F497217

General Info

Members Datasets Scaffolds Average Seq Length
3091 1057 2667 371

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10072199|Ga0207670_100721992
Length 432
Sequence MVGSVLMQRMREERDFDLIEPVFFSASNTGGAGPAIGRDTGPLKDANNAGAFAGLDAIVTCQGGDWTTAMYPKLRDSGWNGYWIDAAKTLRMKDDAVIILDPVNRPVIDAAIAGGIRNYIGGNCTVSLMMMALAGLLQRDLIEWMTCMTYQAASGAGAQNMRELLHQMGDAHLAAKSLLDDPNSAILDIDREVAGILRDESFPTQHFGVPLAGSLIPWIDKDMGNGMSLEEWKGGAETNKILGRGANNAIPVDSLCVRIGAMRCHSQALTIKLRRDVPLAEIETLLDDANEWVRVIPNRREESVRELTPAAVTGKLSIPIGRLRKLAMGPEYLGAFTVGDQLLWGAAATAHGANLALEGHWITPSGAGNRTATCRKRCKRGEPAPGAAFSEASCSGVGASGRCRSLRRRQERNTAACHAVPLHLVGSASAAR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
11 2511231004 Pseudomonas sp. GM102 Isolate Nodule
12 2511231006 Pseudomonas sp. GM17 Isolate Nodule
13 2511231007 Pseudomonas sp. GM18 Isolate Nodule
14 2511231008 Pseudomonas sp. GM21 Isolate Nodule
15 2511231010 Pseudomonas sp. GM25 Isolate Nodule
16 2511231011 Pseudomonas sp. GM30 Isolate Nodule
17 2511231012 Pseudomonas sp. GM33 Isolate Nodule
18 2511231014 Pseudomonas sp. GM48 Isolate Nodule
19 2511231015 Pseudomonas sp. GM49 Isolate Nodule
20 2511231016 Pseudomonas sp. GM50 Isolate Nodule
21 2511231017 Pseudomonas sp. GM55 Isolate Nodule
22 2511231018 Pseudomonas sp. GM60 Isolate Nodule
23 2511231019 Pseudomonas sp. GM67 Isolate Nodule
24 2511231020 Pseudomonas sp. GM74 Isolate Nodule
25 2511231021 Pseudomonas sp. GM78 Isolate Nodule
26 2511231022 Pseudomonas sp. GM79 Isolate Nodule
27 2511231023 Pseudomonas sp. GM80 Isolate Nodule
28 2511231024 Pseudomonas sp. GM84 Isolate Nodule
29 2511231031 Pseudomonas sp. GM16 Isolate Nodule
30 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
31 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
32 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
33 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
34 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
35 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
36 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
37 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
38 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
39 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
40 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
41 2519103095 Burkholderia sp. KJ006 Isolate Nodule
42 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
43 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
44 2547132374 Acidovorax radicis N35 Isolate Unclassified
45 2547132512 Azospira oryzae 6a3 Isolate Unclassified
46 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
47 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
48 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
49 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
50 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
51 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
52 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
53 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
54 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
55 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
56 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
57 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
58 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
59 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
60 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
61 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
62 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
63 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
64 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
65 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
66 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
67 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
68 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
69 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
70 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
71 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
72 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
73 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
74 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
75 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
76 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
77 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
78 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
79 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
80 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
81 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
82 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
83 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
84 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
85 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
86 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
87 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
88 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
89 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
90 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
91 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
92 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
93 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
94 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
95 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
96 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
97 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
98 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
99 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
100 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
101 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
102 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
103 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
104 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
105 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
106 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
107 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
108 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
109 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
110 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
111 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
112 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
113 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
114 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
115 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
116 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
117 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
118 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
119 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
120 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
121 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
122 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
123 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
124 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
125 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
126 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
127 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
128 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
129 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
130 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
131 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
132 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
133 2643221569 Achromobacter sp. Root565 Isolate Unclassified
134 2643221570 Acidovorax sp. Root568 Isolate Unclassified
135 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
136 2643221585 Pelomonas sp. Root662 Isolate Unclassified
137 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
138 2643221594 Achromobacter sp. Root170 Isolate Unclassified
139 2643221596 Acidovorax sp. Root70 Isolate Unclassified
140 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
141 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
142 2643221609 Acidovorax sp. Root217 Isolate Unclassified
143 2643221611 Acidovorax sp. Root219 Isolate Unclassified
144 2643221621 Achromobacter sp. Root83 Isolate Unclassified
145 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
146 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
147 2643221638 Duganella sp. Root336D2 Isolate Unclassified
148 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
149 2643221645 Massilia sp. Root351 Isolate Unclassified
150 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
151 2643221652 Acidovorax sp. Root402 Isolate Unclassified
152 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
153 2643221656 Pelomonas sp. Root405 Isolate Unclassified
154 2643221658 Variovorax sp. Root411 Isolate Unclassified
155 2643221660 Methylibium sp. Root1272 Isolate Unclassified
156 2643221664 Massilia sp. Root418 Isolate Unclassified
157 2643221672 Variovorax sp. Root434 Isolate Unclassified
158 2643221683 Variovorax sp. Root473 Isolate Unclassified
159 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
160 2643221717 Acidovorax sp. Root267 Isolate Unclassified
161 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
162 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
163 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
164 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
165 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
166 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
167 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
168 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
169 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
170 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
171 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
172 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
173 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
174 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
175 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
176 2738541280 Massilia sp. GV090 Isolate Unclassified
177 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
178 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
179 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
180 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
181 2738541300 Massilia sp. GV016 Isolate Unclassified
182 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
183 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
184 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
185 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
186 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
187 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
188 2738543012 Acidovorax sp. CF301 Isolate Unclassified
189 2738543013 Variovorax sp. BT01 Isolate Unclassified
190 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
191 2738543018 Massilia sp. GV045 Isolate Unclassified
192 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
193 2738543030 Massilia sp. GV097 Isolate Unclassified
194 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
195 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
196 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
197 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
198 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
199 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
200 2765235841 Pseudomonas putida AA7 Isolate Unclassified
201 2773857670 Pseudomonas sp. 478 Isolate Unclassified
202 2773857673 Pseudomonas sp. 443 Isolate Unclassified
203 2784132063 Pseudomonas sp. 424 Isolate Unclassified
204 2784132072 Pseudomonas sp. 460 Isolate Unclassified
205 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
206 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
207 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
208 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
209 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
210 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
211 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
212 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
213 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
214 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
215 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
216 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
217 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
218 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
219 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
220 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
221 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
222 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
223 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
224 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
225 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
226 2816332133 Acidovorax radicis 2721A Isolate Unclassified
227 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
228 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
229 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
230 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
231 2818991446 Variovorax sp. 1180 Isolate Unclassified
232 2818991450 Burkholderia sp. 604 Isolate Unclassified
233 2818991452 Burkholderia cepacia 561 Isolate Unclassified
234 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
235 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
236 2821131069 Duganella sp. 1224 Isolate Unclassified
237 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
238 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
239 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
240 2831864461 Roseateles noduli HZ7 Isolate Nodule
241 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
242 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
243 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
244 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
245 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
246 2842677519 Variovorax sp. R-72495 Isolate Unclassified
247 2842711865 Duganella sp. R-73148 Isolate Unclassified
248 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
249 2842733646 Variovorax sp. R-72446 Isolate Unclassified
250 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
251 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
252 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
253 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
254 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
255 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
256 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
257 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
258 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
259 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
260 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
261 2855730933 Achromobacter sp. HZ28 Isolate Nodule
262 2855767633 Achromobacter sp. HZ34 Isolate Nodule
263 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
264 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
265 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
266 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
267 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
268 2857553236 Duganella sp. R-74557 Isolate Unclassified
269 2857558681 Duganella sp. R-74565 Isolate Unclassified
270 2857564685 Duganella sp. R-74599 Isolate Unclassified
271 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
272 2858950400 Achromobacter sp. K91 Isolate Unclassified
273 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
274 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
275 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
276 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
277 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
278 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
279 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
280 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
281 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
282 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
283 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
284 2885198086 Variovorax sp. 679 Isolate Unclassified
285 2885211737 Variovorax sp. 553 Isolate Unclassified
286 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
287 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
288 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
289 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
290 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
291 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
292 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
293 2899924645 Variovorax sp. 369 Isolate Unclassified
294 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
295 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
296 2904424332 Duganella sp. 1411 Isolate Rhizosphere
297 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
298 2904456579 Variovorax sp. 2002 Isolate Unclassified
299 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
300 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
301 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
302 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
303 2904564687 Burkholderia sp. 571 Isolate Unclassified
304 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
305 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
306 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
307 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
308 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
309 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
310 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
311 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
312 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
313 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
314 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
315 2919476304 Duganella sp. 3397 Isolate Unclassified
316 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
317 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
318 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
319 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
