 Bacteria 3147
2583 nmdc:mga03n38_396_c1 3300050490 Bacteria 10795
2584 nmdc:mga00v17_100891_c1 3300050491 Bacteria 1822
2585 nmdc:mga00v17_217_c1 3300050491 Bacteria 20892
2586 nmdc:mga00v17_3725_c1 3300050491 Bacteria 7870
2587 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
2588 nmdc:mga00v17_7535_c1 3300050491 Bacteria 5811
2589 nmdc:mga00v17_84090_c1 3300050491 Bacteria 1991
2590 nmdc:mga00v17_8683_c1 3300050491 Bacteria 5473
2591 nmdc:mga0yw44_111734_c1 3300050492 Bacteria 1752
2592 nmdc:mga0yw44_15237_c1 3300050492 Bacteria 4111
2593 nmdc:mga0yw44_17251_c1 3300050492 Bacteria 3925
2594 nmdc:mga0yw44_20710_c1 3300050492 Bacteria 3656
2595 nmdc:mga0yw44_26119_c1 3300050492 Bacteria 2210
2596 nmdc:mga0yw44_3078_c1 3300050492 Bacteria 7305
2597 nmdc:mga0yw44_55821_c1 3300050492 Bacteria 2404
2598 nmdc:mga0yw44_9437_c1 3300050492 Bacteria 4934
2599 nmdc:mga0k408_20280_c1 3300050493 Bacteria 3722
2600 nmdc:mga0k408_20389_c1 3300050493 Bacteria 3713
2601 nmdc:mga06z11_40250_c1 3300050494 Bacteria 2331
2602 nmdc:mga04h51_1085_c1 3300050495 Bacteria 6276
2603 nmdc:mga04h51_53356_c1 3300050495 Bacteria 1364
2604 nmdc:mga05p37_133211_c1 3300050507 Bacteria 3049
2605 nmdc:mga05p37_272394_c1 3300050507 Bacteria 2022
2606 nmdc:mga05p37_61584_c1 3300050507 Bacteria 4619
2607 nmdc:mga09592_228495_c1 3300050508 Bacteria 1612
2608 nmdc:mga09592_92323_c1 3300050508 Bacteria 2588
2609 nmdc:mga0qj67_125661_c1 3300050509 Bacteria 2076
2610 nmdc:mga0qj67_142371_c1 3300050509 Bacteria 1944
2611 nmdc:mga0qj67_144474_c1 3300050509 Bacteria 1929
2612 nmdc:mga0qj67_35861_c1 3300050509 Bacteria 3878
2613 nmdc:mga0qj67_688_c1 3300050509 Bacteria 23045
2614 nmdc:mga06r32_106472_c2 3300050510 Bacteria 2435
2615 nmdc:mga06r32_2526_c1 3300050510 Bacteria 16363
2616 nmdc:mga06r32_391079_c1 3300050510 Bacteria 1373
2617 nmdc:mga08y16_3102_c1 3300050511 Bacteria 17196
2618 nmdc:mga08y16_366768_c1 3300050511 Bacteria 1478
2619 nmdc:mga08y16_52420_c1 3300050511 Bacteria 4268
2620 nmdc:mga08y16_76316_c1 3300050511 Bacteria 3493
2621 nmdc:mga08y16_8805_c1 3300050511 Bacteria 10591
2622 nmdc:mga0n895_105910_c1 3300050512 Bacteria 2825
2623 nmdc:mga0n895_12052_c1 3300050512 Bacteria 7739
2624 nmdc:mga0n895_142667_c1 3300050512 Bacteria 2424
2625 nmdc:mga0n895_19229_c1 3300050512 Bacteria 6344
2626 nmdc:mga0n895_25596_c1 3300050512 Bacteria 5577
2627 nmdc:mga0n895_54049_c1 3300050512 Bacteria 3948
2628 nmdc:mga0rr50_139941_c1 3300050513 Bacteria 1946
2629 nmdc:mga0rr50_177401_c1 3300050513 Bacteria 1740
2630 nmdc:mga0rr50_180069_c1 3300050513 Bacteria 1727
2631 nmdc:mga0rr50_303516_c1 3300050513 Bacteria 1336
2632 nmdc:mga0rr50_336770_c1 3300050513 Bacteria 1267
2633 nmdc:mga0rr50_60622_c1 3300050513 Bacteria 2847
2634 nmdc:mga08x19_112835_c1 3300050514 Bacteria 1814
2635 nmdc:mga08x19_125019_c1 3300050514 Bacteria 1727
2636 nmdc:mga08x19_2193_c1 3300050514 Bacteria 8925
2637 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
2638 nmdc:mga08x19_34747_c1 3300050514 Bacteria 3187
2639 nmdc:mga08x19_6626_c1 3300050514 Bacteria 6867
2640 nmdc:mga0a205_20357_c1 3300050515 Bacteria 6258
2641 nmdc:mga0sz30_31114_c1 3300050516 Bacteria 2208
2642 nmdc:mga0sz30_58439_c1 3300050516 Bacteria 1644
2643 nmdc:mga0sz30_63943_c1 3300050516 Bacteria 1575
2644 nmdc:mga0sz30_79663_c1 3300050516 Bacteria 1417
2645 nmdc:mga0sz30_94764_c1 3300050516 Bacteria 1301
2646 Ga0495601_0000008 3300053077 Bacteria 362152
2647 Ga0495601_0000515 3300053077 Bacteria 20386
2648 Ga0495601_0001150 3300053077 Bacteria 14457
2649 Ga0495601_0136291 3300053077 Bacteria 1600
2650 Ga0495612_0000002 3300053078 Bacteria 310466
2651 Ga0495612_0000165 3300053078 Bacteria 27544
2652 Ga0495612_0000796 3300053078 Bacteria 12820
2653 Ga0495612_0004422 3300053078 Bacteria 5827
2654 Ga0495612_0008920 3300053078 Bacteria 4064
2655 Ga0495612_0050873 3300053078 Bacteria 1702
2656 Ga0495612_0066094 3300053078 Bacteria 1503
2657 Ga0500610_0142435 3300053079 Bacteria 1209
2658 Ga0500635_0055771 3300053080 Bacteria 1365
2659 Ga0495655_0012865 3300053083 Bacteria 1716
2660 Ga0495595_0000008 3300053084 Bacteria 196206
2661 Ga0495595_0000205 3300053084 Bacteria 24011
2662 Ga0495595_0000830 3300053084 Bacteria 11816
2663 Ga0495595_0001488 3300053084 Bacteria 9151
2664 Ga0495595_0003119 3300053084 Bacteria 6564
2665 Ga0495595_0004564 3300053084 Bacteria 5570
2666 Ga0495595_0012052 3300053084 Bacteria 3625
2667 Ga0495595_0031914 3300053084 Bacteria 2370
2668 Ga0495619_0000002 3300053085 Bacteria 530226
2669 Ga0495619_0000016 3300053085 Bacteria 231442
2670 Ga0495619_0000292 3300053085 Bacteria 35551
2671 Ga0495619_0000458 3300053085 Bacteria 27498
2672 Ga0495619_0000804 3300053085 Bacteria 20515
2673 Ga0495619_0007391 3300053085 Bacteria 6959
2674 Ga0495619_0011276 3300053085 Bacteria 5623
2675 Ga0495619_0021404 3300053085 Bacteria 4128
2676 Ga0495619_0029075 3300053085 Bacteria 3569
2677 Ga0495619_0197631 3300053085 Bacteria 1392
2678 Ga0500643_000008 3300053087 Bacteria 457931
2679 Ga0500643_000091 3300053087 Bacteria 93825
2680 Ga0500643_025947 3300053087 Bacteria 1841
2681 Ga0500581_045784 3300053089 Bacteria 2235
2682 Ga0500646_0058097 3300053090 Bacteria 1132
2683 Ga0500651_0001732 3300053093 Bacteria 11171
2684 Ga0500651_0015118 3300053093 Bacteria 4733
2685 Ga0500566_0000095 3300053094 Bacteria 44474
2686 Ga0500566_0000144 3300053094 Bacteria 36317
2687 Ga0500566_0000565 3300053094 Bacteria 20802
2688 Ga0500641_0018346 3300053096 Bacteria 2631
2689 Ga0500648_111229 3300053097 Bacteria 1512
2690 Ga0500650_0033840 3300053098 Bacteria 2332
2691 Ga0500650_0091863 3300053098 Bacteria 1421
2692 Ga0500650_0093647 3300053098 Bacteria 1406
2693 Ga0500555_009461 3300053103 Bacteria 2787
2694 Ga0500556_0000005 3300053104 Bacteria 581135
2695 Ga0500556_0000250 3300053104 Bacteria 43584
2696 Ga0500557_000028 3300053105 Bacteria 78414
2697 Ga0500572_000337 3300053111 Bacteria 16850
2698 Ga0500572_002615 3300053111 Bacteria 4280
2699 Ga0500592_003205 3300053116 Bacteria 2610
2700 Ga0500593_000145 3300053117 Bacteria 28112
2701 Ga0500593_082878 3300053117 Bacteria 1371
2702 Ga0500595_003128 3300053119 Bacteria 7840
2703 Ga0500595_003651 3300053119 Bacteria 7123
2704 Ga0500595_004366 3300053119 Bacteria 6363
2705 Ga0500595_012611 3300053119 Bacteria 3262
2706 Ga0500595_015485 3300053119 Bacteria 2860
2707 Ga0500608_000314 3300053122 Bacteria 18695
2708 Ga0500608_031166 3300053122 Bacteria 2530
2709 Ga0500608_087006 3300053122 Bacteria 1466
2710 Ga0500614_013540 3300053123 Bacteria 1793
2711 Ga0500617_043511 3300053124 Bacteria 2008
2712 Ga0500618_000090 3300053125 Bacteria 74320
2713 Ga0500618_002263 3300053125 Bacteria 7485
2714 Ga0500642_0000189 3300053130 Bacteria 25159
2715 Ga0500642_0000275 3300053130 Bacteria 19281
2716 Ga0500642_0007786 3300053130 Bacteria 3621
2717 Ga0500642_0027275 3300053130 Bacteria 2342
2718 Ga0500652_000017 3300053131 Bacteria 121760
2719 Ga0500652_000697 3300053131 Bacteria 11434
2720 Ga0500655_008905 3300053133 Bacteria 1806
2721 Ga0500658_0002405 3300053134 Bacteria 7251
2722 Ga0500658_0030846 3300053134 Bacteria 2093
2723 Ga0500658_0051206 3300053134 Bacteria 1688
2724 Ga0500559_0000791 3300053136 Bacteria 20652
2725 Ga0500559_0001773 3300053136 Bacteria 11840
2726 Ga0500559_0011005 3300053136 Bacteria 3873
2727 Ga0500559_0022210 3300053136 Bacteria 2691
2728 Ga0500559_0104106 3300053136 Bacteria 1310
2729 Ga0500561_0000031 3300053137 Bacteria 28771
2730 Ga0500568_0000002 3300053139 Bacteria 880601
2731 Ga0500568_0000211 3300053139 Bacteria 50486
2732 Ga0500568_0000261 3300053139 Bacteria 44777
2733 Ga0500568_0000677 3300053139 Bacteria 24595
2734 Ga0500568_0005885 3300053139 Bacteria 6244
2735 Ga0500568_0012726 3300053139 Bacteria 3858
2736 Ga0500568_0023379 3300053139 Bacteria 2629
2737 Ga0500573_0000028 3300053140 Bacteria 142610
2738 Ga0500573_0026536 3300053140 Bacteria 3329
2739 Ga0500577_0040972 3300053142 Bacteria 1687
2740 Ga0500586_044008 3300053145 Bacteria 1523
2741 Ga0500590_004157 3300053148 Bacteria 6791
2742 Ga0500590_034490 3300053148 Bacteria 2619
2743 Ga0500590_066663 3300053148 Bacteria 1797
2744 Ga0500590_079023 3300053148 Bacteria 1619
2745 Ga0500603_001070 3300053150 Bacteria 6434
2746 Ga0500604_0003206 3300053151 Bacteria 4397
2747 Ga0500604_0009621 3300053151 Bacteria 2577
2748 Ga0500604_0029563 3300053151 Bacteria 1598
2749 Ga0500616_0000118 3300053153 Bacteria 143496
2750 Ga0500616_0001322 3300053153 Bacteria 24433
2751 Ga0500616_0003925 3300053153 Bacteria 10921
2752 Ga0500616_0012628 3300053153 Bacteria 4939
2753 Ga0500616_0035808 3300053153 Bacteria 2697
2754 Ga0500616_0073185 3300053153 Bacteria 1740
2755 Ga0500616_0083031 3300053153 Bacteria 1606
2756 Ga0500619_004547 3300053154 Bacteria 2992
2757 Ga0500620_003706 3300053155 Bacteria 3306
2758 Ga0500622_0001167 3300053156 Bacteria 21767
2759 Ga0500622_0007031 3300053156 Bacteria 6438
2760 Ga0500622_0035929 3300053156 Bacteria 2591
2761 Ga0500630_029286 3300053159 Bacteria 2710
2762 Ga0500633_0012278 3300053160 Bacteria 2361
2763 Ga0500633_0055561 3300053160 Bacteria 1379
2764 Ga0500638_054599 3300053162 Bacteria 1927
2765 Ga0500639_018029 3300053163 Bacteria 3722
2766 Ga0500639_103872 3300053163 Bacteria 1393
2767 Ga0500636_0000006 3300053177 Bacteria 183899
2768 Ga0500636_0000617 3300053177 Bacteria 19244
2769 Ga0500636_0001911 3300053177 Bacteria 11436
2770 Ga0500636_0060693 3300053177 Bacteria 2207
2771 Ga0500637_0000269 3300053178 Bacteria 19469
2772 Ga0500637_0045624 3300053178 Bacteria 2486
2773 Ga0500637_0050590 3300053178 Bacteria 2367
2774 Ga0500570_079774 3300053724 Bacteria 1481
2775 Ga0500576_005425 3300053725 Bacteria 5277
2776 Ga0500625_021414 3300053729 Bacteria 3048
2777 Ga0500645_008727 3300053730 Bacteria 3439
2778 Ga0500645_013032 3300053730 Bacteria 2677
2779 Ga0500609_005057 3300053731 Bacteria 1805
2780 Ga0500596_000453 3300053735 Bacteria 7623
2781 Ga0500596_002778 3300053735 Bacteria 3425
2782 Ga0500599_002540 3300053736 Bacteria 2191
2783 Ga0500601_000069 3300053737 Bacteria 21313
2784 Ga0501084_0001259 3300054114 Bacteria 19951
2785 Ga0501084_0061211 3300054114 Bacteria 3152
2786 Ga0501084_0109004 3300054114 Bacteria 2326
2787 Ga0501084_0156837 3300054114 Bacteria 1920
2788 Ga0501084_0158080 3300054114 Bacteria 1912
2789 Ga0501084_0173532 3300054114 Bacteria 1819
2790 Ga0501084_0247340 3300054114 Bacteria 1505
2791 Ga0501082_0000555 3300060353 Bacteria 33188
2792 Ga0501082_0005147 3300060353 Bacteria 11383
2793 Ga0501082_0007160 3300060353 Bacteria 9616
2794 Ga0501082_0020536 3300060353 Bacteria 5692
2795 Ga0501082_0040987 3300060353 Bacteria 3992
2796 Ga0501082_0052557 3300060353 Bacteria 3512
2797 Ga0501082_0077678 3300060353 Bacteria 2863
2798 Ga0501082_0108075 3300060353 Bacteria 2407
2799 Ga0501082_0114325 3300060353 Bacteria 2337
2800 Ga0501082_0275571 3300060353 Bacteria 1464
2801 Ga0530510_0013685 3300061734 Bacteria 5711
2802 Ga0530510_0042046 3300061734 Bacteria 3301