320 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
321 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
322 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
323 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
324 2928037797 Variovorax sp. 1126 Isolate Unclassified
325 2928044640 Variovorax sp. 1128 Isolate Unclassified
326 2928051484 Variovorax sp. 1133 Isolate Unclassified
327 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
328 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
329 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
330 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
331 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
332 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
333 2928163908 Burkholderia sp. 567 Isolate Unclassified
334 2928170801 Burkholderia sp. 572 Isolate Unclassified
335 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
336 2928536128 Burkholderia sola 565 Isolate Unclassified
337 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
338 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
339 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
340 2929520902 Variovorax beijingensis 502 Isolate Unclassified
341 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
342 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
343 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
344 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
345 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
346 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
347 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
348 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
349 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
350 2941479691
351 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
352 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
353 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
354 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
355 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
356 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
357 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
358 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
359 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
360 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
361 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
362 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
363 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
364 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
365 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
366 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
367 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
368 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
369 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
370 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
371 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
372 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
373 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
374 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
375 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
376 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
377 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
378 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
379 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
380 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
381 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
382 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
383 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
384 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
385 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
386 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
387 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
388 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
389 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
390 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
391 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
392 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
393 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
394 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
395 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
396 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
397 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
398 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
399 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
400 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
401 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
402 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
403 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
404 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
405 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
406 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
407 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
408 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
409 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
410 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
411 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
412 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
413 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
414 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
415 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
416 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
417 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
418 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
419 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
420 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
421 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
422 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
423 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
424 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
425 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
426 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
427 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
428 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
429 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
430 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
431 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
432 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
433 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
434 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
435 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
436 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
437 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
438 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
439 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
440 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
441 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
442 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
443 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
444 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
445 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
446 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
447 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
448 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
449 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
450 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
451 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
452 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
453 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
454 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
455 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
456 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
457 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
458 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
459 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
460 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
461 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
462 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
463 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
464 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
465 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
466 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
467 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
468 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
469 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
470 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
471 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
472 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
473 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
474 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
475 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
476 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
477 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
478 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
479 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
480 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
481 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
482 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
483 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
484 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
485 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
486 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
487 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
488 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
489 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
490 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
491 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
492 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
493 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
494 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
495 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
496 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
497 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
498 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
499 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
500 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
501 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
502 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
503 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
504 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
505 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
506 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
507 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
508 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
509 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
510 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
511 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
512 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
513 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
514 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
515 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
516 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
517 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
518 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
519 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
520 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
521 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
522 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
523 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
524 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
525 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
526 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
527 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
528 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
529 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
530 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
531 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
532 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
533 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
534 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
535 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
536 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
537 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
538 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
539 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
540 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
541 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
542 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
543 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
544 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
545 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
546 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
547 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
548 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
549 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
550 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
551 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
552 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
553 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
554 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
555 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
556 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
557 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
558 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
559 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
560 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
561 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
562 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
563 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
564 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
565 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
566 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
567 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
568 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
569 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
570 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
571 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
577 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
578 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
579 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
581 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
582 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
583 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
584 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
585 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
586 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
587 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
588 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
589 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
590 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
591 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
592 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
593 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
594 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
595 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
596 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
597 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
598 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
600 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
602 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
653 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
658 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
659 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
660 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
661 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
662 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
663 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
664 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
665 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
666 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
667 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
668 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
669 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
670 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
671 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
672 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
673 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
674 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
675 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
676 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
677 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
678 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
679 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
680 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
681 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
682 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
683 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
684 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
685 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
686 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
688 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
689 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
690 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
691 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
692 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
693 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
694 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
695 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
696 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
697 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
698 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