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2967742019 2967743269 295
2 3300041411 Ga0439466_0040336 Ga0439466_0040336_14_949 299
3 3300047673 Ga0495593_0174665 Ga0495593_0174665_158_1063 300
4 3300049573 Ga0501037_0162294 Ga0501037_0162294_21_932 300
5 3300046455 Ga0495603_0169059 Ga0495603_0169059_325_1248 305
6 3300048927 Ga0496124_0199855 Ga0496124_0199855_545_1483 308
7 3300049581 Ga0501047_0032423 Ga0501047_0032423_1606_2556 311
8 3300009551 Ga0105238_10258291 Ga0105238_102582912 317
9 iso_pu_bacteria 2551306093 2551746314 332
10 iso_pu_bacteria 2551306086 2551693758 333
11 3300005328 Ga0070676_10133852 Ga0070676_101338521 339
12 3300005347 Ga0070668_100072026 Ga0070668_1000720262 339
13 3300005618 Ga0068864_100118693 Ga0068864_1001186932 339
14 3300005841 Ga0068863_100265150 Ga0068863_1002651502 339
15 3300005844 Ga0068862_100228426 Ga0068862_1002284261 339
16 3300039062 Ga0400483_277787 Ga0400483_277787_773_1870 339
17 3300048915 Ga0496112_0108260 Ga0496112_0108260_1418_2548 339
18 3300049742 Ga0501080_0383002 Ga0501080_0383002_30_1073 342
19 3300042436 Ga0439435_0005326 Ga0439435_0005326_196_1263 343
20 3300048914 Ga0496111_0078651 Ga0496111_0078651_210_1340 343
21 3300048905 Ga0496102_0019690 Ga0496102_0019690_794_1918 344
22 iso_pu_bacteria 8016539877 8016544987 344
23 3300039062 Ga0400483_109261 Ga0400483_109261_932_2077 345
24 3300039062 Ga0400483_284213 Ga0400483_284213_3024_4169 345
25 3300044684 Ga0466966_0035781 Ga0466966_0035781_202_1308 345
26 iso_pu_bacteria 2551306090 2551716541 346
27 iso_pu_bacteria 2551306090 2551720268 346
28 3300049580 Ga0501046_0261036 Ga0501046_0261036_187_1245 347
29 3300013104 Ga0157370_10060828 Ga0157370_100608283 348
30 3300031090 Ga0265760_10016953 Ga0265760_100169532 348
31 3300046455 Ga0495603_0010693 Ga0495603_0010693_1448_2578 348
32 3300046461 Ga0495641_0051646 Ga0495641_0051646_649_1779 348
33 3300046492 Ga0495585_0021313 Ga0495585_0021313_2462_3583 348
34 3300046523 Ga0495644_0075573 Ga0495644_0075573_71_1201 348
35 3300046557 Ga0495622_0026634 Ga0495622_0026634_1544_2674 348
36 3300048916 Ga0496113_0007098 Ga0496113_0007098_5940_7091 348
37 3300048929 Ga0496126_0011809 Ga0496126_0011809_5806_6936 348
38 3300048929 Ga0496126_0035842 Ga0496126_0035842_1692_2822 348
39 3300053087 Ga0500643_025947 Ga0500643_025947_137_1267 348
40 3300053124 Ga0500617_043511 Ga0500617_043511_770_1900 348
41 iso_pu_bacteria 2551306092 2551735812 348
42 iso_pu_bacteria 8019538911 8019539924 348
43 3300006175 Ga0070712_100004941 Ga0070712_1000049417 349
44 3300025915 Ga0207693_10006352 Ga0207693_100063525 349
45 3300025906 Ga0207699_10051356 Ga0207699_100513562 350
46 3300035692 Ga0373935_0083987 Ga0373935_0083987_43_1119 350
47 3300046531 Ga0495665_0013486 Ga0495665_0013486_3302_4378 350
48 3300046663 Ga0495635_0029725 Ga0495635_0029725_2690_3766 350
49 3300053090 Ga0500646_0058097 Ga0500646_0058097_34_1092 350
50 3300046692 Ga0495671_0001486 Ga0495671_0001486_4863_5948 351
51 3300046507 Ga0495606_0124582 Ga0495606_0124582_144_1232 352
52 3300048907 Ga0496104_0004576 Ga0496104_0004576_827_1963 352
53 3300048908 Ga0496105_0092905 Ga0496105_0092905_1247_2383 352
54 3300048916 Ga0496113_0037392 Ga0496113_0037392_1482_2618 352
55 3300048918 Ga0496115_0010376 Ga0496115_0010376_1062_2198 352
56 iso_pu_bacteria 2937843397 2937844761 352
57 3300039447 Ga0436361_0631953 Ga0436361_0631953_769_1926 353
58 3300005983 Ga0081540_1001004 Ga0081540_10010043 354
59 3300048927 Ga0496124_0000083 Ga0496124_0000083_204373_205449 354
60 iso_pu_bacteria 2551306091 2551730735 354
61 iso_pu_bacteria 2558860983 2561466747 354
62 3300049583 Ga0501067_0007751 Ga0501067_0007751_1158_2282 355
63 3300049589 Ga0501073_0014419 Ga0501073_0014419_334_1425 355
64 3300049593 Ga0501077_0067049 Ga0501077_0067049_861_1985 355
65 3300049744 Ga0501083_0033040 Ga0501083_0033040_847_1938 355
66 3300050491 nmdc:mga00v17_84090_c1 nmdc:mga00v17_84090_c1_893_1975 355
67 iso_pu_bacteria 2523231067 2523466985 355
68 iso_pu_bacteria 2551306089 2551709009 355
69 iso_pu_bacteria 2551306089 2551712751 355
70 iso_pu_bacteria 2643221623 2644130005 355
71 iso_pu_bacteria 2738543024 2739309992 355
72 iso_pu_bacteria 2738543031 2739348596 355
73 iso_pu_bacteria 2869162929 2869164641 355
74 iso_pu_bacteria 2891048133 2891049190 355
75 iso_pu_bacteria 2939669807 2939672587 355
76 iso_pu_bacteria 2995392953 2995394766 355
77 iso_pu_bacteria 8002285264 8002288473 355
78 3300005563 Ga0068855_100058095 Ga0068855_1000580952 356
79 3300013105 Ga0157369_10233683 Ga0157369_102336832 356
80 3300031239 Ga0265328_10000108 Ga0265328_1000010818 356
81 3300049589 Ga0501073_0021793 Ga0501073_0021793_3290_4384 356
82 iso_pu_bacteria 2503198000 2503204689 356
83 iso_pu_bacteria 2508501127 2509145090 356
84 iso_pu_bacteria 2509276022 2509398948 356
85 iso_pu_bacteria 2510065059 2510314288 356
86 iso_pu_bacteria 2512875016 2512934576 356
87 iso_pu_bacteria 2512875024 2512962922 356
88 iso_pu_bacteria 2513237090 2513613548 356
89 iso_pu_bacteria 2513237164 2514037404 356
90 iso_pu_bacteria 2513237305 2514416936 356
91 iso_pu_bacteria 2588253730 2588514185 356
92 iso_pu_bacteria 2597489875 2597816533 356
93 iso_pu_bacteria 2643221551 2643777929 356
94 iso_pu_bacteria 2643221555 2643796377 356
95 iso_pu_bacteria 2643221564 2643836599 356
96 iso_pu_bacteria 2643221595 2643984901 356
97 iso_pu_bacteria 2643221627 2644155514 356
98 iso_pu_bacteria 2687453392 2688601318 356
99 iso_pu_bacteria 2721755686 2723578483 356
100 iso_pu_bacteria 2756170246 2756674674 356
101 iso_pu_bacteria 2791355123 2792746453 356
102 iso_pu_bacteria 2841734538 2841735718 356
103 iso_pu_bacteria 2844002411 2844004233 356
104 iso_pu_bacteria 2844009547 2844009975 356
105 iso_pu_bacteria 2847670302 2847672846 356
106 iso_pu_bacteria 2847686936 2847689320 356
107 iso_pu_bacteria 2856314179 2856314796 356
108 iso_pu_bacteria 2856320880 2856327979 356
109 iso_pu_bacteria 2856328259 2856332154 356
110 iso_pu_bacteria 2856334872 2856335142 356
111 iso_pu_bacteria 2856342000 2856346684 356
112 iso_pu_bacteria 2856349417 2856349625 356
113 iso_pu_bacteria 2856364286 2856367335 356
114 iso_pu_bacteria 2857367948 2857370341 356
115 iso_pu_bacteria 2869234852 2869242101 356
116 iso_pu_bacteria 2869242130 2869245791 356
117 iso_pu_bacteria 2869249662 2869256000 356
118 iso_pu_bacteria 2869256925 2869263674 356
119 iso_pu_bacteria 2869264136 2869270304 356
120 iso_pu_bacteria 2869271264 2869275900 356
121 iso_pu_bacteria 2869278585 2869279930 356
122 iso_pu_bacteria 2869285874 2869287618 356
123 iso_pu_bacteria 2871429161 2871431142 356
124 iso_pu_bacteria 2871435913 2871443856 356
125 iso_pu_bacteria 2871444079 2871445379 356
126 iso_pu_bacteria 2871451962 2871455300 356
127 iso_pu_bacteria 2871459585 2871460923 356
128 iso_pu_bacteria 2871466892 2871473807 356
129 iso_pu_bacteria 2871474448 2871480298 356
130 iso_pu_bacteria 2871481445 2871488181 356
131 iso_pu_bacteria 2871488783 2871490687 356
132 iso_pu_bacteria 2871495908 2871499258 356
133 iso_pu_bacteria 2874102143 2874104179 356
134 iso_pu_bacteria 2874109183 2874115297 356
135 iso_pu_bacteria 2874116593 2874121219 356
136 iso_pu_bacteria 2874123672 2874129628 356
137 iso_pu_bacteria 2874131515 2874133975 356
138 iso_pu_bacteria 2874139085 2874145576 356
139 iso_pu_bacteria 2874146452 2874150414 356
140 iso_pu_bacteria 2874155637 2874157469 356
141 iso_pu_bacteria 2874162495 2874162680 356
142 iso_pu_bacteria 2874168670 2874171642 356
143 iso_pu_bacteria 2876363079 2876363161 356
144 iso_pu_bacteria 2876369609 2876374524 356
145 iso_pu_bacteria 2876386047 2876391852 356
146 iso_pu_bacteria 2876392853 2876393043 356
147 iso_pu_bacteria 2876399893 2876404328 356
148 iso_pu_bacteria 2876406927 2876410340 356
149 iso_pu_bacteria 2876413966 2876416565 356
150 iso_pu_bacteria 2876420981 2876424555 356
151 iso_pu_bacteria 2878035449 2878036123 356
152 iso_pu_bacteria 2878730984 2878734448 356
153 iso_pu_bacteria 2878738818 2878740228 356
154 iso_pu_bacteria 2878745973 2878747755 356
155 iso_pu_bacteria 2878753008 2878755091 356
156 iso_pu_bacteria 2878760144 2878763448 356
157 iso_pu_bacteria 2878767105 2878770446 356
158 iso_pu_bacteria 2878774303 2878776572 356
159 iso_pu_bacteria 2878781027 2878786657 356
160 iso_pu_bacteria 2878788777 2878794909 356
161 iso_pu_bacteria 2881147464 2881147497 356
162 iso_pu_bacteria 2881155292 2881158599 356
163 iso_pu_bacteria 2881161766 2881164273 356
164 iso_pu_bacteria 2881845957 2881850300 356
165 iso_pu_bacteria 2881853255 2881854963 356
166 iso_pu_bacteria 2881861095 2881868869 356
167 iso_pu_bacteria 2882632389 2882632884 356
168 iso_pu_bacteria 2882912400 2882917587 356
169 iso_pu_bacteria 2885305155 2885306137 356
170 iso_pu_bacteria 2885312484 2885314807 356
171 iso_pu_bacteria 2885318864 2885320295 356
172 iso_pu_bacteria 2885326080 2885331216 356
173 iso_pu_bacteria 2885334103 2885337714 356
174 iso_pu_bacteria 2885342637 2885349014 356
175 iso_pu_bacteria 2885350715 2885353856 356
176 iso_pu_bacteria 2888337043 2888342588 356
177 iso_pu_bacteria 2888343758 2888350292 356
178 iso_pu_bacteria 2889790730 2889793702 356
179 iso_pu_bacteria 2889914905 2889917229 356
180 iso_pu_bacteria 2891088606 2891092329 356
181 iso_pu_bacteria 2903492973 2903493541 356
182 iso_pu_bacteria 2903492973 2903499428 356
183 iso_pu_bacteria 2903513507 2903521510 356
184 iso_pu_bacteria 2903521522 2903525111 356
185 iso_pu_bacteria 2903528002 2903532145 356
186 iso_pu_bacteria 2903540706 2903544063 356
187 iso_pu_bacteria 2904659560 2904659749 356
188 iso_pu_bacteria 2906308376 2906310156 356
189 iso_pu_bacteria 2906321335 2906323028 356
190 iso_pu_bacteria 2906328253 2906334668 356
191 iso_pu_bacteria 2906363423 2906366205 356
192 iso_pu_bacteria 2906370794 2906370958 356
193 iso_pu_bacteria 2906378014 2906383084 356
194 iso_pu_bacteria 2906386501 2906388981 356
195 iso_pu_bacteria 2906393657 2906396939 356
196 iso_pu_bacteria 2906401398 2906408097 356
197 iso_pu_bacteria 2906408224 2906411514 356
198 iso_pu_bacteria 2906414383 2906414985 356
199 iso_pu_bacteria 2906427513 2906432892 356
200 iso_pu_bacteria 2922151315 2922154227 356
201 iso_pu_bacteria 2922158528 2922164382 356
202 iso_pu_bacteria 2922172374 2922174063 356
203 iso_pu_bacteria 2922178524 2922182994 356
204 iso_pu_bacteria 2924710171 2924718124 356
205 iso_pu_bacteria 2924718760 2924723435 356
206 iso_pu_bacteria 2924726620 2924729885 356
207 iso_pu_bacteria 2924733363 2924735777 356
208 iso_pu_bacteria 2924741084 2924743331 356
209 iso_pu_bacteria 2924748358 2924752162 356
210 iso_pu_bacteria 2924754689 2924758939 356
211 iso_pu_bacteria 2924776078 2924777828 356
212 iso_pu_bacteria 2924784321 2924791310 356
213 iso_pu_bacteria 2937813078 2937815442 356
214 iso_pu_bacteria 2937822353 2937825896 356
215 iso_pu_bacteria 2937836603 2937837148 356
216 iso_pu_bacteria 2937848649 2937853366 356
217 iso_pu_bacteria 2937861824 2937865414 356
218 iso_pu_bacteria 2937868953 2937877067 356
219 iso_pu_bacteria 2937877337 2937884391 356
220 iso_pu_bacteria 2937891427 2937892363 356
221 iso_pu_bacteria 2937972304 2937980414 356
222 iso_pu_bacteria 2937980651 2937985068 356
223 iso_pu_bacteria 2937994558 2937997909 356
224 iso_pu_bacteria 2958034702 2958035797 356
225 iso_pu_bacteria 2958041894 2958044828 356
226 iso_pu_bacteria 2958064165 2958066617 356
227 iso_pu_bacteria 2958071322 2958076416 356
228 iso_pu_bacteria 2958084443 2958091701 356
229 iso_pu_bacteria 2958092219 2958099349 356
230 iso_pu_bacteria 2958108152 2958113224 356
231 iso_pu_bacteria 2958115193 2958119790 356
232 iso_pu_bacteria 2958122699 2958125216 356
233 iso_pu_bacteria 2958130278 2958132020 356
234 iso_pu_bacteria 2958144490 2958145662 356
235 iso_pu_bacteria 2958158011 2958162468 356
236 iso_pu_bacteria 2958165035 2958168383 356
237 iso_pu_bacteria 2958179912 2958181823 356
238 iso_pu_bacteria 2961077736 2961079667 356
239 iso_pu_bacteria 2961114664 2961115073 356
240 iso_pu_bacteria 2961127735 2961128283 356
241 iso_pu_bacteria 2961136820 2961137038 356
242 iso_pu_bacteria 2961163497 2961166847 356
243 iso_pu_bacteria 2961170736 2961176867 356
244 iso_pu_bacteria 2961183825 2961183927 356
245 iso_pu_bacteria 2963644680 2963651040 356
246 iso_pu_bacteria 2965018300 2965021671 356
247 iso_pu_bacteria 2965025482 2965028961 356
248 iso_pu_bacteria 2965032056 2965033874 356
249 iso_pu_bacteria 2965040258 2965044565 356
250 iso_pu_bacteria 2965062239 2965068120 356
251 iso_pu_bacteria 2965089291 2965095772 356
252 iso_pu_bacteria 2965102966 2965103321 356
253 iso_pu_bacteria 2965110997 2965118579 356
254 iso_pu_bacteria 2967996073 2968001025 356
255 iso_pu_bacteria 2968003550 2968007078 356
256 iso_pu_bacteria 2968016561 2968021513 356
257 iso_pu_bacteria 2968083720 2968089104 356
258 iso_pu_bacteria 2968091066 2968093044 356
259 iso_pu_bacteria 2968097103 2968102683 356
260 iso_pu_bacteria 2968110612 2968110801 356
261 iso_pu_bacteria 2968128360 2968131495 356
262 iso_pu_bacteria 2968138860 2968145465 356
263 iso_pu_bacteria 2968171901 2968175253 356
264 iso_pu_bacteria 2970469710 2970476808 356
265 iso_pu_bacteria 2970489779 2970494266 356
266 iso_pu_bacteria 2970503327 2970509539 356
267 iso_pu_bacteria 2970510686 2970515054 356
268 iso_pu_bacteria 2970524798 2970525404 356
269 iso_pu_bacteria 2970540015 2970543274 356
270 iso_pu_bacteria 2970547951 2970552252 356
271 iso_pu_bacteria 2970554993 2970558291 356
272 iso_pu_bacteria 2970593180 2970594529 356
273 iso_pu_bacteria 2970619444 2970625888 356
274 iso_pu_bacteria 2970627176 2970629458 356
275 iso_pu_bacteria 2977821940 2977824231 356
276 iso_pu_bacteria 2977843712 2977846670 356
277 iso_pu_bacteria 2977851361 2977857220 356
278 iso_pu_bacteria 2977858184 2977860883 356
279 iso_pu_bacteria 2977864932 2977868439 356
280 iso_pu_bacteria 2977872689 2977872914 356
281 iso_pu_bacteria 2977898635 2977906116 356
282 iso_pu_bacteria 2977915119 2977915925 356
283 iso_pu_bacteria 2977922695 2977927282 356
284 iso_pu_bacteria 2977935797 2977940018 356
285 iso_pu_bacteria 2977950692 2977952977 356
286 iso_pu_bacteria 2977957713 2977957824 356
287 iso_pu_bacteria 2977986579 2977991388 356
288 iso_pu_bacteria 2979772303 2979775837 356
289 iso_pu_bacteria 2979779861 2979785705 356
290 iso_pu_bacteria 2979793036 2979800507 356
291 iso_pu_bacteria 2979808191 2979814327 356
292 iso_pu_bacteria 2987645492 2987650109 356
293 iso_pu_bacteria 2987659509 2987662859 356
294 iso_pu_bacteria 2987666974 2987668051 356
295 iso_pu_bacteria 2996310559 2996312755 356
296 iso_pu_bacteria 2996341866 2996346393 356
297 iso_pu_bacteria 2996348954 2996356233 356
298 iso_pu_bacteria 2996386984 2996393601 356
299 iso_pu_bacteria 3000135777 3000135822 356
300 iso_pu_bacteria 3004167301 3004172424 356
301 iso_pu_bacteria 3004188549 3004191911 356
302 iso_pu_bacteria 3004195979 3004200463 356
303 iso_pu_bacteria 3004211236 3004216807 356
304 iso_pu_bacteria 3004218560 3004219840 356
305 iso_pu_bacteria 3004239961 3004245357 356
306 iso_pu_bacteria 3004248173 3004255156 356
307 iso_pu_bacteria 3004268573 3004269631 356
308 iso_pu_bacteria 3004275668 3004282547 356
309 iso_pu_bacteria 3004289098 3004296853 356
310 iso_pu_bacteria 3004334049 3004338183 356
311 iso_pu_bacteria 649633066 649875747 356
312 iso_pu_bacteria 8004300914 8004306322 356
313 iso_pu_bacteria 8004312739 8004320774 356
314 iso_pu_bacteria 8004361976 8004364507 356
315 iso_pu_bacteria 8004374579 8004376670 356
316 iso_pu_bacteria 8004387939 8004390354 356
317 iso_pu_bacteria 8004395343 8004402975 356
318 iso_pu_bacteria 8004445564 8004447754 356
319 iso_pu_bacteria 8004633249 8004635651 356
320 iso_pu_bacteria 8004640170 8004647033 356
321 iso_pu_bacteria 8004695233 8004695636 356
322 iso_pu_bacteria 8004703790 8004707374 356
323 iso_pu_bacteria 8004714634 8004716418 356
324 iso_pu_bacteria 8004727605 8004730847 356
325 iso_pu_bacteria 8055617313 8055624714 356
326 3300005618 Ga0068864_100091303 Ga0068864_1000913031 357
327 3300005842 Ga0068858_100132899 Ga0068858_1001328992 357
328 3300005843 Ga0068860_100064206 Ga0068860_1000642061 357
329 3300006846 Ga0075430_100098984 Ga0075430_1000989842 357
330 3300006847 Ga0075431_100031498 Ga0075431_1000314982 357
331 3300009093 Ga0105240_10163781 Ga0105240_101637812 357
332 3300009094 Ga0111539_10253735 Ga0111539_102537352 357
333 3300009553 Ga0105249_10048633 Ga0105249_100486333 357
334 3300025913 Ga0207695_10025904 Ga0207695_100259044 357
335 3300025913 Ga0207695_10087383 Ga0207695_100873832 357
336 3300026035 Ga0207703_10224192 Ga0207703_102241922 357
337 3300027907 Ga0207428_10163635 Ga0207428_101636352 357
338 3300046477 Ga0495664_0006922 Ga0495664_0006922_2888_4009 357
339 3300048912 Ga0496109_0290960 Ga0496109_0290960_104_1204 357
340 3300049593 Ga0501077_0174451 Ga0501077_0174451_190_1290 357
341 3300049744 Ga0501083_0004517 Ga0501083_0004517_7134_8225 357
342 3300049744 Ga0501083_0102106 Ga0501083_0102106_228_1316 357
343 3300050507 nmdc:mga05p37_272394_c1 nmdc:mga05p37_272394_c1_88_1188 357
344 3300050509 nmdc:mga0qj67_125661_c1 nmdc:mga0qj67_125661_c1_147_1247 357
345 3300050510 nmdc:mga06r32_106472_c2 nmdc:mga06r32_106472_c2_777_1877 357
346 3300050511 nmdc:mga08y16_52420_c1 nmdc:mga08y16_52420_c1_3030_4130 357
347 3300054114 Ga0501084_0109004 Ga0501084_0109004_742_1830 357
348 3300060353 Ga0501082_0114325 Ga0501082_0114325_1200_2291 357
349 3300060353 Ga0501082_0275571 Ga0501082_0275571_291_1379 357
350 iso_pu_bacteria 2508501122 2509111691 357
351 iso_pu_bacteria 2509276019 2509375175 357
352 iso_pu_bacteria 2510065057 2510303474 357
353 iso_pu_bacteria 2510461069 2510839485 357
354 iso_pu_bacteria 2510917022 2511134736 357
355 iso_pu_bacteria 2511231027 2511389269 357
356 iso_pu_bacteria 2511231052 2511500272 357
357 iso_pu_bacteria 2512047086 2512531805 357
358 iso_pu_bacteria 2512875026 2512972936 357
359 iso_pu_bacteria 2513237086 2513582316 357
360 iso_pu_bacteria 2513237089 2513602728 357
361 iso_pu_bacteria 2513237091 2513616570 357
362 iso_pu_bacteria 2513237140 2513885811 357
363 iso_pu_bacteria 2513237143 2513903908 357
364 iso_pu_bacteria 2513237156 2513985744 357
365 iso_pu_bacteria 2513237159 2513996567 357
366 iso_pu_bacteria 2513237160 2514004992 357
367 iso_pu_bacteria 2513237162 2514020472 357
368 iso_pu_bacteria 2515154107 2515607546 357
369 iso_pu_bacteria 2516143018 2516204510 357
370 iso_pu_bacteria 2516653046 2516891673 357
371 iso_pu_bacteria 2517487022 2517568448 357
372 iso_pu_bacteria 2524023207 2524450722 357
373 iso_pu_bacteria 2529292951 2530648017 357
374 iso_pu_bacteria 2534681786 2535484083 357
375 iso_pu_bacteria 2534681796 2535514895 357
376 iso_pu_bacteria 2537561587 2537873281 357
377 iso_pu_bacteria 2551306084 2551674451 357
378 iso_pu_bacteria 2551306085 2551686502 357
379 iso_pu_bacteria 2551306087 2551702925 357
380 iso_pu_bacteria 2554235003 2554246506 357
381 iso_pu_bacteria 2558860100 2558866277 357
382 iso_pu_bacteria 2558860242 2559293681 357
383 iso_pu_bacteria 2582581283 2585164721 357
384 iso_pu_bacteria 2582581306 2585265066 357
385 iso_pu_bacteria 2582581307 2585273803 357
386 iso_pu_bacteria 2582581865 2585385874 357
387 iso_pu_bacteria 2582581866 2585392110 357
388 iso_pu_bacteria 2582581867 2585398762 357
389 iso_pu_bacteria 2585427531 2585559979 357
390 iso_pu_bacteria 2585427590 2585819116 357
391 iso_pu_bacteria 2585427609 2585905841 357
392 iso_pu_bacteria 2585428125 2587979043 357
393 iso_pu_bacteria 2599185210 2599605745 357
394 iso_pu_bacteria 2599185236 2599719055 357
395 iso_pu_bacteria 2599185352 2600191217 357
396 iso_pu_bacteria 2600254933 2600376508 357
397 iso_pu_bacteria 2643221557 2643806104 357
398 iso_pu_bacteria 2643221558 2643812755 357
399 iso_pu_bacteria 2643221568 2643857293 357
400 iso_pu_bacteria 2643221582 2643920845 357
401 iso_pu_bacteria 2643221607 2644047409 357
402 iso_pu_bacteria 2643221610 2644070342 357
403 iso_pu_bacteria 2643221618 2644103478 357
404 iso_pu_bacteria 2643221626 2644144357 357
405 iso_pu_bacteria 2643221634 2644190387 357
406 iso_pu_bacteria 2643221636 2644199827 357
407 iso_pu_bacteria 2643221637 2644206958 357
408 iso_pu_bacteria 2643221653 2644297807 357
409 iso_pu_bacteria 2643221655 2644306408 357
410 iso_pu_bacteria 2643221659 2644330598 357
411 iso_pu_bacteria 2643221668 2644377365 357
412 iso_pu_bacteria 2643221675 2644421104 357
413 iso_pu_bacteria 2643221680 2644454627 357
414 iso_pu_bacteria 2643221686 2644480198 357
415 iso_pu_bacteria 2643221688 2644495657 357
416 iso_pu_bacteria 2643221689 2644497006 357
417 iso_pu_bacteria 2643221693 2644519352 357
418 iso_pu_bacteria 2643221698 2644542598 357
419 iso_pu_bacteria 2643221712 2644612019 357
420 iso_pu_bacteria 2643221718 2644650606 357
421 iso_pu_bacteria 2643221719 2644656060 357
422 iso_pu_bacteria 2643221723 2644671791 357
423 iso_pu_bacteria 2643221726 2644692566 357
424 iso_pu_bacteria 2657244999 2657683033 357
425 iso_pu_bacteria 2751185800 2753358643 357
426 iso_pu_bacteria 2751185821 2753462628 357
427 iso_pu_bacteria 2758568016 2758640882 357
428 iso_pu_bacteria 2765235802 2765464138 357
429 iso_pu_bacteria 2767802442 2770196659 357
430 iso_pu_bacteria 2775506902 2776272690 357
431 iso_pu_bacteria 2775506904 2776284633 357
432 iso_pu_bacteria 2791355082 2792583091 357
433 iso_pu_bacteria 2791355091 2792621237 357
434 iso_pu_bacteria 2791355092 2792625452 357
435 iso_pu_bacteria 2791355094 2792637886 357
436 iso_pu_bacteria 2791355253 2793282198 357
437 iso_pu_bacteria 2791355265 2793355604 357
438 iso_pu_bacteria 2802428858 2802718505 357
439 iso_pu_bacteria 2802428859 2802726328 357
440 iso_pu_bacteria 2802428860 2802734808 357
441 iso_pu_bacteria 2802428861 2802740852 357
442 iso_pu_bacteria 2802428862 2802742412 357
443 iso_pu_bacteria 2802428863 2802749118 357
444 iso_pu_bacteria 2802429268 2804750750 357
445 iso_pu_bacteria 2802429605 2805931702 357
446 iso_pu_bacteria 2802429606 2805932559 357
447 iso_pu_bacteria 2808606387 2808986548 357
448 iso_pu_bacteria 2818991272 2819245051 357
449 iso_pu_bacteria 2818991439 2819556619 357
450 iso_pu_bacteria 2821123053 2821123477 357
451 iso_pu_bacteria 2838016132 2838020080 357
452 iso_pu_bacteria 2838022645 2838027687 357
453 iso_pu_bacteria 2838035591 2838040038 357
454 iso_pu_bacteria 2838061910 2838064272 357
455 iso_pu_bacteria 2838074704 2838075169 357
456 iso_pu_bacteria 2838661181 2838666056 357
457 iso_pu_bacteria 2838668709 2838673341 357
458 iso_pu_bacteria 2838675328 2838677349 357
459 iso_pu_bacteria 2838686498 2838693681 357
460 iso_pu_bacteria 2838701080 2838706088 357
461 iso_pu_bacteria 2838714209 2838716237 357
462 iso_pu_bacteria 2838719591 2838719963 357
463 iso_pu_bacteria 2838724970 2838726989 357
464 iso_pu_bacteria 2838736955 2838739500 357
465 iso_pu_bacteria 2839993093 2839994119 357
466 iso_pu_bacteria 2840764183 2840769472 357
467 iso_pu_bacteria 2841840854 2841844376 357
468 iso_pu_bacteria 2841846520 2841846894 357
469 iso_pu_bacteria 2841859092 2841860579 357
470 iso_pu_bacteria 2842110456 2842111980 357
471 iso_pu_bacteria 2842124991 2842127077 357
472 iso_pu_bacteria 2842130223 2842132242 357
473 iso_pu_bacteria 2842140634 2842144097 357
474 iso_pu_bacteria 2842146304 2842150569 357
475 iso_pu_bacteria 2842152218 2842152589 357
476 iso_pu_bacteria 2842170452 2842172482 357
477 iso_pu_bacteria 2842175837 2842176208 357
478 iso_pu_bacteria 2842180545 2842186918 357
479 iso_pu_bacteria 2842187318 2842189344 357
480 iso_pu_bacteria 2842198810 2842204244 357
481 iso_pu_bacteria 2842211629 2842213658 357
482 iso_pu_bacteria 2842224351 2842224724 357
483 iso_pu_bacteria 2842229732 2842236496 357
484 iso_pu_bacteria 2842271015 2842278245 357
485 iso_pu_bacteria 2842317721 2842323918 357
486 iso_pu_bacteria 2842363717 2842367334 357
487 iso_pu_bacteria 2842475841 2842476141 357
488 iso_pu_bacteria 2842489311 2842492652 357
489 iso_pu_bacteria 2842495871 2842500241 357
490 iso_pu_bacteria 2842515876 2842517364 357
491 iso_pu_bacteria 2842521101 2842521495 357
492 iso_pu_bacteria 2842871566 2842873124 357
493 iso_pu_bacteria 2844163670 2844165071 357
494 iso_pu_bacteria 2844454524 2844456225 357
495 iso_pu_bacteria 2847417321 2847417465 357
496 iso_pu_bacteria 2848992105 2848992300 357
497 iso_pu_bacteria 2850079185 2850079803 357
498 iso_pu_bacteria 2854911287 2854914212 357
499 iso_pu_bacteria 2854916844 2854919759 357
500 iso_pu_bacteria 2855825444 2855828042 357
501 iso_pu_bacteria 2855839649 2855839812 357
502 iso_pu_bacteria 2855872281 2855873560 357
503 iso_pu_bacteria 2857516855 2857521902 357
504 iso_pu_bacteria 2857531043 2857533573 357
505 iso_pu_bacteria 2858800743 2858803787 357
506 iso_pu_bacteria 2894652903 2894652941 357
507 iso_pu_bacteria 2896384573 2896388586 357
508 iso_pu_bacteria 2899792073 2899794634 357
509 iso_pu_bacteria 2899803654 2899805491 357
510 iso_pu_bacteria 2899845264 2899845973 357
511 iso_pu_bacteria 2904578770 2904579215 357
512 iso_pu_bacteria 2913295892 2913298161 357
513 iso_pu_bacteria 2913308742 2913311680 357
514 iso_pu_bacteria 2915650412 2915651095 357
515 iso_pu_bacteria 2915980308 2915984034 357
516 iso_pu_bacteria 2915986958 2915990671 357
517 iso_pu_bacteria 2915993759 2915997181 357
518 iso_pu_bacteria 2916000859 2916000913 357
519 iso_pu_bacteria 2916007675 2916011192 357
520 iso_pu_bacteria 2916014648 2916021274 357
521 iso_pu_bacteria 2916021584 2916021969 357
522 iso_pu_bacteria 2916028427 2916034097 357
523 iso_pu_bacteria 2916035215 2916036330 357
524 iso_pu_bacteria 2916041962 2916048392 357
525 iso_pu_bacteria 2916048683 2916053644 357
526 iso_pu_bacteria 2916055098 2916056956 357
527 iso_pu_bacteria 2916061851 2916068611 357
528 iso_pu_bacteria 2916068649 2916070695 357
529 iso_pu_bacteria 2916076590 2916076875 357
530 iso_pu_bacteria 2919114240 2919116441 357
531 iso_pu_bacteria 2919119836 2919121959 357
532 iso_pu_bacteria 2919166419 2919166731 357
533 iso_pu_bacteria 2919171160 2919172207 357
534 iso_pu_bacteria 2920760137 2920763577 357
535 iso_pu_bacteria 2920822456 2920823198 357
536 iso_pu_bacteria 2921201388 2921206141 357
537 iso_pu_bacteria 2921208531 2921213714 357
538 iso_pu_bacteria 2921237296 2921241505 357
539 iso_pu_bacteria 2921244191 2921247084 357
540 iso_pu_bacteria 2921250672 2921254474 357
541 iso_pu_bacteria 2921257292 2921262818 357
542 iso_pu_bacteria 2921263974 2921268702 357
543 iso_pu_bacteria 2921282425 2921288213 357
544 iso_pu_bacteria 2921289301 2921293777 357
545 iso_pu_bacteria 2921296804 2921298043 357
546 iso_pu_bacteria 2924144063 2924150749 357
547 iso_pu_bacteria 2924150972 2924156686 357
548 iso_pu_bacteria 2924158325 2924160302 357
549 iso_pu_bacteria 2924165586 2924170747 357
550 iso_pu_bacteria 2924172951 2924176864 357
551 iso_pu_bacteria 2924179722 2924183660 357
552 iso_pu_bacteria 2924186466 2924190423 357
553 iso_pu_bacteria 2924193448 2924198976 357
554 iso_pu_bacteria 2924200457 2924200844 357
555 iso_pu_bacteria 2924207177 2924209232 357
556 iso_pu_bacteria 2924214083 2924221011 357
557 iso_pu_bacteria 2924221636 2924222255 357
558 iso_pu_bacteria 2924228884 2924232736 357
559 iso_pu_bacteria 2926754445 2926757416 357
560 iso_pu_bacteria 2926760298 2926761637 357
561 iso_pu_bacteria 2928521798 2928522060 357
562 iso_pu_bacteria 2929138655 2929138691 357
563 iso_pu_bacteria 2933006813 2933007234 357
564 iso_pu_bacteria 2933011516 2933015177 357
565 iso_pu_bacteria 2936996657 2936998439 357
566 iso_pu_bacteria 2937002841 2937007719 357
567 iso_pu_bacteria 2937009748 2937014968 357
568 iso_pu_bacteria 2937016420 2937022288 357
569 iso_pu_bacteria 2937023124 2937023388 357
570 iso_pu_bacteria 2937029754 2937034436 357
571 iso_pu_bacteria 2937036028 2937040517 357
572 iso_pu_bacteria 2937042894 2937044843 357
573 iso_pu_bacteria 2937049772 2937053352 357
574 iso_pu_bacteria 2937056579 2937061559 357
575 iso_pu_bacteria 2937063883 2937064252 357
576 iso_pu_bacteria 2937071275 2937074904 357
577 iso_pu_bacteria 2937078374 2937078924 357
578 iso_pu_bacteria 2937084907 2937089002 357
579 iso_pu_bacteria 2937091812 2937092061 357
580 iso_pu_bacteria 2937098957 2937099898 357
581 iso_pu_bacteria 2937106411 2937106428 357
582 iso_pu_bacteria 2937113482 2937119460 357
583 iso_pu_bacteria 2937119839 2937126202 357
584 iso_pu_bacteria 2937126314 2937131625 357
585 iso_pu_bacteria 2941499720 2941500903 357
586 iso_pu_bacteria 2954011201 2954014579 357
587 iso_pu_bacteria 2957375807 2957381337 357
588 iso_pu_bacteria 2957382221 2957388688 357
589 iso_pu_bacteria 2957388812 2957393368 357
590 iso_pu_bacteria 2957395598 2957397814 357
591 iso_pu_bacteria 2957402308 2957403903 357
592 iso_pu_bacteria 2957408893 2957413333 357
593 iso_pu_bacteria 2957415311 2957417687 357
594 iso_pu_bacteria 2957422303 2957423347 357
595 iso_pu_bacteria 2957430029 2957436876 357
596 iso_pu_bacteria 2957437181 2957440542 357
597 iso_pu_bacteria 2957443900 2957447309 357
598 iso_pu_bacteria 2957450854 2957451231 357
599 iso_pu_bacteria 2957457609 2957460168 357
600 iso_pu_bacteria 2957464669 2957469564 357
601 iso_pu_bacteria 2957471148 2957473512 357
602 iso_pu_bacteria 2957478035 2957481993 357
603 iso_pu_bacteria 2957484790 2957484819 357
604 iso_pu_bacteria 2957491536 2957492094 357
605 iso_pu_bacteria 2957498199 2957500680 357
606 iso_pu_bacteria 2957505466 2957508112 357
607 iso_pu_bacteria 2960584000 2960590209 357
608 iso_pu_bacteria 2960591022 2960594583 357
609 iso_pu_bacteria 2960597568 2960603372 357
610 iso_pu_bacteria 2960603979 2960607820 357
611 iso_pu_bacteria 2960610863 2960611712 357
612 iso_pu_bacteria 2960617483 2960620038 357
613 iso_pu_bacteria 2960624210 2960626759 357
614 iso_pu_bacteria 2960631154 2960634964 357
615 iso_pu_bacteria 2960637947 2960641523 357
616 iso_pu_bacteria 2960645483 2960648097 357
617 iso_pu_bacteria 2960652885 2960655019 357
618 iso_pu_bacteria 2960660292 2960660593 357
619 iso_pu_bacteria 2960667422 2960672172 357
620 iso_pu_bacteria 2960674078 2960679616 357
621 iso_pu_bacteria 2960680706 2960684729 357
622 iso_pu_bacteria 2960687367 2960687492 357
623 iso_pu_bacteria 2960693952 2960694498 357
624 iso_pu_bacteria 2964607997 2964610522 357
625 iso_pu_bacteria 2964615318 2964618414 357
626 iso_pu_bacteria 2964621998 2964625451 357
627 iso_pu_bacteria 2964628898 2964633773 357
628 iso_pu_bacteria 2964636051 2964639478 357
629 iso_pu_bacteria 2964643177 2964649395 357
630 iso_pu_bacteria 2964649959 2964650151 357
631 iso_pu_bacteria 2964656573 2964663093 357
632 iso_pu_bacteria 2964663802 2964668081 357
633 iso_pu_bacteria 2964670856 2964671083 357
634 iso_pu_bacteria 2964678106 2964682507 357
635 iso_pu_bacteria 2964685014 2964687584 357
636 iso_pu_bacteria 2964691889 2964697696 357
637 iso_pu_bacteria 2964698721 2964703370 357
638 iso_pu_bacteria 2964705432 2964710217 357
639 iso_pu_bacteria 2964712639 2964717207 357
640 iso_pu_bacteria 2964719344 2964722019 357
641 iso_pu_bacteria 2967664464 2967670510 357
642 iso_pu_bacteria 2967671571 2967671843 357
643 iso_pu_bacteria 2967678726 2967680946 357
644 iso_pu_bacteria 2967686174 2967689586 357
645 iso_pu_bacteria 2967693043 2967694889 357
646 iso_pu_bacteria 2967699805 2967703549 357
647 iso_pu_bacteria 2967706974 2967712314 357
648 iso_pu_bacteria 2967714385 2967714483 357
649 iso_pu_bacteria 2967721400 2967723430 357
650 iso_pu_bacteria 2967728569 2967730375 357
651 iso_pu_bacteria 2967735183 2967739233 357
652 iso_pu_bacteria 2967748971 2967754871 357
653 iso_pu_bacteria 2967755722 2967758236 357
654 iso_pu_bacteria 2967762386 2967766570 357
655 iso_pu_bacteria 2967769361 2967769925 357
656 iso_pu_bacteria 2967775926 2967778049 357
657 iso_pu_bacteria 2970019648 2970023272 357
658 iso_pu_bacteria 2970026789 2970027828 357
659 iso_pu_bacteria 2970033650 2970037126 357
660 iso_pu_bacteria 2970040964 2970041100 357
661 iso_pu_bacteria 2970047711 2970050678 357
662 iso_pu_bacteria 2970054988 2970056864 357
663 iso_pu_bacteria 2970061556 2970062754 357
664 iso_pu_bacteria 2970068827 2970075409 357
665 iso_pu_bacteria 2970076120 2970081798 357
666 iso_pu_bacteria 2970082768 2970088369 357
667 iso_pu_bacteria 2970088815 2970089486 357
668 iso_pu_bacteria 2970095765 2970098806 357
669 iso_pu_bacteria 2970102677 2970105999 357
670 iso_pu_bacteria 2970109326 2970110875 357
671 iso_pu_bacteria 2970116247 2970118248 357
672 iso_pu_bacteria 2970122695 2970128961 357
673 iso_pu_bacteria 2970129317 2970131387 357
674 iso_pu_bacteria 2970136068 2970138953 357
675 iso_pu_bacteria 2970143518 2970144265 357
676 iso_pu_bacteria 2970149975 2970154487 357
677 iso_pu_bacteria 2970156795 2970162050 357
678 iso_pu_bacteria 2970164137 2970170132 357
679 iso_pu_bacteria 2970170962 2970175841 357
680 iso_pu_bacteria 2970177841 2970183665 357
681 iso_pu_bacteria 2970184632 2970188827 357
682 iso_pu_bacteria 2970191845 2970197468 357
683 iso_pu_bacteria 2977516862 2977521100 357
684 iso_pu_bacteria 2977523885 2977528531 357
685 iso_pu_bacteria 2977530762 2977532630 357
686 iso_pu_bacteria 2977537788 2977543785 357
687 iso_pu_bacteria 2977544691 2977550348 357
688 iso_pu_bacteria 2977551784 2977553476 357
689 iso_pu_bacteria 2977558990 2977563741 357
690 iso_pu_bacteria 2977565890 2977571721 357
691 iso_pu_bacteria 2977572785 2977574698 357
692 iso_pu_bacteria 2977579622 2977584424 357
693 iso_pu_bacteria 2978969890 2978973131 357
694 iso_pu_bacteria 2979089926 2979093101 357
695 iso_pu_bacteria 2979095461 2979099511 357
696 iso_pu_bacteria 2979100975 2979105068 357
697 iso_pu_bacteria 2984509177 2984513118 357
698 iso_pu_bacteria 2984518228 2984520516 357
699 iso_pu_bacteria 2984537506 2984539811 357
700 iso_pu_bacteria 2984587000 2984591400 357
701 iso_pu_bacteria 2984601300 2984602023 357
702 iso_pu_bacteria 2989771324 2989772606 357
703 iso_pu_bacteria 2989776772 2989777246 357
704 iso_pu_bacteria 3002141150 3002142540 357
705 iso_pu_bacteria 643692032 643824366 357
706 iso_pu_bacteria 648276728 648738437 357
707 iso_pu_bacteria 650716007 650738924 357
708 iso_pu_bacteria 8003570095 8003572481 357
709 iso_pu_bacteria 8003992118 8003992266 357
710 iso_pu_bacteria 8003999396 8003999530 357
711 iso_pu_bacteria 8005246636 8005247585 357
712 iso_pu_bacteria 8005289223 8005291289 357
713 iso_pu_bacteria 8005484373 8005484808 357
714 iso_pu_bacteria 8005542996 8005543568 357
715 iso_pu_bacteria 8005658619 8005660184 357
716 iso_pu_bacteria 8018150411 8018154456 357
717 iso_pu_bacteria 8024486573 8024491555 357
718 iso_pu_bacteria 8049293176 8049293303 357
719 iso_pu_bacteria 8054460903 8054461188 357
720 iso_pu_bacteria 8055431914 8055433528 357
721 iso_pu_bacteria 8056875544 8056878020 357
722 3300005347 Ga0070668_100136428 Ga0070668_1001364281 358
723 3300005843 Ga0068860_100000629 Ga0068860_1000006296 358
724 3300006195 Ga0075366_10021066 Ga0075366_100210662 358
725 3300006871 Ga0075434_100191292 Ga0075434_1001912921 358
726 3300009147 Ga0114129_10053096 Ga0114129_100530963 358
727 3300009147 Ga0114129_10170765 Ga0114129_101707653 358
728 3300009147 Ga0114129_10275130 Ga0114129_102751303 358
729 3300010375 Ga0105239_10535351 Ga0105239_105353512 358
730 3300028381 Ga0268264_10000049 Ga0268264_10000049101 358
731 3300031730 Ga0307516_10042969 Ga0307516_100429694 358
732 3300035398 Ga0316574_0166512 Ga0316574_0166512_24_1106 358
733 3300035692 Ga0373935_0044429 Ga0373935_0044429_68_1156 358
734 3300035695 Ga0373927_0000223 Ga0373927_0000223_24804_25892 358
735 3300037068 Ga0373925_0004649 Ga0373925_0004649_7241_8329 358
736 3300037418 Ga0395900_0164866 Ga0395900_0164866_919_2010 358
737 3300037471 Ga0395905_0026374 Ga0395905_0026374_4252_5343 358
738 3300046460 Ga0495638_0025939 Ga0495638_0025939_364_1455 358
739 3300047472 Ga0495686_0091597 Ga0495686_0091597_195_1310 358
740 3300048929 Ga0496126_0069766 Ga0496126_0069766_297_1403 358
741 3300049823 Ga0501044_0380412 Ga0501044_0380412_44_1135 358
742 3300050489 nmdc:mga03683_5606_c1 nmdc:mga03683_5606_c1_2179_3333 358
743 3300050493 nmdc:mga0k408_20280_c1 nmdc:mga0k408_20280_c1_2148_3239 358
744 3300050494 nmdc:mga06z11_40250_c1 nmdc:mga06z11_40250_c1_1124_2203 358
745 3300053103 Ga0500555_009461 Ga0500555_009461_329_1444 358
746 3300053122 Ga0500608_087006 Ga0500608_087006_337_1428 358
747 3300053136 Ga0500559_0104106 Ga0500559_0104106_21_1112 358
748 3300053153 Ga0500616_0083031 Ga0500616_0083031_120_1211 358
749 3300053156 Ga0500622_0007031 Ga0500622_0007031_2882_3973 358
750 iso_pu_bacteria 2508501050 2508725172 358
751 iso_pu_bacteria 2508501114 2509077401 358
752 iso_pu_bacteria 2509276021 2509388644 358
753 iso_pu_bacteria 2509276033 2509444226 358
754 iso_pu_bacteria 2510065019 2510131209 358
755 iso_pu_bacteria 2510461076 2510897540 358
756 iso_pu_bacteria 2510917026 2511169685 358
757 iso_pu_bacteria 2510917028 2511184596 358
758 iso_pu_bacteria 2510917030 2511197737 358
759 iso_pu_bacteria 2513237084 2513570413 358
760 iso_pu_bacteria 2513237085 2513574578 358
761 iso_pu_bacteria 2513237088 2513597291 358
762 iso_pu_bacteria 2513237093 2513635916 358
763 iso_pu_bacteria 2513237103 2513707216 358
764 iso_pu_bacteria 2513237138 2513865056 358
765 iso_pu_bacteria 2513237144 2513911193 358
766 iso_pu_bacteria 2513237146 2513924605 358
767 iso_pu_bacteria 2513237351 2514587912 358
768 iso_pu_bacteria 2515075009 2515110147 358
769 iso_pu_bacteria 2515154113 2515637505 358
770 iso_pu_bacteria 2515154114 2515643583 358
771 iso_pu_bacteria 2515154116 2515656974 358