699 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
700 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
701 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
702 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
703 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
704 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
705 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
706 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
707 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
708 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
709 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
710 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
711 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
712 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
713 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
714 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
715 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
716 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
717 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
718 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
719 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
720 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
721 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
722 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
723 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
724 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
725 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
726 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
727 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
728 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
729 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
730 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
731 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
732 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
733 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
734 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
735 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
736 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
737 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
738 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
739 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
740 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
741 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
742 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
743 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
744 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
745 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
746 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
747 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
748 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
749 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
750 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
751 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
752 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
753 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
754 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
755 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
756 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
757 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
758 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
759 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
760 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
761 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
762 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
763 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
764 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
765 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
766 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
767 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
768 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
769 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
770 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
771 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
772 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
773 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
774 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
775 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
776 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
777 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
778 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
779 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
780 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
781 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
782 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
783 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
784 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
785 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
786 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
787 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
788 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
789 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
790 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
791 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
792 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
793 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
794 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
795 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
796 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
797 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
798 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
799 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
800 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
801 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
802 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
803 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
804 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
805 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
806 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
807 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
808 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
809 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
810 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
811 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
812 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
813 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
814 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
815 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
816 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
817 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
818 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
819 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
820 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
821 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
822 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
823 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
824 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
825 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
826 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
827 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
828 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
829 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
830 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
831 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
832 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
833 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
834 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
835 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
836 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
837 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
838 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
839 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
840 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
841 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
842 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
843 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
844 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
845 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
846 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
847 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
848 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
849 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
850 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
851 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
852 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
853 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
854 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
855 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
856 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
857 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
858 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
859 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
860 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
861 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
862 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
863 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
864 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
865 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
866 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
867 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
868 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
869 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
870 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
871 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
872 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
873 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
874 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
875 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
876 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
877 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
878 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
879 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
880 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
881 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
882 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
883 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
884 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
885 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
886 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
887 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
888 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
889 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
890 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
891 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
892 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
893 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
894 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
895 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
896 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
897 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
898 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
899 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
900 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
901 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
902 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
903 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
904 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
905 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
906 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
907 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
908 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
909 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
910 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
911 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
912 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
913 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
914 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
915 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
916 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
917 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
918 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
919 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
920 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
921 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
922 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
923 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
924 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
925 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
926 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
927 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
928 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
929 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
930 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
931 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
932 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
933 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
934 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
935 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
936 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
937 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
938 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
939 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
940 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
941 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
942 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
943 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
944 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
945 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
946 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
947 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
948 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
949 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
950 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
951 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
952 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
953 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
954 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
955 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
956 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
957 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
958 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
959 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
960 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
961 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
962 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
963 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
964 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
965 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
966 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
967 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
968 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
969 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
970 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
971 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
972 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
973 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
974 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
975 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
976 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
977 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
978 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
979 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
980 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
981 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
982 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
983 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
984 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
985 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
986 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
987 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
988 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
989 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
990 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
991 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
992 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
993 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
994 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
995 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
996 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
997 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
998 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
999 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
1000 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1001 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1002 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
1003 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1004 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1005 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1006 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1007 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
1008 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1009 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1010 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1011 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1012 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
1013 639633007 Azoarcus olearius BH72 Isolate Unclassified
1014 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