772 iso_pu_bacteria 2515154134 2515740780 358
773 iso_pu_bacteria 2516653077 2517038832 358
774 iso_pu_bacteria 2516653085 2517079086 358
775 iso_pu_bacteria 2517093000 2517093021 358
776 iso_pu_bacteria 2517287029 2517409297 358
777 iso_pu_bacteria 2519899620 2520375695 358
778 iso_pu_bacteria 2524023209 2524458223 358
779 iso_pu_bacteria 2582581294 2585205632 358
780 iso_pu_bacteria 2582581298 2585223586 358
781 iso_pu_bacteria 2582581299 2585229646 358
782 iso_pu_bacteria 2582581308 2585280103 358
783 iso_pu_bacteria 2582581315 2585326120 358
784 iso_pu_bacteria 2585427526 2585523577 358
785 iso_pu_bacteria 2585427527 2585533646 358
786 iso_pu_bacteria 2585427528 2585542001 358
787 iso_pu_bacteria 2585427529 2585545818 358
788 iso_pu_bacteria 2585427530 2585553237 358
789 iso_pu_bacteria 2585427593 2585840351 358
790 iso_pu_bacteria 2585427608 2585900654 358
791 iso_pu_bacteria 2585427634 2585998745 358
792 iso_pu_bacteria 2599185170 2599419431 358
793 iso_pu_bacteria 2615840624 2616293629 358
794 iso_pu_bacteria 2615840626 2616309260 358
795 iso_pu_bacteria 2615840698 2616553268 358
796 iso_pu_bacteria 2617270742 2617380397 358
797 iso_pu_bacteria 2643221591 2643966702 358
798 iso_pu_bacteria 2643221599 2644004719 358
799 iso_pu_bacteria 2643221643 2644237353 358
800 iso_pu_bacteria 2667528174 2671113800 358
801 iso_pu_bacteria 2718217882 2719179346 358
802 iso_pu_bacteria 2718217927 2719383923 358
803 iso_pu_bacteria 2718218009 2719730016 358
804 iso_pu_bacteria 2718218363 2721145439 358
805 iso_pu_bacteria 2718218365 2721156970 358
806 iso_pu_bacteria 2718218366 2721162334 358
807 iso_pu_bacteria 2718218423 2721397693 358
808 iso_pu_bacteria 2721755514 2722838504 358
809 iso_pu_bacteria 2721755809 2724036503 358
810 iso_pu_bacteria 2721755810 2724042772 358
811 iso_pu_bacteria 2721755823 2724108450 358
812 iso_pu_bacteria 2724679232 2725952031 358
813 iso_pu_bacteria 2728369365 2730162583 358
814 iso_pu_bacteria 2728369397 2730296602 358
815 iso_pu_bacteria 2738541333 2739036771 358
816 iso_pu_bacteria 2765235942 2766063527 358
817 iso_pu_bacteria 2773857925 2774870833 358
818 iso_pu_bacteria 2775507266 2778179577 358
819 iso_pu_bacteria 2791355259 2793318034 358
820 iso_pu_bacteria 2791355260 2793325447 358
821 iso_pu_bacteria 2791355261 2793326351 358
822 iso_pu_bacteria 2791355263 2793344200 358
823 iso_pu_bacteria 2791355264 2793348352 358
824 iso_pu_bacteria 2791355266 2793363775 358
825 iso_pu_bacteria 2791355267 2793365679 358
826 iso_pu_bacteria 2802429633 2806048471 358
827 iso_pu_bacteria 2802429634 2806055944 358
828 iso_pu_bacteria 2802429635 2806062728 358
829 iso_pu_bacteria 2802429636 2806066464 358
830 iso_pu_bacteria 2802429637 2806073527 358
831 iso_pu_bacteria 2818991448 2819608548 358
832 iso_pu_bacteria 2818991453 2819640654 358
833 iso_pu_bacteria 2829745981 2829750173 358
834 iso_pu_bacteria 2835312727 2835317420 358
835 iso_pu_bacteria 2838029111 2838029429 358
836 iso_pu_bacteria 2838042994 2838048846 358
837 iso_pu_bacteria 2838680041 2838680382 358
838 iso_pu_bacteria 2838694306 2838695585 358
839 iso_pu_bacteria 2838707686 2838708962 358
840 iso_pu_bacteria 2838729681 2838736357 358
841 iso_pu_bacteria 2838742623 2838749176 358
842 iso_pu_bacteria 2841851746 2841858473 358
843 iso_pu_bacteria 2841864319 2841870829 358
844 iso_pu_bacteria 2842077413 2842079803 358
845 iso_pu_bacteria 2842118031 2842120421 358
846 iso_pu_bacteria 2842156927 2842163317 358
847 iso_pu_bacteria 2842163707 2842165381 358
848 iso_pu_bacteria 2842192696 2842192700 358
849 iso_pu_bacteria 2842205361 2842207146 358
850 iso_pu_bacteria 2842217011 2842219053 358
851 iso_pu_bacteria 2842237096 2842238373 358
852 iso_pu_bacteria 2842243621 2842250075 358
853 iso_pu_bacteria 2842250916 2842255552 358
854 iso_pu_bacteria 2842257432 2842264112 358
855 iso_pu_bacteria 2842278818 2842280161 358
856 iso_pu_bacteria 2842291075 2842293464 358
857 iso_pu_bacteria 2842298080 2842299591 358
858 iso_pu_bacteria 2842304105 2842310467 358
859 iso_pu_bacteria 2842341865 2842343282 358
860 iso_pu_bacteria 2842357229 2842361019 358
861 iso_pu_bacteria 2842370503 2842370845 358
862 iso_pu_bacteria 2842377471 2842379861 358
863 iso_pu_bacteria 2842384541 2842386932 358
864 iso_pu_bacteria 2842395702 2842399021 358
865 iso_pu_bacteria 2842502639 2842502957 358
866 iso_pu_bacteria 2842509118 2842512808 358
867 iso_pu_bacteria 2852387548 2852388327 358
868 iso_pu_bacteria 2854896431 2854898064 358
869 iso_pu_bacteria 2882456835 2882459619 358
870 iso_pu_bacteria 2884298095 2884299001 358
871 iso_pu_bacteria 2894232714 2894238662 358
872 iso_pu_bacteria 2919100787 2919101528 358
873 iso_pu_bacteria 2919408235 2919408662 358
874 iso_pu_bacteria 2923556063 2923556518 358
875 iso_pu_bacteria 2933016740 2933020802 358
876 iso_pu_bacteria 2933570622 2933576906 358
877 iso_pu_bacteria 2933586486 2933587309 358
878 iso_pu_bacteria 2935894831 2935896109 358
879 iso_pu_bacteria 2935901341 2935902698 358
880 iso_pu_bacteria 2936367885 2936369158 358
881 iso_pu_bacteria 2936375103 2936377499 358
882 iso_pu_bacteria 2936381700 2936387216 358
883 iso_pu_bacteria 2996887358 2996888312 358
884 iso_pu_bacteria 2996893221 2996893245 358
885 iso_pu_bacteria 3005409236 3005410972 358
886 iso_pu_bacteria 3005445848 3005446008 358
887 iso_pu_bacteria 3005452660 3005456681 358
888 iso_pu_bacteria 639633055 639646430 358
889 iso_pu_bacteria 8005258706 8005261131 358
890 iso_pu_bacteria 8005275841 8005278633 358
891 iso_pu_bacteria 8005301065 8005301343 358
892 iso_pu_bacteria 8005307578 8005310625 358
893 iso_pu_bacteria 8005321885 8005322839 358
894 iso_pu_bacteria 8005376324 8005377650 358
895 iso_pu_bacteria 8005382845 8005387517 358
896 iso_pu_bacteria 8005395548 8005399928 358
897 iso_pu_bacteria 8005460587 8005460784 358
898 iso_pu_bacteria 8005556819 8005560388 358
899 iso_pu_bacteria 8005563573 8005564152 358
900 iso_pu_bacteria 8005570704 8005573717 358
901 iso_pu_bacteria 8005619151 8005619648 358
902 iso_pu_bacteria 8005645114 8005649500 358
903 iso_pu_bacteria 8005682033 8005685254 358
904 iso_pu_bacteria 8005688590 8005692450 358
905 iso_pu_bacteria 8005695170 8005699490 358
906 iso_pu_bacteria 8018127388 8018132890 358
907 iso_pu_bacteria 8018163183 8018165378 358
908 iso_pu_bacteria 8018176218 8018181041 358
909 iso_pu_bacteria 8023680758 8023684460 358
910 iso_pu_bacteria 8024479707 8024480073 358
911 iso_pu_bacteria 8024501048 8024502329 358
912 iso_pu_bacteria 8046767195 8046770844 358
913 iso_pu_bacteria 8054558443 8054562650 358
914 iso_pu_bacteria 8056375014 8056376273 358
915 iso_pu_bacteria 8056382006 8056385570 358
916 iso_pu_bacteria 8057575449 8057580547 358
917 iso_pu_bacteria 8057874678 8057879672 358
918 3300005455 Ga0070663_100179899 Ga0070663_1001798992 359
919 3300005983 Ga0081540_1027031 Ga0081540_10270312 359
920 3300005985 Ga0081539_10052721 Ga0081539_100527212 359
921 3300006195 Ga0075366_10003889 Ga0075366_100038897 359
922 3300015265 Ga0182005_1006513 Ga0182005_10065132 359
923 3300026067 Ga0207678_10011656 Ga0207678_100116566 359
924 3300027312 Ga0209371_1000009 Ga0209371_1000009633 359
925 3300028577 Ga0265318_10023632 Ga0265318_100236322 359
926 3300030500 Ga0268256_1000010 Ga0268256_1000010632 359
927 3300031235 Ga0265330_10056890 Ga0265330_100568901 359
928 3300031247 Ga0265340_10008917 Ga0265340_100089175 359
929 3300031247 Ga0265340_10015076 Ga0265340_100150762 359
930 3300031247 Ga0265340_10034954 Ga0265340_100349543 359
931 3300031249 Ga0265339_10029424 Ga0265339_100294242 359
932 3300031344 Ga0265316_10048110 Ga0265316_100481102 359
933 3300031595 Ga0265313_10008450 Ga0265313_100084507 359
934 3300031595 Ga0265313_10016423 Ga0265313_100164233 359
935 3300031595 Ga0265313_10042197 Ga0265313_100421972 359
936 3300031711 Ga0265314_10009485 Ga0265314_100094854 359
937 3300031712 Ga0265342_10005385 Ga0265342_100053857 359
938 3300031712 Ga0265342_10047370 Ga0265342_100473702 359
939 3300037418 Ga0395900_0001933 Ga0395900_0001933_1429_2544 359
940 3300049569 Ga0501032_0026384 Ga0501032_0026384_2346_3443 359
941 3300049570 Ga0501033_0006388 Ga0501033_0006388_6293_7390 359
942 3300049570 Ga0501033_0147999 Ga0501033_0147999_415_1500 359
943 3300049570 Ga0501033_0153613 Ga0501033_0153613_116_1201 359
944 3300049570 Ga0501033_0182930 Ga0501033_0182930_327_1412 359
945 3300049571 Ga0501034_0033715 Ga0501034_0033715_748_1866 359
946 3300049571 Ga0501034_0063691 Ga0501034_0063691_1272_2390 359
947 3300049571 Ga0501034_0159981 Ga0501034_0159981_931_2028 359
948 3300049571 Ga0501034_0165049 Ga0501034_0165049_610_1740 359
949 3300049571 Ga0501034_0178346 Ga0501034_0178346_758_1852 359
950 3300049573 Ga0501037_0088441 Ga0501037_0088441_801_1898 359
951 3300049573 Ga0501037_0199783 Ga0501037_0199783_153_1250 359
952 3300049581 Ga0501047_0053817 Ga0501047_0053817_890_1987 359
953 3300049581 Ga0501047_0195711 Ga0501047_0195711_752_1846 359
954 3300049583 Ga0501067_0019608 Ga0501067_0019608_1828_2913 359
955 3300049585 Ga0501069_0026908 Ga0501069_0026908_272_1357 359
956 3300049585 Ga0501069_0043862 Ga0501069_0043862_139_1224 359
957 3300049586 Ga0501070_0067218 Ga0501070_0067218_140_1225 359
958 3300049586 Ga0501070_0138616 Ga0501070_0138616_531_1628 359
959 3300049589 Ga0501073_0117951 Ga0501073_0117951_565_1662 359
960 3300049589 Ga0501073_0183010 Ga0501073_0183010_227_1312 359
961 3300049589 Ga0501073_0205376 Ga0501073_0205376_144_1229 359
962 3300049593 Ga0501077_0101761 Ga0501077_0101761_444_1529 359
963 3300049822 Ga0501035_0004845 Ga0501035_0004845_8859_9956 359
964 3300049822 Ga0501035_0011573 Ga0501035_0011573_2750_3835 359
965 3300049822 Ga0501035_0020854 Ga0501035_0020854_3738_4823 359
966 3300049822 Ga0501035_0083021 Ga0501035_0083021_1016_2101 359
967 3300049822 Ga0501035_0089804 Ga0501035_0089804_1498_2583 359
968 3300049822 Ga0501035_0148013 Ga0501035_0148013_479_1576 359
969 3300049823 Ga0501044_0010129 Ga0501044_0010129_4964_6049 359
970 3300049823 Ga0501044_0138749 Ga0501044_0138749_301_1398 359
971 3300049823 Ga0501044_0175936 Ga0501044_0175936_274_1368 359
972 3300050495 nmdc:mga04h51_1085_c1 nmdc:mga04h51_1085_c1_1383_2477 359
973 3300053136 Ga0500559_0011005 Ga0500559_0011005_2065_3150 359
974 iso_pu_bacteria 2513237087 2513593072 359
975 iso_pu_bacteria 2828305725 2828307972 359
976 3300002705 JGI25156J39149_1004689 JGI25156J39149_10046893 360
977 3300002741 JGI25157J39369_1000297 JGI25157J39369_100029731 360
978 3300003762 Ga0055542_1000770 Ga0055542_100077019 360
979 3300003763 Ga0055529_1003107 Ga0055529_10031072 360
980 3300005329 Ga0070683_100026465 Ga0070683_1000264652 360
981 3300005353 Ga0070669_100216628 Ga0070669_1002166282 360
982 3300005354 Ga0070675_100176293 Ga0070675_1001762931 360
983 3300005356 Ga0070674_100001719 Ga0070674_1000017193 360
984 3300005456 Ga0070678_100004746 Ga0070678_1000047462 360
985 3300005457 Ga0070662_100098548 Ga0070662_1000985482 360
986 3300005459 Ga0068867_100097733 Ga0068867_1000977331 360
987 3300005543 Ga0070672_100029161 Ga0070672_1000291616 360
988 3300005564 Ga0070664_100119954 Ga0070664_1001199542 360
989 3300005614 Ga0068856_100187434 Ga0068856_1001874342 360
990 3300005718 Ga0068866_10168635 Ga0068866_101686351 360
991 3300006038 Ga0075365_10013644 Ga0075365_100136444 360
992 3300006038 Ga0075365_10146435 Ga0075365_101464351 360
993 3300006051 Ga0075364_10077287 Ga0075364_100772872 360
994 3300006177 Ga0075362_10000689 Ga0075362_100006892 360
995 3300006177 Ga0075362_10098529 Ga0075362_100985291 360
996 3300006178 Ga0075367_10061101 Ga0075367_100611013 360
997 3300006178 Ga0075367_10104703 Ga0075367_101047032 360
998 3300006195 Ga0075366_10103309 Ga0075366_101033091 360
999 3300006353 Ga0075370_10049465 Ga0075370_100494652 360
1000 3300006881 Ga0068865_100125533 Ga0068865_1001255332 360
1001 3300009093 Ga0105240_10418023 Ga0105240_104180232 360
1002 3300009174 Ga0105241_10127646 Ga0105241_101276461 360
1003 3300009545 Ga0105237_10347199 Ga0105237_103471992 360
1004 3300009551 Ga0105238_10007775 Ga0105238_100077754 360
1005 3300010375 Ga0105239_10175100 Ga0105239_101751002 360
1006 3300010375 Ga0105239_10210011 Ga0105239_102100111 360
1007 3300013105 Ga0157369_10181635 Ga0157369_101816352 360
1008 3300013297 Ga0157378_10453416 Ga0157378_104534161 360
1009 3300014968 Ga0157379_10177524 Ga0157379_101775241 360
1010 3300021384 Ga0213876_10000736 Ga0213876_1000073611 360
1011 3300025250 Ga0209026_1000013 Ga0209026_100001370 360
1012 3300025254 Ga0209148_1000210 Ga0209148_100021059 360
1013 3300025256 Ga0209759_1000149 Ga0209759_1000149110 360
1014 3300025261 Ga0209233_1000034 Ga0209233_1000034506 360
1015 3300025261 Ga0209233_1008280 Ga0209233_10082802 360
1016 3300025272 Ga0209455_1000098 Ga0209455_100009834 360
1017 3300025297 Ga0209758_1005099 Ga0209758_10050993 360
1018 3300025893 Ga0207682_10002657 Ga0207682_100026575 360
1019 3300025913 Ga0207695_10362944 Ga0207695_103629441 360
1020 3300025914 Ga0207671_10159338 Ga0207671_101593381 360
1021 3300025924 Ga0207694_10005148 Ga0207694_100051489 360
1022 3300025926 Ga0207659_10151281 Ga0207659_101512812 360
1023 3300025931 Ga0207644_10115802 Ga0207644_101158022 360
1024 3300025933 Ga0207706_10081410 Ga0207706_100814103 360
1025 3300025937 Ga0207669_10002174 Ga0207669_100021742 360
1026 3300025940 Ga0207691_10009097 Ga0207691_1000909710 360
1027 3300025944 Ga0207661_10028645 Ga0207661_100286453 360
1028 3300025945 Ga0207679_10159017 Ga0207679_101590172 360
1029 3300025960 Ga0207651_10018513 Ga0207651_100185133 360
1030 3300025981 Ga0207640_10040970 Ga0207640_100409701 360
1031 3300026041 Ga0207639_10104697 Ga0207639_101046972 360
1032 3300026067 Ga0207678_10188826 Ga0207678_101888261 360
1033 3300026078 Ga0207702_10312098 Ga0207702_103120981 360
1034 3300026116 Ga0207674_10146451 Ga0207674_101464512 360
1035 3300026121 Ga0207683_10018919 Ga0207683_100189193 360
1036 3300026142 Ga0207698_10119895 Ga0207698_101198951 360
1037 3300031235 Ga0265330_10023712 Ga0265330_100237122 360
1038 3300031247 Ga0265340_10000180 Ga0265340_100001806 360
1039 3300031247 Ga0265340_10028739 Ga0265340_100287392 360
1040 3300031250 Ga0265331_10000009 Ga0265331_1000000960 360
1041 3300031344 Ga0265316_10006464 Ga0265316_100064642 360
1042 3300031595 Ga0265313_10000919 Ga0265313_1000091911 360
1043 3300031711 Ga0265314_10007628 Ga0265314_100076282 360
1044 3300031712 Ga0265342_10002641 Ga0265342_1000264116 360
1045 3300031901 Ga0307406_10184440 Ga0307406_101844402 360
1046 3300037312 Ga0395899_0000014 Ga0395899_0000014_376305_377399 360
1047 3300037312 Ga0395899_0134306 Ga0395899_0134306_457_1551 360
1048 3300037418 Ga0395900_0000007 Ga0395900_0000007_376324_377418 360
1049 3300037418 Ga0395900_0085565 Ga0395900_0085565_659_1753 360
1050 3300037418 Ga0395900_0182159 Ga0395900_0182159_48_1142 360
1051 3300037466 Ga0395898_0000011 Ga0395898_0000011_111443_112537 360
1052 3300037471 Ga0395905_0000008 Ga0395905_0000008_376324_377418 360
1053 3300037471 Ga0395905_0045868 Ga0395905_0045868_2366_3460 360
1054 3300038443 Ga0395901_0000020 Ga0395901_0000020_202382_203476 360
1055 3300038443 Ga0395901_0062391 Ga0395901_0062391_368_1453 360
1056 3300038443 Ga0395901_0419102 Ga0395901_0419102_100_1194 360
1057 3300039437 Ga0436365_1290300 Ga0436365_1290300_343_1428 360
1058 3300039437 Ga0436365_1540042 Ga0436365_1540042_29963_31060 360
1059 3300039450 Ga0436363_1169320 Ga0436363_1169320_10455_11552 360
1060 3300044658 Ga0466972_0018855 Ga0466972_0018855_1714_2808 360
1061 3300044901 Ga0466960_0045898 Ga0466960_0045898_136_1230 360
1062 3300046615 Ga0495656_0017927 Ga0495656_0017927_1430_2515 360
1063 3300046660 Ga0495625_0144379 Ga0495625_0144379_199_1293 360
1064 3300048905 Ga0496102_0399544 Ga0496102_0399544_129_1217 360
1065 3300048913 Ga0496110_0343918 Ga0496110_0343918_183_1268 360
1066 3300048924 Ga0496121_0128425 Ga0496121_0128425_307_1401 360
1067 3300049568 Ga0501031_0000003 Ga0501031_0000003_47422_48519 360
1068 3300049569 Ga0501032_0000010 Ga0501032_0000010_47422_48519 360
1069 3300049569 Ga0501032_0187049 Ga0501032_0187049_63_1160 360
1070 3300049570 Ga0501033_0000017 Ga0501033_0000017_47422_48519 360
1071 3300049570 Ga0501033_0069587 Ga0501033_0069587_1249_2346 360
1072 3300049570 Ga0501033_0147117 Ga0501033_0147117_511_1608 360
1073 3300049571 Ga0501034_0000053 Ga0501034_0000053_158303_159400 360
1074 3300049571 Ga0501034_0017446 Ga0501034_0017446_6122_7210 360
1075 3300049571 Ga0501034_0054374 Ga0501034_0054374_1366_2454 360
1076 3300049572 Ga0501036_0000009 Ga0501036_0000009_47422_48519 360
1077 3300049573 Ga0501037_0000008 Ga0501037_0000008_158294_159391 360
1078 3300049574 Ga0501038_0000008 Ga0501038_0000008_158303_159400 360
1079 3300049574 Ga0501038_0042764 Ga0501038_0042764_340_1473 360
1080 3300049575 Ga0501039_0000021 Ga0501039_0000021_3153_4250 360
1081 3300049576 Ga0501040_0015158 Ga0501040_0015158_3103_4200 360
1082 3300049579 Ga0501043_0000279 Ga0501043_0000279_26422_27519 360
1083 3300049581 Ga0501047_0000126 Ga0501047_0000126_45323_46420 360
1084 3300049581 Ga0501047_0031408 Ga0501047_0031408_344_1504 360
1085 3300049581 Ga0501047_0055349 Ga0501047_0055349_2603_3700 360
1086 3300049583 Ga0501067_0036634 Ga0501067_0036634_1443_2537 360
1087 3300049586 Ga0501070_0056572 Ga0501070_0056572_599_1696 360
1088 3300049822 Ga0501035_0000023 Ga0501035_0000023_47422_48519 360
1089 3300049823 Ga0501044_0000021 Ga0501044_0000021_158303_159400 360
1090 3300050491 nmdc:mga00v17_3725_c1 nmdc:mga00v17_3725_c1_2026_3132 360
1091 3300050492 nmdc:mga0yw44_17251_c1 nmdc:mga0yw44_17251_c1_1162_2256 360
1092 3300050492 nmdc:mga0yw44_55821_c1 nmdc:mga0yw44_55821_c1_188_1282 360
1093 3300050495 nmdc:mga04h51_53356_c1 nmdc:mga04h51_53356_c1_142_1236 360
1094 iso_pu_bacteria 2595698237 2596374149 360
1095 iso_pu_bacteria 2643221580 2643912643 360
1096 iso_pu_bacteria 2643221674 2644413350 360
1097 iso_pu_bacteria 2889306138 2889311411 360
1098 iso_pu_bacteria 2891373044 2891375150 360
1099 iso_pu_bacteria 2902330777 2902333063 360
1100 iso_pu_bacteria 2902405164 2902411899 360
1101 iso_pu_bacteria 2928125067 2928129733 360
1102 iso_pu_bacteria 2932401849 2932404768 360
1103 3300001979 JGI24740J21852_10000265 JGI24740J21852_1000026525 361
1104 3300002704 JGI25155J39150_1000013 JGI25155J39150_100001352 361
1105 3300002705 JGI25156J39149_1000011 JGI25156J39149_100001152 361
1106 3300002737 JGI25162J39368_1004503 JGI25162J39368_10045031 361
1107 3300002738 JGI25154J39366_1000030 JGI25154J39366_100003052 361
1108 3300002739 JGI25158J39367_1000118 JGI25158J39367_100011813 361
1109 3300002739 JGI25158J39367_1006442 JGI25158J39367_10064422 361
1110 3300002741 JGI25157J39369_1000013 JGI25157J39369_100001352 361
1111 3300002773 JGI25152J39213_1003762 JGI25152J39213_10037624 361
1112 3300002773 JGI25152J39213_1018273 JGI25152J39213_10182731 361
1113 3300002773 JGI25152J39213_1018279 JGI25152J39213_10182791 361
1114 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003173 361
1115 3300002987 JGI25159J45721_1000320 JGI25159J45721_100032017 361
1116 3300002987 JGI25159J45721_1002223 JGI25159J45721_10022239 361
1117 3300003187 JGI25151J46595_10000425 JGI25151J46595_1000042535 361
1118 3300003187 JGI25151J46595_10005036 JGI25151J46595_100050362 361
1119 3300003187 JGI25151J46595_10009861 JGI25151J46595_100098618 361
1120 3300003214 JGI25165J46597_1010520 JGI25165J46597_10105202 361
1121 3300003215 JGI25153J46596_10008005 JGI25153J46596_100080051 361
1122 3300003215 JGI25153J46596_10045849 JGI25153J46596_100458491 361
1123 3300003215 JGI25153J46596_10045860 JGI25153J46596_100458601 361
1124 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003354 361
1125 3300003354 JGI25160J50197_1000041 JGI25160J50197_1000041121 361
1126 3300003354 JGI25160J50197_1001749 JGI25160J50197_10017498 361
1127 3300003354 JGI25160J50197_1006450 JGI25160J50197_10064502 361
1128 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002121 361
1129 3300003374 JGI25161J50226_1000184 JGI25161J50226_100018436 361
1130 3300003374 JGI25161J50226_1000315 JGI25161J50226_100031514 361
1131 3300003374 JGI25161J50226_1006751 JGI25161J50226_10067512 361
1132 3300003771 Ga0055526_1000550 Ga0055526_10005504 361
1133 3300003771 Ga0055526_1001211 Ga0055526_100121114 361
1134 3300003771 Ga0055526_1004504 Ga0055526_10045045 361
1135 3300003775 Ga0055524_1009975 Ga0055524_10099752 361
1136 3300003781 Ga0055536_1001178 Ga0055536_10011789 361
1137 3300003781 Ga0055536_1007448 Ga0055536_10074482 361
1138 3300003790 Ga0055528_1000095 Ga0055528_100009536 361
1139 3300003790 Ga0055528_1000618 Ga0055528_100061830 361
1140 3300003790 Ga0055528_1017233 Ga0055528_10172333 361
1141 3300003790 Ga0055528_1017349 Ga0055528_10173491 361
1142 3300003792 Ga0055540_1000190 Ga0055540_10001901 361
1143 3300003792 Ga0055540_1002438 Ga0055540_10024385 361
1144 3300003794 Ga0055531_10014246 Ga0055531_100142463 361
1145 3300004625 Ga0055543_1000059 Ga0055543_1000059120 361
1146 3300004625 Ga0055543_1000203 Ga0055543_100020335 361
1147 3300004625 Ga0055543_1000466 Ga0055543_10004667 361
1148 3300004625 Ga0055543_1001741 Ga0055543_10017412 361
1149 3300005262 Ga0065165_1000031 Ga0065165_1000031134 361
1150 3300005262 Ga0065165_1000084 Ga0065165_100008430 361
1151 3300005331 Ga0070670_100000230 Ga0070670_10000023046 361
1152 3300005340 Ga0070689_100001712 Ga0070689_1000017123 361
1153 3300005354 Ga0070675_100295408 Ga0070675_1002954081 361
1154 3300005355 Ga0070671_100248925 Ga0070671_1002489252 361
1155 3300005364 Ga0070673_100081143 Ga0070673_1000811432 361
1156 3300005367 Ga0070667_100032864 Ga0070667_1000328643 361
1157 3300005458 Ga0070681_10003135 Ga0070681_100031359 361
1158 3300005530 Ga0070679_100020950 Ga0070679_1000209505 361
1159 3300005547 Ga0070693_100167868 Ga0070693_1001678681 361
1160 3300005548 Ga0070665_100315005 Ga0070665_1003150051 361
1161 3300005563 Ga0068855_100000752 Ga0068855_10000075238 361
1162 3300005563 Ga0068855_100013658 Ga0068855_1000136586 361
1163 3300005563 Ga0068855_100142556 Ga0068855_1001425564 361
1164 3300005563 Ga0068855_100264575 Ga0068855_1002645751 361
1165 3300005985 Ga0081539_10001448 Ga0081539_1000144837 361
1166 3300006038 Ga0075365_10000149 Ga0075365_100001494 361
1167 3300006038 Ga0075365_10013829 Ga0075365_100138293 361
1168 3300006038 Ga0075365_10138156 Ga0075365_101381562 361
1169 3300006051 Ga0075364_10024859 Ga0075364_100248592 361
1170 3300006177 Ga0075362_10051166 Ga0075362_100511662 361
1171 3300006178 Ga0075367_10103705 Ga0075367_101037051 361
1172 3300006178 Ga0075367_10188069 Ga0075367_101880691 361
1173 3300006186 Ga0075369_10003266 Ga0075369_100032662 361
1174 3300006186 Ga0075369_10011527 Ga0075369_100115271 361
1175 3300006186 Ga0075369_10092420 Ga0075369_100924201 361
1176 3300006195 Ga0075366_10002943 Ga0075366_1000294313 361
1177 3300006195 Ga0075366_10015692 Ga0075366_100156925 361
1178 3300006195 Ga0075366_10041793 Ga0075366_100417932 361
1179 3300006353 Ga0075370_10044774 Ga0075370_100447742 361
1180 3300006946 Ga0079104_1000033 Ga0079104_1000033205 361
1181 3300006946 Ga0079104_1001143 Ga0079104_10011434 361
1182 3300006946 Ga0079104_1008145 Ga0079104_10081452 361
1183 3300009093 Ga0105240_10000024 Ga0105240_1000002420 361
1184 3300009093 Ga0105240_10053897 Ga0105240_100538973 361
1185 3300009148 Ga0105243_10002207 Ga0105243_100022078 361
1186 3300009148 Ga0105243_10178878 Ga0105243_101788782 361
1187 3300009177 Ga0105248_10008356 Ga0105248_100083565 361
1188 3300009545 Ga0105237_10001005 Ga0105237_1000100529 361
1189 3300009551 Ga0105238_10177712 Ga0105238_101777123 361
1190 3300009766 Ga0123342_1026828 Ga0123342_10268282 361
1191 3300009986 Ga0105033_101895 Ga0105033_1018952 361
1192 3300010375 Ga0105239_10003536 Ga0105239_1000353619 361
1193 3300012500 Ga0157314_1001419 Ga0157314_10014193 361
1194 3300013100 Ga0157373_10154896 Ga0157373_101548962 361
1195 3300013102 Ga0157371_10000004 Ga0157371_10000004363 361
1196 3300013102 Ga0157371_10017626 Ga0157371_100176267 361
1197 3300013104 Ga0157370_10000185 Ga0157370_1000018572 361
1198 3300013104 Ga0157370_10003095 Ga0157370_100030957 361
1199 3300013105 Ga0157369_10014944 Ga0157369_100149446 361
1200 3300013105 Ga0157369_10069674 Ga0157369_100696744 361
1201 3300013249 Ga0171463_1001 Ga0171463_1001934 361
1202 3300014969 Ga0157376_10091886 Ga0157376_100918863 361
1203 3300015262 Ga0182007_10005494 Ga0182007_100054946 361
1204 3300015265 Ga0182005_1006522 Ga0182005_10065224 361
1205 3300021320 Ga0214544_1002289 Ga0214544_100228913 361
1206 3300021321 Ga0214542_1001074 Ga0214542_100107424 361
1207 3300021327 Ga0214543_1000897 Ga0214543_100089724 361
1208 3300022739 Ga0228711_1000041 Ga0228711_100004174 361
1209 3300022740 Ga0228710_1000024 Ga0228710_1000024101 361
1210 3300025206 Ga0209435_100026 Ga0209435_10002652 361
1211 3300025208 Ga0209436_100006 Ga0209436_100006130 361
1212 3300025208 Ga0209436_100694 Ga0209436_10069416 361
1213 3300025208 Ga0209436_107314 Ga0209436_1073142 361
1214 3300025228 Ga0209672_104703 Ga0209672_1047034 361
1215 3300025233 Ga0209437_100196 Ga0209437_100196115 361
1216 3300025245 Ga0207425_1004254 Ga0207425_10042542 361
1217 3300025246 Ga0209646_1000084 Ga0209646_100008452 361
1218 3300025250 Ga0209026_1000080 Ga0209026_100008052 361
1219 3300025254 Ga0209148_1012713 Ga0209148_10127132 361
1220 3300025256 Ga0209759_1000061 Ga0209759_100006152 361
1221 3300025258 Ga0209129_1000206 Ga0209129_10002068 361
1222 3300025258 Ga0209129_1000999 Ga0209129_10009991 361
1223 3300025258 Ga0209129_1001939 Ga0209129_10019396 361
1224 3300025258 Ga0209129_1001947 Ga0209129_100194714 361
1225 3300025258 Ga0209129_1002038 Ga0209129_10020389 361
1226 3300025258 Ga0209129_1003662 Ga0209129_10036621 361
1227 3300025261 Ga0209233_1000037 Ga0209233_1000037448 361
1228 3300025261 Ga0209233_1000243 Ga0209233_10002437 361
1229 3300025273 Ga0209673_1000024 Ga0209673_1000024410 361
1230 3300025273 Ga0209673_1000063 Ga0209673_1000063124 361
1231 3300025273 Ga0209673_1002616 Ga0209673_10026167 361
1232 3300025273 Ga0209673_1004882 Ga0209673_10048824 361
1233 3300025273 Ga0209673_1009839 Ga0209673_10098391 361
1234 3300025284 Ga0209130_1000002 Ga0209130_1000002266 361
1235 3300025284 Ga0209130_1000005 Ga0209130_1000005124 361
1236 3300025284 Ga0209130_1000028 Ga0209130_1000028327 361
1237 3300025292 Ga0209676_1005562 Ga0209676_10055622 361
1238 3300025292 Ga0209676_1007284 Ga0209676_10072842 361
1239 3300025292 Ga0209676_1013715 Ga0209676_10137155 361
1240 3300025294 Ga0209025_1000037 Ga0209025_1000037180 361
1241 3300025294 Ga0209025_1000060 Ga0209025_1000060225 361
1242 3300025294 Ga0209025_1000479 Ga0209025_100047918 361
1243 3300025294 Ga0209025_1001859 Ga0209025_10018597 361
1244 3300025294 Ga0209025_1004322 Ga0209025_10043221 361
1245 3300025294 Ga0209025_1009455 Ga0209025_10094552 361
1246 3300025294 Ga0209025_1026074 Ga0209025_10260741 361
1247 3300025294 Ga0209025_1045214 Ga0209025_10452142 361
1248 3300025294 Ga0209025_1045621 Ga0209025_10456212 361
1249 3300025295 Ga0209564_1000093 Ga0209564_1000093127 361
1250 3300025295 Ga0209564_1000316 Ga0209564_100031666 361
1251 3300025295 Ga0209564_1001013 Ga0209564_100101329 361
1252 3300025295 Ga0209564_1002417 Ga0209564_10024172 361
1253 3300025295 Ga0209564_1004476 Ga0209564_10044767 361
1254 3300025297 Ga0209758_1000361 Ga0209758_100036113 361
1255 3300025297 Ga0209758_1000441 Ga0209758_100044154 361
1256 3300025297 Ga0209758_1000499 Ga0209758_10004996 361
1257 3300025297 Ga0209758_1000994 Ga0209758_100099417 361
1258 3300025297 Ga0209758_1001467 Ga0209758_10014676 361
1259 3300025297 Ga0209758_1008231 Ga0209758_10082315 361
1260 3300025297 Ga0209758_1050415 Ga0209758_10504153 361
1261 3300025298 Ga0209050_1002860 Ga0209050_100286014 361
1262 3300025298 Ga0209050_1015945 Ga0209050_10159454 361
1263 3300025298 Ga0209050_1032075 Ga0209050_10320752 361
1264 3300025299 Ga0209256_1000027 Ga0209256_1000027285 361
1265 3300025299 Ga0209256_1000880 Ga0209256_10008809 361
1266 3300025299 Ga0209256_1000996 Ga0209256_100099613 361
1267 3300025299 Ga0209256_1001570 Ga0209256_10015705 361
1268 3300025299 Ga0209256_1006347 Ga0209256_10063472 361
1269 3300025299 Ga0209256_1011131 Ga0209256_10111313 361
1270 3300025299 Ga0209256_1022145 Ga0209256_10221452 361
1271 3300025299 Ga0209256_1027358 Ga0209256_10273581 361
1272 3300025302 Ga0207426_1000012 Ga0207426_1000012255 361
1273 3300025302 Ga0207426_1000013 Ga0207426_1000013266 361
1274 3300025302 Ga0207426_1000015 Ga0207426_1000015475 361
1275 3300025302 Ga0207426_1000070 Ga0207426_1000070172 361
1276 3300025302 Ga0207426_1031005 Ga0207426_10310052 361
1277 3300025303 Ga0209051_1000135 Ga0209051_100013548 361
1278 3300025303 Ga0209051_1003098 Ga0209051_10030984 361
1279 3300025303 Ga0209051_1004984 Ga0209051_10049846 361
1280 3300025304 Ga0209257_1004510 Ga0209257_10045109 361
1281 3300025304 Ga0209257_1008097 Ga0209257_10080974 361
1282 3300025304 Ga0209257_1008641 Ga0209257_10086412 361
1283 3300025913 Ga0207695_10000036 Ga0207695_1000003691 361
1284 3300025913 Ga0207695_10028657 Ga0207695_100286573 361
1285 3300025914 Ga0207671_10000153 Ga0207671_1000015329 361
1286 3300025917 Ga0207660_10032656 Ga0207660_100326563 361
1287 3300025918 Ga0207662_10008274 Ga0207662_100082743 361
1288 3300025919 Ga0207657_10092842 Ga0207657_100928421 361
1289 3300025921 Ga0207652_10032981 Ga0207652_100329812 361
1290 3300025923 Ga0207681_10022214 Ga0207681_100222142 361
1291 3300025923 Ga0207681_10115583 Ga0207681_101155832 361
1292 3300025926 Ga0207659_10185649 Ga0207659_101856491 361
1293 3300025935 Ga0207709_10119269 Ga0207709_101192692 361
1294 3300025936 Ga0207670_10001158 Ga0207670_100011583 361
1295 3300025937 Ga0207669_10099037 Ga0207669_100990372 361
1296 3300025941 Ga0207711_10018280 Ga0207711_100182804 361
1297 3300025949 Ga0207667_10008754 Ga0207667_1000875412 361
1298 3300025949 Ga0207667_10057349 Ga0207667_100573493 361
1299 3300025960 Ga0207651_10053932 Ga0207651_100539322 361
1300 3300025986 Ga0207658_10032342 Ga0207658_100323422 361
1301 3300026089 Ga0207648_10074288 Ga0207648_100742882 361
1302 3300027111 Ga0209281_1000043 Ga0209281_1000043339 361
1303 3300027111 Ga0209281_1000409 Ga0209281_10004094 361
1304 3300027111 Ga0209281_1000520 Ga0209281_100052030 361
1305 3300027312 Ga0209371_1001907 Ga0209371_10019072 361
1306 3300027666 Ga0209282_1000090 Ga0209282_10000904 361
1307 3300027866 Ga0209813_10052531 Ga0209813_100525311 361
1308 3300028380 Ga0268265_10065568 Ga0268265_100655681 361
1309 3300028794 Ga0307515_10035111 Ga0307515_100351117 361
1310 3300028794 Ga0307515_10070097 Ga0307515_100700974 361
1311 3300030500 Ga0268256_1003048 Ga0268256_10030483 361
1312 3300030500 Ga0268256_1004444 Ga0268256_10044445 361
1313 3300030744 Ga0316181_1158173 Ga0316181_11581732 361
1314 3300031548 Ga0307408_100064324 Ga0307408_1000643242 361
1315 3300031548 Ga0307408_100120933 Ga0307408_1001209332 361
1316 3300031911 Ga0307412_10182678 Ga0307412_101826783 361
1317 3300031967 Ga0315914_1000167 Ga0315914_100016760 361
1318 3300031995 Ga0307409_100163664 Ga0307409_1001636642 361
1319 3300031995 Ga0307409_100224541 Ga0307409_1002245412 361
1320 3300032004 Ga0307414_10038855 Ga0307414_100388552 361
1321 3300032004 Ga0307414_10042024 Ga0307414_100420242 361
1322 3300033430 Ga0315913_1000038 Ga0315913_100003860 361
1323 3300033464 Ga0315915_1000019 Ga0315915_10000194 361
1324 3300035121 Ga0373960_0004551 Ga0373960_0004551_1484_2572 361
1325 3300035691 Ga0373931_0002221 Ga0373931_0002221_4405_5493 361
1326 3300035692 Ga0373935_0050888 Ga0373935_0050888_1000_2088 361
1327 3300035695 Ga0373927_0068280 Ga0373927_0068280_613_1701 361
1328 3300038725 Ga0400484_43756 Ga0400484_43756_63_1274 361
1329 3300041404 Ga0439436_0017393 Ga0439436_0017393_594_1691 361
1330 3300041413 Ga0439465_0011340 Ga0439465_0011340_640_1737 361
1331 3300041503 Ga0451847_1021271 Ga0451847_1021271_1164_2258 361
1332 3300042007 Ga0439449_0018118 Ga0439449_0018118_735_1832 361
1333 3300042531 Ga0450918_002914 Ga0450918_002914_1602_2699 361
1334 3300046459 Ga0495629_0022165 Ga0495629_0022165_828_1928 361
1335 3300046474 Ga0495605_0003086 Ga0495605_0003086_539_1630 361
1336 3300046476 Ga0495662_0083672 Ga0495662_0083672_202_1302 361
1337 3300046507 Ga0495606_0049828 Ga0495606_0049828_296_1390 361
1338 3300046507 Ga0495606_0081097 Ga0495606_0081097_364_1458 361
1339 3300046518 Ga0495631_0023830 Ga0495631_0023830_576_1667 361
1340 3300046522 Ga0495643_0071913 Ga0495643_0071913_504_1598 361
1341 3300046529 Ga0495652_0183620 Ga0495652_0183620_265_1365 361
1342 3300046530 Ga0495654_0024317 Ga0495654_0024317_1456_2550 361
1343 3300046536 Ga0495587_0048098 Ga0495587_0048098_420_1520 361
1344 3300046674 Ga0495588_0002648 Ga0495588_0002648_6016_7122 361
1345 3300046809 Ga0495600_0011734 Ga0495600_0011734_1143_2243 361
1346 3300047317 Ga0495604_0101475 Ga0495604_0101475_879_1979 361
1347 3300048903 Ga0496100_0008335 Ga0496100_0008335_3784_4872 361
1348 3300048904 Ga0496101_0002908 Ga0496101_0002908_3348_4436 361
1349 3300048905 Ga0496102_0207293 Ga0496102_0207293_741_1829 361
1350 3300048907 Ga0496104_0044535 Ga0496104_0044535_151_1239 361
1351 3300048909 Ga0496106_0140803 Ga0496106_0140803_403_1491 361
1352 3300048912 Ga0496109_0027112 Ga0496109_0027112_1112_2200 361
1353 3300048913 Ga0496110_0022376 Ga0496110_0022376_3272_4360 361
1354 3300048913 Ga0496110_0262121 Ga0496110_0262121_44_1147 361
1355 3300048914 Ga0496111_0011884 Ga0496111_0011884_4523_5626 361
1356 3300048916 Ga0496113_0021857 Ga0496113_0021857_1298_2386 361
1357 3300048917 Ga0496114_0002985 Ga0496114_0002985_6032_7120 361
1358 3300048918 Ga0496115_0048178 Ga0496115_0048178_123_1211 361
1359 3300048918 Ga0496115_0048549 Ga0496115_0048549_1166_2254 361
1360 3300048919 Ga0496116_0000100 Ga0496116_0000100_38525_39622 361
1361 3300048919 Ga0496116_0030856 Ga0496116_0030856_2258_3364 361
1362 3300048920 Ga0496117_0000002 Ga0496117_0000002_2093241_2094347 361
1363 3300048920 Ga0496117_0001819 Ga0496117_0001819_420_1514 361
1364 3300048920 Ga0496117_0002714 Ga0496117_0002714_19767_20873 361
1365 3300048920 Ga0496117_0006487 Ga0496117_0006487_4452_5594 361
1366 3300048921 Ga0496118_0000776 Ga0496118_0000776_30528_31634 361
1367 3300048921 Ga0496118_0001431 Ga0496118_0001431_4520_5614 361
1368 3300048921 Ga0496118_0096524 Ga0496118_0096524_616_1710 361
1369 3300048922 Ga0496119_0022495 Ga0496119_0022495_395_1537 361
1370 3300048922 Ga0496119_0080368 Ga0496119_0080368_452_1558 361
1371 3300048923 Ga0496120_0000034 Ga0496120_0000034_26542_27648 361
1372 3300048923 Ga0496120_0011789 Ga0496120_0011789_3653_4795 361
1373 3300048923 Ga0496120_0071472 Ga0496120_0071472_486_1577 361
1374 3300048924 Ga0496121_0000001 Ga0496121_0000001_124933_126075 361
1375 3300048924 Ga0496121_0000897 Ga0496121_0000897_41170_42261 361
1376 3300048924 Ga0496121_0002730 Ga0496121_0002730_153_1247 361
1377 3300048924 Ga0496121_0002776 Ga0496121_0002776_550_1644 361
1378 3300048925 Ga0496122_0000001 Ga0496122_0000001_1464031_1465137 361
1379 3300048925 Ga0496122_0000018 Ga0496122_0000018_44293_45387 361
1380 3300048925 Ga0496122_0001117 Ga0496122_0001117_44989_46131 361
1381 3300048925 Ga0496122_0001480 Ga0496122_0001480_28429_29535 361
1382 3300048925 Ga0496122_0041225 Ga0496122_0041225_2180_3277 361
1383 3300048925 Ga0496122_0120324 Ga0496122_0120324_151_1245 361
1384 3300048926 Ga0496123_0000001 Ga0496123_0000001_1467762_1468868 361
1385 3300048926 Ga0496123_0000015 Ga0496123_0000015_44293_45387 361
1386 3300048926 Ga0496123_0000238 Ga0496123_0000238_101938_103044 361
1387 3300048926 Ga0496123_0021959 Ga0496123_0021959_496_1587 361
1388 3300048926 Ga0496123_0075069 Ga0496123_0075069_490_1581 361
1389 3300048927 Ga0496124_0004346 Ga0496124_0004346_11651_12757 361
1390 3300048927 Ga0496124_0036491 Ga0496124_0036491_17_1159 361
1391 3300048927 Ga0496124_0040620 Ga0496124_0040620_402_1496 361
1392 3300048927 Ga0496124_0049092 Ga0496124_0049092_2060_3166 361
1393 3300048927 Ga0496124_0082537 Ga0496124_0082537_738_1832 361
1394 3300048927 Ga0496124_0126654 Ga0496124_0126654_846_1991 361
1395 3300048928 Ga0496125_0000001 Ga0496125_0000001_238390_239532 361
1396 3300048928 Ga0496125_0000299 Ga0496125_0000299_89305_90411 361
1397 3300048928 Ga0496125_0001021 Ga0496125_0001021_33275_34378 361
1398 3300048928 Ga0496125_0151414 Ga0496125_0151414_402_1547 361
1399 3300048929 Ga0496126_0000311 Ga0496126_0000311_66350_67447 361
1400 3300048929 Ga0496126_0016551 Ga0496126_0016551_5987_7099 361
1401 3300048929 Ga0496126_0133780 Ga0496126_0133780_467_1561 361
1402 3300049570 Ga0501033_0000193 Ga0501033_0000193_610_1704 361
1403 3300049570 Ga0501033_0065023 Ga0501033_0065023_997_2145 361
1404 3300049570 Ga0501033_0132678 Ga0501033_0132678_629_1717 361
1405 3300049571 Ga0501034_0014182 Ga0501034_0014182_1387_2487 361
1406 3300049571 Ga0501034_0036811 Ga0501034_0036811_2247_3401 361
1407 3300049571 Ga0501034_0054954 Ga0501034_0054954_1972_3060 361
1408 3300049571 Ga0501034_0212309 Ga0501034_0212309_619_1713 361
1409 3300049572 Ga0501036_0091015 Ga0501036_0091015_1197_2345 361
1410 3300049572 Ga0501036_0208228 Ga0501036_0208228_177_1331 361
1411 3300049573 Ga0501037_0054212 Ga0501037_0054212_814_1902 361
1412 3300049574 Ga0501038_0030612 Ga0501038_0030612_414_1502 361
1413 3300049579 Ga0501043_0062354 Ga0501043_0062354_583_1731 361
1414 3300049580 Ga0501046_0047408 Ga0501046_0047408_1206_2294 361