1015 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
1016 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
1017 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
1018 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
1019 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
1020 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
1021 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
1022 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
1023 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1024 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
1025 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
1026 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
1027 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
1028 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
1029 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1030 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
1031 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
1032 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
1033 8052494512 Pseudomonas putida LD6 Isolate Unclassified
1034 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1035 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1036 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1037 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
1038 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
1039 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
1040 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
1041 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
1042 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1043 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
1044 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
1045 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1046 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1047 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1048 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
1049 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1050 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1051 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1052 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1053 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1054 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1055 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1056 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1057 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.86
Metatranscriptomes 0.42
Isolates 13.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.68
Nodule 1.97
Rhizoplane 5.21
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 9.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6331 2124908027 Bacteria 8736
2 JGI24740J21852_10004706 3300001979 Bacteria 5839
3 JGI24740J21852_10007323 3300001979 Bacteria 4496
4 JGI24739J22299_10009518 3300001989 Bacteria 3620
5 JGI24739J22299_10012110 3300001989 Bacteria 3169
6 JGI24739J22299_10015834 3300001989 Bacteria 2737
7 JGI24737J22298_10006638 3300001990 Bacteria 3941
8 JGI24737J22298_10011636 3300001990 Bacteria 2879
9 JGI24735J21928_10001314 3300002067 Bacteria 8786
10 JGI24735J21928_10001818 3300002067 Bacteria 7499
11 JGI24735J21928_10005308 3300002067 Bacteria 4278
12 JGI24744J21845_10015985 3300002077 Bacteria 1496
13 JGI24742J22300_10015301 3300002244 Bacteria 1290
14 JGI25155J39150_1000041 3300002704 Bacteria 88843
15 JGI25156J39149_1000031 3300002705 Bacteria 124983
16 JGI25156J39149_1004470 3300002705 Bacteria 4256
17 JGI25162J39368_1000795 3300002737 Bacteria 21062
18 JGI25162J39368_1000824 3300002737 Bacteria 20443
19 JGI25154J39366_1000049 3300002738 Bacteria 124995
20 JGI25154J39366_1004894 3300002738 Bacteria 2261
21 JGI25157J39369_1000041 3300002741 Bacteria 124982
22 JGI25164J39214_1000456 3300002772 Bacteria 21062
23 JGI25164J39214_1000464 3300002772 Bacteria 20573
24 JGI25152J39213_1000132 3300002773 Bacteria 50463
25 JGI25150J39212_1000962 3300002774 Bacteria 9097
26 JGI25150J39212_1007732 3300002774 Bacteria 2144
27 JGI25150J39212_1014290 3300002774 Bacteria 1352
28 JGI25159J45721_1003158 3300002987 Bacteria 5926
29 JGI25159J45721_1003317 3300002987 Bacteria 5749
30 JGI25159J45721_1004771 3300002987 Bacteria 4390
31 JGI25159J45721_1005227 3300002987 Bacteria 4108
32 JGI25151J46595_10000402 3300003187 Bacteria 44892
33 JGI25151J46595_10003385 3300003187 Bacteria 8822
34 JGI25151J46595_10006301 3300003187 Bacteria 5986
35 JGI25151J46595_10007084 3300003187 Bacteria 5535
36 JGI25151J46595_10028913 3300003187 Bacteria 2202
37 JGI25151J46595_10037290 3300003187 Bacteria 1824
38 JGI25151J46595_10049901 3300003187 Bacteria 1431
39 JGI25406J46586_10002230 3300003203 Bacteria 9139
40 JGI25165J46597_1000888 3300003214 Bacteria 21062
41 JGI25165J46597_1000906 3300003214 Bacteria 20573
42 JGI25153J46596_10005422 3300003215 Bacteria 6699
43 JGI25160J50197_1000124 3300003354 Bacteria 69999
44 JGI25160J50197_1000474 3300003354 Bacteria 24439
45 JGI25160J50197_1001366 3300003354 Bacteria 12285
46 JGI25160J50197_1020580 3300003354 Bacteria 1987
47 JGI25161J50226_1000042 3300003374 Bacteria 123841
48 JGI25161J50226_1000925 3300003374 Bacteria 10526
49 JGI25161J50226_1001458 3300003374 Bacteria 7098
50 JGI25161J50226_1006124 3300003374 Bacteria 2222
51 Ga0007409J51694_1011434 3300003575 Bacteria 4195
52 Ga0006562J51391_1016020 3300003578 Bacteria 2930
53 Ga0006562J51391_1016021 3300003578 Bacteria 1876
54 Ga0006562J51391_1079329 3300003578 Bacteria 1463
55 Ga0055538_1000093 3300003751 Bacteria 75896
56 Ga0055539_1000138 3300003752 Bacteria 75896
57 Ga0055533_1000142 3300003756 Bacteria 75896
58 Ga0055532_1000069 3300003758 Bacteria 138614
59 Ga0055532_1000152 3300003758 Bacteria 61495
60 Ga0055525_1000021 3300003759 Bacteria 370802
61 Ga0055525_1000342 3300003759 Bacteria 34036
62 Ga0055525_1001805 3300003759 Bacteria 2969
63 Ga0055527_1000034 3300003760 Bacteria 138614
64 Ga0055535_1000049 3300003761 Bacteria 138835
65 Ga0055535_1000318 3300003761 Bacteria 48605
66 Ga0055542_1000022 3300003762 Bacteria 302315
67 Ga0055542_1000077 3300003762 Bacteria 138614
68 Ga0055529_1000090 3300003763 Bacteria 138416
69 Ga0055529_1000129 3300003763 Bacteria 107881
70 Ga0055529_1001098 3300003763 Bacteria 12177
71 Ga0055526_1000748 3300003771 Bacteria 24400
72 Ga0055526_1000779 3300003771 Bacteria 23765
73 Ga0055526_1001331 3300003771 Bacteria 17689
74 Ga0055526_1009402 3300003771 Bacteria 4706
75 Ga0055526_1013907 3300003771 Bacteria 3360
76 Ga0055526_1035299 3300003771 Bacteria 1350
77 Ga0055526_1035710 3300003771 Bacteria 1333
78 Ga0055537_1000138 3300003773 Bacteria 54593
79 Ga0055537_1000434 3300003773 Bacteria 27009
80 Ga0055537_1001500 3300003773 Bacteria 8983
81 Ga0055524_1000007 3300003775 Bacteria 298766
82 Ga0055524_1000079 3300003775 Bacteria 120203
83 Ga0055524_1000228 3300003775 Bacteria 59742
84 Ga0055524_1000271 3300003775 Bacteria 51890
85 Ga0055524_1004293 3300003775 Bacteria 6609
86 Ga0055524_1010499 3300003775 Bacteria 3681
87 Ga0055524_1015450 3300003775 Bacteria 2782
88 Ga0055536_1004622 3300003781 Bacteria 6973
89 Ga0055536_1013007 3300003781 Bacteria 3037
90 Ga0055536_1021766 3300003781 Bacteria 1934
91 Ga0055534_1000521 3300003784 Bacteria 20755
92 Ga0055534_1001244 3300003784 Bacteria 10533
93 Ga0055534_1001329 3300003784 Bacteria 9921
94 Ga0055534_1001472 3300003784 Bacteria 9347
95 Ga0055534_1004870 3300003784 Bacteria 3756
96 Ga0055528_1000249 3300003790 Bacteria 45543
97 Ga0055528_1000692 3300003790 Bacteria 24069
98 Ga0055528_1001186 3300003790 Bacteria 16833
99 Ga0055528_1004556 3300003790 Bacteria 6646
100 Ga0055528_1008308 3300003790 Bacteria 4472
101 Ga0055530_10000666 3300003791 Bacteria 29345
102 Ga0055530_10002384 3300003791 Bacteria 12179
103 Ga0055530_10005712 3300003791 Bacteria 5799
104 Ga0055540_1000004 3300003792 Bacteria 395545
105 Ga0055540_1000010 3300003792 Bacteria 290865
106 Ga0055540_1001801 3300003792 Bacteria 12179
107 Ga0055540_1004586 3300003792 Bacteria 6141
108 Ga0055540_1015007 3300003792 Bacteria 2278
109 Ga0055540_1021258 3300003792 Bacteria 1690
110 Ga0055531_10000641 3300003794 Bacteria 30181
111 Ga0055531_10001404 3300003794 Bacteria 17808
112 Ga0055531_10004937 3300003794 Bacteria 7931
113 Ga0055531_10011782 3300003794 Bacteria 4177
114 Ga0055531_10040736 3300003794 Bacteria 1356
115 Ga0055541_1000091 3300003841 Bacteria 75896
116 Ga0055543_1001056 3300004625 Bacteria 12222
117 Ga0055543_1002030 3300004625 Bacteria 7127
118 Ga0065165_1000364 3300005262 Bacteria 74307
119 Ga0065165_1000395 3300005262 Bacteria 70688
120 Ga0065165_1002627 3300005262 Bacteria 14628
121 Ga0065165_1005461 3300005262 Bacteria 7122
122 Ga0065165_1008873 3300005262 Bacteria 4613
123 Ga0065165_1041015 3300005262 Bacteria 1376
124 Ga0065165_1041016 3300005262 Bacteria 1376
125 Ga0065165_1047063 3300005262 Bacteria 1247
126 Ga0065714_10000386 3300005288 Bacteria 5084
127 Ga0065714_10013434 3300005288 Bacteria 2027
128 Ga0065714_10086124 3300005288 Bacteria 2115
129 Ga0065704_10007257 3300005289 Bacteria 3280
130 Ga0065704_10007337 3300005289 Bacteria 4768
131 Ga0065704_10019402 3300005289 Bacteria 2110
132 Ga0065704_10095839 3300005289 Bacteria 2470
133 Ga0065712_10000132 3300005290 Bacteria 73390
134 Ga0065715_10196384 3300005293 Bacteria 1381
135 Ga0065707_10091360 3300005295 Bacteria 3961
136 Ga0070658_10010460 3300005327 Bacteria 7442
137 Ga0070658_10015497 3300005327 Bacteria 6099
138 Ga0070658_10022790 3300005327 Bacteria 5025
139 Ga0070658_10027998 3300005327 Bacteria 4524
140 Ga0070658_10121841 3300005327 Bacteria 2167
141 Ga0070658_10199495 3300005327 Bacteria 1688
142 Ga0070658_10230213 3300005327 Bacteria 1569
143 Ga0070676_10000988 3300005328 Bacteria 14116
144 Ga0070676_10003380 3300005328 Bacteria 8307
145 Ga0070676_10003580 3300005328 Bacteria 8119
146 Ga0070676_10018195 3300005328 Bacteria 3890
147 Ga0070683_100097820 3300005329 Bacteria 2761
148 Ga0070683_100321596 3300005329 Bacteria 1472
149 Ga0070690_100030157 3300005330 Bacteria 3368
150 Ga0070690_100044208 3300005330 Bacteria 2826
151 Ga0070690_100047934 3300005330 Bacteria 2719
152 Ga0070690_100088004 3300005330 Bacteria 2041
153 Ga0070670_100004099 3300005331 Bacteria 12172
154 Ga0070670_100004564 3300005331 Bacteria 11615
155 Ga0070670_100010058 3300005331 Bacteria 8075
156 Ga0070670_100020152 3300005331 Bacteria 5729
157 Ga0070670_100020245 3300005331 Bacteria 5717
158 Ga0070670_100023633 3300005331 Bacteria 5289
159 Ga0070670_100042056 3300005331 Bacteria 3927
160 Ga0070670_100130268 3300005331 Bacteria 2172
161 Ga0070677_10032718 3300005333 Bacteria 1997
162 Ga0070677_10039286 3300005333 Bacteria 1856
163 Ga0070677_10042262 3300005333 Bacteria 1804
164 Ga0068869_100000287 3300005334 Bacteria 26922
165 Ga0068869_100001687 3300005334 Bacteria 13186
166 Ga0068869_100005620 3300005334 Bacteria 7901
167 Ga0068869_100016264 3300005334 Bacteria 5011
168 Ga0068869_100024270 3300005334 Bacteria 4199
169 Ga0068869_100030463 3300005334 Bacteria 3787
170 Ga0068869_100106337 3300005334 Bacteria 2129
171 Ga0068869_100186793 3300005334 Bacteria 1627
172 Ga0070666_10001990 3300005335 Bacteria 12436
173 Ga0070666_10006955 3300005335 Bacteria 6974
174 Ga0070666_10028818 3300005335 Bacteria 3646
175 Ga0070666_10118503 3300005335 Bacteria 1834
176 Ga0070666_10124419 3300005335 Bacteria 1789
177 Ga0070666_10190861 3300005335 Bacteria 1439
178 Ga0070680_100026564 3300005336 Bacteria 4631
179 Ga0070680_100060020 3300005336 Bacteria 3112
180 Ga0070680_100149073 3300005336 Bacteria 1964
181 Ga0070680_100168611 3300005336 Bacteria 1842
182 Ga0070680_100171546 3300005336 Bacteria 1825
183 Ga0070682_100024802 3300005337 Bacteria 3573
184 Ga0070682_100026086 3300005337 Bacteria 3494
185 Ga0068868_100003808 3300005338 Bacteria 10533
186 Ga0068868_100004791 3300005338 Bacteria 9497
187 Ga0068868_100023471 3300005338 Bacteria 4669
188 Ga0068868_100055464 3300005338 Bacteria 3126
189 Ga0068868_100077888 3300005338 Bacteria 2653
190 Ga0068868_100141224 3300005338 Bacteria 1977
191 Ga0068868_100190031 3300005338 Bacteria 1708
192 Ga0070660_100002267 3300005339 Bacteria 13211
193 Ga0070660_100004790 3300005339 Bacteria 9356
194 Ga0070660_100013062 3300005339 Bacteria 5946
195 Ga0070660_100018748 3300005339 Bacteria 5061
196 Ga0070660_100234046 3300005339 Bacteria 1495
197 Ga0070689_100002878 3300005340 Bacteria 11316
198 Ga0070689_100007038 3300005340 Bacteria 7832
199 Ga0070689_100013590 3300005340 Bacteria 5895
200 Ga0070689_100017136 3300005340 Bacteria 5315
201 Ga0070689_100038320 3300005340 Bacteria 3667
202 Ga0070689_100059588 3300005340 Bacteria 2967
203 Ga0070661_100000961 3300005344 Bacteria 20513
204 Ga0070661_100001326 3300005344 Bacteria 17338
205 Ga0070661_100004253 3300005344 Bacteria 9874
206 Ga0070661_100005785 3300005344 Bacteria 8502
207 Ga0070661_100016406 3300005344 Bacteria 5235
208 Ga0070661_100023950 3300005344 Bacteria 4380
209 Ga0070661_100063264 3300005344 Bacteria 2717
210 Ga0070692_10008397 3300005345 Bacteria 4606
211 Ga0070668_100001724 3300005347 Bacteria 15891
212 Ga0070668_100001943 3300005347 Bacteria 15080
213 Ga0070668_100002034 3300005347 Bacteria 14791
214 Ga0070668_100002430 3300005347 Bacteria 13699
215 Ga0070668_100006437 3300005347 Bacteria 8708
216 Ga0070668_100012610 3300005347 Bacteria 6293
217 Ga0070668_100023333 3300005347 Bacteria 4679
218 Ga0070668_100052778 3300005347 Bacteria 3134
219 Ga0070668_100113900 3300005347 Bacteria 2155
220 Ga0070669_100000904 3300005353 Bacteria 21597
221 Ga0070669_100006180 3300005353 Bacteria 8644
222 Ga0070669_100050841 3300005353 Bacteria 3028
223 Ga0070669_100094559 3300005353 Bacteria 2246
224 Ga0070669_100104200 3300005353 Bacteria 2144
225 Ga0070669_100109831 3300005353 Bacteria 2091
226 Ga0070669_100124536 3300005353 Bacteria 1971
227 Ga0070675_100000322 3300005354 Bacteria 32261
228 Ga0070675_100003664 3300005354 Bacteria 11685
229 Ga0070675_100010007 3300005354 Bacteria 7395
230 Ga0070675_100018728 3300005354 Bacteria 5511
231 Ga0070675_100024778 3300005354 Bacteria 4806
232 Ga0070675_100025419 3300005354 Bacteria 4748
233 Ga0070675_100038440 3300005354 Bacteria 3900
234 Ga0070675_100103932 3300005354 Bacteria 2395
235 Ga0070675_100154260 3300005354 Bacteria 1971
236 Ga0070675_100173795 3300005354 Bacteria 1859
237 Ga0070675_100238334 3300005354 Bacteria 1589
238 Ga0070671_100000488 3300005355 Bacteria 27659
239 Ga0070671_100014031 3300005355 Bacteria 6469
240 Ga0070671_100020624 3300005355 Bacteria 5377
241 Ga0070671_100027578 3300005355 Bacteria 4675
242 Ga0070671_100041232 3300005355 Bacteria 3836
243 Ga0070671_100041440 3300005355 Bacteria 3827
244 Ga0070671_100061393 3300005355 Bacteria 3130
245 Ga0070671_100073967 3300005355 Bacteria 2846
246 Ga0070671_100078228 3300005355 Bacteria 2765
247 Ga0070671_100088969 3300005355 Bacteria 2584
248 Ga0070671_100111872 3300005355 Bacteria 2294
249 Ga0070671_100152674 3300005355 Bacteria 1950
250 Ga0070674_100012709 3300005356 Bacteria 5177
251 Ga0070674_100019632 3300005356 Bacteria 4297
252 Ga0070674_100062601 3300005356 Bacteria 2600
253 Ga0070674_100111794 3300005356 Bacteria 2007
254 Ga0070674_100141590 3300005356 Bacteria 1805
255 Ga0070673_100000080 3300005364 Bacteria 41486
256 Ga0070673_100001549 3300005364 Bacteria 13533
257 Ga0070673_100006472 3300005364 Bacteria 7615
258 Ga0070673_100009772 3300005364 Bacteria 6459
259 Ga0070673_100028508 3300005364 Bacteria 4153
260 Ga0070673_100035795 3300005364 Bacteria 3768
261 Ga0070673_100041413 3300005364 Bacteria 3542
262 Ga0070673_100046510 3300005364 Bacteria 3371
263 Ga0070673_100243796 3300005364 Bacteria 1564
264 Ga0070688_100000431 3300005365 Bacteria 21145
265 Ga0070688_100012626 3300005365 Bacteria 4737
266 Ga0070688_100036993 3300005365 Bacteria 2972
267 Ga0070659_100000072 3300005366 Bacteria 79387
268 Ga0070659_100000336 3300005366 Bacteria 36297
269 Ga0070659_100013071 3300005366 Bacteria 6174
270 Ga0070659_100018291 3300005366 Bacteria 5288
271 Ga0070659_100049532 3300005366 Bacteria 3303
272 Ga0070659_100082544 3300005366 Bacteria 2567
273 Ga0070659_100093059 3300005366 Bacteria 2418
274 Ga0070659_100192891 3300005366 Bacteria 1675
275 Ga0070667_100004438 3300005367 Bacteria 11832
276 Ga0070667_100009358 3300005367 Bacteria 8122
277 Ga0070667_100013717 3300005367 Bacteria 6697
278 Ga0070667_100026791 3300005367 Bacteria 4796
279 Ga0070667_100055069 3300005367 Bacteria 3359
280 Ga0070667_100071663 3300005367 Bacteria 2951
281 Ga0070667_100080779 3300005367 Bacteria 2782
282 Ga0070667_100081196 3300005367 Bacteria 2774
283 Ga0070667_100085610 3300005367 Bacteria 2703
284 Ga0070667_100104466 3300005367 Bacteria 2450
285 Ga0070667_100115702 3300005367 Bacteria 2329
286 Ga0070709_10011034 3300005434 Bacteria 5020
287 Ga0070714_100005049 3300005435 Bacteria 10037
288 Ga0070714_100006026 3300005435 Bacteria 9308
289 Ga0070714_100050384 3300005435 Bacteria 3547
290 Ga0070714_100056689 3300005435 Bacteria 3352
291 Ga0070714_100233217 3300005435 Bacteria 1696
292 Ga0070713_100000049 3300005436 Bacteria 74072
293 Ga0070710_10036465 3300005437 Bacteria 2689
294 Ga0070701_10005119 3300005438 Bacteria 5387
295 Ga0070701_10006118 3300005438 Bacteria 5040
296 Ga0070711_100017761 3300005439 Bacteria 4532
297 Ga0070711_100019617 3300005439 Bacteria 4340
298 Ga0070711_100133029 3300005439 Bacteria 1855
299 Ga0070705_100000108 3300005440 Bacteria 47179
300 Ga0070705_100049980 3300005440 Bacteria 2430
301 Ga0070705_100108819 3300005440 Bacteria 1766
302 Ga0070700_100004808 3300005441 Bacteria 7085
303 Ga0070700_100006243 3300005441 Bacteria 6357
304 Ga0070700_100016130 3300005441 Bacteria 4251
305 Ga0070694_100001290 3300005444 Bacteria 14566
306 Ga0070694_100051827 3300005444 Bacteria 2772
307 Ga0070708_100000012 3300005445 Bacteria 133550
308 Ga0070708_100338356 3300005445 Bacteria 1418
309 Ga0070663_100000305 3300005455 Bacteria 25223
310 Ga0070663_100001712 3300005455 Bacteria 12174
311 Ga0070663_100105909 3300005455 Bacteria 2106
312 Ga0070663_100108324 3300005455 Bacteria 2084
313 Ga0070663_100152246 3300005455 Bacteria 1774
314 Ga0070678_100001068 3300005456 Bacteria 14327
315 Ga0070678_100001964 3300005456 Bacteria 11107
316 Ga0070678_100028500 3300005456 Bacteria 3809
317 Ga0070678_100117937 3300005456 Bacteria 2088
318 Ga0070678_100136361 3300005456 Bacteria 1957
319 Ga0070678_100170188 3300005456 Bacteria 1774
320 Ga0070662_100000568 3300005457 Bacteria 22525
321 Ga0070662_100002124 3300005457 Bacteria 12146
322 Ga0070662_100003698 3300005457 Bacteria 9568
323 Ga0070662_100020105 3300005457 Bacteria 4544
324 Ga0070662_100032740 3300005457 Bacteria 3654
325 Ga0070662_100071391 3300005457 Bacteria 2560
326 Ga0070662_100227904 3300005457 Bacteria 1489
327 Ga0070662_100249325 3300005457 Bacteria 1427
328 Ga0070681_10003650 3300005458 Bacteria 14445
329 Ga0070681_10004241 3300005458 Bacteria 13592
330 Ga0070681_10020863 3300005458 Bacteria 6561
331 Ga0070681_10075195 3300005458 Bacteria 3338
332 Ga0070681_10109996 3300005458 Bacteria 2695
333 Ga0070681_10165264 3300005458 Bacteria 2136
334 Ga0068867_100001735 3300005459 Bacteria 15186
335 Ga0068867_100003899 3300005459 Bacteria 10495
336 Ga0068867_100019875 3300005459 Bacteria 4787
337 Ga0068867_100034777 3300005459 Bacteria 3654
338 Ga0068867_100045619 3300005459 Bacteria 3215
339 Ga0068867_100072862 3300005459 Bacteria 2572
340 Ga0068867_100088655 3300005459 Bacteria 2345
341 Ga0068867_100286989 3300005459 Bacteria 1351
342 Ga0070685_10000733 3300005466 Bacteria 17900
343 Ga0070685_10036527 3300005466 Bacteria 2778
344 Ga0070707_100008698 3300005468 Bacteria 9414
345 Ga0070707_100144388 3300005468 Bacteria 2316
346 Ga0070698_100046097 3300005471 Bacteria 4458
347 Ga0070699_100019534 3300005518 Bacteria 5837
348 Ga0070699_100054335 3300005518 Bacteria 3467
349 Ga0070679_100015738 3300005530 Bacteria 7275
350 Ga0070679_100025724 3300005530 Bacteria 5776
351 Ga0070679_100028949 3300005530 Bacteria 5463
352 Ga0070679_100032744 3300005530 Bacteria 5144
353 Ga0070679_100105196 3300005530 Bacteria 2809
354 Ga0070679_100152027 3300005530 Bacteria 2291
355 Ga0070679_100167370 3300005530 Bacteria 2171
356 Ga0070679_100206340 3300005530 Bacteria 1929
357 Ga0070684_100055475 3300005535 Bacteria 3455
358 Ga0070684_100056915 3300005535 Bacteria 3413
359 Ga0070684_100123995 3300005535 Bacteria 2325
360 Ga0070684_100381885 3300005535 Bacteria 1297
361 Ga0068853_100001464 3300005539 Bacteria 17125
362 Ga0068853_100008919 3300005539 Bacteria 8074
363 Ga0068853_100015345 3300005539 Bacteria 6295
364 Ga0068853_100019807 3300005539 Bacteria 5588
365 Ga0068853_100044919 3300005539 Bacteria 3783
366 Ga0068853_100109362 3300005539 Bacteria 2453
367 Ga0070672_100003763 3300005543 Bacteria 9873
368 Ga0070672_100004825 3300005543 Bacteria 8859
369 Ga0070672_100010706 3300005543 Bacteria 6371
370 Ga0070672_100030160 3300005543 Bacteria 4071
371 Ga0070672_100081637 3300005543 Bacteria 2592
372 Ga0070672_100090157 3300005543 Bacteria 2472
373 Ga0070672_100118679 3300005543 Bacteria 2163
374 Ga0070672_100158193 3300005543 Bacteria 1878
375 Ga0070672_100233025 3300005543 Bacteria 1547
376 Ga0070686_100014018 3300005544 Bacteria 4608
377 Ga0070686_100070749 3300005544 Bacteria 2282
378 Ga0070695_100000539 3300005545 Bacteria 20041
379 Ga0070696_100000180 3300005546 Bacteria 36576
380 Ga0070696_100002306 3300005546 Bacteria 12587
381 Ga0070696_100035515 3300005546 Bacteria 3433
382 Ga0070693_100006997 3300005547 Bacteria 5493
383 Ga0070693_100017547 3300005547 Bacteria 3723
384 Ga0070693_100183855 3300005547 Bacteria 1347
385 Ga0070665_100005754 3300005548 Bacteria 12728
386 Ga0070665_100038724 3300005548 Bacteria 4793
387 Ga0070665_100049639 3300005548 Bacteria 4210
388 Ga0070665_100054971 3300005548 Bacteria 3992
389 Ga0070665_100061491 3300005548 Bacteria 3765
390 Ga0070665_100139203 3300005548 Bacteria 2431
391 Ga0070665_100142441 3300005548 Bacteria 2400
392 Ga0070665_100209885 3300005548 Bacteria 1948
393 Ga0070704_100007805 3300005549 Bacteria 6381
394 Ga0070704_100016774 3300005549 Bacteria 4638
395 Ga0070704_100021921 3300005549 Bacteria 4149
396 Ga0070704_100045028 3300005549 Bacteria 3069
397 Ga0070704_100046365 3300005549 Bacteria 3030
398 Ga0070704_100272532 3300005549 Bacteria 1399
399 Ga0068855_100000634 3300005563 Bacteria 42949
400 Ga0068855_100004370 3300005563 Bacteria 17280
401 Ga0068855_100012566 3300005563 Bacteria 10219
402 Ga0068855_100019291 3300005563 Bacteria 8196
403 Ga0068855_100032268 3300005563 Bacteria 6253
404 Ga0068855_100038753 3300005563 Bacteria 5661
405 Ga0068855_100065466 3300005563 Bacteria 4237
406 Ga0068855_100082132 3300005563 Bacteria 3735
407 Ga0068855_100167270 3300005563 Bacteria 2492
408 Ga0068855_100168393 3300005563 Bacteria 2482
409 Ga0068855_100195259 3300005563 Bacteria 2280
410 Ga0068855_100197180 3300005563 Bacteria 2268
411 Ga0068855_100533479 3300005563 Bacteria 1272
412 Ga0070664_100000284 3300005564 Bacteria 36685
413 Ga0070664_100005623 3300005564 Bacteria 10088
414 Ga0070664_100005656 3300005564 Bacteria 10064
415 Ga0070664_100010006 3300005564 Bacteria 7686
416 Ga0070664_100024804 3300005564 Bacteria 4966
417 Ga0070664_100034311 3300005564 Bacteria 4256
418 Ga0070664_100037579 3300005564 Bacteria 4071
419 Ga0070664_100039434 3300005564 Bacteria 3980
420 Ga0070664_100074305 3300005564 Bacteria 2917
421 Ga0068857_100011768 3300005577 Bacteria 7609
422 Ga0068857_100013193 3300005577 Bacteria 7201
423 Ga0068857_100054053 3300005577 Bacteria 3562
424 Ga0068857_100116282 3300005577 Bacteria 2406
425 Ga0068857_100132228 3300005577 Bacteria 2251
426 Ga0068854_100013165 3300005578 Bacteria 5422
427 Ga0068854_100034285 3300005578 Bacteria 3545
428 Ga0068854_100142836 3300005578 Bacteria 1838
429 Ga0068854_100203477 3300005578 Bacteria 1558
430 Ga0068856_100000238 3300005614 Bacteria 59833
431 Ga0068856_100013794 3300005614 Bacteria 7811
432 Ga0068856_100031216 3300005614 Bacteria 5212
433 Ga0068856_100044443 3300005614 Bacteria 4373
434 Ga0068856_100297940 3300005614 Bacteria 1630
435 Ga0070702_100004890 3300005615 Bacteria 6170
436 Ga0070702_100008271 3300005615 Bacteria 5028
437 Ga0068852_100000705 3300005616 Bacteria 21852
438 Ga0068852_100003098 3300005616 Bacteria 11576
439 Ga0068852_100005029 3300005616 Bacteria 9397
440 Ga0068852_100007035 3300005616 Bacteria 8192
441 Ga0068852_100009984 3300005616 Bacteria 7065
442 Ga0068852_100042495 3300005616 Bacteria 3848
443 Ga0068852_100058885 3300005616 Bacteria 3329
444 Ga0068852_100155101 3300005616 Bacteria 2132
445 Ga0068852_100202072 3300005616 Bacteria 1881
446 Ga0068859_100008152 3300005617 Bacteria 10625
447 Ga0068859_100008875 3300005617 Bacteria 10149
448 Ga0068859_100009804 3300005617 Bacteria 9674
449 Ga0068859_100016536 3300005617 Bacteria 7406
450 Ga0068859_100030106 3300005617 Bacteria 5446
451 Ga0068859_100054834 3300005617 Bacteria 4010
452 Ga0068859_100061388 3300005617 Bacteria 3788
453 Ga0068859_100061628 3300005617 Bacteria 3780
454 Ga0068859_100131691 3300005617 Bacteria 2573
455 Ga0068859_100133764 3300005617 Bacteria 2552
456 Ga0068859_100151990 3300005617 Bacteria 2390
457 Ga0068859_100160928 3300005617 Bacteria 2324
458 Ga0068859_100214280 3300005617 Bacteria 2013
459 Ga0068864_100002543 3300005618 Bacteria 15058
460 Ga0068864_100002923 3300005618 Bacteria 14129
461 Ga0068864_100006810 3300005618 Bacteria 9362
462 Ga0068864_100006813 3300005618 Bacteria 9361
463 Ga0068864_100047540 3300005618 Bacteria 3686
464 Ga0068864_100056840 3300005618 Bacteria 3380
465 Ga0068864_100059436 3300005618 Bacteria 3307
466 Ga0068866_10001963 3300005718 Bacteria 8567
467 Ga0068866_10015305 3300005718 Bacteria 3405
468 Ga0068866_10022836 3300005718 Bacteria 2900
469 Ga0068866_10092184 3300005718 Bacteria 1652
470 Ga0068861_100001256 3300005719 Bacteria 15820
471 Ga0068861_100009353 3300005719 Bacteria 6764
472 Ga0068861_100009654 3300005719 Bacteria 6665
473 Ga0068861_100026499 3300005719 Bacteria 4215
474 Ga0068861_100027128 3300005719 Bacteria 4169
475 Ga0068861_100038101 3300005719 Bacteria 3577
476 Ga0068861_100123584 3300005719 Bacteria 2091
477 Ga0068861_100145897 3300005719 Bacteria 1937
478 Ga0068851_10000160 3300005834 Bacteria 35442
479 Ga0068851_10001255 3300005834 Bacteria 11045
480 Ga0068851_10007982 3300005834 Bacteria 4880
481 Ga0068851_10015865 3300005834 Bacteria 3596
482 Ga0068851_10017313 3300005834 Bacteria 3460
483 Ga0068851_10048420 3300005834 Bacteria 2154
484 Ga0068870_10013891 3300005840 Bacteria 3793
485 Ga0068863_100003505 3300005841 Bacteria 15482
486 Ga0068863_100005626 3300005841 Bacteria 12313
487 Ga0068863_100006175 3300005841 Bacteria 11751
488 Ga0068863_100007955 3300005841 Bacteria 10361
489 Ga0068863_100008722 3300005841 Bacteria 9907
490 Ga0068863_100009999 3300005841 Bacteria 9234
491 Ga0068863_100021758 3300005841 Bacteria 6118
492 Ga0068863_100080593 3300005841 Bacteria 3083
493 Ga0068858_100001168 3300005842 Bacteria 27226
494 Ga0068858_100001792 3300005842 Bacteria 21909
495 Ga0068858_100004522 3300005842 Bacteria 13638
496 Ga0068858_100016675 3300005842 Bacteria 6898
497 Ga0068858_100018565 3300005842 Bacteria 6512
498 Ga0068858_100019791 3300005842 Bacteria 6292
499 Ga0068858_100021158 3300005842 Bacteria 6074
500 Ga0068858_100036739 3300005842 Bacteria 4542
501 Ga0068858_100047116 3300005842 Bacteria 3997
502 Ga0068858_100115186 3300005842 Bacteria 2511
503 Ga0068858_100221396 3300005842 Bacteria 1792
504 Ga0068858_100224657 3300005842 Bacteria 1779
505 Ga0068860_100000989 3300005843 Bacteria 31420
506 Ga0068860_100001537 3300005843 Bacteria 24868
507 Ga0068860_100005662 3300005843 Bacteria 12618
508 Ga0068860_100006245 3300005843 Bacteria 11971
509 Ga0068860_100007785 3300005843 Bacteria 10700
510 Ga0068860_100017156 3300005843 Bacteria 7058
511 Ga0068860_100025155 3300005843 Bacteria 5745
512 Ga0068860_100028450 3300005843 Bacteria 5379
513 Ga0068860_100054658 3300005843 Bacteria 3795
514 Ga0068860_100054936 3300005843 Bacteria 3785
515 Ga0068860_100069562 3300005843 Bacteria 3346
516 Ga0068860_100225851 3300005843 Bacteria 1819
517 Ga0068862_100016414 3300005844 Bacteria 6162
518 Ga0068862_100017615 3300005844 Bacteria 5947
519 Ga0068862_100027273 3300005844 Bacteria 4807
520 Ga0068862_100037792 3300005844 Bacteria 4093
521 Ga0068862_100050610 3300005844 Bacteria 3551
522 Ga0081455_10094358 3300005937 Bacteria 2417
523 Ga0081539_10000013 3300005985 Bacteria 432395
524 Ga0081539_10011451 3300005985 Bacteria 7005
525 Ga0081539_10043559 3300005985 Bacteria 2600
526 Ga0075365_10018967 3300006038 Bacteria 4237
527 Ga0075368_10032173 3300006042 Bacteria 2036
528 Ga0075363_100000866 3300006048 Bacteria 10603
529 Ga0075363_100012195 3300006048 Bacteria 4136
530 Ga0075364_10002918 3300006051 Bacteria 9644
531 Ga0075364_10007984 3300006051 Bacteria 6306
532 Ga0075364_10022977 3300006051 Bacteria 3944
533 Ga0075364_10025570 3300006051 Bacteria 3758
534 Ga0075364_10041067 3300006051 Bacteria 3002
535 Ga0075364_10051873 3300006051 Bacteria 2679
536 Ga0075364_10086969 3300006051 Bacteria 2071
537 Ga0075364_10129903 3300006051 Bacteria 1690
538 Ga0070712_100009598 3300006175 Bacteria 6101
539 Ga0075362_10003366 3300006177 Bacteria 5575
540 Ga0075362_10005165 3300006177 Bacteria 4757
541 Ga0075362_10019631 3300006177 Bacteria 2814
542 Ga0075362_10020316 3300006177 Bacteria 2774
543 Ga0075362_10023544 3300006177 Bacteria 2606
544 Ga0075362_10098464 3300006177 Bacteria 1365
545 Ga0075367_10020957 3300006178 Bacteria 3647
546 Ga0075367_10023082 3300006178 Bacteria 3497
547 Ga0075367_10040905 3300006178 Bacteria 2707
548 Ga0075367_10084050 3300006178 Bacteria 1929
549 Ga0075366_10001005 3300006195 Bacteria 13778
550 Ga0075366_10001156 3300006195 Bacteria 13058
551 Ga0075366_10011474 3300006195 Bacteria 5004
552 Ga0075366_10018664 3300006195 Bacteria 4006
553 Ga0075366_10027288 3300006195 Bacteria 3349
554 Ga0075366_10029398 3300006195 Bacteria 3228
555 Ga0075366_10029410 3300006195 Bacteria 3227
556 Ga0075366_10040244 3300006195 Bacteria 2764
557 Ga0075366_10043469 3300006195 Bacteria 2662
558 Ga0097621_100003209 3300006237 Bacteria 11233
559 Ga0097621_100010887 3300006237 Bacteria 6675
560 Ga0097621_100022068 3300006237 Bacteria 4937
561 Ga0097621_100036523 3300006237 Bacteria 3931
562 Ga0097621_100062504 3300006237 Bacteria 3057
563 Ga0075370_10000326 3300006353 Bacteria 17238
564 Ga0075370_10001401 3300006353 Bacteria 10412
565 Ga0075370_10001766 3300006353 Bacteria 9651
566 Ga0075370_10002642 3300006353 Bacteria 8370
567 Ga0075370_10009130 3300006353 Bacteria 5132
568 Ga0075370_10009379 3300006353 Bacteria 5078
569 Ga0075370_10017190 3300006353 Bacteria 3904
570 Ga0075370_10019615 3300006353 Bacteria 3684
571 Ga0075370_10042744 3300006353 Bacteria 2560
572 Ga0075370_10069668 3300006353 Bacteria 2010
573 Ga0068871_100001990 3300006358 Bacteria 13838
574 Ga0068871_100004593 3300006358 Bacteria 9631
575 Ga0068871_100015028 3300006358 Bacteria 5788
576 Ga0068871_100016365 3300006358 Bacteria 5584
577 Ga0068871_100022915 3300006358 Bacteria 4821
578 Ga0068871_100035145 3300006358 Bacteria 3981
579 Ga0068871_100074125 3300006358 Bacteria 2807
580 Ga0068871_100077529 3300006358 Bacteria 2746
581 Ga0075428_100002002 3300006844 Bacteria 21951
582 Ga0075428_100008854 3300006844 Bacteria 11165
583 Ga0075428_100017952 3300006844 Bacteria 7818
584 Ga0075430_100018051 3300006846 Bacteria 6005
585 Ga0075430_100030341 3300006846 Bacteria 4591
586 Ga0075431_100000427 3300006847 Bacteria 34400
587 Ga0075431_100003962 3300006847 Bacteria 14425
588 Ga0075431_100014405 3300006847 Bacteria 7998
589 Ga0075431_100050350 3300006847 Bacteria 4295
590 Ga0075433_10016198 3300006852 Bacteria 6134
591 Ga0075434_100041448 3300006871 Bacteria 4562
592 Ga0075434_100184161 3300006871 Bacteria 2109
593 Ga0075434_100265699 3300006871 Bacteria 1735
594 Ga0075434_100418333 3300006871 Bacteria 1361
595 Ga0075429_100000003 3300006880 Bacteria 130377
596 Ga0075429_100003830 3300006880 Bacteria 12848
597 Ga0075429_100005458 3300006880 Bacteria 10949
598 Ga0075429_100006119 3300006880 Bacteria 10400
599 Ga0075429_100073619 3300006880 Bacteria 2975
600 Ga0075429_100157573 3300006880 Bacteria 1988
601 Ga0068865_100009716 3300006881 Bacteria 5969
602 Ga0068865_100046457 3300006881 Bacteria 2979
603 Ga0068865_100177878 3300006881 Bacteria 1636
604 Ga0097620_100008153 3300006931 Bacteria 10625
605 Ga0097620_100008875 3300006931 Bacteria 10149
606 Ga0097620_100009804 3300006931 Bacteria 9674
607 Ga0097620_100016535 3300006931 Bacteria 7406
608 Ga0097620_100030104 3300006931 Bacteria 5446
609 Ga0097620_100054834 3300006931 Bacteria 4010
610 Ga0097620_100061386 3300006931 Bacteria 3788
611 Ga0097620_100061626 3300006931 Bacteria 3780
612 Ga0097620_100131690 3300006931 Bacteria 2573
613 Ga0097620_100151984 3300006931 Bacteria 2390
614 Ga0097620_100160929 3300006931 Bacteria 2324
615 Ga0097620_100214295 3300006931 Bacteria 2013
616 Ga0099823_1000985 3300006944 Bacteria 21888
617 Ga0099823_1031074 3300006944 Bacteria 4431
618 Ga0079104_1000352 3300006946 Bacteria 55479
619 Ga0079104_1000375 3300006946 Bacteria 52652
620 Ga0079104_1000920 3300006946 Bacteria 23632
621 Ga0079104_1008151 3300006946 Bacteria 3705
622 Ga0079104_1016517 3300006946 Bacteria 2156
623 Ga0099826_10000052 3300006948 Bacteria 73156
624 Ga0099826_10001328 3300006948 Bacteria 14629
625 Ga0099826_10013739 3300006948 Bacteria 6120
626 Ga0075435_100025216 3300007076 Bacteria 4626
627 Ga0075435_100075759 3300007076 Bacteria 2756
628 Ga0075435_100177312 3300007076 Bacteria 1800
629 Ga0105251_10001251 3300009011 Bacteria 22007
630 Ga0105251_10005346 3300009011 Bacteria 8428
631 Ga0105251_10032414 3300009011 Bacteria 2604
632 Ga0105244_10003105 3300009036 Bacteria 12140
633 Ga0105244_10005300 3300009036 Bacteria 8586
634 Ga0105244_10035145 3300009036 Bacteria 2634
635 Ga0105244_10119247 3300009036 Bacteria 1278
636 Ga0105240_10003889 3300009093 Bacteria 23062
637 Ga0105240_10006590 3300009093 Bacteria 17043
638 Ga0105240_10010361 3300009093 Bacteria 13116
639 Ga0105240_10026052 3300009093 Bacteria 7678
640 Ga0105240_10066924 3300009093 Bacteria 4455
641 Ga0105240_10110953 3300009093 Bacteria 3319
642 Ga0105240_10376309 3300009093 Bacteria 1604
643 Ga0105240_10435442 3300009093 Bacteria 1470
644 Ga0111539_10001653 3300009094 Bacteria 29768
645 Ga0111539_10001731 3300009094 Bacteria 29064
646 Ga0111539_10001974 3300009094 Bacteria 27386
647 Ga0111539_10017371 3300009094 Bacteria 8904
648 Ga0111539_10032347 3300009094 Bacteria 6353
649 Ga0111539_10035448 3300009094 Bacteria 6040
650 Ga0111539_10062315 3300009094 Bacteria 4415
651 Ga0111539_10198755 3300009094 Bacteria 2338
652 Ga0111539_10465433 3300009094 Bacteria 1472
653 Ga0105245_10000358 3300009098 Bacteria 42613
654 Ga0105245_10025288 3300009098 Bacteria 5220
655 Ga0105245_10035610 3300009098 Bacteria 4418
656 Ga0105245_10054046 3300009098 Bacteria 3606
657 Ga0105245_10108891 3300009098 Bacteria 2574
658 Ga0105245_10260960 3300009098 Bacteria 1686
659 Ga0105245_10354457 3300009098 Bacteria 1455
660 Ga0105247_10010457 3300009101 Bacteria 5610
661 Ga0105247_10060564 3300009101 Bacteria 2346
662 Ga0105247_10110743 3300009101 Bacteria 1767
663 Ga0114129_10017213 3300009147 Bacteria 10295
664 Ga0114129_10038447 3300009147 Bacteria 6750
665 Ga0114129_10057890 3300009147 Bacteria 5422
666 Ga0114129_10084138 3300009147 Bacteria 4417
667 Ga0114129_10085267 3300009147 Bacteria 4382
668 Ga0114129_10171110 3300009147 Bacteria 2961
669 Ga0114129_10235036 3300009147 Bacteria 2467
670 Ga0105243_10002510 3300009148 Bacteria 15315
671 Ga0105243_10002789 3300009148 Bacteria 14515
672 Ga0105243_10005689 3300009148 Bacteria 9697
673 Ga0105243_10045098 3300009148 Bacteria 3463
674 Ga0105243_10057175 3300009148 Bacteria 3105
675 Ga0105243_10083722 3300009148 Bacteria 2610
676 Ga0105243_10086629 3300009148 Bacteria 2569
677 Ga0105243_10109379 3300009148 Bacteria 2309
678 Ga0105243_10115223 3300009148 Bacteria 2256
679 Ga0105243_10117663 3300009148 Bacteria 2235
680 Ga0105243_10186536 3300009148 Bacteria 1808
681 Ga0105243_10390318 3300009148 Bacteria 1290
682 Ga0105241_10018613 3300009174 Bacteria 5111
683 Ga0105241_10065270 3300009174 Bacteria 2813
684 Ga0105242_10019163 3300009176 Bacteria 5360
685 Ga0105242_10023140 3300009176 Bacteria 4897
686 Ga0105242_10033656 3300009176 Bacteria 4105
687 Ga0105242_10068905 3300009176 Bacteria 2928
688 Ga0105242_10242276 3300009176 Bacteria 1622
689 Ga0105242_10253015 3300009176 Bacteria 1588
690 Ga0105248_10010615 3300009177 Bacteria 10154
691 Ga0105248_10027737 3300009177 Bacteria 6306
692 Ga0105248_10043169 3300009177 Bacteria 5055
693 Ga0105248_10053488 3300009177 Bacteria 4530