1415 3300049581 Ga0501047_0005429 Ga0501047_0005429_10468_11616 361
1416 3300049581 Ga0501047_0020365 Ga0501047_0020365_4093_5247 361
1417 3300049583 Ga0501067_0015697 Ga0501067_0015697_2062_3216 361
1418 3300049584 Ga0501068_0027634 Ga0501068_0027634_960_2108 361
1419 3300049584 Ga0501068_0051627 Ga0501068_0051627_1179_2267 361
1420 3300049585 Ga0501069_0080127 Ga0501069_0080127_132_1232 361
1421 3300049586 Ga0501070_0025105 Ga0501070_0025105_3128_4282 361
1422 3300049586 Ga0501070_0040426 Ga0501070_0040426_949_2037 361
1423 3300049589 Ga0501073_0028980 Ga0501073_0028980_2334_3488 361
1424 3300049590 Ga0501074_0072948 Ga0501074_0072948_597_1751 361
1425 3300049741 Ga0501079_0050088 Ga0501079_0050088_249_1403 361
1426 3300049741 Ga0501079_0061077 Ga0501079_0061077_1164_2252 361
1427 3300049742 Ga0501080_0034630 Ga0501080_0034630_1267_2367 361
1428 3300049744 Ga0501083_0014019 Ga0501083_0014019_1256_2356 361
1429 3300049744 Ga0501083_0047911 Ga0501083_0047911_1270_2358 361
1430 3300049758 Ga0501241_001216 Ga0501241_001216_3726_4820 361
1431 3300049822 Ga0501035_0001984 Ga0501035_0001984_4818_5912 361
1432 3300049822 Ga0501035_0005547 Ga0501035_0005547_8777_9931 361
1433 3300049822 Ga0501035_0207612 Ga0501035_0207612_217_1317 361
1434 3300049823 Ga0501044_0003659 Ga0501044_0003659_12839_13927 361
1435 3300049823 Ga0501044_0086246 Ga0501044_0086246_1431_2585 361
1436 3300049823 Ga0501044_0098098 Ga0501044_0098098_1351_2499 361
1437 3300050491 nmdc:mga00v17_217_c1 nmdc:mga00v17_217_c1_9808_10899 361
1438 3300050491 nmdc:mga00v17_48_c1 nmdc:mga00v17_48_c1_64686_65792 361
1439 3300050491 nmdc:mga00v17_8683_c1 nmdc:mga00v17_8683_c1_462_1604 361
1440 3300050492 nmdc:mga0yw44_20710_c1 nmdc:mga0yw44_20710_c1_1280_2386 361
1441 3300050492 nmdc:mga0yw44_3078_c1 nmdc:mga0yw44_3078_c1_573_1664 361
1442 3300050493 nmdc:mga0k408_20389_c1 nmdc:mga0k408_20389_c1_1226_2317 361
1443 3300050516 nmdc:mga0sz30_63943_c1 nmdc:mga0sz30_63943_c1_208_1314 361
1444 3300050516 nmdc:mga0sz30_79663_c1 nmdc:mga0sz30_79663_c1_285_1391 361
1445 3300050516 nmdc:mga0sz30_94764_c1 nmdc:mga0sz30_94764_c1_121_1227 361
1446 3300053117 Ga0500593_000145 Ga0500593_000145_21849_22958 361
1447 3300053125 Ga0500618_000090 Ga0500618_000090_320_1459 361
1448 3300053134 Ga0500658_0002405 Ga0500658_0002405_418_1512 361
1449 3300053134 Ga0500658_0051206 Ga0500658_0051206_577_1665 361
1450 3300053137 Ga0500561_0000031 Ga0500561_0000031_1386_2492 361
1451 3300053139 Ga0500568_0000002 Ga0500568_0000002_580803_581912 361
1452 3300053139 Ga0500568_0000677 Ga0500568_0000677_20091_21185 361
1453 3300053139 Ga0500568_0005885 Ga0500568_0005885_423_1517 361
1454 3300053140 Ga0500573_0026536 Ga0500573_0026536_1627_2724 361
1455 3300053148 Ga0500590_004157 Ga0500590_004157_5406_6506 361
1456 3300053153 Ga0500616_0001322 Ga0500616_0001322_19315_20409 361
1457 3300053153 Ga0500616_0003925 Ga0500616_0003925_7007_8134 361
1458 3300053153 Ga0500616_0012628 Ga0500616_0012628_266_1360 361
1459 3300053153 Ga0500616_0035808 Ga0500616_0035808_1147_2232 361
1460 3300053156 Ga0500622_0001167 Ga0500622_0001167_3510_4604 361
1461 3300053177 Ga0500636_0000006 Ga0500636_0000006_52921_54072 361
1462 3300054114 Ga0501084_0061211 Ga0501084_0061211_2022_3110 361
1463 3300054114 Ga0501084_0247340 Ga0501084_0247340_110_1210 361
1464 3300060353 Ga0501082_0020536 Ga0501082_0020536_982_2082 361
1465 iso_pu_bacteria 2989349275 2989351663 361
1466 iso_pu_bacteria 2996336353 2996337277 361
1467 iso_pu_bacteria 8005314921 8005315277 361
1468 3300003320 rootH2_10009083 rootH2_100090833 362
1469 3300003320 rootH2_10019646 rootH2_100196461 362
1470 3300005335 Ga0070666_10001554 Ga0070666_100015543 362
1471 3300005339 Ga0070660_100008052 Ga0070660_1000080523 362
1472 3300005341 Ga0070691_10026668 Ga0070691_100266681 362
1473 3300005344 Ga0070661_100000165 Ga0070661_1000001652 362
1474 3300005434 Ga0070709_10001921 Ga0070709_100019213 362
1475 3300005435 Ga0070714_100022956 Ga0070714_1000229562 362
1476 3300005435 Ga0070714_100068914 Ga0070714_1000689143 362
1477 3300005436 Ga0070713_100000017 Ga0070713_10000001726 362
1478 3300005439 Ga0070711_100042650 Ga0070711_1000426501 362
1479 3300005439 Ga0070711_100149241 Ga0070711_1001492412 362
1480 3300005440 Ga0070705_100096836 Ga0070705_1000968362 362
1481 3300005456 Ga0070678_100072036 Ga0070678_1000720363 362
1482 3300005563 Ga0068855_100055168 Ga0068855_1000551684 362
1483 3300005578 Ga0068854_100066755 Ga0068854_1000667553 362
1484 3300005614 Ga0068856_100002104 Ga0068856_10000210417 362
1485 3300005616 Ga0068852_100035319 Ga0068852_1000353192 362
1486 3300005842 Ga0068858_100009758 Ga0068858_1000097584 362
1487 3300006175 Ga0070712_100000368 Ga0070712_10000036823 362
1488 3300006175 Ga0070712_100020936 Ga0070712_1000209361 362
1489 3300006237 Ga0097621_100024772 Ga0097621_1000247725 362
1490 3300006358 Ga0068871_100023111 Ga0068871_1000231113 362
1491 3300006871 Ga0075434_100055250 Ga0075434_1000552502 362
1492 3300006914 Ga0075436_100007642 Ga0075436_1000076424 362
1493 3300007076 Ga0075435_100189872 Ga0075435_1001898722 362
1494 3300009093 Ga0105240_10011043 Ga0105240_100110433 362
1495 3300009098 Ga0105245_10017943 Ga0105245_100179433 362
1496 3300009174 Ga0105241_10010945 Ga0105241_100109452 362
1497 3300009177 Ga0105248_10000001 Ga0105248_10000001696 362
1498 3300009553 Ga0105249_10112897 Ga0105249_101128972 362
1499 3300011119 Ga0105246_10064796 Ga0105246_100647962 362
1500 3300013102 Ga0157371_10003085 Ga0157371_100030853 362
1501 3300013307 Ga0157372_10015370 Ga0157372_100153709 362
1502 3300013307 Ga0157372_10183099 Ga0157372_101830992 362
1503 3300013307 Ga0157372_10658310 Ga0157372_106583101 362
1504 3300014326 Ga0157380_10050097 Ga0157380_100500972 362
1505 3300014968 Ga0157379_10001175 Ga0157379_1000117510 362
1506 3300021377 Ga0213874_10010433 Ga0213874_100104332 362
1507 3300025901 Ga0207688_10054535 Ga0207688_100545351 362
1508 3300025903 Ga0207680_10001536 Ga0207680_100015366 362
1509 3300025906 Ga0207699_10000117 Ga0207699_1000011738 362
1510 3300025909 Ga0207705_10000098 Ga0207705_100000989 362
1511 3300025912 Ga0207707_10001764 Ga0207707_100017645 362
1512 3300025913 Ga0207695_10017799 Ga0207695_100177996 362
1513 3300025915 Ga0207693_10000129 Ga0207693_1000012955 362
1514 3300025915 Ga0207693_10000331 Ga0207693_1000033123 362
1515 3300025916 Ga0207663_10021388 Ga0207663_100213883 362
1516 3300025916 Ga0207663_10228171 Ga0207663_102281712 362
1517 3300025919 Ga0207657_10000153 Ga0207657_1000015355 362
1518 3300025920 Ga0207649_10000036 Ga0207649_1000003619 362
1519 3300025921 Ga0207652_10185000 Ga0207652_101850001 362
1520 3300025928 Ga0207700_10000034 Ga0207700_10000034109 362
1521 3300025929 Ga0207664_10008566 Ga0207664_100085665 362
1522 3300025929 Ga0207664_10055277 Ga0207664_100552772 362
1523 3300025932 Ga0207690_10083505 Ga0207690_100835052 362
1524 3300025941 Ga0207711_10000001 Ga0207711_100000011174 362
1525 3300025949 Ga0207667_10150877 Ga0207667_101508771 362
1526 3300025986 Ga0207658_10217747 Ga0207658_102177472 362
1527 3300026067 Ga0207678_10087885 Ga0207678_100878852 362
1528 3300026075 Ga0207708_10103915 Ga0207708_101039153 362
1529 3300026078 Ga0207702_10000007 Ga0207702_100000074 362
1530 3300026078 Ga0207702_10093888 Ga0207702_100938882 362
1531 3300026121 Ga0207683_10029203 Ga0207683_100292034 362
1532 3300028577 Ga0265318_10000549 Ga0265318_1000054915 362
1533 3300028800 Ga0265338_10048903 Ga0265338_100489031 362
1534 3300028800 Ga0265338_10064900 Ga0265338_100649004 362
1535 3300028800 Ga0265338_10106398 Ga0265338_101063982 362
1536 3300028800 Ga0265338_10145943 Ga0265338_101459432 362
1537 3300031235 Ga0265330_10013726 Ga0265330_100137262 362
1538 3300031240 Ga0265320_10001230 Ga0265320_100012301 362
1539 3300031241 Ga0265325_10001987 Ga0265325_1000198710 362
1540 3300031241 Ga0265325_10014291 Ga0265325_100142914 362
1541 3300031241 Ga0265325_10016465 Ga0265325_100164651 362
1542 3300031241 Ga0265325_10021893 Ga0265325_100218932 362
1543 3300031247 Ga0265340_10000808 Ga0265340_100008085 362
1544 3300031247 Ga0265340_10025771 Ga0265340_100257711 362
1545 3300031249 Ga0265339_10000614 Ga0265339_1000061419 362
1546 3300031249 Ga0265339_10048243 Ga0265339_100482432 362
1547 3300031250 Ga0265331_10003350 Ga0265331_100033502 362
1548 3300031251 Ga0265327_10000007 Ga0265327_10000007223 362
1549 3300031344 Ga0265316_10066710 Ga0265316_100667101 362
1550 3300031344 Ga0265316_10095744 Ga0265316_100957442 362
1551 3300031548 Ga0307408_100180528 Ga0307408_1001805282 362
1552 3300031595 Ga0265313_10000063 Ga0265313_1000006388 362
1553 3300031595 Ga0265313_10004977 Ga0265313_100049772 362
1554 3300031595 Ga0265313_10043531 Ga0265313_100435311 362
1555 3300031711 Ga0265314_10012781 Ga0265314_100127814 362
1556 3300031711 Ga0265314_10015443 Ga0265314_100154436 362
1557 3300031711 Ga0265314_10015954 Ga0265314_100159541 362
1558 3300031711 Ga0265314_10152312 Ga0265314_101523121 362
1559 3300031712 Ga0265342_10018201 Ga0265342_100182015 362
1560 3300031712 Ga0265342_10062762 Ga0265342_100627622 362
1561 3300031901 Ga0307406_10091641 Ga0307406_100916411 362
1562 3300031903 Ga0307407_10029304 Ga0307407_100293042 362
1563 3300035112 Ga0373932_0007894 Ga0373932_0007894_1336_2484 362
1564 3300035695 Ga0373927_0127373 Ga0373927_0127373_60_1154 362
1565 3300037068 Ga0373925_0113412 Ga0373925_0113412_86_1252 362
1566 3300037312 Ga0395899_0032205 Ga0395899_0032205_1449_2558 362
1567 3300037466 Ga0395898_0095050 Ga0395898_0095050_1271_2380 362
1568 3300037471 Ga0395905_0040553 Ga0395905_0040553_325_1416 362
1569 3300038443 Ga0395901_0134671 Ga0395901_0134671_736_1845 362
1570 3300039437 Ga0436365_0841916 Ga0436365_0841916_1039_2181 362
1571 3300039437 Ga0436365_1751730 Ga0436365_1751730_3047_4207 362
1572 3300039450 Ga0436363_1405260 Ga0436363_1405260_5321_6472 362
1573 3300045051 Ga0451576_0028696 Ga0451576_0028696_718_1821 362
1574 3300046543 Ga0495645_0006679 Ga0495645_0006679_6576_7730 362
1575 3300049568 Ga0501031_0005866 Ga0501031_0005866_6541_7641 362
1576 3300049569 Ga0501032_0000001 Ga0501032_0000001_410837_411937 362
1577 3300049570 Ga0501033_0000830 Ga0501033_0000830_1472_2572 362
1578 3300049570 Ga0501033_0004882 Ga0501033_0004882_9448_10605 362
1579 3300049570 Ga0501033_0081561 Ga0501033_0081561_1039_2148 362
1580 3300049571 Ga0501034_0000036 Ga0501034_0000036_9172_10272 362
1581 3300049571 Ga0501034_0456782 Ga0501034_0456782_53_1162 362
1582 3300049572 Ga0501036_0009263 Ga0501036_0009263_2880_3980 362
1583 3300049573 Ga0501037_0000017 Ga0501037_0000017_155028_156128 362
1584 3300049573 Ga0501037_0005653 Ga0501037_0005653_7069_8214 362
1585 3300049574 Ga0501038_0000036 Ga0501038_0000036_32336_33436 362
1586 3300049574 Ga0501038_0250123 Ga0501038_0250123_115_1260 362
1587 3300049575 Ga0501039_0000011 Ga0501039_0000011_11621_12721 362
1588 3300049579 Ga0501043_0000105 Ga0501043_0000105_66786_67886 362
1589 3300049579 Ga0501043_0044072 Ga0501043_0044072_2328_3473 362
1590 3300049579 Ga0501043_0131128 Ga0501043_0131128_776_1909 362
1591 3300049580 Ga0501046_0023228 Ga0501046_0023228_1987_3138 362
1592 3300049581 Ga0501047_0004095 Ga0501047_0004095_5838_6995 362
1593 3300049585 Ga0501069_0028278 Ga0501069_0028278_1276_2421 362
1594 3300049586 Ga0501070_0000031 Ga0501070_0000031_80663_81808 362
1595 3300049586 Ga0501070_0018187 Ga0501070_0018187_534_1697 362
1596 3300049586 Ga0501070_0215017 Ga0501070_0215017_216_1361 362
1597 3300049742 Ga0501080_0001044 Ga0501080_0001044_16952_18097 362
1598 3300049822 Ga0501035_0000028 Ga0501035_0000028_9298_10398 362
1599 3300049822 Ga0501035_0000947 Ga0501035_0000947_7388_8533 362
1600 3300049822 Ga0501035_0020935 Ga0501035_0020935_228_1370 362
1601 3300049822 Ga0501035_0046065 Ga0501035_0046065_2295_3440 362
1602 3300049823 Ga0501044_0005402 Ga0501044_0005402_12904_14046 362
1603 3300049823 Ga0501044_0020003 Ga0501044_0020003_481_1638 362
1604 3300049823 Ga0501044_0036997 Ga0501044_0036997_1809_2954 362
1605 3300049823 Ga0501044_0093374 Ga0501044_0093374_1704_2837 362
1606 3300049823 Ga0501044_0242873 Ga0501044_0242873_171_1337 362
1607 3300049823 Ga0501044_0278998 Ga0501044_0278998_80_1222 362
1608 3300050512 nmdc:mga0n895_25596_c1 nmdc:mga0n895_25596_c1_2247_3395 362
1609 3300050512 nmdc:mga0n895_54049_c1 nmdc:mga0n895_54049_c1_1910_3055 362
1610 3300050513 nmdc:mga0rr50_177401_c1 nmdc:mga0rr50_177401_c1_65_1210 362
1611 3300050514 nmdc:mga08x19_2193_c1 nmdc:mga08x19_2193_c1_6718_7863 362
1612 3300053133 Ga0500655_008905 Ga0500655_008905_614_1756 362
1613 3300053163 Ga0500639_103872 Ga0500639_103872_245_1378 362
1614 iso_pu_bacteria 2508501123 2509117838 362
1615 iso_pu_bacteria 2513237094 2513641818 362
1616 iso_pu_bacteria 2513237098 2513673059 362
1617 iso_pu_bacteria 2513237101 2513694823 362
1618 iso_pu_bacteria 2513237104 2513715604 362
1619 iso_pu_bacteria 2513237141 2513889766 362
1620 iso_pu_bacteria 2513237161 2514016390 362
1621 iso_pu_bacteria 2517093001 2517106951 362
1622 iso_pu_bacteria 2524023205 2524435646 362
1623 iso_pu_bacteria 2600255279 2601609298 362
1624 iso_pu_bacteria 2600255308 2601746073 362
1625 iso_pu_bacteria 2602042107 2603858122 362
1626 iso_pu_bacteria 2643221651 2644290062 362
1627 iso_pu_bacteria 2721755755 2723842121 362
1628 iso_pu_bacteria 2728368998 2728753814 362
1629 iso_pu_bacteria 2744054633 2745079913 362
1630 iso_pu_bacteria 2791355199 2793083730 362
1631 iso_pu_bacteria 2824600985 2824608667 362
1632 iso_pu_bacteria 2824609381 2824612744 362
1633 iso_pu_bacteria 2824617872 2824624042 362
1634 iso_pu_bacteria 2824626560 2824632710 362
1635 iso_pu_bacteria 2824635225 2824639598 362
1636 iso_pu_bacteria 2824644064 2824648688 362
1637 iso_pu_bacteria 2824653114 2824659013 362
1638 iso_pu_bacteria 2824661429 2824663565 362
1639 iso_pu_bacteria 2824671348 2824677898 362
1640 iso_pu_bacteria 2824679649 2824685405 362
1641 iso_pu_bacteria 2824687955 2824694600 362
1642 iso_pu_bacteria 2824696289 2824702784 362
1643 iso_pu_bacteria 2824704595 2824713605 362
1644 iso_pu_bacteria 2824714736 2824720930 362
1645 iso_pu_bacteria 2824723954 2824728950 362
1646 iso_pu_bacteria 2824732956 2824736932 362
1647 iso_pu_bacteria 2824746037 2824748224 362
1648 iso_pu_bacteria 2824753945 2824760621 362
1649 iso_pu_bacteria 2824763712 2824772012 362
1650 iso_pu_bacteria 2838122688 2838129454 362
1651 iso_pu_bacteria 2841941048 2841944355 362
1652 iso_pu_bacteria 2841949485 2841954468 362
1653 iso_pu_bacteria 2841957949 2841965984 362
1654 iso_pu_bacteria 2841966195 2841969132 362
1655 iso_pu_bacteria 2841974524 2841979906 362
1656 iso_pu_bacteria 2841983080 2841990913 362
1657 iso_pu_bacteria 2842038055 2842043986 362
1658 iso_pu_bacteria 2842045827 2842052025 362
1659 iso_pu_bacteria 2842698319 2842701100 362
1660 iso_pu_bacteria 2844315083 2844321734 362
1661 iso_pu_bacteria 2847930680 2847939698 362
1662 iso_pu_bacteria 2847939898 2847941651 362
1663 iso_pu_bacteria 2849076700 2849082574 362
1664 iso_pu_bacteria 2857509624 2857511469 362
1665 iso_pu_bacteria 2857524615 2857527509 362
1666 iso_pu_bacteria 2874590934 2874594289 362
1667 iso_pu_bacteria 2874604998 2874610264 362
1668 iso_pu_bacteria 2874612657 2874615547 362
1669 iso_pu_bacteria 2874620515 2874624329 362
1670 iso_pu_bacteria 2874628541 2874634091 362
1671 iso_pu_bacteria 2874645413 2874647715 362
1672 iso_pu_bacteria 2876761206 2876770082 362
1673 iso_pu_bacteria 2876771140 2876772597 362
1674 iso_pu_bacteria 2876818435 2876819858 362
1675 iso_pu_bacteria 2879074833 2879076364 362
1676 iso_pu_bacteria 2879083081 2879090499 362
1677 iso_pu_bacteria 2879099564 2879101840 362
1678 iso_pu_bacteria 2879110137 2879111570 362
1679 iso_pu_bacteria 2879127579 2879130681 362
1680 iso_pu_bacteria 2879142872 2879143137 362
1681 iso_pu_bacteria 2881364244 2881364995 362
1682 iso_pu_bacteria 2881665667 2881673627 362
1683 iso_pu_bacteria 2885366525 2885368098 362
1684 iso_pu_bacteria 2885383462 2885384620 362
1685 iso_pu_bacteria 2885409591 2885410894 362
1686 iso_pu_bacteria 2888378607 2888380067 362
1687 iso_pu_bacteria 2888388044 2888391127 362
1688 iso_pu_bacteria 2888419890 2888420871 362
1689 iso_pu_bacteria 2889033259 2889034962 362
1690 iso_pu_bacteria 2893066018 2893067001 362
1691 iso_pu_bacteria 2903727486 2903727720 362
1692 iso_pu_bacteria 2903768456 2903775387 362
1693 iso_pu_bacteria 2904666416 2904672332 362
1694 iso_pu_bacteria 2904711408 2904717916 362
1695 iso_pu_bacteria 2906602504 2906602794 362
1696 iso_pu_bacteria 2906626472 2906631320 362
1697 iso_pu_bacteria 2906643746 2906645036 362
1698 iso_pu_bacteria 2908775508 2908776702 362
1699 iso_pu_bacteria 2919073203 2919073359 362
1700 iso_pu_bacteria 2922361189 2922366865 362
1701 iso_pu_bacteria 2922368715 2922378450 362
1702 iso_pu_bacteria 2922393267 2922400262 362
1703 iso_pu_bacteria 2929615660 2929622449 362
1704 iso_pu_bacteria 2929624759 2929631333 362
1705 iso_pu_bacteria 2933577622 2933584471 362
1706 iso_pu_bacteria 2933594066 2933594435 362
1707 iso_pu_bacteria 2935608549 2935615048 362
1708 iso_pu_bacteria 2935703347 2935707168 362
1709 iso_pu_bacteria 2935769743 2935772864 362
1710 iso_pu_bacteria 2935777560 2935778000 362
1711 iso_pu_bacteria 2935785616 2935787227 362
1712 iso_pu_bacteria 2935793552 2935795985 362
1713 iso_pu_bacteria 2935819856 2935825914 362
1714 iso_pu_bacteria 2935847175 2935851533 362
1715 iso_pu_bacteria 2935926038 2935927643 362
1716 iso_pu_bacteria 2935934488 2935936485 362
1717 iso_pu_bacteria 2935942939 2935943962 362
1718 iso_pu_bacteria 2935951376 2935952399 362
1719 iso_pu_bacteria 2935959822 2935964240 362
1720 iso_pu_bacteria 2941531003 2941532264 362
1721 iso_pu_bacteria 3005474847 3005475688 362
1722 iso_pu_bacteria 8006926726 8006927656 362
1723 iso_pu_bacteria 8006964411 8006966461 362
1724 iso_pu_bacteria 8006984368 8006988607 362
1725 iso_pu_bacteria 8006994254 8006997122 362
1726 iso_pu_bacteria 8016522445 8016526699 362
1727 iso_pu_bacteria 8016530956 8016531783 362
1728 iso_pu_bacteria 8016548790 8016557085 362
1729 iso_pu_bacteria 8016557553 8016565437 362
1730 iso_pu_bacteria 8016566248 8016570063 362
1731 iso_pu_bacteria 8016575299 8016582634 362
1732 iso_pu_bacteria 8016595262 8016603071 362
1733 iso_pu_bacteria 8016603502 8016605976 362
1734 iso_pu_bacteria 8016613128 8016617862 362
1735 iso_pu_bacteria 8019530166 8019531612 362
1736 iso_pu_bacteria 8019547302 8019550732 362
1737 iso_pu_bacteria 8055742211 8055750900 362
1738 iso_pu_bacteria 8056673599 8056679321 362
1739 iso_pu_bacteria 8056681323 8056681362 362
1740 iso_pu_bacteria 8056967851 8056975584 362
1741 3300003214 JGI25165J46597_1000008 JGI25165J46597_1000008187 363
1742 3300005327 Ga0070658_10018855 Ga0070658_100188552 363
1743 3300005336 Ga0070680_100009595 Ga0070680_1000095954 363
1744 3300005337 Ga0070682_100004765 Ga0070682_1000047654 363
1745 3300005344 Ga0070661_100047545 Ga0070661_1000475452 363
1746 3300005364 Ga0070673_100007245 Ga0070673_1000072452 363
1747 3300005364 Ga0070673_100039899 Ga0070673_1000398992 363
1748 3300005366 Ga0070659_100031682 Ga0070659_1000316823 363
1749 3300005439 Ga0070711_100194670 Ga0070711_1001946701 363
1750 3300005439 Ga0070711_100252231 Ga0070711_1002522312 363
1751 3300005455 Ga0070663_100106719 Ga0070663_1001067192 363
1752 3300005456 Ga0070678_100113375 Ga0070678_1001133752 363
1753 3300005458 Ga0070681_10002902 Ga0070681_100029026 363
1754 3300005458 Ga0070681_10057211 Ga0070681_100572113 363
1755 3300005530 Ga0070679_100115768 Ga0070679_1001157682 363
1756 3300005536 Ga0070697_100007054 Ga0070697_1000070547 363
1757 3300005539 Ga0068853_100010013 Ga0068853_1000100134 363
1758 3300005539 Ga0068853_100249092 Ga0068853_1002490921 363
1759 3300005545 Ga0070695_100001125 Ga0070695_1000011252 363
1760 3300005547 Ga0070693_100011942 Ga0070693_1000119422 363
1761 3300005548 Ga0070665_100181527 Ga0070665_1001815272 363
1762 3300005563 Ga0068855_100061360 Ga0068855_1000613605 363
1763 3300005563 Ga0068855_100163974 Ga0068855_1001639742 363
1764 3300005577 Ga0068857_100020193 Ga0068857_1000201935 363
1765 3300005577 Ga0068857_100041296 Ga0068857_1000412962 363
1766 3300005614 Ga0068856_100080662 Ga0068856_1000806622 363
1767 3300005614 Ga0068856_100118702 Ga0068856_1001187023 363
1768 3300005616 Ga0068852_100292331 Ga0068852_1002923312 363
1769 3300005983 Ga0081540_1004650 Ga0081540_10046502 363
1770 3300006028 Ga0070717_10083274 Ga0070717_100832741 363
1771 3300006237 Ga0097621_100093368 Ga0097621_1000933683 363
1772 3300006914 Ga0075436_100002075 Ga0075436_1000020752 363
1773 3300007076 Ga0075435_100007241 Ga0075435_1000072417 363
1774 3300009093 Ga0105240_10293692 Ga0105240_102936922 363
1775 3300009093 Ga0105240_10365347 Ga0105240_103653472 363
1776 3300009545 Ga0105237_10000609 Ga0105237_1000060917 363
1777 3300009545 Ga0105237_10123463 Ga0105237_101234632 363
1778 3300009551 Ga0105238_10052112 Ga0105238_100521122 363
1779 3300009551 Ga0105238_10341904 Ga0105238_103419041 363
1780 3300010375 Ga0105239_10007900 Ga0105239_100079002 363
1781 3300010375 Ga0105239_10070177 Ga0105239_100701774 363
1782 3300010375 Ga0105239_10092070 Ga0105239_100920702 363
1783 3300011119 Ga0105246_10041896 Ga0105246_100418963 363
1784 3300013100 Ga0157373_10008938 Ga0157373_100089386 363
1785 3300013104 Ga0157370_10014696 Ga0157370_100146966 363
1786 3300013105 Ga0157369_10011642 Ga0157369_100116424 363
1787 3300013297 Ga0157378_10140119 Ga0157378_101401192 363
1788 3300013306 Ga0163162_10217030 Ga0163162_102170302 363
1789 3300013306 Ga0163162_10319613 Ga0163162_103196131 363
1790 3300013307 Ga0157372_10485852 Ga0157372_104858521 363
1791 3300014325 Ga0163163_10000016 Ga0163163_10000016154 363
1792 3300014968 Ga0157379_10008135 Ga0157379_100081357 363
1793 3300021377 Ga0213874_10003946 Ga0213874_100039462 363
1794 3300021384 Ga0213876_10000162 Ga0213876_1000016233 363
1795 3300025261 Ga0209233_1000006 Ga0209233_10000061133 363
1796 3300025261 Ga0209233_1000347 Ga0209233_100034725 363
1797 3300025297 Ga0209758_1000032 Ga0209758_1000032264 363
1798 3300025909 Ga0207705_10015487 Ga0207705_100154875 363
1799 3300025912 Ga0207707_10021722 Ga0207707_100217223 363
1800 3300025912 Ga0207707_10025948 Ga0207707_100259486 363
1801 3300025912 Ga0207707_10076679 Ga0207707_100766792 363
1802 3300025914 Ga0207671_10000368 Ga0207671_1000036833 363
1803 3300025915 Ga0207693_10049973 Ga0207693_100499732 363
1804 3300025919 Ga0207657_10007287 Ga0207657_100072874 363
1805 3300025919 Ga0207657_10007912 Ga0207657_100079125 363
1806 3300025919 Ga0207657_10113800 Ga0207657_101138002 363
1807 3300025921 Ga0207652_10019464 Ga0207652_100194645 363
1808 3300025921 Ga0207652_10023401 Ga0207652_100234012 363
1809 3300025921 Ga0207652_10082331 Ga0207652_100823312 363
1810 3300025924 Ga0207694_10215102 Ga0207694_102151022 363
1811 3300025933 Ga0207706_10023730 Ga0207706_100237302 363
1812 3300025942 Ga0207689_10022709 Ga0207689_100227092 363
1813 3300025949 Ga0207667_10027939 Ga0207667_100279393 363
1814 3300025949 Ga0207667_10249845 Ga0207667_102498452 363
1815 3300026041 Ga0207639_10020276 Ga0207639_100202764 363
1816 3300026041 Ga0207639_10100102 Ga0207639_101001022 363
1817 3300026078 Ga0207702_10084880 Ga0207702_100848802 363
1818 3300026078 Ga0207702_10188967 Ga0207702_101889672 363
1819 3300026089 Ga0207648_10018074 Ga0207648_100180743 363
1820 3300026116 Ga0207674_10026278 Ga0207674_100262785 363
1821 3300026121 Ga0207683_10126281 Ga0207683_101262812 363
1822 3300028379 Ga0268266_10000243 Ga0268266_1000024345 363
1823 3300028379 Ga0268266_10092650 Ga0268266_100926502 363
1824 3300028380 Ga0268265_10309018 Ga0268265_103090182 363
1825 3300028800 Ga0265338_10028582 Ga0265338_100285822 363
1826 3300028800 Ga0265338_10066631 Ga0265338_100666312 363
1827 3300030760 Ga0265762_1001119 Ga0265762_10011192 363
1828 3300031235 Ga0265330_10018400 Ga0265330_100184005 363
1829 3300031238 Ga0265332_10017966 Ga0265332_100179662 363
1830 3300031247 Ga0265340_10006730 Ga0265340_100067303 363
1831 3300031247 Ga0265340_10072523 Ga0265340_100725231 363
1832 3300031249 Ga0265339_10031564 Ga0265339_100315642 363
1833 3300031250 Ga0265331_10004328 Ga0265331_100043284 363
1834 3300031251 Ga0265327_10084692 Ga0265327_100846922 363
1835 3300031344 Ga0265316_10058171 Ga0265316_100581712 363
1836 3300031711 Ga0265314_10005936 Ga0265314_100059362 363
1837 3300031711 Ga0265314_10030441 Ga0265314_100304412 363
1838 3300031711 Ga0265314_10100685 Ga0265314_101006852 363
1839 3300032004 Ga0307414_10056905 Ga0307414_100569053 363
1840 3300033180 Ga0307510_10183088 Ga0307510_101830882 363
1841 3300035088 Ga0373940_0038867 Ga0373940_0038867_137_1279 363
1842 3300035724 Ga0373933_0209498 Ga0373933_0209498_41_1135 363
1843 3300037418 Ga0395900_0011657 Ga0395900_0011657_3446_4558 363
1844 3300037853 Ga0436364_0309458 Ga0436364_0309458_299_1453 363
1845 3300037853 Ga0436364_0312684 Ga0436364_0312684_740_1840 363
1846 3300039437 Ga0436365_0569849 Ga0436365_0569849_1544_2668 363
1847 3300039437 Ga0436365_0879719 Ga0436365_0879719_576_1673 363
1848 3300039437 Ga0436365_1168772 Ga0436365_1168772_133130_134296 363
1849 3300039437 Ga0436365_1478396 Ga0436365_1478396_180_1355 363
1850 3300039438 Ga0436360_0019097 Ga0436360_0019097_1986_3083 363
1851 3300039447 Ga0436361_0893904 Ga0436361_0893904_135_1328 363
1852 3300039447 Ga0436361_1079345 Ga0436361_1079345_264_1412 363
1853 3300039450 Ga0436363_1033365 Ga0436363_1033365_9154_10329 363
1854 3300039450 Ga0436363_1666906 Ga0436363_1666906_1325_2515 363
1855 3300045049 Ga0466959_0180155 Ga0466959_0180155_130_1320 363
1856 3300046507 Ga0495606_0037919 Ga0495606_0037919_188_1327 363
1857 3300046559 Ga0495667_0165008 Ga0495667_0165008_287_1384 363
1858 3300047319 Ga0495674_0090317 Ga0495674_0090317_520_1617 363
1859 3300047470 Ga0495681_0094511 Ga0495681_0094511_82_1233 363
1860 3300047471 Ga0495684_0083481 Ga0495684_0083481_800_1897 363
1861 3300048907 Ga0496104_0052803 Ga0496104_0052803_2302_3402 363
1862 3300048915 Ga0496112_0090328 Ga0496112_0090328_1037_2137 363
1863 3300048918 Ga0496115_0250613 Ga0496115_0250613_134_1234 363
1864 3300048929 Ga0496126_0000406 Ga0496126_0000406_61534_62679 363
1865 3300049569 Ga0501032_0140369 Ga0501032_0140369_24_1148 363
1866 3300049569 Ga0501032_0237890 Ga0501032_0237890_48_1160 363
1867 3300049570 Ga0501033_0000230 Ga0501033_0000230_24912_26066 363
1868 3300049570 Ga0501033_0019512 Ga0501033_0019512_3337_4500 363
1869 3300049570 Ga0501033_0022248 Ga0501033_0022248_1696_2808 363
1870 3300049570 Ga0501033_0179206 Ga0501033_0179206_132_1265 363
1871 3300049571 Ga0501034_0002063 Ga0501034_0002063_3758_4870 363
1872 3300049572 Ga0501036_0022933 Ga0501036_0022933_3814_4977 363
1873 3300049573 Ga0501037_0000168 Ga0501037_0000168_33709_34863 363
1874 3300049573 Ga0501037_0035626 Ga0501037_0035626_1713_2876 363
1875 3300049579 Ga0501043_0000005 Ga0501043_0000005_137573_138727 363
1876 3300049579 Ga0501043_0029255 Ga0501043_0029255_479_1600 363
1877 3300049579 Ga0501043_0110782 Ga0501043_0110782_428_1591 363
1878 3300049580 Ga0501046_0041200 Ga0501046_0041200_1609_2721 363
1879 3300049580 Ga0501046_0092649 Ga0501046_0092649_926_2023 363
1880 3300049581 Ga0501047_0015068 Ga0501047_0015068_3643_4806 363
1881 3300049581 Ga0501047_0073578 Ga0501047_0073578_535_1689 363
1882 3300049581 Ga0501047_0121207 Ga0501047_0121207_1089_2201 363
1883 3300049581 Ga0501047_0124409 Ga0501047_0124409_732_1886 363
1884 3300049581 Ga0501047_0232755 Ga0501047_0232755_481_1605 363
1885 3300049582 Ga0501048_0160784 Ga0501048_0160784_140_1288 363
1886 3300049583 Ga0501067_0064647 Ga0501067_0064647_875_2014 363
1887 3300049585 Ga0501069_0000011 Ga0501069_0000011_132884_134038 363
1888 3300049586 Ga0501070_0000055 Ga0501070_0000055_67527_68681 363
1889 3300049586 Ga0501070_0006547 Ga0501070_0006547_8359_9483 363
1890 3300049586 Ga0501070_0011687 Ga0501070_0011687_6191_7303 363
1891 3300049586 Ga0501070_0069113 Ga0501070_0069113_832_1929 363
1892 3300049586 Ga0501070_0090375 Ga0501070_0090375_370_1482 363
1893 3300049586 Ga0501070_0241222 Ga0501070_0241222_83_1207 363
1894 3300049587 Ga0501071_0004100 Ga0501071_0004100_768_1922 363
1895 3300049589 Ga0501073_0005414 Ga0501073_0005414_4727_5881 363
1896 3300049589 Ga0501073_0008803 Ga0501073_0008803_6226_7347 363
1897 3300049589 Ga0501073_0022155 Ga0501073_0022155_1350_2489 363
1898 3300049590 Ga0501074_0000039 Ga0501074_0000039_35462_36616 363
1899 3300049590 Ga0501074_0140812 Ga0501074_0140812_308_1432 363
1900 3300049742 Ga0501080_0000217 Ga0501080_0000217_34242_35396 363
1901 3300049742 Ga0501080_0008361 Ga0501080_0008361_6176_7300 363
1902 3300049742 Ga0501080_0015456 Ga0501080_0015456_323_1420 363
1903 3300049742 Ga0501080_0184075 Ga0501080_0184075_167_1264 363
1904 3300049744 Ga0501083_0000180 Ga0501083_0000180_31235_32389 363
1905 3300049744 Ga0501083_0080105 Ga0501083_0080105_791_1912 363
1906 3300049822 Ga0501035_0000938 Ga0501035_0000938_90_1244 363
1907 3300049822 Ga0501035_0015209 Ga0501035_0015209_4941_6065 363
1908 3300049822 Ga0501035_0034174 Ga0501035_0034174_1446_2558 363
1909 3300049822 Ga0501035_0069023 Ga0501035_0069023_1785_2909 363
1910 3300049822 Ga0501035_0175538 Ga0501035_0175538_681_1793 363
1911 3300049823 Ga0501044_0001322 Ga0501044_0001322_70_1224 363
1912 3300049823 Ga0501044_0054087 Ga0501044_0054087_667_1779 363
1913 3300050492 nmdc:mga0yw44_26119_c1 nmdc:mga0yw44_26119_c1_605_1705 363
1914 3300050513 nmdc:mga0rr50_60622_c1 nmdc:mga0rr50_60622_c1_1422_2546 363
1915 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_237682_238806 363
1916 3300053078 Ga0495612_0050873 Ga0495612_0050873_292_1389 363
1917 3300053087 Ga0500643_000008 Ga0500643_000008_248346_249503 363
1918 3300053119 Ga0500595_003128 Ga0500595_003128_119_1279 363
1919 3300053119 Ga0500595_003651 Ga0500595_003651_5504_6640 363
1920 3300053139 Ga0500568_0000211 Ga0500568_0000211_7741_8841 363
1921 3300053140 Ga0500573_0000028 Ga0500573_0000028_47163_48305 363
1922 3300054114 Ga0501084_0156837 Ga0501084_0156837_695_1807 363
1923 iso_pu_bacteria 2757320392 2757569186 363
1924 iso_pu_bacteria 2919450847 2919454748 363
1925 iso_pu_bacteria 8001845381 8001850370 363
1926 3300005327 Ga0070658_10017911 Ga0070658_100179112 364
1927 3300005336 Ga0070680_100080661 Ga0070680_1000806611 364
1928 3300005339 Ga0070660_100041455 Ga0070660_1000414552 364
1929 3300005367 Ga0070667_100136030 Ga0070667_1001360302 364
1930 3300005434 Ga0070709_10095435 Ga0070709_100954351 364
1931 3300005436 Ga0070713_100235813 Ga0070713_1002358131 364
1932 3300005445 Ga0070708_100001838 Ga0070708_1000018389 364
1933 3300005445 Ga0070708_100041588 Ga0070708_1000415882 364
1934 3300005458 Ga0070681_10032008 Ga0070681_100320082 364
1935 3300005467 Ga0070706_100006876 Ga0070706_1000068763 364
1936 3300005467 Ga0070706_100053048 Ga0070706_1000530482 364
1937 3300005468 Ga0070707_100000816 Ga0070707_10000081614 364
1938 3300005471 Ga0070698_100001667 Ga0070698_10000166722 364
1939 3300005518 Ga0070699_100001000 Ga0070699_10000100016 364
1940 3300005530 Ga0070679_100042239 Ga0070679_1000422392 364
1941 3300005530 Ga0070679_100154678 Ga0070679_1001546782 364
1942 3300005536 Ga0070697_100001374 Ga0070697_10000137410 364
1943 3300005545 Ga0070695_100039776 Ga0070695_1000397762 364
1944 3300005546 Ga0070696_100000661 Ga0070696_1000006615 364
1945 3300005547 Ga0070693_100059190 Ga0070693_1000591902 364
1946 3300005548 Ga0070665_100001523 Ga0070665_1000015234 364
1947 3300005548 Ga0070665_100039789 Ga0070665_1000397894 364
1948 3300005563 Ga0068855_100013526 Ga0068855_1000135264 364
1949 3300005614 Ga0068856_100189629 Ga0068856_1001896292 364
1950 3300005614 Ga0068856_100270957 Ga0068856_1002709572 364
1951 3300005616 Ga0068852_100092017 Ga0068852_1000920173 364
1952 3300005617 Ga0068859_100089332 Ga0068859_1000893322 364
1953 3300005618 Ga0068864_100136675 Ga0068864_1001366751 364
1954 3300005719 Ga0068861_100022277 Ga0068861_1000222772 364
1955 3300005842 Ga0068858_100069324 Ga0068858_1000693242 364
1956 3300005842 Ga0068858_100380991 Ga0068858_1003809912 364
1957 3300006028 Ga0070717_10000871 Ga0070717_1000087120 364
1958 3300006051 Ga0075364_10130075 Ga0075364_101300752 364
1959 3300006178 Ga0075367_10002265 Ga0075367_100022658 364
1960 3300006186 Ga0075369_10025048 Ga0075369_100250482 364
1961 3300006237 Ga0097621_100003326 Ga0097621_1000033265 364
1962 3300006237 Ga0097621_100167296 Ga0097621_1001672961 364
1963 3300006358 Ga0068871_100000061 Ga0068871_10000006144 364
1964 3300006358 Ga0068871_100017658 Ga0068871_1000176585 364
1965 3300006871 Ga0075434_100107052 Ga0075434_1001070523 364
1966 3300006871 Ga0075434_100143083 Ga0075434_1001430833 364
1967 3300006871 Ga0075434_100267257 Ga0075434_1002672572 364
1968 3300006881 Ga0068865_100137427 Ga0068865_1001374272 364
1969 3300006914 Ga0075436_100035085 Ga0075436_1000350853 364
1970 3300006931 Ga0097620_100089333 Ga0097620_1000893333 364
1971 3300007076 Ga0075435_100315049 Ga0075435_1003150491 364
1972 3300007788 Ga0099795_10028222 Ga0099795_100282222 364
1973 3300009093 Ga0105240_10089708 Ga0105240_100897081 364
1974 3300009093 Ga0105240_10226031 Ga0105240_102260312 364
1975 3300009093 Ga0105240_10338669 Ga0105240_103386691 364
1976 3300009093 Ga0105240_10357197 Ga0105240_103571971 364
1977 3300009093 Ga0105240_10360871 Ga0105240_103608712 364
1978 3300009174 Ga0105241_10076564 Ga0105241_100765643 364
1979 3300009176 Ga0105242_10044318 Ga0105242_100443182 364
1980 3300009177 Ga0105248_10003976 Ga0105248_100039762 364
1981 3300009553 Ga0105249_10010582 Ga0105249_100105827 364
1982 3300009553 Ga0105249_10015216 Ga0105249_100152162 364
1983 3300014325 Ga0163163_10145640 Ga0163163_101456402 364
1984 3300014326 Ga0157380_10188800 Ga0157380_101888002 364
1985 3300014968 Ga0157379_10070553 Ga0157379_100705533 364
1986 3300014968 Ga0157379_10138901 Ga0157379_101389013 364
1987 3300014969 Ga0157376_10012407 Ga0157376_100124072 364
1988 3300017792 Ga0163161_10053334 Ga0163161_100533342 364
1989 3300025261 Ga0209233_1001513 Ga0209233_10015133 364
1990 3300025903 Ga0207680_10021195 Ga0207680_100211953 364
1991 3300025903 Ga0207680_10155174 Ga0207680_101551742 364
1992 3300025909 Ga0207705_10097660 Ga0207705_100976602 364
1993 3300025910 Ga0207684_10000940 Ga0207684_1000094024 364
1994 3300025910 Ga0207684_10043573 Ga0207684_100435735 364
1995 3300025911 Ga0207654_10042061 Ga0207654_100420612 364
1996 3300025913 Ga0207695_10012494 Ga0207695_100124943 364
1997 3300025914 Ga0207671_10053437 Ga0207671_100534372 364
1998 3300025917 Ga0207660_10222624 Ga0207660_102226241 364
1999 3300025919 Ga0207657_10006720 Ga0207657_100067205 364
2000 3300025921 Ga0207652_10030322 Ga0207652_100303222 364
2001 3300025921 Ga0207652_10044187 Ga0207652_100441873 364
2002 3300025922 Ga0207646_10001375 Ga0207646_1000137522 364
2003 3300025924 Ga0207694_10071185 Ga0207694_100711852 364
2004 3300025925 Ga0207650_10081358 Ga0207650_100813582 364
2005 3300025934 Ga0207686_10019901 Ga0207686_100199012 364
2006 3300025939 Ga0207665_10108718 Ga0207665_101087181 364
2007 3300025941 Ga0207711_10024942 Ga0207711_100249423 364
2008 3300025942 Ga0207689_10075138 Ga0207689_100751382 364
2009 3300025961 Ga0207712_10007235 Ga0207712_100072357 364
2010 3300025961 Ga0207712_10010612 Ga0207712_100106125 364
2011 3300026035 Ga0207703_10066189 Ga0207703_100661894 364
2012 3300026035 Ga0207703_10072186 Ga0207703_100721862 364
2013 3300026035 Ga0207703_10360406 Ga0207703_103604061 364
2014 3300026078 Ga0207702_10031870 Ga0207702_100318703 364
2015 3300026088 Ga0207641_10003773 Ga0207641_100037737 364
2016 3300026089 Ga0207648_10040603 Ga0207648_100406033 364
2017 3300026118 Ga0207675_100169149 Ga0207675_1001691492 364
2018 3300026142 Ga0207698_10075079 Ga0207698_100750793 364
2019 3300028379 Ga0268266_10000635 Ga0268266_1000063534 364
2020 3300028379 Ga0268266_10009639 Ga0268266_100096394 364
2021 3300028379 Ga0268266_10018676 Ga0268266_100186763 364
2022 3300028379 Ga0268266_10099918 Ga0268266_100999182 364
2023 3300028381 Ga0268264_10075835 Ga0268264_100758352 364
2024 3300031090 Ga0265760_10005819 Ga0265760_100058192 364
2025 3300031730 Ga0307516_10016590 Ga0307516_100165901 364
2026 3300031730 Ga0307516_10032302 Ga0307516_100323023 364
2027 3300035111 Ga0373923_0005183 Ga0373923_0005183_3207_4307 364
2028 3300035113 Ga0373936_0000922 Ga0373936_0000922_8944_10044 364
2029 3300035116 Ga0373945_0005798 Ga0373945_0005798_29_1129 364
2030 3300035117 Ga0373953_0003384 Ga0373953_0003384_54_1154 364
2031 3300035118 Ga0373954_0004206 Ga0373954_0004206_746_1846 364
2032 3300035118 Ga0373954_0017135 Ga0373954_0017135_1589_2689 364
2033 3300035170 Ga0373943_0022496 Ga0373943_0022496_49_1149 364
2034 3300035171 Ga0373946_0001636 Ga0373946_0001636_1265_2365 364
2035 3300035398 Ga0316574_0000231 Ga0316574_0000231_16773_17870 364
2036 3300035410 Ga0373924_0000516 Ga0373924_0000516_55_1155 364
2037 3300035692 Ga0373935_0000097 Ga0373935_0000097_15285_16385 364
2038 3300035724 Ga0373933_0000820 Ga0373933_0000820_6886_7986 364
2039 3300035725 Ga0373947_0000353 Ga0373947_0000353_18066_19166 364
2040 3300036401 Ga0373937_0000006 Ga0373937_0000006_18327_19427 364
2041 3300037068 Ga0373925_0000002 Ga0373925_0000002_149903_151003 364
2042 3300041413 Ga0439465_0013429 Ga0439465_0013429_1244_2350 364
2043 3300045976 Ga0466967_0285145 Ga0466967_0285145_329_1429 364
2044 3300046454 Ga0495592_0000039 Ga0495592_0000039_23149_24249 364