694 Ga0105248_10055961 3300009177 Bacteria 4425
695 Ga0105248_10064423 3300009177 Bacteria 4115
696 Ga0105248_10140656 3300009177 Bacteria 2723
697 Ga0105248_10142733 3300009177 Bacteria 2701
698 Ga0105248_10153327 3300009177 Bacteria 2599
699 Ga0105248_10182585 3300009177 Bacteria 2364
700 Ga0105237_10000335 3300009545 Bacteria 66335
701 Ga0105237_10010664 3300009545 Bacteria 9760
702 Ga0105237_10029850 3300009545 Bacteria 5538
703 Ga0105237_10046192 3300009545 Bacteria 4381
704 Ga0105237_10085194 3300009545 Bacteria 3150
705 Ga0105237_10279751 3300009545 Bacteria 1671
706 Ga0105238_10002245 3300009551 Bacteria 19503
707 Ga0105238_10004929 3300009551 Bacteria 13212
708 Ga0105238_10016518 3300009551 Bacteria 7471
709 Ga0105238_10023750 3300009551 Bacteria 6249
710 Ga0105238_10047726 3300009551 Bacteria 4317
711 Ga0105238_10047864 3300009551 Bacteria 4310
712 Ga0105238_10051771 3300009551 Bacteria 4129
713 Ga0105238_10059536 3300009551 Bacteria 3826
714 Ga0105238_10125378 3300009551 Bacteria 2547
715 Ga0105238_10335129 3300009551 Bacteria 1500
716 Ga0105249_10012011 3300009553 Bacteria 7620
717 Ga0105249_10085998 3300009553 Bacteria 2932
718 Ga0105249_10212544 3300009553 Bacteria 1899
719 Ga0105249_10223221 3300009553 Bacteria 1855
720 Ga0105249_10378957 3300009553 Bacteria 1440
721 Ga0105249_10415242 3300009553 Bacteria 1378
722 Ga0105239_10000366 3300010375 Bacteria 66301
723 Ga0105239_10009251 3300010375 Bacteria 11139
724 Ga0105239_10022811 3300010375 Bacteria 6900
725 Ga0105239_10139903 3300010375 Bacteria 2697
726 Ga0105239_10258521 3300010375 Bacteria 1957
727 Ga0105239_10394711 3300010375 Bacteria 1565
728 Ga0105246_10029356 3300011119 Bacteria 3621
729 Ga0105246_10075538 3300011119 Bacteria 2386
730 Ga0105246_10150949 3300011119 Bacteria 1759
731 Ga0105246_10152498 3300011119 Bacteria 1751
732 Ga0105246_10280340 3300011119 Bacteria 1337
733 Ga0105246_10306551 3300011119 Bacteria 1284
734 Ga0157319_1000006 3300012497 Bacteria 361506
735 Ga0157373_10021191 3300013100 Bacteria 4719
736 Ga0157373_10025001 3300013100 Bacteria 4323
737 Ga0157373_10145619 3300013100 Bacteria 1666
738 Ga0157371_10000001 3300013102 Bacteria 1162285
739 Ga0157371_10000174 3300013102 Bacteria 93381
740 Ga0157371_10024139 3300013102 Bacteria 4442
741 Ga0157371_10047612 3300013102 Bacteria 3048
742 Ga0157371_10081997 3300013102 Bacteria 2284
743 Ga0157370_10023394 3300013104 Bacteria 6134
744 Ga0157370_10027657 3300013104 Bacteria 5590
745 Ga0157370_10030996 3300013104 Bacteria 5235
746 Ga0157370_10035492 3300013104 Bacteria 4846
747 Ga0157370_10055120 3300013104 Bacteria 3789
748 Ga0157370_10059170 3300013104 Bacteria 3641
749 Ga0157370_10064927 3300013104 Bacteria 3454
750 Ga0157370_10116343 3300013104 Bacteria 2498
751 Ga0157370_10281064 3300013104 Bacteria 1538
752 Ga0157370_10286837 3300013104 Bacteria 1521
753 Ga0157370_10610209 3300013104 Bacteria 999
754 Ga0157369_10000847 3300013105 Bacteria 39121
755 Ga0157369_10001910 3300013105 Bacteria 25140
756 Ga0157369_10006399 3300013105 Bacteria 13651
757 Ga0157369_10018644 3300013105 Bacteria 7781
758 Ga0157369_10019593 3300013105 Bacteria 7571
759 Ga0157369_10057068 3300013105 Bacteria 4213
760 Ga0157374_10000081 3300013296 Bacteria 95406
761 Ga0157374_10000600 3300013296 Bacteria 31879
762 Ga0157374_10002680 3300013296 Bacteria 14978
763 Ga0157374_10014259 3300013296 Bacteria 6951
764 Ga0157374_10014722 3300013296 Bacteria 6849
765 Ga0157374_10019413 3300013296 Bacteria 6016
766 Ga0157374_10219454 3300013296 Bacteria 1865
767 Ga0157374_10278607 3300013296 Bacteria 1651
768 Ga0157378_10022412 3300013297 Bacteria 5560
769 Ga0157378_10073012 3300013297 Bacteria 3083
770 Ga0157378_10073621 3300013297 Bacteria 3072
771 Ga0157378_10196957 3300013297 Bacteria 1903
772 Ga0157378_10403762 3300013297 Bacteria 1347
773 Ga0163162_10000874 3300013306 Bacteria 28091
774 Ga0163162_10005793 3300013306 Bacteria 11959
775 Ga0163162_10014327 3300013306 Bacteria 7746
776 Ga0163162_10014382 3300013306 Bacteria 7733
777 Ga0163162_10024652 3300013306 Bacteria 5941
778 Ga0163162_10040114 3300013306 Bacteria 4680
779 Ga0163162_10045027 3300013306 Bacteria 4420
780 Ga0163162_10046883 3300013306 Bacteria 4332
781 Ga0163162_10100244 3300013306 Bacteria 2987
782 Ga0163162_10110970 3300013306 Bacteria 2840
783 Ga0163162_10111874 3300013306 Bacteria 2829
784 Ga0163162_10114283 3300013306 Bacteria 2798
785 Ga0163162_10115905 3300013306 Bacteria 2780
786 Ga0163162_10190315 3300013306 Bacteria 2179
787 Ga0157372_10004504 3300013307 Bacteria 14867
788 Ga0157372_10020695 3300013307 Bacteria 7100
789 Ga0157372_10023447 3300013307 Bacteria 6690
790 Ga0157372_10025586 3300013307 Bacteria 6420
791 Ga0157372_10032003 3300013307 Bacteria 5763
792 Ga0157372_10058323 3300013307 Bacteria 4315
793 Ga0157372_10073928 3300013307 Bacteria 3842
794 Ga0157372_10134547 3300013307 Bacteria 2846
795 Ga0157372_10180277 3300013307 Bacteria 2445
796 Ga0157372_10189282 3300013307 Bacteria 2383
797 Ga0157372_10199954 3300013307 Bacteria 2315
798 Ga0157372_10408260 3300013307 Bacteria 1583
799 Ga0157375_10002680 3300013308 Bacteria 15424
800 Ga0157375_10017229 3300013308 Bacteria 6514
801 Ga0157375_10069553 3300013308 Bacteria 3527
802 Ga0157375_10078718 3300013308 Bacteria 3330
803 Ga0157375_10111272 3300013308 Bacteria 2837
804 Ga0157375_10145408 3300013308 Bacteria 2501
805 Ga0157375_10165477 3300013308 Bacteria 2356
806 Ga0157375_10173714 3300013308 Bacteria 2303
807 Ga0157375_10315094 3300013308 Bacteria 1729
808 Ga0157375_10450862 3300013308 Bacteria 1452
809 Ga0157375_10457343 3300013308 Bacteria 1442
810 Ga0157375_10514553 3300013308 Bacteria 1360
811 Ga0157375_10530653 3300013308 Bacteria 1340
812 Ga0163163_10004930 3300014325 Bacteria 11481
813 Ga0163163_10022124 3300014325 Bacteria 6014
814 Ga0163163_10043369 3300014325 Bacteria 4410
815 Ga0163163_10059999 3300014325 Bacteria 3765
816 Ga0163163_10078197 3300014325 Bacteria 3304
817 Ga0163163_10140690 3300014325 Bacteria 2455
818 Ga0163163_10255595 3300014325 Bacteria 1803
819 Ga0163163_10539809 3300014325 Bacteria 1228
820 Ga0157380_10001456 3300014326 Bacteria 15479
821 Ga0157380_10027607 3300014326 Bacteria 4318
822 Ga0157380_10031639 3300014326 Bacteria 4064
823 Ga0157380_10077987 3300014326 Bacteria 2701
824 Ga0157380_10094634 3300014326 Bacteria 2473
825 Ga0157380_10221022 3300014326 Bacteria 1695
826 Ga0157380_10351228 3300014326 Bacteria 1380
827 Ga0182008_10006136 3300014497 Bacteria 6755
828 Ga0182008_10014350 3300014497 Bacteria 4150
829 Ga0182008_10024473 3300014497 Bacteria 3075
830 Ga0157377_10001448 3300014745 Bacteria 10254
831 Ga0157377_10012258 3300014745 Bacteria 4304
832 Ga0157379_10007711 3300014968 Bacteria 9320
833 Ga0157379_10009027 3300014968 Bacteria 8688
834 Ga0157379_10013776 3300014968 Bacteria 7085
835 Ga0157379_10016512 3300014968 Bacteria 6494
836 Ga0157379_10020826 3300014968 Bacteria 5804
837 Ga0157379_10063912 3300014968 Bacteria 3290
838 Ga0157379_10111542 3300014968 Bacteria 2457
839 Ga0157379_10111752 3300014968 Bacteria 2454
840 Ga0157376_10008997 3300014969 Bacteria 7232
841 Ga0157376_10013067 3300014969 Bacteria 6184
842 Ga0157376_10020343 3300014969 Bacteria 5132
843 Ga0157376_10036360 3300014969 Bacteria 3990
844 Ga0157376_10120836 3300014969 Bacteria 2321
845 Ga0157376_10131397 3300014969 Bacteria 2234
846 Ga0157376_10150952 3300014969 Bacteria 2095
847 Ga0182006_1000002 3300015261 Bacteria 887990
848 Ga0182006_1000021 3300015261 Bacteria 280808
849 Ga0182006_1008897 3300015261 Bacteria 4532
850 Ga0182007_10000211 3300015262 Bacteria 38928
851 Ga0182007_10001036 3300015262 Bacteria 15214
852 Ga0182007_10002147 3300015262 Bacteria 10032
853 Ga0182005_1000020 3300015265 Bacteria 278671
854 Ga0182005_1000029 3300015265 Bacteria 214132
855 Ga0182005_1005819 3300015265 Bacteria 3825
856 Ga0183362_10001 3300015683 Bacteria 2046624
857 Ga0183361_10029 3300016635 Bacteria 57317
858 Ga0163161_10012343 3300017792 Bacteria 5930
859 Ga0163161_10036842 3300017792 Bacteria 3504
860 Ga0163161_10070470 3300017792 Bacteria 2556
861 Ga0163161_10071418 3300017792 Bacteria 2540
862 Ga0163161_10243528 3300017792 Bacteria 1399
863 Ga0206356_11155722 3300020070 Bacteria 5063
864 Ga0206354_10762381 3300020081 Bacteria 3065
865 Ga0206354_11476839 3300020081 Bacteria 1445
866 Ga0206353_11189317 3300020082 Bacteria 4016
867 Ga0206353_11427262 3300020082 Bacteria 2230
868 Ga0213872_10000048 3300021361 Bacteria 109712
869 Ga0213872_10000089 3300021361 Bacteria 83910
870 Ga0213872_10000090 3300021361 Bacteria 83813
871 Ga0213872_10000647 3300021361 Bacteria 26348
872 Ga0213872_10002492 3300021361 Bacteria 10772
873 Ga0213876_10024329 3300021384 Bacteria 3197
874 Ga0224712_10001206 3300022467 Bacteria 5808
875 Ga0224712_10029638 3300022467 Bacteria 1967
876 Ga0209435_100014 3300025206 Bacteria 322129
877 Ga0209435_103278 3300025206 Bacteria 1852
878 Ga0209435_104790 3300025206 Bacteria 1523
879 Ga0209760_100079 3300025207 Bacteria 77345
880 Ga0209760_100211 3300025207 Bacteria 26630
881 Ga0209436_105735 3300025208 Bacteria 2811
882 Ga0209784_100128 3300025224 Bacteria 76497
883 Ga0209566_100157 3300025225 Bacteria 76430
884 Ga0209566_100868 3300025225 Bacteria 14852
885 Ga0209674_100139 3300025226 Bacteria 110389
886 Ga0209674_100180 3300025226 Bacteria 76497
887 Ga0209674_100191 3300025226 Bacteria 66206
888 Ga0209674_102220 3300025226 Bacteria 4311
889 Ga0209672_100002 3300025228 Bacteria 1733325
890 Ga0209672_100015 3300025228 Bacteria 529352
891 Ga0209672_100050 3300025228 Bacteria 238103
892 Ga0209672_100667 3300025228 Bacteria 17376
893 Ga0209672_100852 3300025228 Bacteria 14002
894 Ga0209147_100003 3300025229 Bacteria 1733325
895 Ga0209147_100016 3300025229 Bacteria 527606
896 Ga0209147_100183 3300025229 Bacteria 75926
897 Ga0209147_100406 3300025229 Bacteria 29162
898 Ga0209147_101378 3300025229 Bacteria 9015
899 Ga0209563_100005 3300025230 Bacteria 1774893
900 Ga0209563_100007 3300025230 Bacteria 1579402
901 Ga0209563_100144 3300025230 Bacteria 76497
902 Ga0209563_100667 3300025230 Bacteria 10926
903 Ga0209563_100859 3300025230 Bacteria 9033
904 Ga0207427_100001 3300025231 Bacteria 1410763
905 Ga0207427_100048 3300025231 Bacteria 238464
906 Ga0207427_100748 3300025231 Bacteria 14898
907 Ga0209437_100003 3300025233 Bacteria 1517827
908 Ga0209437_100094 3300025233 Bacteria 238465
909 Ga0209258_100009 3300025242 Bacteria 996276
910 Ga0209258_100026 3300025242 Bacteria 527606
911 Ga0209258_100077 3300025242 Bacteria 264510
912 Ga0209258_100310 3300025242 Bacteria 76430
913 Ga0209258_100590 3300025242 Bacteria 30015
914 Ga0209258_105139 3300025242 Bacteria 2289
915 Ga0207425_1000001 3300025245 Bacteria 2525432
916 Ga0207425_1000140 3300025245 Bacteria 63941
917 Ga0207425_1002423 3300025245 Bacteria 6566
918 Ga0207425_1003719 3300025245 Bacteria 4785
919 Ga0209646_1000001 3300025246 Bacteria 3092932
920 Ga0209646_1000087 3300025246 Bacteria 193273
921 Ga0209646_1000355 3300025246 Bacteria 32593
922 Ga0209026_1000073 3300025250 Bacteria 205399
923 Ga0209677_100127 3300025253 Bacteria 76548
924 Ga0209677_106170 3300025253 Bacteria 2915
925 Ga0209148_1000006 3300025254 Bacteria 1733325
926 Ga0209148_1000007 3300025254 Bacteria 1592273
927 Ga0209148_1000211 3300025254 Bacteria 102391
928 Ga0209759_1000013 3300025256 Bacteria 399300
929 Ga0209759_1000170 3300025256 Bacteria 110023
930 Ga0209759_1000225 3300025256 Bacteria 84464
931 Ga0209759_1000528 3300025256 Bacteria 40580
932 Ga0209759_1004564 3300025256 Bacteria 5116
933 Ga0209759_1010048 3300025256 Bacteria 2808
934 Ga0209129_1000001 3300025258 Bacteria 1452436
935 Ga0209129_1008178 3300025258 Bacteria 2959
936 Ga0209233_1000007 3300025261 Bacteria 1411234
937 Ga0209233_1000106 3300025261 Bacteria 268795
938 Ga0209233_1000177 3300025261 Bacteria 141716
939 Ga0209565_1000009 3300025263 Bacteria 751701
940 Ga0209565_1000036 3300025263 Bacteria 293334
941 Ga0209565_1000046 3300025263 Bacteria 226073
942 Ga0209565_1000518 3300025263 Bacteria 27559
943 Ga0209565_1001213 3300025263 Bacteria 12203
944 Ga0209565_1001975 3300025263 Bacteria 8021
945 Ga0209565_1002632 3300025263 Bacteria 6326
946 Ga0209455_1000140 3300025272 Bacteria 138610
947 Ga0209455_1000175 3300025272 Bacteria 107931
948 Ga0209455_1001930 3300025272 Bacteria 8565
949 Ga0209673_1000008 3300025273 Bacteria 626013
950 Ga0209673_1000019 3300025273 Bacteria 449094
951 Ga0209673_1000028 3300025273 Bacteria 358901
952 Ga0209673_1000053 3300025273 Bacteria 279449
953 Ga0209673_1002050 3300025273 Bacteria 15255
954 Ga0209673_1003115 3300025273 Bacteria 10152
955 Ga0209673_1005752 3300025273 Bacteria 6174
956 Ga0209673_1007796 3300025273 Bacteria 4862
957 Ga0209673_1015853 3300025273 Bacteria 2842
958 Ga0209130_1000179 3300025284 Bacteria 90126
959 Ga0209130_1000216 3300025284 Bacteria 75536
960 Ga0209130_1000278 3300025284 Bacteria 63352
961 Ga0209130_1000578 3300025284 Bacteria 35635
962 Ga0209130_1001433 3300025284 Bacteria 15842
963 Ga0209130_1001480 3300025284 Bacteria 15295
964 Ga0209130_1004129 3300025284 Bacteria 5706
965 Ga0209130_1004158 3300025284 Bacteria 5669
966 Ga0209130_1008775 3300025284 Bacteria 2948
967 Ga0209675_1000010 3300025291 Bacteria 541927
968 Ga0209675_1000013 3300025291 Bacteria 448220
969 Ga0209675_1000942 3300025291 Bacteria 18500
970 Ga0209675_1001061 3300025291 Bacteria 17037
971 Ga0209675_1001188 3300025291 Bacteria 15806
972 Ga0209675_1001338 3300025291 Bacteria 14560
973 Ga0209675_1013977 3300025291 Bacteria 2470
974 Ga0209676_1000007 3300025292 Bacteria 1029371
975 Ga0209676_1000055 3300025292 Bacteria 361565
976 Ga0209676_1000108 3300025292 Bacteria 221168
977 Ga0209676_1000959 3300025292 Bacteria 34915
978 Ga0209676_1001598 3300025292 Bacteria 20156
979 Ga0209676_1002730 3300025292 Bacteria 11853
980 Ga0209676_1002788 3300025292 Bacteria 11595
981 Ga0209676_1004219 3300025292 Bacteria 8132
982 Ga0209676_1008915 3300025292 Bacteria 4406
983 Ga0209025_1000003 3300025294 Bacteria 1366495
984 Ga0209025_1002450 3300025294 Bacteria 19609
985 Ga0209025_1002457 3300025294 Bacteria 19579
986 Ga0209025_1002889 3300025294 Bacteria 17198
987 Ga0209025_1012482 3300025294 Bacteria 5437
988 Ga0209025_1013171 3300025294 Bacteria 5222
989 Ga0209025_1017450 3300025294 Bacteria 4140
990 Ga0209025_1017725 3300025294 Bacteria 4090
991 Ga0209025_1036082 3300025294 Bacteria 2221
992 Ga0209025_1040850 3300025294 Bacteria 1998
993 Ga0209564_1000003 3300025295 Bacteria 1585848
994 Ga0209564_1000009 3300025295 Bacteria 950196
995 Ga0209564_1000045 3300025295 Bacteria 376549
996 Ga0209564_1000058 3300025295 Bacteria 332955
997 Ga0209564_1000447 3300025295 Bacteria 70825
998 Ga0209564_1000633 3300025295 Bacteria 53597
999 Ga0209564_1001853 3300025295 Bacteria 19189
1000 Ga0209564_1002900 3300025295 Bacteria 12507
1001 Ga0209564_1014134 3300025295 Bacteria 3341
1002 Ga0209564_1017151 3300025295 Bacteria 2840
1003 Ga0209758_1000166 3300025297 Bacteria 151104
1004 Ga0209758_1000513 3300025297 Bacteria 62232
1005 Ga0209050_1000002 3300025298 Bacteria 1792849
1006 Ga0209050_1000003 3300025298 Bacteria 1609245
1007 Ga0209050_1000079 3300025298 Bacteria 277803
1008 Ga0209050_1000435 3300025298 Bacteria 76330
1009 Ga0209050_1000606 3300025298 Bacteria 57003
1010 Ga0209050_1001046 3300025298 Bacteria 34171
1011 Ga0209050_1003226 3300025298 Bacteria 12316
1012 Ga0209050_1003660 3300025298 Bacteria 11105
1013 Ga0209050_1034848 3300025298 Bacteria 1498
1014 Ga0209256_1000001 3300025299 Bacteria 2166974
1015 Ga0209256_1000005 3300025299 Bacteria 1315082
1016 Ga0209256_1000011 3300025299 Bacteria 865309
1017 Ga0209256_1000052 3300025299 Bacteria 299374
1018 Ga0209256_1000098 3300025299 Bacteria 204152
1019 Ga0209256_1000568 3300025299 Bacteria 52740
1020 Ga0209256_1001880 3300025299 Bacteria 19356
1021 Ga0209256_1002401 3300025299 Bacteria 15389
1022 Ga0209256_1006842 3300025299 Bacteria 5867
1023 Ga0207426_1000020 3300025302 Bacteria 558084
1024 Ga0207426_1000038 3300025302 Bacteria 441522
1025 Ga0207426_1000817 3300025302 Bacteria 33418
1026 Ga0207426_1001461 3300025302 Bacteria 19544
1027 Ga0207426_1002025 3300025302 Bacteria 14230
1028 Ga0207426_1003424 3300025302 Bacteria 8643
1029 Ga0209051_1000002 3300025303 Bacteria 1631846
1030 Ga0209051_1000003 3300025303 Bacteria 1609245
1031 Ga0209051_1000016 3300025303 Bacteria 541891
1032 Ga0209051_1000054 3300025303 Bacteria 280804
1033 Ga0209051_1000083 3300025303 Bacteria 192732
1034 Ga0209051_1000429 3300025303 Bacteria 57551
1035 Ga0209051_1000976 3300025303 Bacteria 27866
1036 Ga0209051_1003196 3300025303 Bacteria 10941
1037 Ga0209051_1003352 3300025303 Bacteria 10557
1038 Ga0209051_1007299 3300025303 Bacteria 6066
1039 Ga0209051_1010309 3300025303 Bacteria 4739
1040 Ga0209051_1011396 3300025303 Bacteria 4392
1041 Ga0209051_1016469 3300025303 Bacteria 3343
1042 Ga0209051_1041597 3300025303 Bacteria 1633
1043 Ga0209257_1000002 3300025304 Bacteria 1767052
1044 Ga0209257_1000017 3300025304 Bacteria 866287
1045 Ga0209257_1000020 3300025304 Bacteria 773356
1046 Ga0209257_1000102 3300025304 Bacteria 251074
1047 Ga0209257_1000107 3300025304 Bacteria 240937
1048 Ga0209257_1000175 3300025304 Bacteria 165070
1049 Ga0209257_1001931 3300025304 Bacteria 22372
1050 Ga0209257_1003587 3300025304 Bacteria 13113
1051 Ga0209257_1008671 3300025304 Bacteria 5690
1052 Ga0209257_1018727 3300025304 Bacteria 2645
1053 Ga0207697_10001001 3300025315 Bacteria 15824
1054 Ga0207697_10006462 3300025315 Bacteria 5303
1055 Ga0207656_10003515 3300025321 Bacteria 5391
1056 Ga0207656_10006593 3300025321 Bacteria 4187
1057 Ga0207696_1000019 3300025711 Bacteria 476309
1058 Ga0207696_1000175 3300025711 Bacteria 102142
1059 Ga0207696_1000426 3300025711 Bacteria 38552
1060 Ga0207696_1006503 3300025711 Bacteria 4704
1061 Ga0207696_1017475 3300025711 Bacteria 2375
1062 Ga0207655_1000019 3300025728 Bacteria 536324
1063 Ga0207655_1000434 3300025728 Bacteria 56142
1064 Ga0207655_1000972 3300025728 Bacteria 29527
1065 Ga0207655_1001025 3300025728 Bacteria 28225
1066 Ga0207655_1001801 3300025728 Bacteria 18589
1067 Ga0207655_1001882 3300025728 Bacteria 18026
1068 Ga0207655_1003673 3300025728 Bacteria 11309
1069 Ga0207655_1008926 3300025728 Bacteria 6293
1070 Ga0207655_1013236 3300025728 Bacteria 4751
1071 Ga0207655_1026927 3300025728 Bacteria 2751
1072 Ga0207655_1027485 3300025728 Bacteria 2709
1073 Ga0207713_1000201 3300025735 Bacteria 82948
1074 Ga0207713_1000207 3300025735 Bacteria 79895
1075 Ga0207713_1000299 3300025735 Bacteria 56880
1076 Ga0207713_1002659 3300025735 Bacteria 12824
1077 Ga0207713_1005031 3300025735 Bacteria 8403
1078 Ga0207682_10000156 3300025893 Bacteria 30863
1079 Ga0207682_10001232 3300025893 Bacteria 11839
1080 Ga0207682_10004086 3300025893 Bacteria 6196
1081 Ga0207692_10025121 3300025898 Bacteria 2778
1082 Ga0207692_10050193 3300025898 Bacteria 2109
1083 Ga0207642_10051048 3300025899 Bacteria 1869
1084 Ga0207642_10086416 3300025899 Bacteria 1537
1085 Ga0207642_10150172 3300025899 Bacteria 1239
1086 Ga0207710_10016391 3300025900 Bacteria 3134
1087 Ga0207688_10007576 3300025901 Bacteria 5909
1088 Ga0207688_10008649 3300025901 Bacteria 5540
1089 Ga0207688_10030832 3300025901 Bacteria 2958
1090 Ga0207688_10140150 3300025901 Bacteria 1423
1091 Ga0207680_10016706 3300025903 Bacteria 3859
1092 Ga0207680_10021098 3300025903 Bacteria 3519
1093 Ga0207680_10031705 3300025903 Bacteria 2996
1094 Ga0207680_10069034 3300025903 Bacteria 2182
1095 Ga0207680_10208989 3300025903 Bacteria 1333
1096 Ga0207647_10000377 3300025904 Bacteria 36280
1097 Ga0207647_10007194 3300025904 Bacteria 8062
1098 Ga0207647_10008442 3300025904 Bacteria 7386
1099 Ga0207699_10017562 3300025906 Bacteria 3770
1100 Ga0207645_10001112 3300025907 Bacteria 22233
1101 Ga0207645_10001627 3300025907 Bacteria 18325
1102 Ga0207645_10002076 3300025907 Bacteria 16034
1103 Ga0207645_10006800 3300025907 Bacteria 8163
1104 Ga0207645_10008242 3300025907 Bacteria 7286
1105 Ga0207645_10039500 3300025907 Bacteria 3024
1106 Ga0207645_10069092 3300025907 Bacteria 2260
1107 Ga0207645_10086265 3300025907 Bacteria 2017
1108 Ga0207643_10000445 3300025908 Bacteria 26895
1109 Ga0207643_10002852 3300025908 Bacteria 9334
1110 Ga0207643_10011643 3300025908 Bacteria 4749
1111 Ga0207643_10026801 3300025908 Bacteria 3193
1112 Ga0207643_10029178 3300025908 Bacteria 3068
1113 Ga0207705_10001325 3300025909 Bacteria 19811
1114 Ga0207705_10015699 3300025909 Bacteria 5438
1115 Ga0207705_10024322 3300025909 Bacteria 4324
1116 Ga0207705_10046680 3300025909 Bacteria 3113
1117 Ga0207705_10050935 3300025909 Bacteria 2981
1118 Ga0207705_10078717 3300025909 Bacteria 2400
1119 Ga0207705_10090670 3300025909 Bacteria 2238
1120 Ga0207684_10009722 3300025910 Bacteria 8480
1121 Ga0207684_10152204 3300025910 Bacteria 1990
1122 Ga0207654_10091081 3300025911 Bacteria 1859
1123 Ga0207707_10006527 3300025912 Bacteria 10184
1124 Ga0207707_10060072 3300025912 Bacteria 3307
1125 Ga0207707_10084046 3300025912 Bacteria 2780
1126 Ga0207707_10131426 3300025912 Bacteria 2190
1127 Ga0207695_10002871 3300025913 Bacteria 25012
1128 Ga0207695_10004334 3300025913 Bacteria 19434
1129 Ga0207695_10012539 3300025913 Bacteria 10161
1130 Ga0207695_10023511 3300025913 Bacteria 6960
1131 Ga0207695_10023843 3300025913 Bacteria 6906
1132 Ga0207695_10026262 3300025913 Bacteria 6501
1133 Ga0207695_10040042 3300025913 Bacteria 5031
1134 Ga0207695_10152276 3300025913 Bacteria 2251
1135 Ga0207695_10204405 3300025913 Bacteria 1888
1136 Ga0207671_10000018 3300025914 Bacteria 318130
1137 Ga0207671_10007955 3300025914 Bacteria 9084
1138 Ga0207671_10010367 3300025914 Bacteria 7696
1139 Ga0207671_10038886 3300025914 Bacteria 3525
1140 Ga0207671_10092797 3300025914 Bacteria 2276
1141 Ga0207671_10103515 3300025914 Bacteria 2159
1142 Ga0207671_10107401 3300025914 Bacteria 2120
1143 Ga0207693_10000913 3300025915 Bacteria 26504
1144 Ga0207663_10028531 3300025916 Bacteria 3267
1145 Ga0207663_10033735 3300025916 Bacteria 3053
1146 Ga0207663_10188930 3300025916 Bacteria 1478
1147 Ga0207660_10009561 3300025917 Bacteria 6275
1148 Ga0207660_10061073 3300025917 Bacteria 2712
1149 Ga0207660_10240578 3300025917 Bacteria 1426
1150 Ga0207662_10005690 3300025918 Bacteria 6668
1151 Ga0207662_10018159 3300025918 Bacteria 3986
1152 Ga0207662_10031171 3300025918 Bacteria 3097
1153 Ga0207662_10174300 3300025918 Bacteria 1381
1154 Ga0207657_10000119 3300025919 Bacteria 78609
1155 Ga0207657_10000234 3300025919 Bacteria 58447
1156 Ga0207657_10008836 3300025919 Bacteria 10190
1157 Ga0207657_10018689 3300025919 Bacteria 6605
1158 Ga0207657_10022056 3300025919 Bacteria 5976
1159 Ga0207657_10025210 3300025919 Bacteria 5487
1160 Ga0207657_10057178 3300025919 Bacteria 3363
1161 Ga0207657_10088684 3300025919 Bacteria 2585
1162 Ga0207649_10000008 3300025920 Bacteria 315683
1163 Ga0207649_10002483 3300025920 Bacteria 10308
1164 Ga0207649_10036098 3300025920 Bacteria 2974
1165 Ga0207649_10069097 3300025920 Bacteria 2248
1166 Ga0207649_10107147 3300025920 Bacteria 1860
1167 Ga0207649_10113717 3300025920 Bacteria 1813
1168 Ga0207652_10006543 3300025921 Bacteria 9389
1169 Ga0207652_10008656 3300025921 Bacteria 8192
1170 Ga0207652_10033197 3300025921 Bacteria 4345
1171 Ga0207652_10072047 3300025921 Bacteria 3004
1172 Ga0207652_10091327 3300025921 Bacteria 2677
1173 Ga0207652_10092429 3300025921 Bacteria 2661
1174 Ga0207652_10152433 3300025921 Bacteria 2070
1175 Ga0207652_10216129 3300025921 Bacteria 1727
1176 Ga0207646_10003730 3300025922 Bacteria 16988
1177 Ga0207681_10000205 3300025923 Bacteria 47034
1178 Ga0207681_10002297 3300025923 Bacteria 12156
1179 Ga0207681_10024951 3300025923 Bacteria 3841
1180 Ga0207681_10025718 3300025923 Bacteria 3789
1181 Ga0207681_10059594 3300025923 Bacteria 2617
1182 Ga0207681_10062354 3300025923 Bacteria 2567
1183 Ga0207681_10306395 3300025923 Bacteria 1258
1184 Ga0207694_10005611 3300025924 Bacteria 9616
1185 Ga0207694_10016228 3300025924 Bacteria 5620
1186 Ga0207694_10022482 3300025924 Bacteria 4784
1187 Ga0207650_10002243 3300025925 Bacteria 13495
1188 Ga0207650_10002265 3300025925 Bacteria 13428
1189 Ga0207650_10004376 3300025925 Bacteria 9649
1190 Ga0207650_10011131 3300025925 Bacteria 6186
1191 Ga0207650_10013910 3300025925 Bacteria 5581
1192 Ga0207650_10029250 3300025925 Bacteria 3959
1193 Ga0207650_10031362 3300025925 Bacteria 3837
1194 Ga0207650_10046965 3300025925 Bacteria 3180
1195 Ga0207650_10061153 3300025925 Bacteria 2811
1196 Ga0207650_10173856 3300025925 Bacteria 1713
1197 Ga0207650_10212254 3300025925 Bacteria 1555
1198 Ga0207659_10010965 3300025926 Bacteria 5710
1199 Ga0207659_10025791 3300025926 Bacteria 3956
1200 Ga0207659_10037177 3300025926 Bacteria 3378
1201 Ga0207659_10042085 3300025926 Bacteria 3201
1202 Ga0207659_10286633 3300025926 Bacteria 1348
1203 Ga0207687_10008206 3300025927 Bacteria 6833
1204 Ga0207687_10044741 3300025927 Bacteria 3057
1205 Ga0207687_10054860 3300025927 Bacteria 2790
1206 Ga0207687_10055637 3300025927 Bacteria 2773
1207 Ga0207687_10119217 3300025927 Bacteria 1971
1208 Ga0207687_10333747 3300025927 Bacteria 1231
1209 Ga0207700_10004038 3300025928 Bacteria 8597
1210 Ga0207700_10015961 3300025928 Bacteria 4975
1211 Ga0207700_10106107 3300025928 Bacteria 2251
1212 Ga0207664_10023687 3300025929 Bacteria 4603
1213 Ga0207664_10046620 3300025929 Bacteria 3403
1214 Ga0207664_10047911 3300025929 Bacteria 3359
1215 Ga0207664_10231314 3300025929 Bacteria 1607
1216 Ga0207644_10021664 3300025931 Bacteria 4382
1217 Ga0207644_10030542 3300025931 Bacteria 3748
1218 Ga0207644_10034352 3300025931 Bacteria 3547
1219 Ga0207644_10039289 3300025931 Bacteria 3340
1220 Ga0207644_10045043 3300025931 Bacteria 3137
1221 Ga0207644_10069583 3300025931 Bacteria 2570
1222 Ga0207644_10100718 3300025931 Bacteria 2169
1223 Ga0207644_10104938 3300025931 Bacteria 2128
1224 Ga0207644_10110008 3300025931 Bacteria 2082
1225 Ga0207644_10291120 3300025931 Bacteria 1313
1226 Ga0207690_10000008 3300025932 Bacteria 366090
1227 Ga0207690_10000627 3300025932 Bacteria 22858
1228 Ga0207690_10013177 3300025932 Bacteria 4963
1229 Ga0207690_10014970 3300025932 Bacteria 4697
1230 Ga0207690_10082534 3300025932 Bacteria 2248
1231 Ga0207690_10204595 3300025932 Bacteria 1501
1232 Ga0207706_10000097 3300025933 Bacteria 91923
1233 Ga0207706_10001633 3300025933 Bacteria 22226
1234 Ga0207706_10003177 3300025933 Bacteria 15787
1235 Ga0207706_10005729 3300025933 Bacteria 11570
1236 Ga0207706_10009403 3300025933 Bacteria 8972
1237 Ga0207706_10009658 3300025933 Bacteria 8855
1238 Ga0207706_10030578 3300025933 Bacteria 4803
1239 Ga0207706_10045443 3300025933 Bacteria 3891
1240 Ga0207706_10052295 3300025933 Bacteria 3606
1241 Ga0207706_10092786 3300025933 Bacteria 2655
1242 Ga0207706_10111170 3300025933 Bacteria 2410
1243 Ga0207706_10346463 3300025933 Bacteria 1292
1244 Ga0207686_10010975 3300025934 Bacteria 4943
1245 Ga0207686_10035550 3300025934 Bacteria 2992
1246 Ga0207686_10053243 3300025934 Bacteria 2529
1247 Ga0207709_10000089 3300025935 Bacteria 149139
1248 Ga0207709_10001396 3300025935 Bacteria 16890
1249 Ga0207709_10001533 3300025935 Bacteria 15879
1250 Ga0207709_10001814 3300025935 Bacteria 14255
1251 Ga0207709_10006336 3300025935 Bacteria 6643
1252 Ga0207709_10020396 3300025935 Bacteria 3739
1253 Ga0207709_10034506 3300025935 Bacteria 2982
1254 Ga0207709_10062840 3300025935 Bacteria 2325
1255 Ga0207709_10076547 3300025935 Bacteria 2142
1256 Ga0207709_10086292 3300025935 Bacteria 2037
1257 Ga0207709_10174546 3300025935 Bacteria 1512
1258 Ga0207709_10292332 3300025935 Bacteria 1208
1259 Ga0207670_10016406 3300025936 Bacteria 4451
1260 Ga0207670_10069548 3300025936 Bacteria 2429
1261 Ga0207670_10072199 3300025936 Bacteria 2389
1262 Ga0207669_10047302 3300025937 Bacteria 2547
1263 Ga0207669_10066966 3300025937 Bacteria 2236
1264 Ga0207669_10083766 3300025937 Bacteria 2052
1265 Ga0207669_10092702 3300025937 Bacteria 1971
1266 Ga0207704_10053681 3300025938 Bacteria 2452
1267 Ga0207704_10054287 3300025938 Bacteria 2442
1268 Ga0207704_10070761 3300025938 Bacteria 2210
1269 Ga0207704_10071465 3300025938 Bacteria 2202
1270 Ga0207704_10101606 3300025938 Bacteria 1918
1271 Ga0207691_10000379 3300025940 Bacteria 44711
1272 Ga0207691_10000560 3300025940 Bacteria 37165
1273 Ga0207691_10001443 3300025940 Bacteria 23702
1274 Ga0207691_10002611 3300025940 Bacteria 17592
1275 Ga0207691_10028589 3300025940 Bacteria 5219
1276 Ga0207691_10033839 3300025940 Bacteria 4758
1277 Ga0207691_10068248 3300025940 Bacteria 3213
1278 Ga0207691_10079106 3300025940 Bacteria 2959
1279 Ga0207691_10083473 3300025940 Bacteria 2868
1280 Ga0207691_10113760 3300025940 Bacteria 2405
1281 Ga0207711_10003680 3300025941 Bacteria 13243
1282 Ga0207711_10004990 3300025941 Bacteria 11255
1283 Ga0207711_10005367 3300025941 Bacteria 10853
1284 Ga0207711_10006526 3300025941 Bacteria 9821
1285 Ga0207711_10032423 3300025941 Bacteria 4417
1286 Ga0207711_10044576 3300025941 Bacteria 3787
1287 Ga0207711_10069096 3300025941 Bacteria 3061
1288 Ga0207711_10102996 3300025941 Bacteria 2527
1289 Ga0207711_10105929 3300025941 Bacteria 2494
1290 Ga0207711_10122871 3300025941 Bacteria 2319
1291 Ga0207711_10226826 3300025941 Bacteria 1710
1292 Ga0207711_10236964 3300025941 Bacteria 1672
1293 Ga0207689_10000354 3300025942 Bacteria 42996
1294 Ga0207689_10000612 3300025942 Bacteria 34213
1295 Ga0207689_10010118 3300025942 Bacteria 8132
1296 Ga0207689_10033000 3300025942 Bacteria 4303
1297 Ga0207689_10040531 3300025942 Bacteria 3854
1298 Ga0207689_10055805 3300025942 Bacteria 3250
1299 Ga0207689_10077170 3300025942 Bacteria 2739
1300 Ga0207689_10113631 3300025942 Bacteria 2226
1301 Ga0207689_10121857 3300025942 Bacteria 2145
1302 Ga0207661_10108785 3300025944 Bacteria 2341
1303 Ga0207679_10000008 3300025945 Bacteria 412057
1304 Ga0207679_10000526 3300025945 Bacteria 25924
1305 Ga0207679_10002757 3300025945 Bacteria 10873
1306 Ga0207679_10010614 3300025945 Bacteria 5934
1307 Ga0207679_10014592 3300025945 Bacteria 5170
1308 Ga0207679_10029495 3300025945 Bacteria 3820
1309 Ga0207679_10051583 3300025945 Bacteria 3012
1310 Ga0207679_10107972 3300025945 Bacteria 2191
1311 Ga0207679_10125651 3300025945 Bacteria 2049
1312 Ga0207679_10271530 3300025945 Bacteria 1450
1313 Ga0207667_10012400 3300025949 Bacteria 9823
1314 Ga0207667_10018784 3300025949 Bacteria 7740
1315 Ga0207667_10021965 3300025949 Bacteria 7063
1316 Ga0207667_10024510 3300025949 Bacteria 6622
1317 Ga0207667_10044647 3300025949 Bacteria 4695
1318 Ga0207667_10056334 3300025949 Bacteria 4130
1319 Ga0207667_10074493 3300025949 Bacteria 3527
1320 Ga0207667_10084145 3300025949 Bacteria 3293
1321 Ga0207667_10087708 3300025949 Bacteria 3218
1322 Ga0207667_10189972 3300025949 Bacteria 2108
1323 Ga0207667_10212257 3300025949 Bacteria 1984
1324 Ga0207667_10384176 3300025949 Bacteria 1430
1325 Ga0207667_10401541 3300025949 Bacteria 1395
1326 Ga0207651_10003368 3300025960 Bacteria 7844
1327 Ga0207651_10033658 3300025960 Bacteria 3308
1328 Ga0207651_10040363 3300025960 Bacteria 3087
1329 Ga0207651_10135151 3300025960 Bacteria 1895
1330 Ga0207651_10148424 3300025960 Bacteria 1821
1331 Ga0207651_10191975 3300025960 Bacteria 1630
1332 Ga0207712_10070647 3300025961 Bacteria 2509
1333 Ga0207712_10123361 3300025961 Bacteria 1963
1334 Ga0207712_10243709 3300025961 Bacteria 1449
1335 Ga0207668_10004059 3300025972 Bacteria 8610
1336 Ga0207668_10008553 3300025972 Bacteria 6106
1337 Ga0207668_10021244 3300025972 Bacteria 4138
1338 Ga0207668_10056464 3300025972 Bacteria 2735
1339 Ga0207668_10109639 3300025972 Bacteria 2068
1340 Ga0207668_10111859 3300025972 Bacteria 2050
1341 Ga0207668_10117769 3300025972 Bacteria 2005
1342 Ga0207640_10019600 3300025981 Bacteria 4000
1343 Ga0207640_10030172 3300025981 Bacteria 3337
1344 Ga0207640_10049656 3300025981 Bacteria 2718
1345 Ga0207640_10057661 3300025981 Bacteria 2555
1346 Ga0207640_10218980 3300025981 Bacteria 1456
1347 Ga0207658_10001252 3300025986 Bacteria 20100
1348 Ga0207658_10003819 3300025986 Bacteria 10607
1349 Ga0207658_10005575 3300025986 Bacteria 8613
1350 Ga0207658_10012973 3300025986 Bacteria 5691
1351 Ga0207658_10014187 3300025986 Bacteria 5457
1352 Ga0207658_10056931 3300025986 Bacteria 2903
1353 Ga0207658_10062968 3300025986 Bacteria 2778
1354 Ga0207658_10066205 3300025986 Bacteria 2717
1355 Ga0207658_10074285 3300025986 Bacteria 2583
1356 Ga0207658_10120780 3300025986 Bacteria 2089
1357 Ga0207658_10170607 3300025986 Bacteria 1792
1358 Ga0207658_10390197 3300025986 Bacteria 1221
1359 Ga0207677_10001106 3300026023 Bacteria 14727
1360 Ga0207677_10019405 3300026023 Bacteria 4105
1361 Ga0207677_10042551 3300026023 Bacteria 3013
1362 Ga0207677_10054457 3300026023 Bacteria 2730
1363 Ga0207677_10095683 3300026023 Bacteria 2171
1364 Ga0207677_10115179 3300026023 Bacteria 2010
1365 Ga0207677_10222553 3300026023 Bacteria 1514
1366 Ga0207677_10279817 3300026023 Bacteria 1369
1367 Ga0207703_10007447 3300026035 Bacteria 8694
1368 Ga0207703_10008714 3300026035 Bacteria 8007
1369 Ga0207703_10014143 3300026035 Bacteria 6222
1370 Ga0207703_10023553 3300026035 Bacteria 4838
1371 Ga0207703_10034602 3300026035 Bacteria 4009
1372 Ga0207703_10087658 3300026035 Bacteria 2610
1373 Ga0207703_10127492 3300026035 Bacteria 2193
1374 Ga0207703_10323430 3300026035 Bacteria 1413
1375 Ga0207639_10017922 3300026041 Bacteria 5023
1376 Ga0207639_10019392 3300026041 Bacteria 4850
1377 Ga0207639_10028968 3300026041 Bacteria 4049
1378 Ga0207639_10033342 3300026041 Bacteria 3798
1379 Ga0207639_10043030 3300026041 Bacteria 3388
1380 Ga0207639_10061127 3300026041 Bacteria 2908
1381 Ga0207639_10066858 3300026041 Bacteria 2795
1382 Ga0207639_10117172 3300026041 Bacteria 2182
1383 Ga0207639_10199624 3300026041 Bacteria 1714
1384 Ga0207678_10001071 3300026067 Bacteria 25052
1385 Ga0207678_10001111 3300026067 Bacteria 24650
1386 Ga0207678_10003293 3300026067 Bacteria 14561
1387 Ga0207678_10011773 3300026067 Bacteria 7681
1388 Ga0207678_10020332 3300026067 Bacteria 5824
1389 Ga0207678_10072223 3300026067 Bacteria 2957
1390 Ga0207708_10000507 3300026075 Bacteria 30006
1391 Ga0207708_10001176 3300026075 Bacteria 19697
1392 Ga0207708_10025273 3300026075 Bacteria 4492
1393 Ga0207708_10036835 3300026075 Bacteria 3726
1394 Ga0207708_10041800 3300026075 Bacteria 3495
1395 Ga0207708_10078304 3300026075 Bacteria 2538
1396 Ga0207702_10008298 3300026078 Bacteria 8778
1397 Ga0207702_10101427 3300026078 Bacteria 2541
1398 Ga0207702_10166875 3300026078 Bacteria 2015
1399 Ga0207702_10258172 3300026078 Bacteria 1639
1400 Ga0207641_10001267 3300026088 Bacteria 25148
1401 Ga0207641_10003226 3300026088 Bacteria 14575
1402 Ga0207641_10007661 3300026088 Bacteria 8977
1403 Ga0207641_10010832 3300026088 Bacteria 7470
1404 Ga0207641_10033258 3300026088 Bacteria 4284
1405 Ga0207641_10037845 3300026088 Bacteria 4031
1406 Ga0207641_10038623 3300026088 Bacteria 3991
1407 Ga0207641_10073262 3300026088 Bacteria 2951
1408 Ga0207641_10132522 3300026088 Bacteria 2239
1409 Ga0207641_10318037 3300026088 Bacteria 1475
1410 Ga0207648_10000310 3300026089 Bacteria 53471
1411 Ga0207648_10000715 3300026089 Bacteria 37217
1412 Ga0207648_10001454 3300026089 Bacteria 26051
1413 Ga0207648_10001816 3300026089 Bacteria 23361
1414 Ga0207648_10034496 3300026089 Bacteria 4460
1415 Ga0207648_10041225 3300026089 Bacteria 4054
1416 Ga0207648_10044589 3300026089 Bacteria 3890
1417 Ga0207648_10054187 3300026089 Bacteria 3503
1418 Ga0207648_10087839 3300026089 Bacteria 2714
1419 Ga0207648_10093563 3300026089 Bacteria 2628
1420 Ga0207648_10097092 3300026089 Bacteria 2579
1421 Ga0207676_10002033 3300026095 Bacteria 14699
1422 Ga0207676_10002448 3300026095 Bacteria 13230
1423 Ga0207676_10002699 3300026095 Bacteria 12624
1424 Ga0207676_10008507 3300026095 Bacteria 7297
1425 Ga0207676_10023700 3300026095 Bacteria 4533
1426 Ga0207676_10145554 3300026095 Bacteria 2035
1427 Ga0207676_10153440 3300026095 Bacteria 1986
1428 Ga0207676_10230700 3300026095 Bacteria 1655
1429 Ga0207676_10329576 3300026095 Bacteria 1404
1430 Ga0207674_10000302 3300026116 Bacteria 62546
1431 Ga0207674_10006175 3300026116 Bacteria 14138
1432 Ga0207674_10011524 3300026116 Bacteria 9932
1433 Ga0207674_10016443 3300026116 Bacteria 8098
1434 Ga0207674_10019180 3300026116 Bacteria 7416
1435 Ga0207674_10025436 3300026116 Bacteria 6313
1436 Ga0207674_10026126 3300026116 Bacteria 6211
1437 Ga0207674_10062082 3300026116 Bacteria 3774
1438 Ga0207674_10092788 3300026116 Bacteria 3009
1439 Ga0207674_10098372 3300026116 Bacteria 2909
1440 Ga0207674_10099739 3300026116 Bacteria 2886
1441 Ga0207674_10320326 3300026116 Bacteria 1500
1442 Ga0207675_100002511 3300026118 Bacteria 18156
1443 Ga0207675_100003355 3300026118 Bacteria 15653
1444 Ga0207675_100005635 3300026118 Bacteria 11987