2045 3300046459 Ga0495629_0012996 Ga0495629_0012996_4887_5987 364
2046 3300046462 Ga0495651_0002872 Ga0495651_0002872_5849_6949 364
2047 3300046463 Ga0495653_0000006 Ga0495653_0000006_150051_151151 364
2048 3300046476 Ga0495662_0032793 Ga0495662_0032793_1367_2467 364
2049 3300046477 Ga0495664_0000002 Ga0495664_0000002_185685_186785 364
2050 3300046511 Ga0495608_0000006 Ga0495608_0000006_27761_28861 364
2051 3300046514 Ga0495618_0000027 Ga0495618_0000027_35823_36923 364
2052 3300046516 Ga0495628_0000002 Ga0495628_0000002_150070_151170 364
2053 3300046517 Ga0495630_0003968 Ga0495630_0003968_922_2022 364
2054 3300046529 Ga0495652_0000004 Ga0495652_0000004_437713_438813 364
2055 3300046531 Ga0495665_0121427 Ga0495665_0121427_69_1169 364
2056 3300046533 Ga0495640_0000005 Ga0495640_0000005_293665_294765 364
2057 3300046536 Ga0495587_0000007 Ga0495587_0000007_23477_24577 364
2058 3300046543 Ga0495645_0000003 Ga0495645_0000003_131321_132421 364
2059 3300046557 Ga0495622_0005434 Ga0495622_0005434_2425_3600 364
2060 3300046559 Ga0495667_0000002 Ga0495667_0000002_286553_287653 364
2061 3300046663 Ga0495635_0000022 Ga0495635_0000022_120353_121453 364
2062 3300046675 Ga0495657_0000072 Ga0495657_0000072_28912_30012 364
2063 3300046678 Ga0495599_0000001 Ga0495599_0000001_288748_289848 364
2064 3300046679 Ga0495623_0000001 Ga0495623_0000001_57693_58793 364
2065 3300046680 Ga0495646_0000014 Ga0495646_0000014_52097_53197 364
2066 3300046809 Ga0495600_0000006 Ga0495600_0000006_19228_20328 364
2067 3300047317 Ga0495604_0000005 Ga0495604_0000005_175714_176814 364
2068 3300047319 Ga0495674_0000003 Ga0495674_0000003_410956_412056 364
2069 3300047322 Ga0495680_0001324 Ga0495680_0001324_10009_11109 364
2070 3300047444 Ga0495675_0000338 Ga0495675_0000338_18781_19881 364
2071 3300047471 Ga0495684_0000028 Ga0495684_0000028_99108_100208 364
2072 3300048088 Ga0495602_0000029 Ga0495602_0000029_131213_132313 364
2073 3300048915 Ga0496112_0018308 Ga0496112_0018308_1881_3023 364
2074 3300048924 Ga0496121_0003810 Ga0496121_0003810_6658_7812 364
2075 3300049570 Ga0501033_0064718 Ga0501033_0064718_496_1605 364
2076 3300049570 Ga0501033_0249176 Ga0501033_0249176_40_1173 364
2077 3300049571 Ga0501034_0073745 Ga0501034_0073745_649_1761 364
2078 3300049571 Ga0501034_0127860 Ga0501034_0127860_921_2030 364
2079 3300049572 Ga0501036_0037190 Ga0501036_0037190_2514_3623 364
2080 3300049574 Ga0501038_0037797 Ga0501038_0037797_810_1919 364
2081 3300049579 Ga0501043_0073242 Ga0501043_0073242_1086_2195 364
2082 3300049580 Ga0501046_0021790 Ga0501046_0021790_1660_2769 364
2083 3300049581 Ga0501047_0133998 Ga0501047_0133998_163_1272 364
2084 3300049586 Ga0501070_0128874 Ga0501070_0128874_507_1616 364
2085 3300049587 Ga0501071_0042246 Ga0501071_0042246_460_1569 364
2086 3300049588 Ga0501072_0213477 Ga0501072_0213477_239_1348 364
2087 3300049589 Ga0501073_0004806 Ga0501073_0004806_8416_9525 364
2088 3300049590 Ga0501074_0071048 Ga0501074_0071048_270_1379 364
2089 3300049742 Ga0501080_0060616 Ga0501080_0060616_355_1464 364
2090 3300049822 Ga0501035_0076326 Ga0501035_0076326_1359_2468 364
2091 3300049823 Ga0501044_0115422 Ga0501044_0115422_1086_2195 364
2092 3300049824 Ga0501045_0024541 Ga0501045_0024541_921_2030 364
2093 3300050490 nmdc:mga03n38_13020_c1 nmdc:mga03n38_13020_c1_996_2102 364
2094 3300050491 nmdc:mga00v17_100891_c1 nmdc:mga00v17_100891_c1_243_1349 364
2095 3300050512 nmdc:mga0n895_105910_c1 nmdc:mga0n895_105910_c1_661_1824 364
2096 3300050512 nmdc:mga0n895_19229_c1 nmdc:mga0n895_19229_c1_2480_3580 364
2097 3300050513 nmdc:mga0rr50_139941_c1 nmdc:mga0rr50_139941_c1_552_1661 364
2098 3300050513 nmdc:mga0rr50_303516_c1 nmdc:mga0rr50_303516_c1_66_1166 364
2099 3300050514 nmdc:mga08x19_34747_c1 nmdc:mga08x19_34747_c1_655_1812 364
2100 3300053077 Ga0495601_0000008 Ga0495601_0000008_171572_172672 364
2101 3300053078 Ga0495612_0000002 Ga0495612_0000002_61666_62766 364
2102 3300053083 Ga0495655_0012865 Ga0495655_0012865_361_1482 364
2103 3300053084 Ga0495595_0000008 Ga0495595_0000008_171700_172800 364
2104 3300053085 Ga0495619_0000002 Ga0495619_0000002_150073_151173 364
2105 3300053131 Ga0500652_000017 Ga0500652_000017_87424_88527 364
2106 3300053139 Ga0500568_0023379 Ga0500568_0023379_734_1837 364
2107 3300053151 Ga0500604_0029563 Ga0500604_0029563_394_1506 364
2108 3300053730 Ga0500645_008727 Ga0500645_008727_103_1278 364
2109 iso_pu_bacteria 2643221550 2643772254 364
2110 iso_pu_bacteria 2917554339 2917558379 364
2111 3300001977 JGI24746J21847_1001644 JGI24746J21847_10016442 365
2112 3300001979 JGI24740J21852_10026361 JGI24740J21852_100263612 365
2113 3300001989 JGI24739J22299_10003310 JGI24739J22299_100033103 365
2114 3300002070 JGI24750J21931_1001929 JGI24750J21931_10019292 365
2115 3300002073 JGI24745J21846_1000039 JGI24745J21846_10000397 365
2116 3300002155 JGI24033J26618_1000943 JGI24033J26618_10009432 365
2117 3300002459 JGI24751J29686_10000813 JGI24751J29686_100008135 365
2118 3300005290 Ga0065712_10071767 Ga0065712_100717671 365
2119 3300005293 Ga0065715_10089090 Ga0065715_100890901 365
2120 3300005327 Ga0070658_10090355 Ga0070658_100903553 365
2121 3300005330 Ga0070690_100002968 Ga0070690_1000029681 365
2122 3300005331 Ga0070670_100019485 Ga0070670_1000194856 365
2123 3300005333 Ga0070677_10000046 Ga0070677_1000004640 365
2124 3300005334 Ga0068869_100002768 Ga0068869_1000027689 365
2125 3300005335 Ga0070666_10003904 Ga0070666_100039046 365
2126 3300005337 Ga0070682_100057287 Ga0070682_1000572871 365
2127 3300005338 Ga0068868_100018435 Ga0068868_1000184351 365
2128 3300005338 Ga0068868_100276245 Ga0068868_1002762451 365
2129 3300005340 Ga0070689_100003866 Ga0070689_1000038662 365
2130 3300005341 Ga0070691_10002565 Ga0070691_100025652 365
2131 3300005345 Ga0070692_10000631 Ga0070692_1000063112 365
2132 3300005354 Ga0070675_100002649 Ga0070675_10000264914 365
2133 3300005355 Ga0070671_100003717 Ga0070671_1000037171 365
2134 3300005364 Ga0070673_100000632 Ga0070673_1000006322 365
2135 3300005364 Ga0070673_100155614 Ga0070673_1001556142 365
2136 3300005366 Ga0070659_100062130 Ga0070659_1000621302 365
2137 3300005367 Ga0070667_100119569 Ga0070667_1001195693 365
2138 3300005435 Ga0070714_100180622 Ga0070714_1001806221 365
2139 3300005436 Ga0070713_100246380 Ga0070713_1002463801 365
2140 3300005441 Ga0070700_100001202 Ga0070700_1000012029 365
2141 3300005445 Ga0070708_100076015 Ga0070708_1000760154 365
2142 3300005458 Ga0070681_10085272 Ga0070681_100852722 365
2143 3300005458 Ga0070681_10255850 Ga0070681_102558502 365
2144 3300005459 Ga0068867_100000619 Ga0068867_10000061918 365
2145 3300005466 Ga0070685_10000856 Ga0070685_100008563 365
2146 3300005468 Ga0070707_100012325 Ga0070707_1000123255 365
2147 3300005530 Ga0070679_100049786 Ga0070679_1000497862 365
2148 3300005530 Ga0070679_100073230 Ga0070679_1000732303 365
2149 3300005535 Ga0070684_100040007 Ga0070684_1000400074 365
2150 3300005544 Ga0070686_100000923 Ga0070686_1000009231 365
2151 3300005548 Ga0070665_100004139 Ga0070665_1000041394 365
2152 3300005549 Ga0070704_100030133 Ga0070704_1000301332 365
2153 3300005563 Ga0068855_100001552 Ga0068855_10000155210 365
2154 3300005563 Ga0068855_100072529 Ga0068855_1000725293 365
2155 3300005563 Ga0068855_100326385 Ga0068855_1003263852 365
2156 3300005577 Ga0068857_100007206 Ga0068857_10000720610 365
2157 3300005577 Ga0068857_100012323 Ga0068857_1000123232 365
2158 3300005577 Ga0068857_100090038 Ga0068857_1000900382 365
2159 3300005578 Ga0068854_100002007 Ga0068854_1000020072 365
2160 3300005614 Ga0068856_100019343 Ga0068856_1000193435 365
2161 3300005616 Ga0068852_100097935 Ga0068852_1000979352 365
2162 3300005617 Ga0068859_100076574 Ga0068859_1000765742 365
2163 3300005617 Ga0068859_100172234 Ga0068859_1001722342 365
2164 3300005618 Ga0068864_100000501 Ga0068864_10000050123 365
2165 3300005618 Ga0068864_100030762 Ga0068864_1000307622 365
2166 3300005618 Ga0068864_100044977 Ga0068864_1000449773 365
2167 3300005840 Ga0068870_10000104 Ga0068870_1000010417 365
2168 3300005841 Ga0068863_100006851 Ga0068863_1000068512 365
2169 3300005841 Ga0068863_100088638 Ga0068863_1000886384 365
2170 3300005841 Ga0068863_100186457 Ga0068863_1001864573 365
2171 3300005842 Ga0068858_100007763 Ga0068858_1000077633 365
2172 3300005842 Ga0068858_100009333 Ga0068858_10000933310 365
2173 3300005843 Ga0068860_100002395 Ga0068860_10000239513 365
2174 3300005937 Ga0081455_10000957 Ga0081455_1000095730 365
2175 3300005937 Ga0081455_10014639 Ga0081455_100146397 365
2176 3300006237 Ga0097621_100019283 Ga0097621_1000192834 365
2177 3300006237 Ga0097621_100043293 Ga0097621_1000432934 365
2178 3300006237 Ga0097621_100127601 Ga0097621_1001276012 365
2179 3300006358 Ga0068871_100000485 Ga0068871_10000048521 365
2180 3300006358 Ga0068871_100014511 Ga0068871_1000145115 365
2181 3300006914 Ga0075436_100001554 Ga0075436_1000015546 365
2182 3300006914 Ga0075436_100019721 Ga0075436_1000197214 365
2183 3300006931 Ga0097620_100076573 Ga0097620_1000765732 365
2184 3300006931 Ga0097620_100172226 Ga0097620_1001722262 365
2185 3300006948 Ga0099826_10000779 Ga0099826_1000077921 365
2186 3300009093 Ga0105240_10179760 Ga0105240_101797603 365
2187 3300009098 Ga0105245_10001701 Ga0105245_1000170113 365
2188 3300009098 Ga0105245_10004672 Ga0105245_100046727 365
2189 3300009098 Ga0105245_10066365 Ga0105245_100663652 365
2190 3300009098 Ga0105245_10130275 Ga0105245_101302752 365
2191 3300009101 Ga0105247_10053939 Ga0105247_100539392 365
2192 3300009101 Ga0105247_10222906 Ga0105247_102229061 365
2193 3300009174 Ga0105241_10000805 Ga0105241_1000080519 365
2194 3300009174 Ga0105241_10076763 Ga0105241_100767634 365
2195 3300009174 Ga0105241_10166729 Ga0105241_101667292 365
2196 3300009176 Ga0105242_10024314 Ga0105242_100243144 365
2197 3300009176 Ga0105242_10045683 Ga0105242_100456833 365
2198 3300009177 Ga0105248_10009673 Ga0105248_100096736 365
2199 3300009177 Ga0105248_10010458 Ga0105248_100104589 365
2200 3300009545 Ga0105237_10024690 Ga0105237_100246906 365
2201 3300009551 Ga0105238_10031532 Ga0105238_100315324 365
2202 3300009551 Ga0105238_10086980 Ga0105238_100869803 365
2203 3300010375 Ga0105239_10014257 Ga0105239_1001425710 365
2204 3300010375 Ga0105239_10071773 Ga0105239_100717734 365
2205 3300011119 Ga0105246_10002092 Ga0105246_100020922 365
2206 3300011119 Ga0105246_10012017 Ga0105246_100120176 365
2207 3300013102 Ga0157371_10032640 Ga0157371_100326402 365
2208 3300013104 Ga0157370_10007220 Ga0157370_100072204 365
2209 3300013104 Ga0157370_10079982 Ga0157370_100799823 365
2210 3300013105 Ga0157369_10113374 Ga0157369_101133742 365
2211 3300013105 Ga0157369_10123092 Ga0157369_101230923 365
2212 3300013297 Ga0157378_10011410 Ga0157378_100114109 365
2213 3300013297 Ga0157378_10079622 Ga0157378_100796222 365
2214 3300013306 Ga0163162_10068764 Ga0163162_100687642 365
2215 3300013306 Ga0163162_10075923 Ga0163162_100759233 365
2216 3300013307 Ga0157372_10016173 Ga0157372_1001617310 365
2217 3300013307 Ga0157372_10284121 Ga0157372_102841212 365
2218 3300013308 Ga0157375_10001699 Ga0157375_1000169913 365
2219 3300013308 Ga0157375_10049620 Ga0157375_100496204 365
2220 3300013308 Ga0157375_10062038 Ga0157375_100620384 365
2221 3300013308 Ga0157375_10172782 Ga0157375_101727822 365
2222 3300014325 Ga0163163_10005423 Ga0163163_100054236 365
2223 3300014325 Ga0163163_10039573 Ga0163163_100395734 365
2224 3300014326 Ga0157380_10062544 Ga0157380_100625441 365
2225 3300014968 Ga0157379_10004716 Ga0157379_1000471612 365
2226 3300014969 Ga0157376_10000696 Ga0157376_1000069621 365
2227 3300014969 Ga0157376_10007981 Ga0157376_100079812 365
2228 3300021384 Ga0213876_10000956 Ga0213876_1000095611 365
2229 3300025271 Ga0207666_1000245 Ga0207666_10002457 365
2230 3300025893 Ga0207682_10000793 Ga0207682_100007939 365
2231 3300025900 Ga0207710_10007749 Ga0207710_100077495 365
2232 3300025900 Ga0207710_10098202 Ga0207710_100982021 365
2233 3300025901 Ga0207688_10000420 Ga0207688_100004202 365
2234 3300025906 Ga0207699_10154436 Ga0207699_101544362 365
2235 3300025907 Ga0207645_10000668 Ga0207645_1000066821 365
2236 3300025908 Ga0207643_10000085 Ga0207643_1000008522 365
2237 3300025910 Ga0207684_10154836 Ga0207684_101548361 365
2238 3300025911 Ga0207654_10000373 Ga0207654_100003737 365
2239 3300025912 Ga0207707_10003697 Ga0207707_1000369711 365
2240 3300025913 Ga0207695_10010533 Ga0207695_100105332 365
2241 3300025914 Ga0207671_10006714 Ga0207671_100067146 365
2242 3300025915 Ga0207693_10149018 Ga0207693_101490182 365
2243 3300025916 Ga0207663_10237299 Ga0207663_102372991 365
2244 3300025917 Ga0207660_10002189 Ga0207660_100021897 365
2245 3300025919 Ga0207657_10045027 Ga0207657_100450273 365
2246 3300025920 Ga0207649_10000476 Ga0207649_1000047620 365
2247 3300025921 Ga0207652_10003058 Ga0207652_100030587 365
2248 3300025921 Ga0207652_10179247 Ga0207652_101792472 365
2249 3300025921 Ga0207652_10200219 Ga0207652_102002191 365
2250 3300025923 Ga0207681_10001971 Ga0207681_1000197113 365
2251 3300025924 Ga0207694_10008965 Ga0207694_100089653 365
2252 3300025924 Ga0207694_10072352 Ga0207694_100723523 365
2253 3300025925 Ga0207650_10139793 Ga0207650_101397932 365
2254 3300025927 Ga0207687_10001321 Ga0207687_100013217 365
2255 3300025927 Ga0207687_10006403 Ga0207687_100064037 365
2256 3300025928 Ga0207700_10046008 Ga0207700_100460083 365
2257 3300025931 Ga0207644_10000759 Ga0207644_1000075910 365
2258 3300025932 Ga0207690_10004643 Ga0207690_100046437 365
2259 3300025934 Ga0207686_10000682 Ga0207686_100006827 365
2260 3300025934 Ga0207686_10019092 Ga0207686_100190922 365
2261 3300025935 Ga0207709_10001961 Ga0207709_1000196113 365
2262 3300025936 Ga0207670_10000908 Ga0207670_1000090810 365
2263 3300025941 Ga0207711_10002466 Ga0207711_100024662 365
2264 3300025941 Ga0207711_10006567 Ga0207711_100065676 365
2265 3300025941 Ga0207711_10032756 Ga0207711_100327566 365
2266 3300025941 Ga0207711_10239961 Ga0207711_102399612 365
2267 3300025942 Ga0207689_10002200 Ga0207689_1000220021 365
2268 3300025944 Ga0207661_10000373 Ga0207661_100003739 365
2269 3300025945 Ga0207679_10001125 Ga0207679_100011259 365
2270 3300025949 Ga0207667_10111808 Ga0207667_101118082 365
2271 3300025960 Ga0207651_10002032 Ga0207651_100020322 365
2272 3300025972 Ga0207668_10001143 Ga0207668_100011439 365
2273 3300025981 Ga0207640_10002628 Ga0207640_100026283 365
2274 3300025986 Ga0207658_10133906 Ga0207658_101339062 365
2275 3300026023 Ga0207677_10008931 Ga0207677_100089317 365
2276 3300026023 Ga0207677_10054654 Ga0207677_100546543 365
2277 3300026035 Ga0207703_10001627 Ga0207703_1000162714 365
2278 3300026035 Ga0207703_10040942 Ga0207703_100409423 365
2279 3300026035 Ga0207703_10093312 Ga0207703_100933122 365
2280 3300026075 Ga0207708_10007573 Ga0207708_100075737 365
2281 3300026078 Ga0207702_10026745 Ga0207702_100267456 365
2282 3300026078 Ga0207702_10028018 Ga0207702_100280184 365
2283 3300026078 Ga0207702_10101943 Ga0207702_101019432 365
2284 3300026088 Ga0207641_10002374 Ga0207641_100023747 365
2285 3300026088 Ga0207641_10026025 Ga0207641_100260252 365
2286 3300026088 Ga0207641_10074215 Ga0207641_100742153 365
2287 3300026089 Ga0207648_10001362 Ga0207648_1000136222 365
2288 3300026095 Ga0207676_10001403 Ga0207676_100014032 365
2289 3300026095 Ga0207676_10003182 Ga0207676_100031829 365
2290 3300026095 Ga0207676_10058371 Ga0207676_100583712 365
2291 3300026116 Ga0207674_10016802 Ga0207674_100168022 365
2292 3300026116 Ga0207674_10056468 Ga0207674_100564682 365
2293 3300026116 Ga0207674_10074504 Ga0207674_100745044 365
2294 3300026118 Ga0207675_100004955 Ga0207675_1000049552 365
2295 3300028379 Ga0268266_10004206 Ga0268266_100042066 365
2296 3300028379 Ga0268266_10100929 Ga0268266_101009292 365
2297 3300028381 Ga0268264_10001202 Ga0268264_1000120218 365
2298 3300028381 Ga0268264_10005528 Ga0268264_100055283 365
2299 3300028381 Ga0268264_10385760 Ga0268264_103857601 365
2300 3300028800 Ga0265338_10061292 Ga0265338_100612923 365
2301 3300031344 Ga0265316_10097415 Ga0265316_100974153 365
2302 3300031711 Ga0265314_10010160 Ga0265314_100101607 365
2303 3300034819 Ga0373958_0002994 Ga0373958_0002994_591_1688 365
2304 3300035092 Ga0373952_0000725 Ga0373952_0000725_4573_5670 365
2305 3300035115 Ga0373941_0002926 Ga0373941_0002926_2181_3278 365
2306 3300035121 Ga0373960_0000528 Ga0373960_0000528_989_2086 365
2307 3300035170 Ga0373943_0033796 Ga0373943_0033796_122_1225 365
2308 3300035241 Ga0373961_0026902 Ga0373961_0026902_121_1227 365
2309 3300035691 Ga0373931_0006839 Ga0373931_0006839_2527_3624 365
2310 3300035692 Ga0373935_0071923 Ga0373935_0071923_919_2043 365
2311 3300035695 Ga0373927_0031878 Ga0373927_0031878_1768_2871 365
2312 3300035725 Ga0373947_0049729 Ga0373947_0049729_1371_2474 365
2313 3300035725 Ga0373947_0178766 Ga0373947_0178766_96_1220 365
2314 3300037068 Ga0373925_0196635 Ga0373925_0196635_350_1453 365
2315 3300037853 Ga0436364_0583374 Ga0436364_0583374_225_1409 365
2316 3300037853 Ga0436364_1217366 Ga0436364_1217366_2799_3983 365
2317 3300037853 Ga0436364_1373353 Ga0436364_1373353_396_1502 365
2318 3300039437 Ga0436365_1202069 Ga0436365_1202069_18248_19432 365
2319 3300039450 Ga0436363_0476242 Ga0436363_0476242_7748_8932 365
2320 3300039453 Ga0436362_0929089 Ga0436362_0929089_3598_4782 365
2321 3300046461 Ga0495641_0093817 Ga0495641_0093817_62_1165 365
2322 3300046472 Ga0495580_0000576 Ga0495580_0000576_20883_22058 365
2323 3300046684 Ga0495669_0022482 Ga0495669_0022482_1520_2617 365
2324 3300048913 Ga0496110_0168965 Ga0496110_0168965_351_1454 365
2325 3300048917 Ga0496114_0004331 Ga0496114_0004331_3088_4185 365
2326 3300048918 Ga0496115_0014383 Ga0496115_0014383_3466_4563 365
2327 3300048918 Ga0496115_0219431 Ga0496115_0219431_47_1270 365
2328 3300048919 Ga0496116_0088424 Ga0496116_0088424_418_1539 365
2329 3300048920 Ga0496117_0151466 Ga0496117_0151466_120_1241 365
2330 3300048922 Ga0496119_0015551 Ga0496119_0015551_4709_5830 365
2331 3300048923 Ga0496120_0103800 Ga0496120_0103800_98_1219 365
2332 3300049575 Ga0501039_0291581 Ga0501039_0291581_60_1163 365
2333 3300049743 Ga0501081_0261904 Ga0501081_0261904_130_1233 365
2334 3300050509 nmdc:mga0qj67_144474_c1 nmdc:mga0qj67_144474_c1_112_1215 365
2335 3300050514 nmdc:mga08x19_112835_c1 nmdc:mga08x19_112835_c1_73_1194 365
2336 3300050514 nmdc:mga08x19_125019_c1 nmdc:mga08x19_125019_c1_371_1546 365
2337 3300050514 nmdc:mga08x19_6626_c1 nmdc:mga08x19_6626_c1_2044_3219 365
2338 3300053117 Ga0500593_082878 Ga0500593_082878_109_1278 365
2339 3300001989 JGI24739J22299_10010953 JGI24739J22299_100109533 366
2340 3300002067 JGI24735J21928_10010073 JGI24735J21928_100100734 366
2341 3300002075 JGI24738J21930_10000730 JGI24738J21930_100007307 366
2342 3300002126 JGI24035J26624_1000058 JGI24035J26624_10000582 366
2343 3300002244 JGI24742J22300_10000198 JGI24742J22300_100001989 366
2344 3300003215 JGI25153J46596_10002490 JGI25153J46596_100024908 366
2345 3300003215 JGI25153J46596_10010701 JGI25153J46596_100107011 366
2346 3300003215 JGI25153J46596_10041259 JGI25153J46596_100412591 366
2347 3300003762 Ga0055542_1011094 Ga0055542_10110941 366
2348 3300003794 Ga0055531_10005776 Ga0055531_100057762 366
2349 3300005262 Ga0065165_1001966 Ga0065165_100196623 366
2350 3300005262 Ga0065165_1003663 Ga0065165_10036631 366
2351 3300005327 Ga0070658_10080193 Ga0070658_100801931 366
2352 3300005329 Ga0070683_100000585 Ga0070683_10000058521 366
2353 3300005337 Ga0070682_100034975 Ga0070682_1000349752 366
2354 3300005338 Ga0068868_100215163 Ga0068868_1002151631 366
2355 3300005339 Ga0070660_100026290 Ga0070660_1000262905 366
2356 3300005339 Ga0070660_100247016 Ga0070660_1002470161 366
2357 3300005343 Ga0070687_100007741 Ga0070687_1000077411 366
2358 3300005347 Ga0070668_100029287 Ga0070668_1000292872 366
2359 3300005356 Ga0070674_100002656 Ga0070674_1000026562 366
2360 3300005365 Ga0070688_100005511 Ga0070688_1000055111 366
2361 3300005406 Ga0070703_10006667 Ga0070703_100066672 366
2362 3300005434 Ga0070709_10226942 Ga0070709_102269421 366
2363 3300005435 Ga0070714_100065295 Ga0070714_1000652952 366
2364 3300005435 Ga0070714_100099155 Ga0070714_1000991552 366
2365 3300005435 Ga0070714_100333164 Ga0070714_1003331641 366
2366 3300005436 Ga0070713_100009592 Ga0070713_1000095922 366
2367 3300005436 Ga0070713_100021511 Ga0070713_1000215115 366
2368 3300005436 Ga0070713_100203852 Ga0070713_1002038523 366
2369 3300005436 Ga0070713_100232158 Ga0070713_1002321582 366
2370 3300005437 Ga0070710_10002057 Ga0070710_100020578 366
2371 3300005437 Ga0070710_10020638 Ga0070710_100206383 366
2372 3300005438 Ga0070701_10000116 Ga0070701_100001168 366
2373 3300005439 Ga0070711_100000833 Ga0070711_1000008332 366
2374 3300005439 Ga0070711_100012063 Ga0070711_1000120633 366
2375 3300005439 Ga0070711_100062328 Ga0070711_1000623282 366
2376 3300005439 Ga0070711_100157768 Ga0070711_1001577682 366
2377 3300005440 Ga0070705_100002646 Ga0070705_1000026462 366
2378 3300005455 Ga0070663_100013643 Ga0070663_1000136432 366
2379 3300005455 Ga0070663_100016660 Ga0070663_1000166601 366
2380 3300005455 Ga0070663_100023380 Ga0070663_1000233804 366
2381 3300005455 Ga0070663_100240568 Ga0070663_1002405681 366
2382 3300005455 Ga0070663_100271808 Ga0070663_1002718081 366
2383 3300005458 Ga0070681_10017652 Ga0070681_100176525 366
2384 3300005458 Ga0070681_10018751 Ga0070681_100187512 366
2385 3300005458 Ga0070681_10027863 Ga0070681_100278635 366
2386 3300005459 Ga0068867_100109766 Ga0068867_1001097662 366
2387 3300005518 Ga0070699_100157075 Ga0070699_1001570752 366
2388 3300005530 Ga0070679_100015294 Ga0070679_1000152944 366
2389 3300005530 Ga0070679_100108843 Ga0070679_1001088432 366
2390 3300005535 Ga0070684_100003206 Ga0070684_1000032063 366
2391 3300005535 Ga0070684_100003951 Ga0070684_1000039513 366
2392 3300005535 Ga0070684_100130887 Ga0070684_1001308871 366
2393 3300005539 Ga0068853_100002639 Ga0068853_1000026397 366
2394 3300005539 Ga0068853_100004569 Ga0068853_1000045692 366
2395 3300005539 Ga0068853_100014282 Ga0068853_1000142824 366
2396 3300005539 Ga0068853_100042194 Ga0068853_1000421945 366
2397 3300005539 Ga0068853_100061864 Ga0068853_1000618642 366
2398 3300005539 Ga0068853_100213806 Ga0068853_1002138062 366
2399 3300005543 Ga0070672_100000875 Ga0070672_10000087513 366
2400 3300005543 Ga0070672_100221370 Ga0070672_1002213701 366
2401 3300005544 Ga0070686_100140152 Ga0070686_1001401521 366
2402 3300005545 Ga0070695_100000960 Ga0070695_1000009608 366
2403 3300005547 Ga0070693_100000844 Ga0070693_1000008444 366
2404 3300005548 Ga0070665_100077875 Ga0070665_1000778752 366
2405 3300005548 Ga0070665_100278762 Ga0070665_1002787621 366
2406 3300005563 Ga0068855_100004638 Ga0068855_10000463817 366
2407 3300005563 Ga0068855_100329271 Ga0068855_1003292711 366
2408 3300005563 Ga0068855_100341706 Ga0068855_1003417062 366
2409 3300005577 Ga0068857_100082245 Ga0068857_1000822451 366
2410 3300005578 Ga0068854_100032752 Ga0068854_1000327522 366
2411 3300005578 Ga0068854_100082819 Ga0068854_1000828192 366
2412 3300005614 Ga0068856_100000511 Ga0068856_1000005112 366
2413 3300005614 Ga0068856_100052061 Ga0068856_1000520613 366
2414 3300005616 Ga0068852_100035668 Ga0068852_1000356684 366
2415 3300005617 Ga0068859_100009773 Ga0068859_1000097739 366
2416 3300005937 Ga0081455_10069108 Ga0081455_100691083 366
2417 3300005983 Ga0081540_1000198 Ga0081540_100019844 366
2418 3300005983 Ga0081540_1008018 Ga0081540_10080186 366
2419 3300005983 Ga0081540_1010819 Ga0081540_10108192 366
2420 3300005983 Ga0081540_1012538 Ga0081540_10125383 366
2421 3300005983 Ga0081540_1025031 Ga0081540_10250312 366
2422 3300005985 Ga0081539_10000324 Ga0081539_1000032428 366
2423 3300005985 Ga0081539_10000902 Ga0081539_1000090211 366
2424 3300006028 Ga0070717_10091209 Ga0070717_100912092 366
2425 3300006038 Ga0075365_10067986 Ga0075365_100679861 366
2426 3300006048 Ga0075363_100004319 Ga0075363_1000043191 366
2427 3300006048 Ga0075363_100027529 Ga0075363_1000275292 366
2428 3300006048 Ga0075363_100047081 Ga0075363_1000470812 366
2429 3300006048 Ga0075363_100083445 Ga0075363_1000834451 366
2430 3300006051 Ga0075364_10022715 Ga0075364_100227152 366
2431 3300006173 Ga0070716_100078923 Ga0070716_1000789232 366
2432 3300006175 Ga0070712_100006043 Ga0070712_1000060433 366
2433 3300006175 Ga0070712_100006276 Ga0070712_1000062767 366
2434 3300006175 Ga0070712_100026120 Ga0070712_1000261202 366
2435 3300006186 Ga0075369_10053803 Ga0075369_100538031 366
2436 3300006353 Ga0075370_10082888 Ga0075370_100828882 366
2437 3300006353 Ga0075370_10160980 Ga0075370_101609801 366
2438 3300006844 Ga0075428_100053293 Ga0075428_1000532936 366
2439 3300006847 Ga0075431_100001278 Ga0075431_10000127823 366
2440 3300006852 Ga0075433_10010489 Ga0075433_100104892 366
2441 3300006871 Ga0075434_100153366 Ga0075434_1001533661 366
2442 3300006880 Ga0075429_100097062 Ga0075429_1000970622 366
2443 3300006881 Ga0068865_100001815 Ga0068865_1000018152 366
2444 3300006881 Ga0068865_100023367 Ga0068865_1000233672 366
2445 3300006931 Ga0097620_100009773 Ga0097620_1000097739 366
2446 3300006942 Ga0099824_1008958 Ga0099824_100895815 366
2447 3300006943 Ga0099822_1009768 Ga0099822_10097688 366
2448 3300006944 Ga0099823_1018580 Ga0099823_10185803 366
2449 3300007076 Ga0075435_100066599 Ga0075435_1000665993 366
2450 3300007265 Ga0099794_10096414 Ga0099794_100964141 366
2451 3300009093 Ga0105240_10002869 Ga0105240_1000286932 366
2452 3300009093 Ga0105240_10016217 Ga0105240_100162178 366
2453 3300009093 Ga0105240_10072534 Ga0105240_100725343 366
2454 3300009094 Ga0111539_10002680 Ga0111539_1000268017 366
2455 3300009098 Ga0105245_10035960 Ga0105245_100359607 366
2456 3300009148 Ga0105243_10083211 Ga0105243_100832112 366
2457 3300009148 Ga0105243_10367631 Ga0105243_103676311 366
2458 3300009174 Ga0105241_10037050 Ga0105241_100370502 366
2459 3300009176 Ga0105242_10004554 Ga0105242_100045548 366
2460 3300009177 Ga0105248_10160514 Ga0105248_101605141 366
2461 3300009545 Ga0105237_10040819 Ga0105237_100408195 366
2462 3300009545 Ga0105237_10105783 Ga0105237_101057832 366
2463 3300009545 Ga0105237_10107765 Ga0105237_101077651 366
2464 3300009545 Ga0105237_10209001 Ga0105237_102090013 366
2465 3300009545 Ga0105237_10329287 Ga0105237_103292872 366
2466 3300009545 Ga0105237_10375926 Ga0105237_103759261 366
2467 3300009551 Ga0105238_10013449 Ga0105238_100134497 366
2468 3300009551 Ga0105238_10077409 Ga0105238_100774093 366
2469 3300009551 Ga0105238_10169694 Ga0105238_101696942 366
2470 3300009553 Ga0105249_10048821 Ga0105249_100488215 366
2471 3300009553 Ga0105249_10231661 Ga0105249_102316611 366
2472 3300010159 Ga0099796_10016259 Ga0099796_100162591 366
2473 3300010375 Ga0105239_10009412 Ga0105239_100094125 366
2474 3300010375 Ga0105239_10085636 Ga0105239_100856362 366
2475 3300010375 Ga0105239_10109291 Ga0105239_101092914 366
2476 3300010375 Ga0105239_10198109 Ga0105239_101981092 366
2477 3300010375 Ga0105239_10230087 Ga0105239_102300873 366
2478 3300010375 Ga0105239_10367891 Ga0105239_103678912 366
2479 3300010375 Ga0105239_10493147 Ga0105239_104931471 366
2480 3300010375 Ga0105239_10623077 Ga0105239_106230771 366
2481 3300011119 Ga0105246_10116645 Ga0105246_101166452 366
2482 3300013100 Ga0157373_10034908 Ga0157373_100349081 366
2483 3300013104 Ga0157370_10350412 Ga0157370_103504121 366
2484 3300013105 Ga0157369_10011139 Ga0157369_1001113913 366
2485 3300013296 Ga0157374_10006560 Ga0157374_100065602 366
2486 3300013296 Ga0157374_10048025 Ga0157374_100480253 366
2487 3300013306 Ga0163162_10004482 Ga0163162_1000448213 366
2488 3300013306 Ga0163162_10009997 Ga0163162_100099976 366
2489 3300013306 Ga0163162_10094581 Ga0163162_100945811 366
2490 3300013306 Ga0163162_10440011 Ga0163162_104400112 366
2491 3300013306 Ga0163162_10557338 Ga0163162_105573382 366
2492 3300014325 Ga0163163_10010700 Ga0163163_100107005 366
2493 3300014968 Ga0157379_10047441 Ga0157379_100474412 366
2494 3300017792 Ga0163161_10002208 Ga0163161_1000220810 366
2495 3300017792 Ga0163161_10152836 Ga0163161_101528362 366
2496 3300021320 Ga0214544_1000003 Ga0214544_1000003226 366
2497 3300021321 Ga0214542_1000003 Ga0214542_1000003216 366
2498 3300021324 Ga0214545_1000004 Ga0214545_1000004229 366
2499 3300021327 Ga0214543_1000007 Ga0214543_1000007188 366
2500 3300021377 Ga0213874_10009062 Ga0213874_100090622 366
2501 3300021384 Ga0213876_10002341 Ga0213876_100023412 366
2502 3300021388 Ga0213875_10000011 Ga0213875_1000001177 366
2503 3300025253 Ga0209677_100341 Ga0209677_1003419 366
2504 3300025253 Ga0209677_104070 Ga0209677_1040703 366
2505 3300025254 Ga0209148_1000904 Ga0209148_100090423 366
2506 3300025261 Ga0209233_1024792 Ga0209233_10247922 366
2507 3300025290 Ga0207673_1001360 Ga0207673_10013602 366
2508 3300025295 Ga0209564_1030254 Ga0209564_10302542 366
2509 3300025297 Ga0209758_1000015 Ga0209758_1000015269 366
2510 3300025297 Ga0209758_1000389 Ga0209758_10003898 366
2511 3300025297 Ga0209758_1000716 Ga0209758_100071648 366
2512 3300025297 Ga0209758_1001131 Ga0209758_100113120 366
2513 3300025297 Ga0209758_1006317 Ga0209758_10063173 366
2514 3300025297 Ga0209758_1008275 Ga0209758_10082752 366
2515 3300025299 Ga0209256_1018445 Ga0209256_10184452 366
2516 3300025302 Ga0207426_1000380 Ga0207426_100038071 366
2517 3300025302 Ga0207426_1000832 Ga0207426_100083216 366
2518 3300025304 Ga0209257_1003856 Ga0209257_10038567 366
2519 3300025315 Ga0207697_10003263 Ga0207697_100032632 366
2520 3300025898 Ga0207692_10000982 Ga0207692_100009823 366
2521 3300025898 Ga0207692_10011557 Ga0207692_100115573 366
2522 3300025904 Ga0207647_10004676 Ga0207647_100046764 366
2523 3300025905 Ga0207685_10035749 Ga0207685_100357491 366
2524 3300025906 Ga0207699_10003211 Ga0207699_100032116 366
2525 3300025906 Ga0207699_10022340 Ga0207699_100223402 366
2526 3300025910 Ga0207684_10104849 Ga0207684_101048492 366
2527 3300025912 Ga0207707_10000712 Ga0207707_1000071232 366
2528 3300025912 Ga0207707_10002643 Ga0207707_100026438 366
2529 3300025912 Ga0207707_10011682 Ga0207707_100116821 366
2530 3300025912 Ga0207707_10115723 Ga0207707_101157231 366
2531 3300025913 Ga0207695_10000065 Ga0207695_1000006591 366
2532 3300025913 Ga0207695_10000463 Ga0207695_1000046358 366
2533 3300025913 Ga0207695_10035315 Ga0207695_100353153 366
2534 3300025913 Ga0207695_10136948 Ga0207695_101369482 366
2535 3300025914 Ga0207671_10149586 Ga0207671_101495861 366
2536 3300025915 Ga0207693_10004868 Ga0207693_100048687 366
2537 3300025915 Ga0207693_10031231 Ga0207693_100312312 366
2538 3300025915 Ga0207693_10064475 Ga0207693_100644753 366
2539 3300025915 Ga0207693_10149408 Ga0207693_101494082 366
2540 3300025916 Ga0207663_10003606 Ga0207663_100036064 366
2541 3300025916 Ga0207663_10045009 Ga0207663_100450092 366
2542 3300025916 Ga0207663_10138879 Ga0207663_101388791 366
2543 3300025917 Ga0207660_10024969 Ga0207660_100249694 366
2544 3300025918 Ga0207662_10000730 Ga0207662_1000073017 366
2545 3300025919 Ga0207657_10004333 Ga0207657_1000433312 366
2546 3300025919 Ga0207657_10007870 Ga0207657_100078701 366
2547 3300025919 Ga0207657_10175434 Ga0207657_101754341 366
2548 3300025921 Ga0207652_10025482 Ga0207652_100254824 366
2549 3300025921 Ga0207652_10081669 Ga0207652_100816692 366
2550 3300025924 Ga0207694_10000234 Ga0207694_1000023410 366
2551 3300025924 Ga0207694_10020734 Ga0207694_100207344 366
2552 3300025924 Ga0207694_10117451 Ga0207694_101174512 366
2553 3300025928 Ga0207700_10042507 Ga0207700_100425073 366
2554 3300025928 Ga0207700_10084009 Ga0207700_100840091 366
2555 3300025929 Ga0207664_10024019 Ga0207664_100240194 366
2556 3300025929 Ga0207664_10032068 Ga0207664_100320682 366
2557 3300025933 Ga0207706_10006279 Ga0207706_100062799 366
2558 3300025933 Ga0207706_10064181 Ga0207706_100641813 366
2559 3300025937 Ga0207669_10000129 Ga0207669_1000012931 366
2560 3300025937 Ga0207669_10042606 Ga0207669_100426062 366
2561 3300025938 Ga0207704_10000366 Ga0207704_1000036616 366
2562 3300025939 Ga0207665_10001517 Ga0207665_1000151711 366
2563 3300025940 Ga0207691_10010088 Ga0207691_100100882 366
2564 3300025940 Ga0207691_10108228 Ga0207691_101082281 366
2565 3300025940 Ga0207691_10123790 Ga0207691_101237903 366
2566 3300025941 Ga0207711_10149547 Ga0207711_101495472 366
2567 3300025944 Ga0207661_10053290 Ga0207661_100532903 366
2568 3300025949 Ga0207667_10071532 Ga0207667_100715323 366
2569 3300025949 Ga0207667_10120347 Ga0207667_101203474 366
2570 3300025949 Ga0207667_10242720 Ga0207667_102427202 366
2571 3300025960 Ga0207651_10139475 Ga0207651_101394752 366
2572 3300025961 Ga0207712_10002238 Ga0207712_100022387 366
2573 3300025981 Ga0207640_10005345 Ga0207640_100053455 366
2574 3300025981 Ga0207640_10135178 Ga0207640_101351781 366
2575 3300026041 Ga0207639_10005334 Ga0207639_100053347 366
2576 3300026041 Ga0207639_10017709 Ga0207639_100177092 366
2577 3300026041 Ga0207639_10051471 Ga0207639_100514713 366
2578 3300026041 Ga0207639_10070142 Ga0207639_100701424 366
2579 3300026067 Ga0207678_10006198 Ga0207678_1000619812 366
2580 3300026067 Ga0207678_10010758 Ga0207678_100107587 366
2581 3300026067 Ga0207678_10022779 Ga0207678_100227791 366
2582 3300026067 Ga0207678_10022967 Ga0207678_100229671 366
2583 3300026067 Ga0207678_10082104 Ga0207678_100821043 366
2584 3300026067 Ga0207678_10096372 Ga0207678_100963721 366
2585 3300026067 Ga0207678_10117401 Ga0207678_101174012 366
2586 3300026078 Ga0207702_10000355 Ga0207702_1000035549 366
2587 3300026078 Ga0207702_10000936 Ga0207702_1000093611 366
2588 3300026078 Ga0207702_10084328 Ga0207702_100843284 366
2589 3300026078 Ga0207702_10105447 Ga0207702_101054472 366
2590 3300026078 Ga0207702_10343354 Ga0207702_103433541 366
2591 3300026078 Ga0207702_10355669 Ga0207702_103556691 366
2592 3300026088 Ga0207641_10088023 Ga0207641_100880232 366
2593 3300026089 Ga0207648_10037140 Ga0207648_100371403 366
2594 3300026089 Ga0207648_10159654 Ga0207648_101596542 366
2595 3300026116 Ga0207674_10004202 Ga0207674_100042025 366
2596 3300026116 Ga0207674_10004213 Ga0207674_100042134 366
2597 3300026116 Ga0207674_10011327 Ga0207674_100113272 366
2598 3300026121 Ga0207683_10001220 Ga0207683_1000122018 366
2599 3300026121 Ga0207683_10414056 Ga0207683_104140561 366
2600 3300026142 Ga0207698_10041448 Ga0207698_100414484 366
2601 3300026142 Ga0207698_10152076 Ga0207698_101520762 366
2602 3300027296 Ga0209389_1000168 Ga0209389_10001687 366
2603 3300027296 Ga0209389_1000180 Ga0209389_100018045 366
2604 3300027357 Ga0209589_1000015 Ga0209589_1000015176 366
2605 3300027357 Ga0209589_1000570 Ga0209589_10005707 366
2606 3300027361 Ga0209489_100015 Ga0209489_100015176 366
2607 3300027361 Ga0209489_101190 Ga0209489_1011907 366
2608 3300027361 Ga0209489_101411 Ga0209489_10141145 366
2609 3300027363 Ga0209700_100025 Ga0209700_100025176 366
2610 3300027363 Ga0209700_101443 Ga0209700_10144346 366
2611 3300027552 Ga0209982_1001329 Ga0209982_10013292 366
2612 3300027617 Ga0210002_1000223 Ga0210002_10002233 366
2613 3300027717 Ga0209998_10001714 Ga0209998_100017141 366
2614 3300027907 Ga0207428_10000896 Ga0207428_1000089618 366
2615 3300028379 Ga0268266_10005316 Ga0268266_100053165 366
2616 3300028379 Ga0268266_10213386 Ga0268266_102133862 366
2617 3300028380 Ga0268265_10005917 Ga0268265_100059172 366
2618 3300028556 Ga0265337_1030874 Ga0265337_10308741 366
2619 3300028573 Ga0265334_10002765 Ga0265334_100027653 366
2620 3300028577 Ga0265318_10004378 Ga0265318_100043785 366
2621 3300028577 Ga0265318_10014708 Ga0265318_100147082 366
2622 3300028653 Ga0265323_10000980 Ga0265323_100009802 366
2623 3300028654 Ga0265322_10034965 Ga0265322_100349651 366
2624 3300028666 Ga0265336_10000380 Ga0265336_1000038018 366
2625 3300028786 Ga0307517_10002508 Ga0307517_1000250821 366
2626 3300028800 Ga0265338_10000024 Ga0265338_10000024168 366
2627 3300029957 Ga0265324_10006426 Ga0265324_100064264 366
2628 3300030521 Ga0307511_10126390 Ga0307511_101263901 366
2629 3300031235 Ga0265330_10009926 Ga0265330_100099262 366
2630 3300031235 Ga0265330_10072226 Ga0265330_100722262 366
2631 3300031238 Ga0265332_10022448 Ga0265332_100224482 366
2632 3300031238 Ga0265332_10047310 Ga0265332_100473101 366
2633 3300031240 Ga0265320_10009660 Ga0265320_100096608 366
2634 3300031241 Ga0265325_10014090 Ga0265325_100140904 366
2635 3300031241 Ga0265325_10017230 Ga0265325_100172302 366
2636 3300031247 Ga0265340_10004598 Ga0265340_100045987 366
2637 3300031247 Ga0265340_10008009 Ga0265340_100080092 366
2638 3300031247 Ga0265340_10032968 Ga0265340_100329683 366
2639 3300031249 Ga0265339_10023958 Ga0265339_100239584 366
2640 3300031250 Ga0265331_10004211 Ga0265331_100042115 366
2641 3300031250 Ga0265331_10011549 Ga0265331_100115492 366
2642 3300031250 Ga0265331_10022033 Ga0265331_100220333 366
2643 3300031456 Ga0307513_10159062 Ga0307513_101590621 366
2644 3300031456 Ga0307513_10181183 Ga0307513_101811831 366
2645 3300031616 Ga0307508_10027537 Ga0307508_100275372 366
2646 3300031616 Ga0307508_10049126 Ga0307508_100491262 366
2647 3300031616 Ga0307508_10130177 Ga0307508_101301772 366
2648 3300031711 Ga0265314_10011734 Ga0265314_100117346 366
2649 3300031711 Ga0265314_10019710 Ga0265314_100197104 366
2650 3300031711 Ga0265314_10032961 Ga0265314_100329612 366
2651 3300031712 Ga0265342_10007469 Ga0265342_100074696 366
2652 3300031712 Ga0265342_10010859 Ga0265342_1001085910 366
2653 3300031712 Ga0265342_10082442 Ga0265342_100824422 366
2654 3300031730 Ga0307516_10049843 Ga0307516_100498434 366
2655 3300031911 Ga0307412_10195423 Ga0307412_101954232 366
2656 3300032005 Ga0307411_10093424 Ga0307411_100934242 366
2657 3300033180 Ga0307510_10042341 Ga0307510_100423414 366
2658 3300033180 Ga0307510_10239117 Ga0307510_102391171 366
2659 3300034818 Ga0373950_0001089 Ga0373950_0001089_1009_2109 366
2660 3300035083 Ga0373926_0021851 Ga0373926_0021851_810_1910 366
2661 3300035086 Ga0373934_0050768 Ga0373934_0050768_362_1468 366
2662 3300035088 Ga0373940_0013285 Ga0373940_0013285_234_1334 366
2663 3300035089 Ga0373944_0000574 Ga0373944_0000574_5214_6338 366
2664 3300035090 Ga0373949_0008909 Ga0373949_0008909_625_1725 366
2665 3300035091 Ga0373951_0000816 Ga0373951_0000816_4594_5694 366
2666 3300035111 Ga0373923_0044076 Ga0373923_0044076_605_1720 366
2667 3300035113 Ga0373936_0005142 Ga0373936_0005142_2292_3398 366
2668 3300035113 Ga0373936_0015918 Ga0373936_0015918_1240_2382 366
2669 3300035113 Ga0373936_0029984 Ga0373936_0029984_177_1277 366
2670 3300035116 Ga0373945_0020001 Ga0373945_0020001_453_1553 366
2671 3300035116 Ga0373945_0024786 Ga0373945_0024786_47_1153 366
2672 3300035117 Ga0373953_0056785 Ga0373953_0056785_118_1224 366
2673 3300035118 Ga0373954_0000393 Ga0373954_0000393_7136_8242 366
2674 3300035118 Ga0373954_0007401 Ga0373954_0007401_125_1240 366
2675 3300035118 Ga0373954_0054444 Ga0373954_0054444_531_1637 366
2676 3300035118 Ga0373954_0103847 Ga0373954_0103847_167_1321 366
2677 3300035119 Ga0373956_0021553 Ga0373956_0021553_309_1424 366
2678 3300035119 Ga0373956_0033610 Ga0373956_0033610_986_2086 366
2679 3300035120 Ga0373957_0006229 Ga0373957_0006229_925_2031 366
2680 3300035120 Ga0373957_0011445 Ga0373957_0011445_1801_2907 366
2681 3300035170 Ga0373943_0003412 Ga0373943_0003412_4685_5809 366
2682 3300035170 Ga0373943_0003971 Ga0373943_0003971_237_1343 366
2683 3300035170 Ga0373943_0109436 Ga0373943_0109436_260_1384 366
2684 3300035171 Ga0373946_0004408 Ga0373946_0004408_3778_4902 366
2685 3300035171 Ga0373946_0004434 Ga0373946_0004434_862_1962 366
2686 3300035171 Ga0373946_0024174 Ga0373946_0024174_912_2018 366
2687 3300035171 Ga0373946_0061501 Ga0373946_0061501_232_1338 366
2688 3300035171 Ga0373946_0089125 Ga0373946_0089125_127_1242 366
2689 3300035172 Ga0373955_0000362 Ga0373955_0000362_2814_3920 366
2690 3300035410 Ga0373924_0006999 Ga0373924_0006999_192_1298 366
2691 3300035410 Ga0373924_0029653 Ga0373924_0029653_717_1817 366
2692 3300035410 Ga0373924_0053157 Ga0373924_0053157_332_1456 366
2693 3300035691 Ga0373931_0057166 Ga0373931_0057166_269_1420 366
2694 3300035692 Ga0373935_0000444 Ga0373935_0000444_7381_8487 366
2695 3300035692 Ga0373935_0043696 Ga0373935_0043696_391_1497 366
2696 3300035692 Ga0373935_0070488 Ga0373935_0070488_367_1467 366
2697 3300035692 Ga0373935_0100073 Ga0373935_0100073_80_1186 366
2698 3300035692 Ga0373935_0189231 Ga0373935_0189231_185_1291 366
2699 3300035695 Ga0373927_0002219 Ga0373927_0002219_2386_3528 366
2700 3300035695 Ga0373927_0003966 Ga0373927_0003966_1857_2963 366
2701 3300035695 Ga0373927_0007035 Ga0373927_0007035_1456_2580 366
2702 3300035695 Ga0373927_0012518 Ga0373927_0012518_132_1256 366
2703 3300035695 Ga0373927_0103185 Ga0373927_0103185_95_1201 366
2704 3300035724 Ga0373933_0000288 Ga0373933_0000288_1190_2341 366
2705 3300035724 Ga0373933_0001277 Ga0373933_0001277_9920_11035 366
2706 3300035724 Ga0373933_0051968 Ga0373933_0051968_601_1707 366
2707 3300035724 Ga0373933_0076417 Ga0373933_0076417_746_1852 366
2708 3300035724 Ga0373933_0130284 Ga0373933_0130284_140_1240 366
2709 3300035725 Ga0373947_0006258 Ga0373947_0006258_5606_6730 366
2710 3300035725 Ga0373947_0017128 Ga0373947_0017128_609_1733 366
2711 3300035725 Ga0373947_0025158 Ga0373947_0025158_538_1644 366
2712 3300035725 Ga0373947_0122843 Ga0373947_0122843_233_1375 366
2713 3300036401 Ga0373937_0000454 Ga0373937_0000454_10439_11554 366
2714 3300036401 Ga0373937_0009599 Ga0373937_0009599_2840_3946 366
2715 3300036401 Ga0373937_0032663 Ga0373937_0032663_3115_4221 366
2716 3300036401 Ga0373937_0038782 Ga0373937_0038782_449_1555 366
2717 3300036401 Ga0373937_0042987 Ga0373937_0042987_1989_3089 366
2718 3300036401 Ga0373937_0070693 Ga0373937_0070693_1898_3004 366
2719 3300036401 Ga0373937_0080326 Ga0373937_0080326_1747_2853 366
2720 3300037068 Ga0373925_0007597 Ga0373925_0007597_6583_7707 366
2721 3300037068 Ga0373925_0030216 Ga0373925_0030216_2510_3616 366
2722 3300037068 Ga0373925_0034731 Ga0373925_0034731_392_1492 366
2723 3300037068 Ga0373925_0067621 Ga0373925_0067621_1310_2416 366
2724 3300037418 Ga0395900_0000937 Ga0395900_0000937_6885_7991 366
2725 3300037418 Ga0395900_0025611 Ga0395900_0025611_1588_2694 366
2726 3300037418 Ga0395900_0402632 Ga0395900_0402632_23_1150 366
2727 3300037466 Ga0395898_0005127 Ga0395898_0005127_205_1311 366
2728 3300037466 Ga0395898_0093489 Ga0395898_0093489_1334_2440 366
2729 3300037466 Ga0395898_0101000 Ga0395898_0101000_48_1154 366
2730 3300037471 Ga0395905_0003588 Ga0395905_0003588_13739_14875 366
2731 3300037471 Ga0395905_0126386 Ga0395905_0126386_255_1361 366
2732 3300037853 Ga0436364_0232280 Ga0436364_0232280_86473_87579 366
2733 3300037853 Ga0436364_1298189 Ga0436364_1298189_61_1167 366
2734 3300038443 Ga0395901_0006000 Ga0395901_0006000_10934_12040 366
2735 3300038443 Ga0395901_0013958 Ga0395901_0013958_6987_8099 366
2736 3300038443 Ga0395901_0378063 Ga0395901_0378063_238_1344 366
2737 3300039437 Ga0436365_0487883 Ga0436365_0487883_42_1169 366
2738 3300039437 Ga0436365_0900104 Ga0436365_0900104_450_1598 366
2739 3300039437 Ga0436365_1117139 Ga0436365_1117139_3421_4524 366
2740 3300039438 Ga0436360_0611830 Ga0436360_0611830_333_1472 366
2741 3300039450 Ga0436363_0612476 Ga0436363_0612476_653_1804 366
2742 3300039450 Ga0436363_1381581 Ga0436363_1381581_5500_6606 366
2743 3300039453 Ga0436362_1056084 Ga0436362_1056084_1359_2465 366
2744 3300041505 Ga0451849_0681971 Ga0451849_0681971_659_1765 366
2745 3300044658 Ga0466972_0000171 Ga0466972_0000171_49630_50736 366
2746 3300044658 Ga0466972_0009777 Ga0466972_0009777_584_1690 366
2747 3300044683 Ga0466965_0035997 Ga0466965_0035997_193_1329 366
2748 3300044684 Ga0466966_0001410 Ga0466966_0001410_11648_12754 366
2749 3300044693 Ga0466961_0000126 Ga0466961_0000126_39212_40318 366
2750 3300044694 Ga0466963_0035594 Ga0466963_0035594_87_1223 366
2751 3300044735 Ga0466968_0031901 Ga0466968_0031901_162_1268 366
2752 3300044765 Ga0466970_0069201 Ga0466970_0069201_107_1213 366
2753 3300044842 Ga0466957_0110537 Ga0466957_0110537_150_1286 366
2754 3300044901 Ga0466960_0007320 Ga0466960_0007320_3064_4170 366
2755 3300044901 Ga0466960_0123430 Ga0466960_0123430_129_1235 366
2756 3300045049 Ga0466959_0024698 Ga0466959_0024698_713_1819 366
2757 3300045976 Ga0466967_0010924 Ga0466967_0010924_5059_6165 366
2758 3300046454 Ga0495592_0005257 Ga0495592_0005257_2229_3344 366
2759 3300046454 Ga0495592_0008932 Ga0495592_0008932_274_1374 366
2760 3300046454 Ga0495592_0013853 Ga0495592_0013853_2865_3971 366
2761 3300046454 Ga0495592_0027219 Ga0495592_0027219_920_2026 366
2762 3300046454 Ga0495592_0122502 Ga0495592_0122502_471_1607 366
2763 3300046454 Ga0495592_0162530 Ga0495592_0162530_348_1484 366
2764 3300046455 Ga0495603_0000066 Ga0495603_0000066_11119_12225 366
2765 3300046455 Ga0495603_0029648 Ga0495603_0029648_307_1449 366
2766 3300046459 Ga0495629_0000232 Ga0495629_0000232_41686_42792 366
2767 3300046459 Ga0495629_0000984 Ga0495629_0000984_5298_6404 366
2768 3300046459 Ga0495629_0005261 Ga0495629_0005261_2368_3483 366
2769 3300046459 Ga0495629_0037987 Ga0495629_0037987_1668_2768 366
2770 3300046459 Ga0495629_0088718 Ga0495629_0088718_468_1598 366
2771 3300046459 Ga0495629_0123389 Ga0495629_0123389_484_1608 366
2772 3300046459 Ga0495629_0154691 Ga0495629_0154691_468_1574 366
2773 3300046459 Ga0495629_0162579 Ga0495629_0162579_399_1535 366
2774 3300046459 Ga0495629_0216227 Ga0495629_0216227_48_1178 366
2775 3300046460 Ga0495638_0007934 Ga0495638_0007934_774_1880 366
2776 3300046460 Ga0495638_0024002 Ga0495638_0024002_485_1621 366
2777 3300046461 Ga0495641_0006156 Ga0495641_0006156_6542_7648 366
2778 3300046461 Ga0495641_0016275 Ga0495641_0016275_1895_2995 366
2779 3300046462 Ga0495651_0002916 Ga0495651_0002916_181_1281 366
2780 3300046462 Ga0495651_0012097 Ga0495651_0012097_3817_4923 366
2781 3300046462 Ga0495651_0019985 Ga0495651_0019985_1871_2986 366
2782 3300046462 Ga0495651_0040484 Ga0495651_0040484_965_2101 366
2783 3300046462 Ga0495651_0043242 Ga0495651_0043242_415_1521 366
2784 3300046463 Ga0495653_0000575 Ga0495653_0000575_6639_7745 366
2785 3300046463 Ga0495653_0003920 Ga0495653_0003920_10473_11588 366
2786 3300046463 Ga0495653_0005424 Ga0495653_0005424_8877_9977 366
2787 3300046463 Ga0495653_0026350 Ga0495653_0026350_3399_4523 366
2788 3300046463 Ga0495653_0096053 Ga0495653_0096053_588_1694 366
2789 3300046472 Ga0495580_0009197 Ga0495580_0009197_599_1705 366
2790 3300046472 Ga0495580_0012190 Ga0495580_0012190_3143_4243 366
2791 3300046472 Ga0495580_0039128 Ga0495580_0039128_196_1320 366
2792 3300046472 Ga0495580_0072738 Ga0495580_0072738_783_1889 366
2793 3300046472 Ga0495580_0169932 Ga0495580_0169932_199_1341 366
2794 3300046473 Ga0495582_0001315 Ga0495582_0001315_5424_6530 366
2795 3300046473 Ga0495582_0011416 Ga0495582_0011416_728_1828 366
2796 3300046474 Ga0495605_0065351 Ga0495605_0065351_48_1184 366
2797 3300046475 Ga0495639_0002771 Ga0495639_0002771_5057_6157 366
2798 3300046475 Ga0495639_0010026 Ga0495639_0010026_1516_2622 366
2799 3300046475 Ga0495639_0064686 Ga0495639_0064686_191_1315 366
2800 3300046476 Ga0495662_0000386 Ga0495662_0000386_17334_18440 366
2801 3300046476 Ga0495662_0001495 Ga0495662_0001495_5915_7039 366
2802 3300046476 Ga0495662_0058459 Ga0495662_0058459_357_1457 366
2803 3300046477 Ga0495664_0000799 Ga0495664_0000799_7513_8637 366
2804 3300046477 Ga0495664_0054820 Ga0495664_0054820_192_1298 366
2805 3300046477 Ga0495664_0054969 Ga0495664_0054969_1237_2337 366
2806 3300046477 Ga0495664_0085271 Ga0495664_0085271_744_1880 366
2807 3300046491 Ga0495584_0046225 Ga0495584_0046225_472_1572 366
2808 3300046491 Ga0495584_0064983 Ga0495584_0064983_188_1294 366
2809 3300046492 Ga0495585_0006961 Ga0495585_0006961_3707_4807 366
2810 3300046499 Ga0495594_0001247 Ga0495594_0001247_3221_4327 366
2811 3300046499 Ga0495594_0145684 Ga0495594_0145684_126_1241 366
2812 3300046501 Ga0495607_0032449 Ga0495607_0032449_847_1947 366
2813 3300046507 Ga0495606_0000244 Ga0495606_0000244_33129_34235 366
2814 3300046507 Ga0495606_0012811 Ga0495606_0012811_3946_5082 366
2815 3300046507 Ga0495606_0139686 Ga0495606_0139686_14_1120 366
2816 3300046511 Ga0495608_0001846 Ga0495608_0001846_3557_4672 366
2817 3300046511 Ga0495608_0005567 Ga0495608_0005567_6975_8081 366
2818 3300046511 Ga0495608_0024126 Ga0495608_0024126_2427_3527 366
2819 3300046511 Ga0495608_0071434 Ga0495608_0071434_617_1723 366
2820 3300046511 Ga0495608_0083044 Ga0495608_0083044_808_1944 366
2821 3300046512 Ga0495610_0100160 Ga0495610_0100160_145_1251 366
2822 3300046514 Ga0495618_0001214 Ga0495618_0001214_6676_7800 366
2823 3300046514 Ga0495618_0002693 Ga0495618_0002693_7913_9028 366
2824 3300046514 Ga0495618_0013963 Ga0495618_0013963_3580_4686 366
2825 3300046514 Ga0495618_0072249 Ga0495618_0072249_470_1570 366
2826 3300046516 Ga0495628_0013829 Ga0495628_0013829_4294_5400 366
2827 3300046516 Ga0495628_0230827 Ga0495628_0230827_240_1346 366
2828 3300046517 Ga0495630_0005417 Ga0495630_0005417_433_1533 366
2829 3300046517 Ga0495630_0007116 Ga0495630_0007116_1314_2420 366
2830 3300046517 Ga0495630_0022986 Ga0495630_0022986_175_1299 366
2831 3300046517 Ga0495630_0063912 Ga0495630_0063912_202_1326 366
2832 3300046517 Ga0495630_0174773 Ga0495630_0174773_427_1542 366
2833 3300046520 Ga0495637_0047592 Ga0495637_0047592_213_1313 366
2834 3300046523 Ga0495644_0003829 Ga0495644_0003829_3155_4255 366
2835 3300046524 Ga0495648_0003301 Ga0495648_0003301_9063_10199 366
2836 3300046524 Ga0495648_0005188 Ga0495648_0005188_4278_5393 366
2837 3300046526 Ga0495666_0081739 Ga0495666_0081739_62_1168 366
2838 3300046529 Ga0495652_0011732 Ga0495652_0011732_6659_7765 366
2839 3300046529 Ga0495652_0015242 Ga0495652_0015242_2035_3141 366
2840 3300046529 Ga0495652_0027611 Ga0495652_0027611_362_1477 366
2841 3300046529 Ga0495652_0069786 Ga0495652_0069786_50_1156 366
2842 3300046530 Ga0495654_0017162 Ga0495654_0017162_2379_3485 366
2843 3300046531 Ga0495665_0007254 Ga0495665_0007254_2566_3672 366
2844 3300046531 Ga0495665_0060024 Ga0495665_0060024_51_1151 366
2845 3300046533 Ga0495640_0005884 Ga0495640_0005884_4300_5424 366
2846 3300046533 Ga0495640_0014177 Ga0495640_0014177_1778_2893 366
2847 3300046533 Ga0495640_0029589 Ga0495640_0029589_2279_3385 366
2848 3300046533 Ga0495640_0032341 Ga0495640_0032341_2365_3465 366
2849 3300046535 Ga0495586_0084110 Ga0495586_0084110_482_1582 366
2850 3300046536 Ga0495587_0001032 Ga0495587_0001032_13484_14599 366
2851 3300046536 Ga0495587_0005889 Ga0495587_0005889_4237_5373 366
2852 3300046536 Ga0495587_0018965 Ga0495587_0018965_2458_3564 366
2853 3300046537 Ga0495598_0004557 Ga0495598_0004557_937_2037 366
2854 3300046538 Ga0495609_0081750 Ga0495609_0081750_22_1158 366
2855 3300046543 Ga0495645_0004688 Ga0495645_0004688_8067_9173 366
2856 3300046543 Ga0495645_0019274 Ga0495645_0019274_2336_3472 366
2857 3300046543 Ga0495645_0023333 Ga0495645_0023333_2846_3970 366
2858 3300046543 Ga0495645_0154049 Ga0495645_0154049_56_1162 366
2859 3300046543 Ga0495645_0252320 Ga0495645_0252320_52_1152 366
2860 3300046557 Ga0495622_0005926 Ga0495622_0005926_688_1788 366
2861 3300046557 Ga0495622_0018244 Ga0495622_0018244_1979_3085 366
2862 3300046557 Ga0495622_0050431 Ga0495622_0050431_462_1568 366
2863 3300046557 Ga0495622_0080577 Ga0495622_0080577_229_1365 366
2864 3300046558 Ga0495633_0011600 Ga0495633_0011600_1033_2133 366
2865 3300046559 Ga0495667_0001388 Ga0495667_0001388_362_1468 366
2866 3300046559 Ga0495667_0004682 Ga0495667_0004682_3606_4721 366
2867 3300046559 Ga0495667_0005195 Ga0495667_0005195_706_1806 366
2868 3300046559 Ga0495667_0008027 Ga0495667_0008027_211_1317 366
2869 3300046559 Ga0495667_0030322 Ga0495667_0030322_1562_2668 366
2870 3300046615 Ga0495656_0007167 Ga0495656_0007167_406_1506 366
2871 3300046615 Ga0495656_0066878 Ga0495656_0066878_152_1282 366
2872 3300046642 Ga0495634_0002417 Ga0495634_0002417_1005_2129 366
2873 3300046642 Ga0495634_0002458 Ga0495634_0002458_7846_8952 366
2874 3300046642 Ga0495634_0005107 Ga0495634_0005107_5032_6147 366
2875 3300046642 Ga0495634_0075786 Ga0495634_0075786_570_1676 366
2876 3300046660 Ga0495625_0063832 Ga0495625_0063832_72_1178 366
2877 3300046663 Ga0495635_0002261 Ga0495635_0002261_7360_8466 366
2878 3300046663 Ga0495635_0003059 Ga0495635_0003059_6578_7684 366
2879 3300046663 Ga0495635_0003935 Ga0495635_0003935_2961_4085 366
2880 3300046663 Ga0495635_0004185 Ga0495635_0004185_2582_3697 366
2881 3300046663 Ga0495635_0008567 Ga0495635_0008567_845_1981 366
2882 3300046663 Ga0495635_0010842 Ga0495635_0010842_4817_5917 366
2883 3300046663 Ga0495635_0021171 Ga0495635_0021171_1939_3045 366
2884 3300046664 Ga0495659_0013046 Ga0495659_0013046_764_1864 366
2885 3300046664 Ga0495659_0017997 Ga0495659_0017997_1058_2188 366
2886 3300046665 Ga0495661_0034962 Ga0495661_0034962_1518_2618 366
2887 3300046665 Ga0495661_0119355 Ga0495661_0119355_95_1201 366
2888 3300046674 Ga0495588_0000925 Ga0495588_0000925_6543_7679 366
2889 3300046674 Ga0495588_0009390 Ga0495588_0009390_187_1293 366
2890 3300046674 Ga0495588_0042209 Ga0495588_0042209_163_1293 366
2891 3300046674 Ga0495588_0107111 Ga0495588_0107111_284_1384 366
2892 3300046675 Ga0495657_0002950 Ga0495657_0002950_2330_3445 366
2893 3300046675 Ga0495657_0004169 Ga0495657_0004169_3817_4923 366
2894 3300046675 Ga0495657_0046913 Ga0495657_0046913_1770_2906 366
2895 3300046678 Ga0495599_0020130 Ga0495599_0020130_1423_2559 366
2896 3300046678 Ga0495599_0027135 Ga0495599_0027135_2423_3529 366
2897 3300046678 Ga0495599_0054301 Ga0495599_0054301_288_1394 366
2898 3300046679 Ga0495623_0004733 Ga0495623_0004733_2645_3781 366
2899 3300046679 Ga0495623_0019052 Ga0495623_0019052_1927_3042 366
2900 3300046679 Ga0495623_0024094 Ga0495623_0024094_362_1468 366
2901 3300046679 Ga0495623_0172185 Ga0495623_0172185_147_1253 366
2902 3300046680 Ga0495646_0010522 Ga0495646_0010522_1737_2843 366
2903 3300046680 Ga0495646_0055918 Ga0495646_0055918_100_1215 366
2904 3300046680 Ga0495646_0093364 Ga0495646_0093364_222_1358 366
2905 3300046680 Ga0495646_0098624 Ga0495646_0098624_157_1281 366
2906 3300046680 Ga0495646_0129241 Ga0495646_0129241_281_1381 366
2907 3300046681 Ga0495647_0001619 Ga0495647_0001619_4091_5197 366
2908 3300046681 Ga0495647_0007783 Ga0495647_0007783_1033_2133 366
2909 3300046683 Ga0495658_0003104 Ga0495658_0003104_1058_2164 366
2910 3300046683 Ga0495658_0013306 Ga0495658_0013306_2185_3285 366
2911 3300046683 Ga0495658_0093241 Ga0495658_0093241_658_1764 366
2912 3300046684 Ga0495669_0005200 Ga0495669_0005200_239_1345 366
2913 3300046684 Ga0495669_0038137 Ga0495669_0038137_501_1601 366
2914 3300046689 Ga0495613_0012477 Ga0495613_0012477_2399_3523 366
2915 3300046689 Ga0495613_0015287 Ga0495613_0015287_879_1985 366
2916 3300046689 Ga0495613_0118632 Ga0495613_0118632_734_1834 366
2917 3300046689 Ga0495613_0155648 Ga0495613_0155648_359_1465 366
2918 3300046690 Ga0495624_0009695 Ga0495624_0009695_3579_4703 366
2919 3300046690 Ga0495624_0019005 Ga0495624_0019005_2963_4063 366
2920 3300046690 Ga0495624_0038928 Ga0495624_0038928_607_1713 366
2921 3300046690 Ga0495624_0187887 Ga0495624_0187887_28_1143 366
2922 3300046691 Ga0495670_0000124 Ga0495670_0000124_27928_29028 366
2923 3300046691 Ga0495670_0012397 Ga0495670_0012397_3018_4148 366
2924 3300046691 Ga0495670_0042047 Ga0495670_0042047_1161_2267 366
2925 3300046794 Ga0495589_0102391 Ga0495589_0102391_210_1316 366
2926 3300046809 Ga0495600_0002118 Ga0495600_0002118_8877_9977 366
2927 3300046809 Ga0495600_0004962 Ga0495600_0004962_1254_2390 366
2928 3300046809 Ga0495600_0006845 Ga0495600_0006845_3031_4137 366
2929 3300046809 Ga0495600_0074783 Ga0495600_0074783_1001_2116 366
2930 3300046810 Ga0495660_0024878 Ga0495660_0024878_2152_3258 366
2931 3300047315 Ga0495581_0005581 Ga0495581_0005581_1017_2141 366
2932 3300047315 Ga0495581_0034721 Ga0495581_0034721_362_1468 366
2933 3300047315 Ga0495581_0096386 Ga0495581_0096386_386_1510 366
2934 3300047317 Ga0495604_0003737 Ga0495604_0003737_576_1691 366
2935 3300047317 Ga0495604_0006998 Ga0495604_0006998_6641_7747 366
2936 3300047317 Ga0495604_0013432 Ga0495604_0013432_2891_4027 366
2937 3300047317 Ga0495604_0025232 Ga0495604_0025232_3280_4380 366
2938 3300047317 Ga0495604_0045626 Ga0495604_0045626_782_1918 366
2939 3300047317 Ga0495604_0099532 Ga0495604_0099532_506_1612 366
2940 3300047317 Ga0495604_0119881 Ga0495604_0119881_397_1521 366
2941 3300047317 Ga0495604_0136973 Ga0495604_0136973_78_1184 366
2942 3300047319 Ga0495674_0000895 Ga0495674_0000895_9447_10571 366
2943 3300047319 Ga0495674_0003541 Ga0495674_0003541_6349_7455 366
2944 3300047319 Ga0495674_0005482 Ga0495674_0005482_8602_9738 366
2945 3300047319 Ga0495674_0006060 Ga0495674_0006060_625_1725 366
2946 3300047319 Ga0495674_0030060 Ga0495674_0030060_408_1523 366
2947 3300047319 Ga0495674_0032650 Ga0495674_0032650_3342_4448 366
2948 3300047319 Ga0495674_0098312 Ga0495674_0098312_1348_2454 366
2949 3300047320 Ga0495672_0072341 Ga0495672_0072341_706_1821 366
2950 3300047321 Ga0495676_0092638 Ga0495676_0092638_985_2121 366
2951 3300047321 Ga0495676_0125073 Ga0495676_0125073_145_1245 366
2952 3300047321 Ga0495676_0249991 Ga0495676_0249991_61_1191 366
2953 3300047322 Ga0495680_0000961 Ga0495680_0000961_20429_21544 366
2954 3300047322 Ga0495680_0006684 Ga0495680_0006684_6634_7740 366
2955 3300047322 Ga0495680_0009328 Ga0495680_0009328_7673_8779 366
2956 3300047322 Ga0495680_0026763 Ga0495680_0026763_998_2104 366
2957 3300047443 Ga0495687_006634 Ga0495687_006634_500_1636 366
2958 3300047443 Ga0495687_078870 Ga0495687_078870_29_1135 366
2959 3300047444 Ga0495675_0006984 Ga0495675_0006984_3655_4761 366
2960 3300047444 Ga0495675_0009373 Ga0495675_0009373_1536_2651 366
2961 3300047444 Ga0495675_0024811 Ga0495675_0024811_233_1339 366
2962 3300047471 Ga0495684_0004548 Ga0495684_0004548_6201_7325 366
2963 3300047471 Ga0495684_0012591 Ga0495684_0012591_4394_5518 366
2964 3300047471 Ga0495684_0027300 Ga0495684_0027300_2251_3351 366
2965 3300047471 Ga0495684_0027819 Ga0495684_0027819_3042_4157 366
2966 3300047471 Ga0495684_0031347 Ga0495684_0031347_216_1322 366
2967 3300047472 Ga0495686_0116590 Ga0495686_0116590_241_1347 366
2968 3300047472 Ga0495686_0136968 Ga0495686_0136968_229_1365 366
2969 3300047673 Ga0495593_0015258 Ga0495593_0015258_1813_2919 366
2970 3300047673 Ga0495593_0022245 Ga0495593_0022245_1334_2434 366
2971 3300047673 Ga0495593_0035706 Ga0495593_0035706_355_1461 366
2972 3300047673 Ga0495593_0053468 Ga0495593_0053468_196_1320 366
2973 3300048088 Ga0495602_0018740 Ga0495602_0018740_3146_4252 366
2974 3300048088 Ga0495602_0023870 Ga0495602_0023870_3400_4515 366
2975 3300048088 Ga0495602_0033248 Ga0495602_0033248_2322_3458 366
2976 3300048088 Ga0495602_0164811 Ga0495602_0164811_161_1267 366
2977 3300048089 Ga0495614_0014870 Ga0495614_0014870_1438_2544 366
2978 3300048904 Ga0496101_0018379 Ga0496101_0018379_128_1270 366
2979 3300048904 Ga0496101_0114529 Ga0496101_0114529_878_1984 366
2980 3300048904 Ga0496101_0190424 Ga0496101_0190424_170_1324 366
2981 3300048904 Ga0496101_0258493 Ga0496101_0258493_25_1146 366
2982 3300048905 Ga0496102_0001311 Ga0496102_0001311_15581_16711 366
2983 3300048905 Ga0496102_0353133 Ga0496102_0353133_109_1215 366
2984 3300048905 Ga0496102_0361608 Ga0496102_0361608_48_1184 366
2985 3300048905 Ga0496102_0448791 Ga0496102_0448791_34_1140 366
2986 3300048906 Ga0496103_0005145 Ga0496103_0005145_5446_6546 366
2987 3300048906 Ga0496103_0030667 Ga0496103_0030667_914_2050 366
2988 3300048906 Ga0496103_0063741 Ga0496103_0063741_478_1629 366
2989 3300048906 Ga0496103_0127946 Ga0496103_0127946_209_1339 366
2990 3300048907 Ga0496104_0023614 Ga0496104_0023614_4277_5407 366
2991 3300048907 Ga0496104_0131246 Ga0496104_0131246_367_1488 366
2992 3300048907 Ga0496104_0138976 Ga0496104_0138976_1121_2275 366
2993 3300048907 Ga0496104_0140436 Ga0496104_0140436_1043_2179 366
2994 3300048907 Ga0496104_0206107 Ga0496104_0206107_214_1320 366
2995 3300048908 Ga0496105_0034765 Ga0496105_0034765_682_1818 366
2996 3300048908 Ga0496105_0114196 Ga0496105_0114196_164_1300 366
2997 3300048909 Ga0496106_0000545 Ga0496106_0000545_18919_20025 366
2998 3300048909 Ga0496106_0035798 Ga0496106_0035798_1475_2605 366
2999 3300048909 Ga0496106_0038675 Ga0496106_0038675_128_1282 366
3000 3300048909 Ga0496106_0103568 Ga0496106_0103568_134_1240 366
3001 3300048910 Ga0496107_0004655 Ga0496107_0004655_6660_7814 366
3002 3300048910 Ga0496107_0065099 Ga0496107_0065099_431_1567 366
3003 3300048910 Ga0496107_0157955 Ga0496107_0157955_336_1466 366
3004 3300048910 Ga0496107_0178841 Ga0496107_0178841_111_1232 366
3005 3300048911 Ga0496108_0006861 Ga0496108_0006861_6758_7912 366
3006 3300048911 Ga0496108_0033633 Ga0496108_0033633_2637_3773 366
3007 3300048911 Ga0496108_0033933 Ga0496108_0033933_1952_3052 366
3008 3300048911 Ga0496108_0072725 Ga0496108_0072725_1512_2642 366
3009 3300048911 Ga0496108_0116929 Ga0496108_0116929_253_1359 366
3010 3300048911 Ga0496108_0185307 Ga0496108_0185307_518_1624 366
3011 3300048912 Ga0496109_0061090 Ga0496109_0061090_2265_3419 366
3012 3300048912 Ga0496109_0172895 Ga0496109_0172895_98_1204 366
3013 3300048913 Ga0496110_0023373 Ga0496110_0023373_1720_2820 366
3014 3300048913 Ga0496110_0033603 Ga0496110_0033603_319_1425 366
3015 3300048913 Ga0496110_0060270 Ga0496110_0060270_2132_3286 366
3016 3300048913 Ga0496110_0263228 Ga0496110_0263228_195_1346 366
3017 3300048913 Ga0496110_0355074 Ga0496110_0355074_201_1307 366
3018 3300048914 Ga0496111_0046514 Ga0496111_0046514_1465_2616 366
3019 3300048914 Ga0496111_0061544 Ga0496111_0061544_30_1160 366
3020 3300048915 Ga0496112_0000019 Ga0496112_0000019_28088_29194 366
3021 3300048915 Ga0496112_0005879 Ga0496112_0005879_7215_8321 366
3022 3300048915 Ga0496112_0096815 Ga0496112_0096815_1466_2602 366
3023 3300048915 Ga0496112_0172011 Ga0496112_0172011_671_1825 366
3024 3300048915 Ga0496112_0179462 Ga0496112_0179462_153_1289 366
3025 3300048915 Ga0496112_0181207 Ga0496112_0181207_215_1345 366
3026 3300048915 Ga0496112_0251688 Ga0496112_0251688_49_1155 366
3027 3300048916 Ga0496113_0014807 Ga0496113_0014807_2618_3724 366
3028 3300048916 Ga0496113_0019960 Ga0496113_0019960_1072_2226 366
3029 3300048916 Ga0496113_0206789 Ga0496113_0206789_295_1431 366
3030 3300048917 Ga0496114_0007267 Ga0496114_0007267_7462_8592 366
3031 3300048917 Ga0496114_0036591 Ga0496114_0036591_66_1172 366
3032 3300048917 Ga0496114_0131798 Ga0496114_0131798_291_1412 366
3033 3300048917 Ga0496114_0142358 Ga0496114_0142358_892_1998 366
3034 3300048917 Ga0496114_0148077 Ga0496114_0148077_70_1224 366
3035 3300048918 Ga0496115_0001845 Ga0496115_0001845_4429_5559 366
3036 3300048918 Ga0496115_0008766 Ga0496115_0008766_4635_5786 366
3037 3300048918 Ga0496115_0051878 Ga0496115_0051878_2020_3156 366
3038 3300048918 Ga0496115_0090646 Ga0496115_0090646_1212_2318 366
3039 3300048918 Ga0496115_0278950 Ga0496115_0278950_186_1292 366
3040 3300048919 Ga0496116_0003944 Ga0496116_0003944_8420_9526 366
3041 3300048920 Ga0496117_0028580 Ga0496117_0028580_2982_4088 366
3042 3300048920 Ga0496117_0032581 Ga0496117_0032581_305_1411 366
3043 3300048921 Ga0496118_0004149 Ga0496118_0004149_14764_15870 366
3044 3300048921 Ga0496118_0011970 Ga0496118_0011970_6288_7394 366
3045 3300048921 Ga0496118_0098707 Ga0496118_0098707_348_1454 366
3046 3300048922 Ga0496119_0008983 Ga0496119_0008983_792_1922 366
3047 3300048922 Ga0496119_0039112 Ga0496119_0039112_1134_2270 366
3048 3300048922 Ga0496119_0069459 Ga0496119_0069459_620_1726 366
3049 3300048922 Ga0496119_0095880 Ga0496119_0095880_154_1260 366
3050 3300048922 Ga0496119_0118282 Ga0496119_0118282_118_1254 366
3051 3300048923 Ga0496120_0038187 Ga0496120_0038187_822_1928 366
3052 3300048923 Ga0496120_0040356 Ga0496120_0040356_295_1401 366
3053 3300048924 Ga0496121_0000261 Ga0496121_0000261_65079_66185 366
3054 3300048924 Ga0496121_0000416 Ga0496121_0000416_29609_30754 366
3055 3300048924 Ga0496121_0017585 Ga0496121_0017585_479_1594 366
3056 3300048924 Ga0496121_0026315 Ga0496121_0026315_486_1622 366
3057 3300048924 Ga0496121_0084273 Ga0496121_0084273_352_1488 366
3058 3300048924 Ga0496121_0121828 Ga0496121_0121828_624_1730 366
3059 3300048925 Ga0496122_0001783 Ga0496122_0001783_7083_8213 366
3060 3300048925 Ga0496122_0024803 Ga0496122_0024803_3353_4459 366
3061 3300048925 Ga0496122_0024811 Ga0496122_0024811_1734_2840 366
3062 3300048925 Ga0496122_0129620 Ga0496122_0129620_156_1262 366
3063 3300048926 Ga0496123_0008945 Ga0496123_0008945_6488_7618 366
3064 3300048926 Ga0496123_0035782 Ga0496123_0035782_1501_2607 366
3065 3300048926 Ga0496123_0123641 Ga0496123_0123641_17_1123 366
3066 3300048927 Ga0496124_0001094 Ga0496124_0001094_10328_11434 366
3067 3300048928 Ga0496125_0000420 Ga0496125_0000420_43952_45067 366
3068 3300048928 Ga0496125_0001161 Ga0496125_0001161_19436_20551 366
3069 3300048928 Ga0496125_0004611 Ga0496125_0004611_9038_10144 366
3070 3300048928 Ga0496125_0019636 Ga0496125_0019636_256_1362 366
3071 3300048928 Ga0496125_0048935 Ga0496125_0048935_315_1421 366
3072 3300048928 Ga0496125_0049688 Ga0496125_0049688_942_2048 366
3073 3300048928 Ga0496125_0050516 Ga0496125_0050516_1959_3065 366
3074 3300048929 Ga0496126_0004026 Ga0496126_0004026_14249_15355 366
3075 3300048929 Ga0496126_0018156 Ga0496126_0018156_4379_5485 366
3076 3300048929 Ga0496126_0020204 Ga0496126_0020204_4232_5368 366
3077 3300048929 Ga0496126_0027661 Ga0496126_0027661_180_1286 366
3078 3300048929 Ga0496126_0057931 Ga0496126_0057931_340_1446 366
3079 3300048929 Ga0496126_0059982 Ga0496126_0059982_1640_2770 366
3080 3300048929 Ga0496126_0129344 Ga0496126_0129344_18_1124 366
3081 3300048929 Ga0496126_0235206 Ga0496126_0235206_66_1172 366
3082 3300048929 Ga0496126_0280838 Ga0496126_0280838_260_1366 366
3083 3300049460 Ga0495682_0018103 Ga0495682_0018103_880_2016 366
3084 3300049568 Ga0501031_0002158 Ga0501031_0002158_6668_7774 366
3085 3300049568 Ga0501031_0079654 Ga0501031_0079654_970_2076 366
3086 3300049569 Ga0501032_0000172 Ga0501032_0000172_31488_32594 366
3087 3300049570 Ga0501033_0021419 Ga0501033_0021419_869_1975 366
3088 3300049571 Ga0501034_0000676 Ga0501034_0000676_19102_20208 366
3089 3300049571 Ga0501034_0288505 Ga0501034_0288505_148_1254 366
3090 3300049572 Ga0501036_0000431 Ga0501036_0000431_25818_26924 366
3091 3300049573 Ga0501037_0000755 Ga0501037_0000755_19025_20131 366
3092 3300049574 Ga0501038_0000089 Ga0501038_0000089_41007_42113 366
3093 3300049574 Ga0501038_0028255 Ga0501038_0028255_2303_3409 366
3094 3300049574 Ga0501038_0063535 Ga0501038_0063535_60_1166 366
3095 3300049574 Ga0501038_0085329 Ga0501038_0085329_1019_2125 366
3096 3300049574 Ga0501038_0160582 Ga0501038_0160582_148_1254 366
3097 3300049575 Ga0501039_0000559 Ga0501039_0000559_21043_22149 366
3098 3300049576 Ga0501040_0028523 Ga0501040_0028523_1010_2116 366
3099 3300049578 Ga0501042_0020346 Ga0501042_0020346_1734_2840 366
3100 3300049579 Ga0501043_0006222 Ga0501043_0006222_2393_3499 366
3101 3300049580 Ga0501046_0001949 Ga0501046_0001949_6370_7476 366
3102 3300049581 Ga0501047_0000594 Ga0501047_0000594_16992_18098 366
3103 3300049581 Ga0501047_0204100 Ga0501047_0204100_148_1254 366
3104 3300049581 Ga0501047_0282107 Ga0501047_0282107_252_1358 366
3105 3300049582 Ga0501048_0013422 Ga0501048_0013422_1782_2888 366
3106 3300049582 Ga0501048_0064543 Ga0501048_0064543_556_1731 366
3107 3300049583 Ga0501067_0000445 Ga0501067_0000445_3636_4742 366
3108 3300049584 Ga0501068_0000286 Ga0501068_0000286_5978_7084 366
3109 3300049585 Ga0501069_0000915 Ga0501069_0000915_5167_6273 366
3110 3300049586 Ga0501070_0067515 Ga0501070_0067515_1773_2879 366
3111 3300049586 Ga0501070_0145593 Ga0501070_0145593_762_1937 366
3112 3300049587 Ga0501071_0191197 Ga0501071_0191197_246_1442 366
3113 3300049588 Ga0501072_0005386 Ga0501072_0005386_3012_4118 366
3114 3300049588 Ga0501072_0055521 Ga0501072_0055521_1837_2988 366
3115 3300049588 Ga0501072_0202314 Ga0501072_0202314_259_1455 366
3116 3300049589 Ga0501073_0000055 Ga0501073_0000055_632_1738 366
3117 3300049589 Ga0501073_0038611 Ga0501073_0038611_760_1947 366
3118 3300049590 Ga0501074_0002060 Ga0501074_0002060_3508_4614 366
3119 3300049590 Ga0501074_0130577 Ga0501074_0130577_41_1147 366
3120 3300049593 Ga0501077_0041742 Ga0501077_0041742_650_1756 366
3121 3300049741 Ga0501079_0011896 Ga0501079_0011896_42_1172 366
3122 3300049741 Ga0501079_0037919 Ga0501079_0037919_868_1974 366
3123 3300049741 Ga0501079_0234013 Ga0501079_0234013_69_1274 366
3124 3300049742 Ga0501080_0000841 Ga0501080_0000841_15006_16112 366
3125 3300049742 Ga0501080_0150348 Ga0501080_0150348_870_1976 366
3126 3300049744 Ga0501083_0002306 Ga0501083_0002306_10736_11857 366
3127 3300049744 Ga0501083_0014147 Ga0501083_0014147_1696_2802 366
3128 3300049744 Ga0501083_0018025 Ga0501083_0018025_1555_2661 366
3129 3300049822 Ga0501035_0000150 Ga0501035_0000150_67353_68459 366
3130 3300049822 Ga0501035_0140841 Ga0501035_0140841_273_1379 366
3131 3300049822 Ga0501035_0147948 Ga0501035_0147948_697_1803 366
3132 3300049822 Ga0501035_0189792 Ga0501035_0189792_508_1614 366
3133 3300049822 Ga0501035_0206488 Ga0501035_0206488_341_1516 366
3134 3300049822 Ga0501035_0371660 Ga0501035_0371660_42_1148 366
3135 3300049823 Ga0501044_0000546 Ga0501044_0000546_13246_14352 366
3136 3300049823 Ga0501044_0157903 Ga0501044_0157903_525_1631 366
3137 3300049823 Ga0501044_0168465 Ga0501044_0168465_582_1688 366
3138 3300049823 Ga0501044_0306137 Ga0501044_0306137_148_1254 366
3139 3300049824 Ga0501045_0051344 Ga0501045_0051344_968_2155 366
3140 3300049824 Ga0501045_0174228 Ga0501045_0174228_127_1323 366
3141 3300050490 nmdc:mga03n38_396_c1 nmdc:mga03n38_396_c1_9599_10729 366
3142 3300050491 nmdc:mga00v17_7535_c1 nmdc:mga00v17_7535_c1_3217_4323 366
3143 3300050492 nmdc:mga0yw44_111734_c1 nmdc:mga0yw44_111734_c1_138_1274 366
3144 3300050492 nmdc:mga0yw44_9437_c1 nmdc:mga0yw44_9437_c1_2236_3378 366
3145 3300050508 nmdc:mga09592_92323_c1 nmdc:mga09592_92323_c1_921_2072 366
3146 3300050510 nmdc:mga06r32_2526_c1 nmdc:mga06r32_2526_c1_10825_11976 366
3147 3300050511 nmdc:mga08y16_8805_c1 nmdc:mga08y16_8805_c1_2902_4002 366
3148 3300050512 nmdc:mga0n895_12052_c1 nmdc:mga0n895_12052_c1_5502_6608 366
3149 3300050512 nmdc:mga0n895_142667_c1 nmdc:mga0n895_142667_c1_220_1359 366
3150 3300050513 nmdc:mga0rr50_336770_c1 nmdc:mga0rr50_336770_c1_139_1245 366
3151 3300050515 nmdc:mga0a205_20357_c1 nmdc:mga0a205_20357_c1_4611_5711 366
3152 3300050516 nmdc:mga0sz30_31114_c1 nmdc:mga0sz30_31114_c1_332_1468 366
3153 3300050516 nmdc:mga0sz30_58439_c1 nmdc:mga0sz30_58439_c1_192_1328 366
3154 3300053077 Ga0495601_0001150 Ga0495601_0001150_7558_8682 366
3155 3300053077 Ga0495601_0136291 Ga0495601_0136291_151_1257 366
3156 3300053078 Ga0495612_0000165 Ga0495612_0000165_2962_4086 366
3157 3300053078 Ga0495612_0000796 Ga0495612_0000796_9253_10368 366
3158 3300053078 Ga0495612_0008920 Ga0495612_0008920_2272_3372 366
3159 3300053078 Ga0495612_0066094 Ga0495612_0066094_371_1477 366
3160 3300053079 Ga0500610_0142435 Ga0500610_0142435_14_1120 366
3161 3300053080 Ga0500635_0055771 Ga0500635_0055771_156_1298 366
3162 3300053084 Ga0495595_0000205 Ga0495595_0000205_2666_3781 366
3163 3300053084 Ga0495595_0000830 Ga0495595_0000830_8126_9226 366
3164 3300053084 Ga0495595_0001488 Ga0495595_0001488_1067_2173 366
3165 3300053084 Ga0495595_0012052 Ga0495595_0012052_644_1750 366
3166 3300053084 Ga0495595_0031914 Ga0495595_0031914_572_1693 366
3167 3300053085 Ga0495619_0000458 Ga0495619_0000458_21070_22176 366
3168 3300053085 Ga0495619_0007391 Ga0495619_0007391_1142_2257 366
3169 3300053085 Ga0495619_0011276 Ga0495619_0011276_1333_2484 366
3170 3300053085 Ga0495619_0021404 Ga0495619_0021404_1487_2656 366
3171 3300053085 Ga0495619_0197631 Ga0495619_0197631_33_1139 366
3172 3300053087 Ga0500643_000091 Ga0500643_000091_8897_10033 366
3173 3300053089 Ga0500581_045784 Ga0500581_045784_973_2079 366
3174 3300053093 Ga0500651_0001732 Ga0500651_0001732_2650_3756 366
3175 3300053093 Ga0500651_0015118 Ga0500651_0015118_1325_2461 366
3176 3300053094 Ga0500566_0000095 Ga0500566_0000095_37087_38226 366
3177 3300053094 Ga0500566_0000144 Ga0500566_0000144_26930_28036 366
3178 3300053094 Ga0500566_0000565 Ga0500566_0000565_16906_18012 366
3179 3300053096 Ga0500641_0018346 Ga0500641_0018346_1225_2355 366
3180 3300053097 Ga0500648_111229 Ga0500648_111229_212_1348 366
3181 3300053098 Ga0500650_0033840 Ga0500650_0033840_598_1704 366
3182 3300053098 Ga0500650_0093647 Ga0500650_0093647_169_1305 366
3183 3300053104 Ga0500556_0000005 Ga0500556_0000005_5648_6754 366
3184 3300053104 Ga0500556_0000250 Ga0500556_0000250_14807_15937 366
3185 3300053105 Ga0500557_000028 Ga0500557_000028_20960_22066 366
3186 3300053111 Ga0500572_000337 Ga0500572_000337_14640_15746 366
3187 3300053111 Ga0500572_002615 Ga0500572_002615_2017_3123 366
3188 3300053116 Ga0500592_003205 Ga0500592_003205_1138_2244 366
3189 3300053119 Ga0500595_004366 Ga0500595_004366_4177_5313 366
3190 3300053119 Ga0500595_012611 Ga0500595_012611_2044_3174 366
3191 3300053119 Ga0500595_015485 Ga0500595_015485_1528_2688 366
3192 3300053122 Ga0500608_000314 Ga0500608_000314_4081_5187 366
3193 3300053122 Ga0500608_031166 Ga0500608_031166_236_1372 366
3194 3300053123 Ga0500614_013540 Ga0500614_013540_604_1743 366
3195 3300053125 Ga0500618_002263 Ga0500618_002263_2930_4036 366
3196 3300053130 Ga0500642_0000189 Ga0500642_0000189_179_1285 366
3197 3300053130 Ga0500642_0000275 Ga0500642_0000275_5704_6810 366
3198 3300053130 Ga0500642_0007786 Ga0500642_0007786_1566_2702 366
3199 3300053130 Ga0500642_0027275 Ga0500642_0027275_113_1219 366
3200 3300053131 Ga0500652_000697 Ga0500652_000697_5812_6918 366
3201 3300053134 Ga0500658_0030846 Ga0500658_0030846_223_1329 366
3202 3300053136 Ga0500559_0000791 Ga0500559_0000791_15360_16466 366
3203 3300053136 Ga0500559_0001773 Ga0500559_0001773_5759_6865 366
3204 3300053136 Ga0500559_0022210 Ga0500559_0022210_675_1811 366
3205 3300053139 Ga0500568_0000261 Ga0500568_0000261_5201_6307 366
3206 3300053139 Ga0500568_0012726 Ga0500568_0012726_1309_2454 366
3207 3300053142 Ga0500577_0040972 Ga0500577_0040972_469_1605 366
3208 3300053145 Ga0500586_044008 Ga0500586_044008_146_1264 366
3209 3300053148 Ga0500590_034490 Ga0500590_034490_136_1272 366
3210 3300053148 Ga0500590_066663 Ga0500590_066663_28_1167 366
3211 3300053148 Ga0500590_079023 Ga0500590_079023_294_1400 366
3212 3300053150 Ga0500603_001070 Ga0500603_001070_4263_5405 366
3213 3300053151 Ga0500604_0003206 Ga0500604_0003206_314_1420 366
3214 3300053151 Ga0500604_0009621 Ga0500604_0009621_612_1748 366
3215 3300053153 Ga0500616_0000118 Ga0500616_0000118_109372_110478 366
3216 3300053153 Ga0500616_0073185 Ga0500616_0073185_552_1688 366
3217 3300053154 Ga0500619_004547 Ga0500619_004547_894_2030 366
3218 3300053155 Ga0500620_003706 Ga0500620_003706_962_2098 366
3219 3300053156 Ga0500622_0035929 Ga0500622_0035929_1439_2575 366
3220 3300053159 Ga0500630_029286 Ga0500630_029286_959_2098 366
3221 3300053160 Ga0500633_0012278 Ga0500633_0012278_983_2089 366
3222 3300053160 Ga0500633_0055561 Ga0500633_0055561_11_1147 366
3223 3300053162 Ga0500638_054599 Ga0500638_054599_759_1865 366
3224 3300053163 Ga0500639_018029 Ga0500639_018029_2233_3372 366
3225 3300053177 Ga0500636_0000617 Ga0500636_0000617_14400_15536 366
3226 3300053177 Ga0500636_0001911 Ga0500636_0001911_6526_7632 366
3227 3300053177 Ga0500636_0060693 Ga0500636_0060693_307_1455 366
3228 3300053178 Ga0500637_0000269 Ga0500637_0000269_5874_7016 366
3229 3300053178 Ga0500637_0045624 Ga0500637_0045624_1262_2368 366
3230 3300053178 Ga0500637_0050590 Ga0500637_0050590_201_1307 366
3231 3300053724 Ga0500570_079774 Ga0500570_079774_118_1224 366
3232 3300053725 Ga0500576_005425 Ga0500576_005425_3504_4610 366
3233 3300053729 Ga0500625_021414 Ga0500625_021414_1243_2349 366
3234 3300053730 Ga0500645_013032 Ga0500645_013032_912_2048 366
3235 3300053731 Ga0500609_005057 Ga0500609_005057_14_1120 366
3236 3300053735 Ga0500596_000453 Ga0500596_000453_170_1309 366
3237 3300053735 Ga0500596_002778 Ga0500596_002778_653_1759 366
3238 3300053736 Ga0500599_002540 Ga0500599_002540_20_1126 366
3239 3300053737 Ga0500601_000069 Ga0500601_000069_546_1682 366
3240 3300054114 Ga0501084_0001259 Ga0501084_0001259_9898_11004 366
3241 3300054114 Ga0501084_0173532 Ga0501084_0173532_257_1432 366
3242 3300060353 Ga0501082_0000555 Ga0501082_0000555_13879_14988 366
3243 3300060353 Ga0501082_0005147 Ga0501082_0005147_9090_10196 366
3244 3300060353 Ga0501082_0007160 Ga0501082_0007160_742_1872 366
3245 3300061734 Ga0530510_0013685 Ga0530510_0013685_1239_2390 366
3246 iso_pu_bacteria 2507262055 2507504754 366
3247 iso_pu_bacteria 2508501009 2508546106 366
3248 iso_pu_bacteria 2508501042 2508695040 366
3249 iso_pu_bacteria 2508501128 2509150819 366
3250 iso_pu_bacteria 2511231028 2511399578 366
3251 iso_pu_bacteria 2513237092 2513626681 366
3252 iso_pu_bacteria 2513237095 2513648060 366
3253 iso_pu_bacteria 2513237102 2513702276 366
3254 iso_pu_bacteria 2513237139 2513875724 366
3255 iso_pu_bacteria 2515154112 2515625957 366
3256 iso_pu_bacteria 2528768022 2528850298 366
3257 iso_pu_bacteria 2617270735 2617352955 366
3258 iso_pu_bacteria 2617270741 2617374226 366
3259 iso_pu_bacteria 2791355196 2793063196 366
3260 iso_pu_bacteria 2802429603 2805919400 366
3261 iso_pu_bacteria 2816332527 2818237182 366
3262 iso_pu_bacteria 2824773399 2824779877 366
3263 iso_pu_bacteria 2922386360 2922391918 366
3264 iso_pu_bacteria 2932784394 2932786249 366
3265 iso_pu_bacteria 2932794094 2932794776 366
3266 iso_pu_bacteria 2932801729 2932805414 366
3267 iso_pu_bacteria 2932809354 2932812677 366
3268 iso_pu_bacteria 2932818245 2932823039 366
3269 iso_pu_bacteria 2932828146 2932829487 366
3270 iso_pu_bacteria 2935616580 2935618005 366
3271 iso_pu_bacteria 2935638405 2935641597 366
3272 iso_pu_bacteria 2935648319 2935651600 366
3273 iso_pu_bacteria 2935656913 2935659632 366
3274 iso_pu_bacteria 2935665750 2935669345 366
3275 iso_pu_bacteria 2935675223 2935678059 366
3276 iso_pu_bacteria 2935684952 2935693622 366
3277 iso_pu_bacteria 2935694250 2935701704 366
3278 iso_pu_bacteria 2935713505 2935717011 366
3279 iso_pu_bacteria 2935722832 2935730155 366
3280 iso_pu_bacteria 2935732158 2935738425 366
3281 iso_pu_bacteria 2935741537 2935750213 366
3282 iso_pu_bacteria 2935750917 2935759807 366
3283 iso_pu_bacteria 2935760218 2935764542 366
3284 iso_pu_bacteria 2935801545 2935804451 366
3285 iso_pu_bacteria 2935810662 2935817312 366
3286 iso_pu_bacteria 2935827899 2935831328 366
3287 iso_pu_bacteria 2935837841 2935841937 366
3288 iso_pu_bacteria 2935855204 2935856496 366
3289 iso_pu_bacteria 2935864058 2935870962 366
3290 iso_pu_bacteria 2935873716 2935874478 366
3291 iso_pu_bacteria 2935883170 2935888989 366
3292 iso_pu_bacteria 2935908558 2935910446 366
3293 iso_pu_bacteria 2935916978 2935918268 366
3294 iso_pu_bacteria 2935967501 2935969239 366
3295 iso_pu_bacteria 2935975950 2935978000 366
3296 iso_pu_bacteria 2935984226 2935984700 366
3297 iso_pu_bacteria 2935992306 2935993939 366
3298 iso_pu_bacteria 2936002035 2936005050 366
3299 iso_pu_bacteria 2936011229 2936014048 366
3300 iso_pu_bacteria 2936019824 2936023043 366
3301 iso_pu_bacteria 2936028420 2936031179 366
3302 iso_pu_bacteria 2936037263 2936044109 366
3303 iso_pu_bacteria 2936046547 2936049301 366
3304 iso_pu_bacteria 2936055302 2936055870 366
3305 iso_pu_bacteria 2940556831 2940565739 366
3306 iso_pu_bacteria 2941538514 2941544010 366
3307 iso_pu_bacteria 3005483717 3005490993 366
3308 iso_pu_bacteria 3005506211 3005509641 366
3309 iso_pu_bacteria 3005587118 3005594246 366
3310 iso_pu_bacteria 3005594810 3005602080 366
3311 iso_pu_bacteria 3005710791 3005717833 366
3312 iso_pu_bacteria 3005718088 3005724865 366
3313 iso_pu_bacteria 8016511872 8016518746 366
3314 iso_pu_bacteria 8016630954 8016636182 366
3315 iso_pu_bacteria 8017057580 8017057931 366
3316 iso_pu_bacteria 8019576017 8019577792 366
3317 iso_pu_bacteria 8019597564 8019605861 366
3318 iso_pu_bacteria 8019608314 8019612671 366
3319 iso_pu_bacteria 8019619141 8019622447 366
3320 iso_pu_bacteria 8019629233 8019630667 366
3321 iso_pu_bacteria 8019638758 8019639950 366
3322 iso_pu_bacteria 8019648815 8019651979 366
3323 iso_pu_bacteria 8019668869 8019677263 366
3324 iso_pu_bacteria 8019678201 8019678720 366
3325 2209111006 2214800759 2213830097 367
3326 3300000041 ARcpr5oldR_c000105 ARcpr5oldR_00010512 367
3327 3300000042 ARSoilYngRDRAFT_c00092 ARSoilYngRDRAFT_000923 367
3328 3300000043 ARcpr5yngRDRAFT_c000085 ARcpr5yngRDRAFT_00008512 367
3329 3300000044 ARSoilOldRDRAFT_c000016 ARSoilOldRDRAFT_00001612 367
3330 3300000652 ARCol0yngRDRAFT_1000096 ARCol0yngRDRAFT_100009612 367
3331 3300001990 JGI24737J22298_10000990 JGI24737J22298_100009902 367
3332 3300002076 JGI24749J21850_1000343 JGI24749J21850_10003437 367
3333 3300002076 JGI24749J21850_1006188 JGI24749J21850_10061882 367
3334 3300005289 Ga0065704_10156323 Ga0065704_101563232 367
3335 3300005290 Ga0065712_10016440 Ga0065712_100164403 367
3336 3300005293 Ga0065715_10000443 Ga0065715_1000044315 367
3337 3300005293 Ga0065715_10096504 Ga0065715_100965044 367
3338 3300005327 Ga0070658_10010864 Ga0070658_100108641 367
3339 3300005327 Ga0070658_10025416 Ga0070658_100254162 367
3340 3300005327 Ga0070658_10043589 Ga0070658_100435892 367
3341 3300005328 Ga0070676_10009033 Ga0070676_100090339 367
3342 3300005330 Ga0070690_100011128 Ga0070690_1000111284 367
3343 3300005331 Ga0070670_100154118 Ga0070670_1001541181 367
3344 3300005335 Ga0070666_10094351 Ga0070666_100943511 367
3345 3300005336 Ga0070680_100019564 Ga0070680_1000195642 367
3346 3300005336 Ga0070680_100047915 Ga0070680_1000479153 367
3347 3300005336 Ga0070680_100077207 Ga0070680_1000772071 367
3348 3300005336 Ga0070680_100153664 Ga0070680_1001536641 367
3349 3300005339 Ga0070660_100015510 Ga0070660_1000155104 367
3350 3300005339 Ga0070660_100032520 Ga0070660_1000325202 367
3351 3300005340 Ga0070689_100005254 Ga0070689_1000052549 367
3352 3300005341 Ga0070691_10010936 Ga0070691_100109363 367
3353 3300005343 Ga0070687_100007739 Ga0070687_1000077392 367
3354 3300005343 Ga0070687_100016014 Ga0070687_1000160142 367
3355 3300005344 Ga0070661_100034109 Ga0070661_1000341092 367
3356 3300005353 Ga0070669_100018363 Ga0070669_1000183633 367
3357 3300005353 Ga0070669_100031957 Ga0070669_1000319573 367
3358 3300005354 Ga0070675_100062309 Ga0070675_1000623092 367
3359 3300005356 Ga0070674_100053467 Ga0070674_1000534672 367
3360 3300005364 Ga0070673_100071005 Ga0070673_1000710052 367
3361 3300005365 Ga0070688_100011455 Ga0070688_1000114554 367
3362 3300005365 Ga0070688_100012378 Ga0070688_1000123782 367
3363 3300005366 Ga0070659_100019129 Ga0070659_1000191292 367
3364 3300005366 Ga0070659_100158851 Ga0070659_1001588512 367
3365 3300005366 Ga0070659_100250797 Ga0070659_1002507971 367
3366 3300005367 Ga0070667_100053463 Ga0070667_1000534632 367
3367 3300005434 Ga0070709_10003452 Ga0070709_100034529 367
3368 3300005435 Ga0070714_100009726 Ga0070714_10000972611 367
3369 3300005435 Ga0070714_100050831 Ga0070714_1000508312 367
3370 3300005436 Ga0070713_100000386 Ga0070713_10000038625 367
3371 3300005436 Ga0070713_100154606 Ga0070713_1001546061 367
3372 3300005437 Ga0070710_10010371 Ga0070710_100103712 367
3373 3300005437 Ga0070710_10043511 Ga0070710_100435112 367
3374 3300005438 Ga0070701_10014395 Ga0070701_100143952 367
3375 3300005438 Ga0070701_10032960 Ga0070701_100329602 367
3376 3300005439 Ga0070711_100014050 Ga0070711_1000140504 367
3377 3300005439 Ga0070711_100105954 Ga0070711_1001059542 367
3378 3300005440 Ga0070705_100026217 Ga0070705_1000262173 367
3379 3300005444 Ga0070694_100084477 Ga0070694_1000844772 367
3380 3300005455 Ga0070663_100023489 Ga0070663_1000234894 367
3381 3300005456 Ga0070678_100038617 Ga0070678_1000386173 367
3382 3300005456 Ga0070678_100046087 Ga0070678_1000460872 367
3383 3300005456 Ga0070678_100110336 Ga0070678_1001103362 367
3384 3300005456 Ga0070678_100192076 Ga0070678_1001920762 367
3385 3300005457 Ga0070662_100022584 Ga0070662_1000225841 367
3386 3300005457 Ga0070662_100206953 Ga0070662_1002069531 367
3387 3300005458 Ga0070681_10034908 Ga0070681_100349082 367
3388 3300005458 Ga0070681_10078688 Ga0070681_100786884 367
3389 3300005458 Ga0070681_10215061 Ga0070681_102150611 367
3390 3300005459 Ga0068867_100071366 Ga0068867_1000713662 367
3391 3300005459 Ga0068867_100076736 Ga0068867_1000767361 367
3392 3300005466 Ga0070685_10005781 Ga0070685_100057814 367
3393 3300005466 Ga0070685_10027271 Ga0070685_100272712 367
3394 3300005466 Ga0070685_10046510 Ga0070685_100465101 367
3395 3300005530 Ga0070679_100010513 Ga0070679_1000105133 367
3396 3300005530 Ga0070679_100080404 Ga0070679_1000804041 367
3397 3300005530 Ga0070679_100111902 Ga0070679_1001119022 367
3398 3300005530 Ga0070679_100358068 Ga0070679_1003580682 367
3399 3300005539 Ga0068853_100040080 Ga0068853_1000400802 367
3400 3300005539 Ga0068853_100098833 Ga0068853_1000988332 367
3401 3300005543 Ga0070672_100087531 Ga0070672_1000875312 367
3402 3300005544 Ga0070686_100004747 Ga0070686_1000047474 367
3403 3300005544 Ga0070686_100031156 Ga0070686_1000311563 367
3404 3300005546 Ga0070696_100022107 Ga0070696_1000221072 367
3405 3300005548 Ga0070665_100160054 Ga0070665_1001600542 367
3406 3300005549 Ga0070704_100001223 Ga0070704_10000122311 367
3407 3300005563 Ga0068855_100178690 Ga0068855_1001786902 367
3408 3300005563 Ga0068855_100303923 Ga0068855_1003039231 367
3409 3300005564 Ga0070664_100032460 Ga0070664_1000324608 367
3410 3300005578 Ga0068854_100272883 Ga0068854_1002728831 367
3411 3300005614 Ga0068856_100171814 Ga0068856_1001718142 367
3412 3300005616 Ga0068852_100190583 Ga0068852_1001905834 367
3413 3300005617 Ga0068859_100057107 Ga0068859_1000571072 367
3414 3300005618 Ga0068864_100157810 Ga0068864_1001578102 367
3415 3300005718 Ga0068866_10002984 Ga0068866_100029842 367
3416 3300005718 Ga0068866_10060663 Ga0068866_100606633 367
3417 3300005718 Ga0068866_10072236 Ga0068866_100722362 367
3418 3300005840 Ga0068870_10031475 Ga0068870_100314751 367
3419 3300005842 Ga0068858_100082749 Ga0068858_1000827493 367
3420 3300005843 Ga0068860_100028984 Ga0068860_1000289844 367
3421 3300005844 Ga0068862_100026173 Ga0068862_1000261734 367
3422 3300005844 Ga0068862_100030423 Ga0068862_1000304232 367
3423 3300005937 Ga0081455_10000313 Ga0081455_1000031317 367
3424 3300005937 Ga0081455_10026809 Ga0081455_100268096 367
3425 3300005937 Ga0081455_10046295 Ga0081455_100462952 367
3426 3300006028 Ga0070717_10000430 Ga0070717_100004305 367
3427 3300006028 Ga0070717_10040867 Ga0070717_100408674 367
3428 3300006028 Ga0070717_10179552 Ga0070717_101795521 367
3429 3300006163 Ga0070715_10002480 Ga0070715_100024804 367
3430 3300006173 Ga0070716_100005496 Ga0070716_1000054964 367
3431 3300006175 Ga0070712_100000486 Ga0070712_10000048620 367
3432 3300006237 Ga0097621_100011369 Ga0097621_1000113693 367
3433 3300006237 Ga0097621_100156506 Ga0097621_1001565063 367
3434 3300006237 Ga0097621_100164442 Ga0097621_1001644422 367
3435 3300006358 Ga0068871_100062309 Ga0068871_1000623094 367
3436 3300006358 Ga0068871_100090359 Ga0068871_1000903592 367
3437 3300006844 Ga0075428_100155722 Ga0075428_1001557222 367
3438 3300006846 Ga0075430_100001903 Ga0075430_1000019032 367
3439 3300006847 Ga0075431_100024699 Ga0075431_1000246993 367
3440 3300006847 Ga0075431_100126059 Ga0075431_1001260592 367
3441 3300006871 Ga0075434_100288356 Ga0075434_1002883561 367
3442 3300006880 Ga0075429_100134858 Ga0075429_1001348582 367
3443 3300006880 Ga0075429_100309917 Ga0075429_1003099172 367
3444 3300006931 Ga0097620_100057110 Ga0097620_1000571102 367
3445 3300009011 Ga0105251_10024284 Ga0105251_100242842 367
3446 3300009036 Ga0105244_10077255 Ga0105244_100772551 367
3447 3300009093 Ga0105240_10079613 Ga0105240_100796134 367
3448 3300009093 Ga0105240_10402716 Ga0105240_104027161 367
3449 3300009093 Ga0105240_10425045 Ga0105240_104250451 367
3450 3300009094 Ga0111539_10004667 Ga0111539_1000466719 367
3451 3300009094 Ga0111539_10466147 Ga0111539_104661471 367
3452 3300009098 Ga0105245_10326443 Ga0105245_103264432 367
3453 3300009101 Ga0105247_10017367 Ga0105247_100173672 367
3454 3300009147 Ga0114129_10017061 Ga0114129_100170612 367
3455 3300009147 Ga0114129_10068914 Ga0114129_100689145 367
3456 3300009147 Ga0114129_10189279 Ga0114129_101892793 367
3457 3300009147 Ga0114129_10268116 Ga0114129_102681162 367
3458 3300009148 Ga0105243_10031631 Ga0105243_100316311 367
3459 3300009148 Ga0105243_10086915 Ga0105243_100869152 367
3460 3300009174 Ga0105241_10037412 Ga0105241_100374123 367
3461 3300009177 Ga0105248_10120171 Ga0105248_101201711 367
3462 3300009545 Ga0105237_10437364 Ga0105237_104373641 367
3463 3300009551 Ga0105238_10330648 Ga0105238_103306482 367
3464 3300009553 Ga0105249_10012291 Ga0105249_100122915 367
3465 3300009553 Ga0105249_10412181 Ga0105249_104121811 367
3466 3300010375 Ga0105239_10293883 Ga0105239_102938832 367
3467 3300011119 Ga0105246_10103054 Ga0105246_101030542 367
3468 3300013104 Ga0157370_10064602 Ga0157370_100646023 367
3469 3300013308 Ga0157375_10029577 Ga0157375_100295773 367
3470 3300014325 Ga0163163_10001518 Ga0163163_100015181 367
3471 3300014325 Ga0163163_10112471 Ga0163163_101124712 367
3472 3300014326 Ga0157380_10067319 Ga0157380_100673192 367
3473 3300014968 Ga0157379_10191895 Ga0157379_101918951 367
3474 3300014968 Ga0157379_10370992 Ga0157379_103709921 367
3475 3300017792 Ga0163161_10037237 Ga0163161_100372372 367
3476 3300021384 Ga0213876_10042416 Ga0213876_100424162 367
3477 3300025315 Ga0207697_10017104 Ga0207697_100171043 367
3478 3300025735 Ga0207713_1018221 Ga0207713_10182212 367
3479 3300025898 Ga0207692_10018412 Ga0207692_100184122 367
3480 3300025900 Ga0207710_10017846 Ga0207710_100178462 367
3481 3300025901 Ga0207688_10003340 Ga0207688_100033406 367
3482 3300025901 Ga0207688_10029653 Ga0207688_100296532 367
3483 3300025903 Ga0207680_10026718 Ga0207680_100267186 367
3484 3300025906 Ga0207699_10000580 Ga0207699_1000058015 367
3485 3300025906 Ga0207699_10043170 Ga0207699_100431703 367
3486 3300025906 Ga0207699_10082937 Ga0207699_100829373 367
3487 3300025907 Ga0207645_10010809 Ga0207645_100108092 367
3488 3300025908 Ga0207643_10006188 Ga0207643_100061887 367
3489 3300025909 Ga0207705_10053776 Ga0207705_100537761 367
3490 3300025910 Ga0207684_10195213 Ga0207684_101952131 367
3491 3300025912 Ga0207707_10082304 Ga0207707_100823041 367
3492 3300025913 Ga0207695_10351034 Ga0207695_103510341 367
3493 3300025915 Ga0207693_10005739 Ga0207693_100057392 367
3494 3300025915 Ga0207693_10016937 Ga0207693_100169375 367
3495 3300025915 Ga0207693_10033231 Ga0207693_100332312 367
3496 3300025916 Ga0207663_10059389 Ga0207663_100593891 367
3497 3300025917 Ga0207660_10050924 Ga0207660_100509242 367
3498 3300025917 Ga0207660_10051959 Ga0207660_100519593 367
3499 3300025917 Ga0207660_10102538 Ga0207660_101025382 367
3500 3300025918 Ga0207662_10021184 Ga0207662_100211842 367
3501 3300025919 Ga0207657_10016322 Ga0207657_100163227 367
3502 3300025919 Ga0207657_10063022 Ga0207657_100630221 367
3503 3300025920 Ga0207649_10083231 Ga0207649_100832312 367
3504 3300025921 Ga0207652_10030811 Ga0207652_100308113 367
3505 3300025921 Ga0207652_10086698 Ga0207652_100866981 367
3506 3300025925 Ga0207650_10030467 Ga0207650_100304672 367
3507 3300025926 Ga0207659_10014624 Ga0207659_100146242 367
3508 3300025928 Ga0207700_10001911 Ga0207700_100019113 367
3509 3300025928 Ga0207700_10056151 Ga0207700_100561514 367
3510 3300025929 Ga0207664_10002339 Ga0207664_100023396 367
3511 3300025929 Ga0207664_10037822 Ga0207664_100378225 367
3512 3300025929 Ga0207664_10041979 Ga0207664_100419792 367
3513 3300025931 Ga0207644_10013576 Ga0207644_100135769 367
3514 3300025932 Ga0207690_10028730 Ga0207690_100287302 367
3515 3300025933 Ga0207706_10013252 Ga0207706_100132526 367
3516 3300025934 Ga0207686_10194692 Ga0207686_101946922 367
3517 3300025935 Ga0207709_10122069 Ga0207709_101220691 367
3518 3300025936 Ga0207670_10046212 Ga0207670_100462122 367
3519 3300025938 Ga0207704_10065946 Ga0207704_100659462 367
3520 3300025939 Ga0207665_10010246 Ga0207665_100102463 367
3521 3300025939 Ga0207665_10014078 Ga0207665_100140781 367
3522 3300025940 Ga0207691_10032246 Ga0207691_100322462 367
3523 3300025940 Ga0207691_10149858 Ga0207691_101498582 367
3524 3300025940 Ga0207691_10240513 Ga0207691_102405131 367
3525 3300025941 Ga0207711_10107637 Ga0207711_101076372 367
3526 3300025941 Ga0207711_10116431 Ga0207711_101164313 367
3527 3300025942 Ga0207689_10005044 Ga0207689_100050442 367
3528 3300025949 Ga0207667_10305416 Ga0207667_103054162 367
3529 3300025960 Ga0207651_10100407 Ga0207651_101004072 367
3530 3300025960 Ga0207651_10111583 Ga0207651_101115832 367
3531 3300025972 Ga0207668_10048012 Ga0207668_100480122 367
3532 3300025981 Ga0207640_10188810 Ga0207640_101888102 367
3533 3300025986 Ga0207658_10112104 Ga0207658_101121042 367
3534 3300026067 Ga0207678_10016458 Ga0207678_100164585 367
3535 3300026067 Ga0207678_10023304 Ga0207678_100233044 367
3536 3300026067 Ga0207678_10103124 Ga0207678_101031241 367
3537 3300026067 Ga0207678_10145785 Ga0207678_101457852 367
3538 3300026075 Ga0207708_10002247 Ga0207708_100022479 367
3539 3300026075 Ga0207708_10025846 Ga0207708_100258463 367
3540 3300026088 Ga0207641_10031833 Ga0207641_100318337 367
3541 3300026089 Ga0207648_10006107 Ga0207648_100061077 367
3542 3300026089 Ga0207648_10218661 Ga0207648_102186612 367
3543 3300026095 Ga0207676_10023801 Ga0207676_100238015 367
3544 3300026095 Ga0207676_10222121 Ga0207676_102221212 367
3545 3300026118 Ga0207675_100017703 Ga0207675_1000177033 367
3546 3300026118 Ga0207675_100281719 Ga0207675_1002817191 367
3547 3300026121 Ga0207683_10009326 Ga0207683_100093266 367
3548 3300026121 Ga0207683_10012626 Ga0207683_100126267 367
3549 3300026121 Ga0207683_10209087 Ga0207683_102090872 367
3550 3300026142 Ga0207698_10043189 Ga0207698_100431892 367
3551 3300027695 Ga0209966_1000796 Ga0209966_10007967 367
3552 3300027717 Ga0209998_10010773 Ga0209998_100107731 367
3553 3300027907 Ga0207428_10000664 Ga0207428_1000066422 367
3554 3300028380 Ga0268265_10010547 Ga0268265_100105474 367
3555 3300028381 Ga0268264_10042527 Ga0268264_100425272 367
3556 3300028556 Ga0265337_1000071 Ga0265337_10000714 367
3557 3300028800 Ga0265338_10018373 Ga0265338_100183733 367
3558 3300031235 Ga0265330_10023048 Ga0265330_100230482 367
3559 3300031235 Ga0265330_10023474 Ga0265330_100234742 367
3560 3300031241 Ga0265325_10000119 Ga0265325_1000011943 367
3561 3300031241 Ga0265325_10056179 Ga0265325_100561791 367
3562 3300031241 Ga0265325_10060985 Ga0265325_100609852 367
3563 3300031249 Ga0265339_10000033 Ga0265339_1000003340 367
3564 3300031249 Ga0265339_10002262 Ga0265339_1000226217 367
3565 3300031249 Ga0265339_10075010 Ga0265339_100750104 367
3566 3300031344 Ga0265316_10122350 Ga0265316_101223502 367
3567 3300031595 Ga0265313_10001301 Ga0265313_100013015 367
3568 3300031595 Ga0265313_10006020 Ga0265313_100060203 367
3569 3300031665 Ga0316575_10070914 Ga0316575_100709141 367
3570 3300031711 Ga0265314_10005008 Ga0265314_100050084 367
3571 3300031711 Ga0265314_10038255 Ga0265314_100382553 367
3572 3300031712 Ga0265342_10000717 Ga0265342_1000071723 367
3573 3300032133 Ga0316583_10000114 Ga0316583_1000011419 367
3574 3300034816 Ga0373930_0000082 Ga0373930_0000082_2143_3252 367
3575 3300034816 Ga0373930_0006103 Ga0373930_0006103_206_1309 367
3576 3300034817 Ga0373948_0000469 Ga0373948_0000469_3250_4359 367
3577 3300034819 Ga0373958_0000063 Ga0373958_0000063_1803_2912 367
3578 3300034820 Ga0373959_0000620 Ga0373959_0000620_2665_3774 367
3579 3300034957 Ga0373938_0001127 Ga0373938_0001127_2418_3527 367
3580 3300035084 Ga0373928_0000048 Ga0373928_0000048_2597_3706 367
3581 3300035085 Ga0373929_0000056 Ga0373929_0000056_6409_7518 367
3582 3300035088 Ga0373940_0000527 Ga0373940_0000527_3277_4386 367
3583 3300035090 Ga0373949_0000558 Ga0373949_0000558_9432_10541 367
3584 3300035091 Ga0373951_0000521 Ga0373951_0000521_7584_8693 367
3585 3300035092 Ga0373952_0002577 Ga0373952_0002577_1529_2638 367
3586 3300035111 Ga0373923_0014359 Ga0373923_0014359_741_1844 367
3587 3300035112 Ga0373932_0002948 Ga0373932_0002948_165_1268 367
3588 3300035112 Ga0373932_0004021 Ga0373932_0004021_2078_3187 367
3589 3300035114 Ga0373939_0004937 Ga0373939_0004937_931_2040 367
3590 3300035115 Ga0373941_0000282 Ga0373941_0000282_7335_8444 367
3591 3300035115 Ga0373941_0005954 Ga0373941_0005954_1405_2508 367
3592 3300035116 Ga0373945_0009632 Ga0373945_0009632_501_1604 367
3593 3300035116 Ga0373945_0014508 Ga0373945_0014508_620_1732 367
3594 3300035119 Ga0373956_0011092 Ga0373956_0011092_871_1974 367
3595 3300035121 Ga0373960_0000021 Ga0373960_0000021_6131_7240 367
3596 3300035170 Ga0373943_0015825 Ga0373943_0015825_1045_2157 367
3597 3300035170 Ga0373943_0060824 Ga0373943_0060824_517_1620 367
3598 3300035170 Ga0373943_0067068 Ga0373943_0067068_64_1170 367
3599 3300035171 Ga0373946_0070011 Ga0373946_0070011_81_1187 367
3600 3300035172 Ga0373955_0181116 Ga0373955_0181116_37_1140 367
3601 3300035207 Ga0373942_0000259 Ga0373942_0000259_11882_12991 367
3602 3300035241 Ga0373961_0000771 Ga0373961_0000771_9511_10620 367
3603 3300035241 Ga0373961_0008394 Ga0373961_0008394_1375_2478 367
3604 3300035242 Ga0373962_0003997 Ga0373962_0003997_819_1928 367
3605 3300035242 Ga0373962_0009530 Ga0373962_0009530_181_1284 367
3606 3300035410 Ga0373924_0041993 Ga0373924_0041993_215_1366 367
3607 3300035691 Ga0373931_0008064 Ga0373931_0008064_3678_4784 367
3608 3300035691 Ga0373931_0054155 Ga0373931_0054155_417_1520 367
3609 3300035692 Ga0373935_0052649 Ga0373935_0052649_58_1161 367
3610 3300035692 Ga0373935_0185065 Ga0373935_0185065_100_1203 367
3611 3300035692 Ga0373935_0251315 Ga0373935_0251315_100_1209 367
3612 3300035695 Ga0373927_0010580 Ga0373927_0010580_924_2027 367
3613 3300035695 Ga0373927_0036047 Ga0373927_0036047_828_1940 367
3614 3300035695 Ga0373927_0051781 Ga0373927_0051781_621_1799 367
3615 3300035724 Ga0373933_0044881 Ga0373933_0044881_1323_2426 367
3616 3300035725 Ga0373947_0066077 Ga0373947_0066077_427_1530 367
3617 3300036401 Ga0373937_0011614 Ga0373937_0011614_735_1838 367
3618 3300036401 Ga0373937_0019043 Ga0373937_0019043_4322_5425 367
3619 3300036401 Ga0373937_0056668 Ga0373937_0056668_1770_2873 367
3620 3300037068 Ga0373925_0012775 Ga0373925_0012775_1124_2227 367
3621 3300037068 Ga0373925_0090224 Ga0373925_0090224_239_1351 367
3622 3300037068 Ga0373925_0195958 Ga0373925_0195958_161_1264 367
3623 3300039437 Ga0436365_1850502 Ga0436365_1850502_237_1346 367
3624 3300039438 Ga0436360_0320074 Ga0436360_0320074_673_1779 367
3625 3300039447 Ga0436361_1034319 Ga0436361_1034319_2511_3617 367
3626 3300042008 Ga0439450_004952 Ga0439450_004952_108_1211 367
3627 3300042876 Ga0451577_0108786 Ga0451577_0108786_873_1982 367
3628 3300044694 Ga0466963_0011055 Ga0466963_0011055_2535_3737 367
3629 3300044712 Ga0453684_0088136 Ga0453684_0088136_289_1398 367
3630 3300045049 Ga0466959_0026696 Ga0466959_0026696_2043_3245 367
3631 3300045051 Ga0451576_0022529 Ga0451576_0022529_4099_5208 367
3632 3300045836 Ga0466958_0014174 Ga0466958_0014174_445_1647 367
3633 3300046454 Ga0495592_0038633 Ga0495592_0038633_2362_3465 367
3634 3300046459 Ga0495629_0000393 Ga0495629_0000393_23457_24560 367
3635 3300046459 Ga0495629_0176509 Ga0495629_0176509_283_1395 367
3636 3300046461 Ga0495641_0046479 Ga0495641_0046479_711_1814 367
3637 3300046462 Ga0495651_0069149 Ga0495651_0069149_800_1903 367
3638 3300046462 Ga0495651_0101772 Ga0495651_0101772_503_1606 367
3639 3300046473 Ga0495582_0050350 Ga0495582_0050350_548_1669 367
3640 3300046475 Ga0495639_0100620 Ga0495639_0100620_128_1249 367
3641 3300046476 Ga0495662_0033677 Ga0495662_0033677_266_1390 367
3642 3300046477 Ga0495664_0052243 Ga0495664_0052243_1114_2217 367
3643 3300046491 Ga0495584_0054483 Ga0495584_0054483_281_1393 367
3644 3300046499 Ga0495594_0045171 Ga0495594_0045171_1128_2231 367
3645 3300046511 Ga0495608_0032057 Ga0495608_0032057_1955_3058 367
3646 3300046516 Ga0495628_0040855 Ga0495628_0040855_1183_2334 367
3647 3300046529 Ga0495652_0041837 Ga0495652_0041837_675_1778 367
3648 3300046529 Ga0495652_0081130 Ga0495652_0081130_1270_2379 367
3649 3300046531 Ga0495665_0037231 Ga0495665_0037231_1447_2550 367
3650 3300046531 Ga0495665_0143117 Ga0495665_0143117_28_1137 367
3651 3300046536 Ga0495587_0022441 Ga0495587_0022441_1278_2381 367
3652 3300046539 Ga0495621_0061208 Ga0495621_0061208_116_1228 367
3653 3300046543 Ga0495645_0000411 Ga0495645_0000411_4859_5962 367
3654 3300046558 Ga0495633_0034992 Ga0495633_0034992_1115_2227 367
3655 3300046559 Ga0495667_0004098 Ga0495667_0004098_4043_5194 367
3656 3300046559 Ga0495667_0175030 Ga0495667_0175030_91_1194 367
3657 3300046648 Ga0495611_0012895 Ga0495611_0012895_2293_3405 367
3658 3300046663 Ga0495635_0046763 Ga0495635_0046763_180_1283 367
3659 3300046678 Ga0495599_0006418 Ga0495599_0006418_5001_6152 367
3660 3300046683 Ga0495658_0044481 Ga0495658_0044481_817_1920 367
3661 3300046683 Ga0495658_0139335 Ga0495658_0139335_244_1347 367
3662 3300046689 Ga0495613_0059509 Ga0495613_0059509_758_1861 367
3663 3300046690 Ga0495624_0025324 Ga0495624_0025324_444_1547 367
3664 3300046690 Ga0495624_0100624 Ga0495624_0100624_532_1635 367
3665 3300046691 Ga0495670_0009262 Ga0495670_0009262_3680_4792 367
3666 3300046809 Ga0495600_0011108 Ga0495600_0011108_817_1920 367
3667 3300047315 Ga0495581_0022293 Ga0495581_0022293_945_2048 367
3668 3300047317 Ga0495604_0016972 Ga0495604_0016972_1507_2658 367
3669 3300047317 Ga0495604_0074879 Ga0495604_0074879_332_1435 367
3670 3300047319 Ga0495674_0135324 Ga0495674_0135324_164_1276 367
3671 3300047319 Ga0495674_0272492 Ga0495674_0272492_29_1132 367
3672 3300047321 Ga0495676_0098203 Ga0495676_0098203_140_1261 367
3673 3300047322 Ga0495680_0005907 Ga0495680_0005907_7246_8349 367
3674 3300047322 Ga0495680_0056862 Ga0495680_0056862_1010_2113 367
3675 3300047322 Ga0495680_0084778 Ga0495680_0084778_132_1235 367
3676 3300047445 Ga0495677_0063268 Ga0495677_0063268_169_1278 367
3677 3300047471 Ga0495684_0078766 Ga0495684_0078766_259_1410 367
3678 3300047673 Ga0495593_0113650 Ga0495593_0113650_56_1159 367
3679 3300048088 Ga0495602_0000965 Ga0495602_0000965_26609_27712 367
3680 3300048089 Ga0495614_0100795 Ga0495614_0100795_12_1115 367
3681 3300048903 Ga0496100_0229079 Ga0496100_0229079_85_1197 367
3682 3300048904 Ga0496101_0045678 Ga0496101_0045678_1372_2484 367
3683 3300048904 Ga0496101_0050859 Ga0496101_0050859_442_1551 367
3684 3300048904 Ga0496101_0216038 Ga0496101_0216038_148_1317 367
3685 3300048904 Ga0496101_0272497 Ga0496101_0272497_144_1247 367
3686 3300048905 Ga0496102_0080991 Ga0496102_0080991_1241_2350 367
3687 3300048905 Ga0496102_0151895 Ga0496102_0151895_878_1990 367
3688 3300048906 Ga0496103_0016501 Ga0496103_0016501_177_1289 367
3689 3300048907 Ga0496104_0000140 Ga0496104_0000140_28632_29735 367
3690 3300048907 Ga0496104_0004257 Ga0496104_0004257_3197_4336 367
3691 3300048907 Ga0496104_0100464 Ga0496104_0100464_222_1334 367
3692 3300048907 Ga0496104_0271785 Ga0496104_0271785_341_1444 367
3693 3300048908 Ga0496105_0000380 Ga0496105_0000380_24141_25253 367
3694 3300048908 Ga0496105_0000576 Ga0496105_0000576_7216_8319 367
3695 3300048909 Ga0496106_0017571 Ga0496106_0017571_1961_3073 367
3696 3300048909 Ga0496106_0031474 Ga0496106_0031474_450_1559 367
3697 3300048910 Ga0496107_0056408 Ga0496107_0056408_1531_2640 367
3698 3300048910 Ga0496107_0239521 Ga0496107_0239521_97_1203 367
3699 3300048911 Ga0496108_0003527 Ga0496108_0003527_8913_10025 367
3700 3300048911 Ga0496108_0038687 Ga0496108_0038687_1215_2318 367
3701 3300048912 Ga0496109_0000239 Ga0496109_0000239_9597_10709 367
3702 3300048912 Ga0496109_0005738 Ga0496109_0005738_2510_3613 367
3703 3300048913 Ga0496110_0019956 Ga0496110_0019956_3103_4215 367
3704 3300048914 Ga0496111_0000118 Ga0496111_0000118_9309_10421 367
3705 3300048914 Ga0496111_0003424 Ga0496111_0003424_4397_5506 367
3706 3300048914 Ga0496111_0179964 Ga0496111_0179964_293_1396 367
3707 3300048914 Ga0496111_0193324 Ga0496111_0193324_325_1434 367
3708 3300048915 Ga0496112_0002190 Ga0496112_0002190_7377_8480 367
3709 3300048915 Ga0496112_0004513 Ga0496112_0004513_2957_4069 367
3710 3300048915 Ga0496112_0059395 Ga0496112_0059395_75_1178 367
3711 3300048915 Ga0496112_0183328 Ga0496112_0183328_632_1741 367
3712 3300048916 Ga0496113_0002933 Ga0496113_0002933_416_1528 367
3713 3300048916 Ga0496113_0005641 Ga0496113_0005641_5831_6934 367
3714 3300048916 Ga0496113_0107723 Ga0496113_0107723_663_1772 367
3715 3300048916 Ga0496113_0238835 Ga0496113_0238835_75_1178 367
3716 3300048917 Ga0496114_0028502 Ga0496114_0028502_2452_3555 367
3717 3300048917 Ga0496114_0285620 Ga0496114_0285620_60_1199 367
3718 3300048918 Ga0496115_0027324 Ga0496115_0027324_2949_4052 367
3719 3300048918 Ga0496115_0083033 Ga0496115_0083033_40_1152 367
3720 3300048918 Ga0496115_0097888 Ga0496115_0097888_1028_2131 367
3721 3300049568 Ga0501031_0018296 Ga0501031_0018296_2395_3498 367
3722 3300049568 Ga0501031_0035636 Ga0501031_0035636_363_1478 367
3723 3300049568 Ga0501031_0041845 Ga0501031_0041845_510_1613 367
3724 3300049569 Ga0501032_0027935 Ga0501032_0027935_2098_3201 367
3725 3300049569 Ga0501032_0081469 Ga0501032_0081469_835_1938 367
3726 3300049569 Ga0501032_0126055 Ga0501032_0126055_405_1508 367
3727 3300049570 Ga0501033_0012923 Ga0501033_0012923_2288_3391 367
3728 3300049570 Ga0501033_0107452 Ga0501033_0107452_185_1288 367
3729 3300049571 Ga0501034_0000270 Ga0501034_0000270_46336_47439 367
3730 3300049571 Ga0501034_0003680 Ga0501034_0003680_5354_6457 367
3731 3300049571 Ga0501034_0044021 Ga0501034_0044021_598_1701 367
3732 3300049571 Ga0501034_0074311 Ga0501034_0074311_1920_3023 367
3733 3300049571 Ga0501034_0106224 Ga0501034_0106224_1474_2577 367
3734 3300049571 Ga0501034_0209763 Ga0501034_0209763_149_1252 367
3735 3300049571 Ga0501034_0466808 Ga0501034_0466808_45_1148 367
3736 3300049572 Ga0501036_0000325 Ga0501036_0000325_21555_22658 367
3737 3300049572 Ga0501036_0009265 Ga0501036_0009265_4350_5465 367
3738 3300049572 Ga0501036_0015408 Ga0501036_0015408_3436_4539 367
3739 3300049573 Ga0501037_0003704 Ga0501037_0003704_8883_9986 367
3740 3300049573 Ga0501037_0019304 Ga0501037_0019304_2401_3504 367
3741 3300049573 Ga0501037_0021833 Ga0501037_0021833_2531_3646 367
3742 3300049573 Ga0501037_0083035 Ga0501037_0083035_846_1949 367
3743 3300049573 Ga0501037_0142987 Ga0501037_0142987_385_1488 367
3744 3300049574 Ga0501038_0057515 Ga0501038_0057515_926_2041 367
3745 3300049574 Ga0501038_0079564 Ga0501038_0079564_526_1629 367
3746 3300049574 Ga0501038_0154863 Ga0501038_0154863_203_1306 367
3747 3300049575 Ga0501039_0026996 Ga0501039_0026996_164_1267 367
3748 3300049575 Ga0501039_0045634 Ga0501039_0045634_1863_2966 367
3749 3300049575 Ga0501039_0172423 Ga0501039_0172423_243_1346 367
3750 3300049575 Ga0501039_0333710 Ga0501039_0333710_68_1171 367
3751 3300049579 Ga0501043_0005921 Ga0501043_0005921_6627_7730 367
3752 3300049579 Ga0501043_0009335 Ga0501043_0009335_1443_2546 367
3753 3300049579 Ga0501043_0033851 Ga0501043_0033851_124_1239 367
3754 3300049579 Ga0501043_0134713 Ga0501043_0134713_140_1255 367
3755 3300049580 Ga0501046_0013725 Ga0501046_0013725_2394_3497 367
3756 3300049580 Ga0501046_0028623 Ga0501046_0028623_317_1432 367
3757 3300049580 Ga0501046_0078424 Ga0501046_0078424_1370_2476 367
3758 3300049581 Ga0501047_0000161 Ga0501047_0000161_44116_45219 367
3759 3300049581 Ga0501047_0004487 Ga0501047_0004487_848_1951 367
3760 3300049581 Ga0501047_0058693 Ga0501047_0058693_460_1620 367
3761 3300049581 Ga0501047_0067367 Ga0501047_0067367_1859_2962 367
3762 3300049581 Ga0501047_0218742 Ga0501047_0218742_40_1143 367
3763 3300049582 Ga0501048_0000030 Ga0501048_0000030_31855_32958 367
3764 3300049582 Ga0501048_0111085 Ga0501048_0111085_816_1919 367
3765 3300049584 Ga0501068_0017894 Ga0501068_0017894_1723_2826 367
3766 3300049584 Ga0501068_0090490 Ga0501068_0090490_683_1786 367
3767 3300049585 Ga0501069_0023739 Ga0501069_0023739_523_1629 367
3768 3300049585 Ga0501069_0101520 Ga0501069_0101520_507_1610 367
3769 3300049585 Ga0501069_0141878 Ga0501069_0141878_202_1305 367
3770 3300049586 Ga0501070_0005933 Ga0501070_0005933_922_2028 367
3771 3300049586 Ga0501070_0006643 Ga0501070_0006643_4439_5542 367
3772 3300049586 Ga0501070_0019925 Ga0501070_0019925_2954_4096 367
3773 3300049586 Ga0501070_0020096 Ga0501070_0020096_1280_2386 367
3774 3300049586 Ga0501070_0028804 Ga0501070_0028804_2154_3257 367
3775 3300049586 Ga0501070_0041477 Ga0501070_0041477_1804_2907 367
3776 3300049588 Ga0501072_0001354 Ga0501072_0001354_11540_12649 367
3777 3300049588 Ga0501072_0104025 Ga0501072_0104025_472_1575 367
3778 3300049588 Ga0501072_0217356 Ga0501072_0217356_289_1392 367
3779 3300049589 Ga0501073_0025861 Ga0501073_0025861_1683_2786 367
3780 3300049589 Ga0501073_0033513 Ga0501073_0033513_2070_3173 367
3781 3300049589 Ga0501073_0126953 Ga0501073_0126953_556_1659 367
3782 3300049590 Ga0501074_0002024 Ga0501074_0002024_2796_3899 367
3783 3300049590 Ga0501074_0007017 Ga0501074_0007017_777_1880 367
3784 3300049590 Ga0501074_0070376 Ga0501074_0070376_46_1149 367
3785 3300049591 Ga0501075_0177777 Ga0501075_0177777_233_1342 367
3786 3300049592 Ga0501076_0125059 Ga0501076_0125059_403_1506 367
3787 3300049593 Ga0501077_0056811 Ga0501077_0056811_728_1834 367
3788 3300049741 Ga0501079_0018135 Ga0501079_0018135_2573_3676 367
3789 3300049741 Ga0501079_0069758 Ga0501079_0069758_964_2067 367
3790 3300049742 Ga0501080_0000181 Ga0501080_0000181_33416_34519 367
3791 3300049742 Ga0501080_0024721 Ga0501080_0024721_1673_2788 367
3792 3300049742 Ga0501080_0040727 Ga0501080_0040727_2531_3637 367
3793 3300049742 Ga0501080_0044725 Ga0501080_0044725_2950_4053 367
3794 3300049742 Ga0501080_0054823 Ga0501080_0054823_2466_3626 367
3795 3300049744 Ga0501083_0000423 Ga0501083_0000423_5264_6367 367
3796 3300049744 Ga0501083_0164512 Ga0501083_0164512_75_1178 367
3797 3300049822 Ga0501035_0002250 Ga0501035_0002250_406_1512 367
3798 3300049822 Ga0501035_0037722 Ga0501035_0037722_749_1909 367
3799 3300049822 Ga0501035_0041151 Ga0501035_0041151_883_1986 367
3800 3300049822 Ga0501035_0061662 Ga0501035_0061662_1606_2709 367
3801 3300049822 Ga0501035_0146904 Ga0501035_0146904_412_1527 367
3802 3300049823 Ga0501044_0003346 Ga0501044_0003346_16895_18037 367
3803 3300049823 Ga0501044_0043641 Ga0501044_0043641_397_1500 367
3804 3300049823 Ga0501044_0061297 Ga0501044_0061297_2377_3480 367
3805 3300049823 Ga0501044_0108936 Ga0501044_0108936_94_1197 367
3806 3300049823 Ga0501044_0134958 Ga0501044_0134958_947_2107 367
3807 3300050492 nmdc:mga0yw44_15237_c1 nmdc:mga0yw44_15237_c1_1214_2323 367
3808 3300050507 nmdc:mga05p37_133211_c1 nmdc:mga05p37_133211_c1_780_1916 367
3809 3300050507 nmdc:mga05p37_61584_c1 nmdc:mga05p37_61584_c1_97_1209 367
3810 3300050508 nmdc:mga09592_228495_c1 nmdc:mga09592_228495_c1_295_1407 367
3811 3300050509 nmdc:mga0qj67_142371_c1 nmdc:mga0qj67_142371_c1_242_1378 367
3812 3300050509 nmdc:mga0qj67_35861_c1 nmdc:mga0qj67_35861_c1_305_1411 367
3813 3300050509 nmdc:mga0qj67_688_c1 nmdc:mga0qj67_688_c1_15210_16343 367
3814 3300050510 nmdc:mga06r32_391079_c1 nmdc:mga06r32_391079_c1_50_1156 367
3815 3300050511 nmdc:mga08y16_3102_c1 nmdc:mga08y16_3102_c1_9830_10939 367
3816 3300050511 nmdc:mga08y16_366768_c1 nmdc:mga08y16_366768_c1_94_1206 367
3817 3300050511 nmdc:mga08y16_76316_c1 nmdc:mga08y16_76316_c1_1501_2610 367
3818 3300050513 nmdc:mga0rr50_180069_c1 nmdc:mga0rr50_180069_c1_528_1631 367
3819 3300053077 Ga0495601_0000515 Ga0495601_0000515_16845_17948 367
3820 3300053078 Ga0495612_0004422 Ga0495612_0004422_3598_4701 367
3821 3300053084 Ga0495595_0003119 Ga0495595_0003119_1466_2617 367
3822 3300053084 Ga0495595_0004564 Ga0495595_0004564_4275_5378 367
3823 3300053085 Ga0495619_0000016 Ga0495619_0000016_228700_229803 367
3824 3300053085 Ga0495619_0000292 Ga0495619_0000292_13745_14848 367
3825 3300053085 Ga0495619_0000804 Ga0495619_0000804_5006_6109 367
3826 3300053085 Ga0495619_0029075 Ga0495619_0029075_263_1408 367
3827 3300053098 Ga0500650_0091863 Ga0500650_0091863_65_1168 367
3828 3300054114 Ga0501084_0158080 Ga0501084_0158080_763_1866 367
3829 3300060353 Ga0501082_0040987 Ga0501082_0040987_1432_2535 367
3830 3300060353 Ga0501082_0052557 Ga0501082_0052557_1065_2168 367
3831 3300060353 Ga0501082_0077678 Ga0501082_0077678_1664_2770 367
3832 3300060353 Ga0501082_0108075 Ga0501082_0108075_314_1429 367
3833 3300061734 Ga0530510_0042046 Ga0530510_0042046_288_1394 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06559

DCD_N

2'-deoxycytidine 5'-triphosphate deaminase (DCD) N-terminal domain

86

249

0.99

PF22569

DCD_C

2'-deoxycytidine 5'-triphosphate deaminase (DCD), C-terminal domain

253

443

0.98

PF22769

DCD

dCTP deaminase-like

89

248

0.96

PF22769

DCD

dCTP deaminase-like

251

416

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r9q-assembly2.cif.gz_C crystal structure of 2'-deoxycytidine 5'-triphosphate deaminase from agrobacterium tumefaciens 0.9803 8 343
2r9q-assembly2.cif.gz_C crystal structure of 2'-deoxycytidine 5'-triphosphate deaminase from agrobacterium tumefaciens 0.9774 8 343
2r9q-assembly2.cif.gz_A crystal structure of 2'-deoxycytidine 5'-triphosphate deaminase from agrobacterium tumefaciens 0.9754 8 343
2r9q-assembly3.cif.gz_D crystal structure of 2'-deoxycytidine 5'-triphosphate deaminase from agrobacterium tumefaciens 0.9752 8 338
2r9q-assembly2.cif.gz_A crystal structure of 2'-deoxycytidine 5'-triphosphate deaminase from agrobacterium tumefaciens 0.9725 8 343
ID Description Score Start End Superfamily
2r9qC01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9847 8 171 2.70.40.10
2r9qC01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9787 8 171 2.70.40.10
2r9qA02 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9557 172 343 2.70.40.10
2r9qA02 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.95 172 343 2.70.40.10
4xjcF00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8131 12 167 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A355WH11-F1-model_v4 2'-deoxycytidine 5'-triphosphate deaminase (EC 3.5.4.13) 1.001 89 157 GO:0008829
GO:0009394
GO:0015949
AF-A0A528CW70-F1-model_v4 2'-deoxycytidine 5'-triphosphate deaminase (EC 3.5.4.13) 0.9964 80 180 GO:0008829
GO:0009394
AF-A0A382PC59-F1-model_v4 2'-deoxycytidine 5'-triphosphate deaminase N-terminal domain-containing protein 0.9915 11 153 GO:0008829
GO:0009394
AF-A0A2E1PEU8-F1-model_v4 2-deoxycytidine 5-triphosphate deaminase (EC 3.5.4.13) 0.9907 12 170 GO:0008829
GO:0009394
AF-A0A528P1F0-F1-model_v4 deleted 0.9906 7 170

Feature Viewer

pLDDT pTM Quality
89.31 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map