1445 Ga0207675_100007661 3300026118 Bacteria 10196
1446 Ga0207675_100012910 3300026118 Bacteria 7801
1447 Ga0207675_100018129 3300026118 Bacteria 6564
1448 Ga0207675_100043683 3300026118 Bacteria 4186
1449 Ga0207675_100046280 3300026118 Bacteria 4064
1450 Ga0207675_100054962 3300026118 Bacteria 3714
1451 Ga0207675_100093683 3300026118 Bacteria 2826
1452 Ga0207675_100137700 3300026118 Bacteria 2317
1453 Ga0207675_100383368 3300026118 Bacteria 1383
1454 Ga0207683_10000219 3300026121 Bacteria 50089
1455 Ga0207683_10001087 3300026121 Bacteria 24715
1456 Ga0207683_10002982 3300026121 Bacteria 14773
1457 Ga0207683_10004264 3300026121 Bacteria 12341
1458 Ga0207683_10017541 3300026121 Bacteria 6102
1459 Ga0207683_10020412 3300026121 Bacteria 5668
1460 Ga0207683_10024997 3300026121 Bacteria 5149
1461 Ga0207683_10042403 3300026121 Bacteria 3975
1462 Ga0207683_10049439 3300026121 Bacteria 3681
1463 Ga0207683_10062219 3300026121 Bacteria 3287
1464 Ga0207683_10066054 3300026121 Bacteria 3189
1465 Ga0207683_10078408 3300026121 Bacteria 2927
1466 Ga0207683_10087225 3300026121 Bacteria 2775
1467 Ga0207683_10092320 3300026121 Bacteria 2698
1468 Ga0207683_10214809 3300026121 Bacteria 1751
1469 Ga0207683_10348761 3300026121 Bacteria 1358
1470 Ga0207698_10003673 3300026142 Bacteria 9269
1471 Ga0207698_10025605 3300026142 Bacteria 4159
1472 Ga0207698_10078042 3300026142 Bacteria 2657
1473 Ga0207698_10093741 3300026142 Bacteria 2466
1474 Ga0207698_10131537 3300026142 Bacteria 2139
1475 Ga0207698_10276039 3300026142 Bacteria 1552
1476 Ga0209281_1000018 3300027111 Bacteria 579091
1477 Ga0209281_1000391 3300027111 Bacteria 68959
1478 Ga0209281_1000454 3300027111 Bacteria 58234
1479 Ga0209281_1002058 3300027111 Bacteria 9059
1480 Ga0209973_1004069 3300027252 Bacteria 1481
1481 Ga0209389_1000037 3300027296 Bacteria 125897
1482 Ga0209371_1000172 3300027312 Bacteria 96352
1483 Ga0209371_1003240 3300027312 Bacteria 8117
1484 Ga0209371_1006324 3300027312 Bacteria 4415
1485 Ga0209969_1001247 3300027360 Bacteria 3502
1486 Ga0209995_1002155 3300027471 Bacteria 3089
1487 Ga0209968_1000410 3300027526 Bacteria 7019
1488 Ga0209999_1001968 3300027543 Bacteria 3581
1489 Ga0209970_1000226 3300027614 Bacteria 9094
1490 Ga0209983_1007661 3300027665 Bacteria 2212
1491 Ga0209282_1000001 3300027666 Bacteria 2450367
1492 Ga0209971_1002317 3300027682 Bacteria 4608
1493 Ga0209971_1004307 3300027682 Bacteria 3379
1494 Ga0209971_1013619 3300027682 Bacteria 1926
1495 Ga0209966_1000013 3300027695 Bacteria 83121
1496 Ga0209813_10015332 3300027866 Bacteria 2075
1497 Ga0209974_10001761 3300027876 Bacteria 7887
1498 Ga0209974_10008251 3300027876 Bacteria 3565
1499 Ga0209974_10017172 3300027876 Bacteria 2400
1500 Ga0209974_10022047 3300027876 Bacteria 2108
1501 Ga0207428_10003029 3300027907 Bacteria 16546
1502 Ga0207428_10015306 3300027907 Bacteria 6639
1503 Ga0207428_10017334 3300027907 Bacteria 6182
1504 Ga0207428_10127106 3300027907 Bacteria 1952
1505 Ga0268266_10017134 3300028379 Bacteria 6187
1506 Ga0268266_10017399 3300028379 Bacteria 6133
1507 Ga0268266_10018069 3300028379 Bacteria 6010
1508 Ga0268266_10070292 3300028379 Bacteria 3033
1509 Ga0268266_10160234 3300028379 Bacteria 2035
1510 Ga0268265_10003310 3300028380 Bacteria 11667
1511 Ga0268265_10014749 3300028380 Bacteria 5332
1512 Ga0268265_10030331 3300028380 Bacteria 3893
1513 Ga0268265_10036644 3300028380 Bacteria 3594
1514 Ga0268265_10041969 3300028380 Bacteria 3390
1515 Ga0268264_10001585 3300028381 Bacteria 21062
1516 Ga0268264_10002307 3300028381 Bacteria 16875
1517 Ga0268264_10004874 3300028381 Bacteria 11372
1518 Ga0268264_10005529 3300028381 Bacteria 10716
1519 Ga0268264_10012192 3300028381 Bacteria 7074
1520 Ga0268264_10022198 3300028381 Bacteria 5181
1521 Ga0268264_10029677 3300028381 Bacteria 4482
1522 Ga0268264_10095128 3300028381 Bacteria 2577
1523 Ga0268264_10111632 3300028381 Bacteria 2395
1524 Ga0268264_10152367 3300028381 Bacteria 2074
1525 Ga0268264_10265504 3300028381 Bacteria 1601
1526 Ga0265318_10006724 3300028577 Bacteria 5263
1527 Ga0265323_10010139 3300028653 Bacteria 3825
1528 Ga0307517_10066072 3300028786 Bacteria 3335
1529 Ga0307515_10000265 3300028794 Bacteria 129554
1530 Ga0307515_10001533 3300028794 Bacteria 51699
1531 Ga0307515_10002116 3300028794 Bacteria 43530
1532 Ga0307515_10002409 3300028794 Bacteria 40792
1533 Ga0307515_10006008 3300028794 Bacteria 24426
1534 Ga0307515_10007308 3300028794 Bacteria 21863
1535 Ga0307515_10041356 3300028794 Bacteria 7249
1536 Ga0307515_10081014 3300028794 Bacteria 4223
1537 Ga0307515_10208759 3300028794 Bacteria 1804
1538 Ga0265338_10000120 3300028800 Bacteria 145451
1539 Ga0265338_10003187 3300028800 Bacteria 23409
1540 Ga0237817_11503 3300030083 Bacteria 1160
1541 Ga0268256_1000144 3300030500 Bacteria 96352
1542 Ga0268256_1002112 3300030500 Bacteria 10628
1543 Ga0268256_1006351 3300030500 Bacteria 4415
1544 Ga0316177_1019555 3300030731 Bacteria 2663
1545 Ga0316177_1039113 3300030731 Bacteria 3665
1546 Ga0316176_1074634 3300030732 Bacteria 3044
1547 Ga0316180_1019713 3300030736 Bacteria 3632
1548 Ga0316180_1079513 3300030736 Bacteria 4259
1549 Ga0316183_1009536 3300030742 Bacteria 1910
1550 Ga0316181_1030642 3300030744 Bacteria 4347
1551 Ga0316182_1113191 3300030745 Bacteria 3481
1552 Ga0265330_10000022 3300031235 Bacteria 154198
1553 Ga0265330_10001258 3300031235 Bacteria 14845
1554 Ga0265332_10000001 3300031238 Bacteria 863783
1555 Ga0265332_10000009 3300031238 Bacteria 295760
1556 Ga0265332_10000013 3300031238 Bacteria 250095
1557 Ga0265328_10000002 3300031239 Bacteria 275819
1558 Ga0265328_10002006 3300031239 Bacteria 9220
1559 Ga0265320_10026638 3300031240 Bacteria 3023
1560 Ga0265325_10001755 3300031241 Bacteria 15021
1561 Ga0265325_10003565 3300031241 Bacteria 10095
1562 Ga0265325_10023913 3300031241 Bacteria 3329
1563 Ga0265331_10000810 3300031250 Bacteria 25854
1564 Ga0265331_10001587 3300031250 Bacteria 16617
1565 Ga0265331_10003982 3300031250 Bacteria 9334
1566 Ga0265331_10004504 3300031250 Bacteria 8698
1567 Ga0265331_10028581 3300031250 Bacteria 2788
1568 Ga0265327_10000265 3300031251 Bacteria 103720
1569 Ga0265327_10000311 3300031251 Bacteria 93995
1570 Ga0265327_10001663 3300031251 Bacteria 26735
1571 Ga0265327_10003678 3300031251 Bacteria 14361
1572 Ga0265327_10005658 3300031251 Bacteria 10345
1573 Ga0265327_10021283 3300031251 Bacteria 3918
1574 Ga0265316_10000168 3300031344 Bacteria 73962
1575 Ga0265316_10003746 3300031344 Bacteria 15279
1576 Ga0265316_10082035 3300031344 Bacteria 2471
1577 Ga0265316_10180019 3300031344 Bacteria 1574
1578 Ga0307513_10000011 3300031456 Bacteria 354929
1579 Ga0307513_10000557 3300031456 Bacteria 53384
1580 Ga0307513_10009083 3300031456 Bacteria 12601
1581 Ga0307513_10023326 3300031456 Bacteria 7232
1582 Ga0307513_10037880 3300031456 Bacteria 5361
1583 Ga0307513_10278117 3300031456 Bacteria 1453
1584 Ga0307509_10000006 3300031507 Bacteria 421538
1585 Ga0307509_10004944 3300031507 Bacteria 18868
1586 Ga0307408_100000030 3300031548 Bacteria 223389
1587 Ga0307408_100000874 3300031548 Bacteria 23686
1588 Ga0307408_100006963 3300031548 Bacteria 7483
1589 Ga0307408_100007900 3300031548 Bacteria 7034
1590 Ga0307408_100019680 3300031548 Bacteria 4547
1591 Ga0307408_100029205 3300031548 Bacteria 3817
1592 Ga0307408_100047789 3300031548 Bacteria 3066
1593 Ga0307408_100125979 3300031548 Bacteria 1992
1594 Ga0307508_10000140 3300031616 Bacteria 85941
1595 Ga0307508_10002594 3300031616 Bacteria 19009
1596 Ga0307514_10000906 3300031649 Bacteria 45659
1597 Ga0307514_10014842 3300031649 Bacteria 6436
1598 Ga0307514_10052588 3300031649 Bacteria 3148
1599 Ga0316579_10033723 3300031691 Bacteria 2353
1600 Ga0265314_10000013 3300031711 Bacteria 403405
1601 Ga0265314_10003409 3300031711 Bacteria 15393
1602 Ga0265314_10005133 3300031711 Bacteria 11913
1603 Ga0265314_10007174 3300031711 Bacteria 9702
1604 Ga0265342_10031385 3300031712 Bacteria 3285
1605 Ga0316576_10034981 3300031727 Bacteria 3583
1606 Ga0316576_10080536 3300031727 Bacteria 2415
1607 Ga0316578_10066424 3300031728 Bacteria 2130
1608 Ga0307516_10000033 3300031730 Bacteria 155697
1609 Ga0307516_10000698 3300031730 Bacteria 45639
1610 Ga0307516_10001303 3300031730 Bacteria 34698
1611 Ga0307516_10013118 3300031730 Bacteria 8860
1612 Ga0307405_10024390 3300031731 Bacteria 3454
1613 Ga0307405_10051815 3300031731 Bacteria 2548
1614 Ga0307413_10001172 3300031824 Bacteria 9644
1615 Ga0307413_10035257 3300031824 Bacteria 2868
1616 Ga0307413_10088161 3300031824 Bacteria 2012
1617 Ga0307518_10093464 3300031838 Bacteria 2161
1618 Ga0307410_10004386 3300031852 Bacteria 7286
1619 Ga0307410_10016464 3300031852 Bacteria 4410
1620 Ga0307410_10051418 3300031852 Bacteria 2777
1621 Ga0307410_10217706 3300031852 Bacteria 1467
1622 Ga0307406_10004610 3300031901 Bacteria 7504
1623 Ga0307406_10010021 3300031901 Bacteria 5332
1624 Ga0307406_10034775 3300031901 Bacteria 3094
1625 Ga0307407_10008901 3300031903 Bacteria 4640
1626 Ga0307412_10000064 3300031911 Bacteria 125607
1627 Ga0307412_10002780 3300031911 Bacteria 9729
1628 Ga0307412_10017543 3300031911 Bacteria 4286
1629 Ga0307412_10021200 3300031911 Bacteria 3965
1630 Ga0307412_10028329 3300031911 Bacteria 3502
1631 Ga0307412_10051436 3300031911 Bacteria 2722
1632 Ga0307412_10121458 3300031911 Bacteria 1881
1633 Ga0307412_10201045 3300031911 Bacteria 1513
1634 Ga0307409_100021074 3300031995 Bacteria 4460
1635 Ga0307409_100024696 3300031995 Bacteria 4197
1636 Ga0307409_100033030 3300031995 Bacteria 3760
1637 Ga0307409_100082791 3300031995 Bacteria 2599
1638 Ga0307416_100016000 3300032002 Bacteria 5199
1639 Ga0307416_100036523 3300032002 Bacteria 3769
1640 Ga0307416_100054240 3300032002 Bacteria 3222
1641 Ga0307416_100064650 3300032002 Bacteria 3002
1642 Ga0307416_100110632 3300032002 Bacteria 2419
1643 Ga0307416_100205779 3300032002 Bacteria 1872
1644 Ga0307416_100407944 3300032002 Bacteria 1398
1645 Ga0307414_10004874 3300032004 Bacteria 7332
1646 Ga0307414_10118569 3300032004 Bacteria 2030
1647 Ga0307414_10162823 3300032004 Bacteria 1774
1648 Ga0307411_10000234 3300032005 Bacteria 18110
1649 Ga0307411_10009412 3300032005 Bacteria 5134
1650 Ga0307411_10011067 3300032005 Bacteria 4847
1651 Ga0307411_10073360 3300032005 Bacteria 2328
1652 Ga0307415_100005148 3300032126 Bacteria 6898
1653 Ga0307415_100008810 3300032126 Bacteria 5615
1654 Ga0307415_100048172 3300032126 Bacteria 2874
1655 Ga0307415_100243882 3300032126 Bacteria 1455
1656 Ga0316583_10000162 3300032133 Bacteria 16464
1657 Ga0316585_10017931 3300032137 Bacteria 2144
1658 Ga0373948_0003324 3300034817 Bacteria 2465
1659 Ga0373934_0012312 3300035086 Bacteria 3229
1660 Ga0373951_0016480 3300035091 Bacteria 1667
1661 Ga0373939_0000062 3300035114 Bacteria 36165
1662 Ga0373945_0030690 3300035116 Bacteria 1895
1663 Ga0373953_0065934 3300035117 Bacteria 1487
1664 Ga0373956_0013846 3300035119 Bacteria 3360
1665 Ga0373956_0093886 3300035119 Bacteria 1386
1666 Ga0373957_0012296 3300035120 Bacteria 2878
1667 Ga0373960_0002471 3300035121 Bacteria 4154
1668 Ga0373955_0008896 3300035172 Bacteria 4682
1669 Ga0316574_0011523 3300035398 Bacteria 5027
1670 Ga0373924_0005899 3300035410 Bacteria 4367
1671 Ga0373924_0021947 3300035410 Bacteria 2492
1672 Ga0373931_0018762 3300035691 Bacteria 3443
1673 Ga0373931_0040429 3300035691 Bacteria 2447
1674 Ga0373931_0044034 3300035691 Bacteria 2353
1675 Ga0373931_0057733 3300035691 Bacteria 2082
1676 Ga0373935_0007754 3300035692 Bacteria 6434
1677 Ga0373927_0001550 3300035695 Bacteria 17254
1678 Ga0373927_0068385 3300035695 Bacteria 2298
1679 Ga0373947_0057839 3300035725 Bacteria 2348
1680 Ga0373947_0117200 3300035725 Bacteria 1689
1681 Ga0373937_0017870 3300036401 Bacteria 6327
1682 Ga0373937_0018133 3300036401 Bacteria 6279
1683 Ga0373937_0059355 3300036401 Bacteria 3516
1684 Ga0373937_0118340 3300036401 Bacteria 2468
1685 Ga0373937_0210726 3300036401 Bacteria 1828
1686 Ga0373937_0217664 3300036401 Bacteria 1797
1687 Ga0316584_0020143 3300036712 Bacteria 4831
1688 Ga0373925_0011334 3300037068 Bacteria 6471
1689 Ga0373925_0044804 3300037068 Bacteria 3285
1690 Ga0373925_0047135 3300037068 Bacteria 3207
1691 Ga0373925_0089772 3300037068 Bacteria 2348
1692 Ga0373925_0096098 3300037068 Bacteria 2270
1693 Ga0395899_0000028 3300037312 Bacteria 334378
1694 Ga0395899_0000097 3300037312 Bacteria 152056
1695 Ga0395899_0001141 3300037312 Bacteria 23519
1696 Ga0395899_0001726 3300037312 Bacteria 18165
1697 Ga0395899_0006490 3300037312 Bacteria 9063
1698 Ga0395900_0000015 3300037418 Bacteria 384313
1699 Ga0395900_0000054 3300037418 Bacteria 220487
1700 Ga0395900_0000395 3300037418 Bacteria 63065
1701 Ga0395900_0004661 3300037418 Bacteria 14468
1702 Ga0395900_0010181 3300037418 Bacteria 9618
1703 Ga0395900_0013213 3300037418 Bacteria 8441
1704 Ga0395900_0016288 3300037418 Bacteria 7577
1705 Ga0395900_0032779 3300037418 Bacteria 5344
1706 Ga0395900_0070493 3300037418 Bacteria 3594
1707 Ga0395900_0091804 3300037418 Bacteria 3120
1708 Ga0395900_0139757 3300037418 Bacteria 2480
1709 Ga0395898_0000407 3300037466 Bacteria 93281
1710 Ga0395898_0004344 3300037466 Bacteria 15524
1711 Ga0395898_0007404 3300037466 Bacteria 11651
1712 Ga0395898_0009612 3300037466 Bacteria 10152
1713 Ga0395898_0014059 3300037466 Bacteria 8225
1714 Ga0395898_0049947 3300037466 Bacteria 4096
1715 Ga0395898_0059986 3300037466 Bacteria 3699
1716 Ga0395898_0182158 3300037466 Bacteria 2007
1717 Ga0395898_0266401 3300037466 Bacteria 1634
1718 Ga0395905_0000052 3300037471 Bacteria 215018
1719 Ga0395905_0000407 3300037471 Bacteria 60417
1720 Ga0395905_0001278 3300037471 Bacteria 31041
1721 Ga0395905_0001910 3300037471 Bacteria 23959
1722 Ga0395905_0005404 3300037471 Bacteria 13056
1723 Ga0395905_0007546 3300037471 Bacteria 10811
1724 Ga0395905_0017695 3300037471 Bacteria 6767
1725 Ga0395905_0019820 3300037471 Bacteria 6374
1726 Ga0395905_0045815 3300037471 Bacteria 4102
1727 Ga0395905_0060830 3300037471 Bacteria 3532
1728 Ga0395905_0066583 3300037471 Bacteria 3373
1729 Ga0395905_0082918 3300037471 Bacteria 3004
1730 Ga0395905_0086481 3300037471 Bacteria 2938
1731 Ga0395905_0122835 3300037471 Bacteria 2441
1732 Ga0395905_0196533 3300037471 Bacteria 1891
1733 Ga0395901_0000034 3300038443 Bacteria 230365
1734 Ga0395901_0000286 3300038443 Bacteria 62586
1735 Ga0395901_0000749 3300038443 Bacteria 36580
1736 Ga0395901_0017987 3300038443 Bacteria 7213
1737 Ga0395901_0030281 3300038443 Bacteria 5575
1738 Ga0395901_0057877 3300038443 Bacteria 4031
1739 Ga0395901_0089915 3300038443 Bacteria 3213
1740 Ga0395901_0192851 3300038443 Bacteria 2136
1741 Ga0237819_00787 3300038705 Bacteria 10146
1742 Ga0400490_10538 3300038726 Bacteria 11782
1743 Ga0400486_09343 3300038742 Bacteria 15627
1744 Ga0400483_083197 3300039062 Bacteria 151799
1745 Ga0436365_1492911 3300039437 Bacteria 1891
1746 Ga0436365_1835414 3300039437 Bacteria 2896
1747 Ga0436361_0071281 3300039447 Bacteria 2169
1748 Ga0436361_0072935 3300039447 Bacteria 1203
1749 Ga0436361_0172012 3300039447 Bacteria 25267
1750 Ga0436361_0503231 3300039447 Bacteria 21369
1751 Ga0436361_0534908 3300039447 Bacteria 1866
1752 Ga0436361_0796155 3300039447 Bacteria 8850
1753 Ga0436361_0882487 3300039447 Bacteria 26486
1754 Ga0436361_1043638 3300039447 Bacteria 25534
1755 Ga0436361_1091674 3300039447 Bacteria 10560
1756 Ga0436361_1210742 3300039447 Bacteria 34787
1757 Ga0436363_0570022 3300039450 Bacteria 2045
1758 Ga0439436_0004259 3300041404 Bacteria 4385
1759 Ga0439466_0024004 3300041411 Bacteria 2141
1760 Ga0439465_0003593 3300041413 Bacteria 5061
1761 Ga0439433_0005244 3300041999 Bacteria 2784
1762 Ga0439448_0002009 3300042005 Bacteria 5434
1763 Ga0439432_005105 3300042006 Bacteria 4747
1764 Ga0439449_0000273 3300042007 Bacteria 18655
1765 Ga0439449_0010454 3300042007 Bacteria 3505
1766 Ga0439452_001971 3300042010 Bacteria 7849
1767 Ga0450890_000361 3300042127 Bacteria 6652
1768 Ga0450891_002062 3300042129 Bacteria 2048
1769 Ga0450892_000087 3300042130 Bacteria 10249
1770 Ga0450898_007031 3300042134 Bacteria 1745
1771 Ga0439446_0005918 3300042156 Bacteria 3166
1772 Ga0450908_000485 3300042184 Bacteria 7638
1773 Ga0439434_0002822 3300042435 Bacteria 5072
1774 Ga0439434_0014046 3300042435 Bacteria 2382
1775 Ga0439435_0010437 3300042436 Bacteria 2206
1776 Ga0450918_000265 3300042531 Bacteria 11803
1777 Ga0450918_002692 3300042531 Bacteria 3337
1778 Ga0451577_0000635 3300042876 Bacteria 56126
1779 Ga0451577_0000641 3300042876 Bacteria 55722
1780 Ga0451577_0001534 3300042876 Bacteria 30298
1781 Ga0451577_0005521 3300042876 Bacteria 12911
1782 Ga0451577_0010011 3300042876 Bacteria 9084
1783 Ga0451577_0044724 3300042876 Bacteria 3964
1784 Ga0451577_0060411 3300042876 Bacteria 3379
1785 Ga0451577_0095252 3300042876 Bacteria 2658
1786 Ga0451577_0136449 3300042876 Bacteria 2203
1787 Ga0466969_0000058 3300044656 Bacteria 58556
1788 Ga0466969_0000075 3300044656 Bacteria 52007
1789 Ga0466969_0005424 3300044656 Bacteria 6780
1790 Ga0466969_0012113 3300044656 Bacteria 4558
1791 Ga0466969_0019267 3300044656 Bacteria 3550
1792 Ga0466969_0037128 3300044656 Bacteria 2459
1793 Ga0466969_0052143 3300044656 Bacteria 2010
1794 Ga0466972_0000221 3300044658 Bacteria 40061
1795 Ga0466972_0002680 3300044658 Bacteria 8814
1796 Ga0466973_0055731 3300044659 Bacteria 3617
1797 Ga0466977_0030250 3300044666 Bacteria 3454
1798 Ga0453683_0004136 3300044673 Bacteria 10417
1799 Ga0466965_0003407 3300044683 Bacteria 6965
1800 Ga0466965_0008016 3300044683 Bacteria 4874
1801 Ga0466965_0032081 3300044683 Bacteria 2565
1802 Ga0466966_0002897 3300044684 Bacteria 11307
1803 Ga0466966_0008239 3300044684 Bacteria 6911
1804 Ga0466966_0008930 3300044684 Bacteria 6641
1805 Ga0466966_0018078 3300044684 Bacteria 4653
1806 Ga0466966_0022581 3300044684 Bacteria 4127
1807 Ga0466961_0005091 3300044693 Bacteria 8270
1808 Ga0466961_0014542 3300044693 Bacteria 5056
1809 Ga0466961_0029845 3300044693 Bacteria 3503
1810 Ga0466961_0053620 3300044693 Bacteria 2572
1811 Ga0466961_0054733 3300044693 Bacteria 2544
1812 Ga0466961_0085185 3300044693 Bacteria 1999
1813 Ga0466961_0114382 3300044693 Bacteria 1696
1814 Ga0466963_0002853 3300044694 Bacteria 9753
1815 Ga0466963_0005442 3300044694 Bacteria 7458
1816 Ga0466963_0005576 3300044694 Bacteria 7378
1817 Ga0466964_0012450 3300044706 Bacteria 3218
1818 Ga0453684_0000005 3300044712 Bacteria 1431632
1819 Ga0453684_0000102 3300044712 Bacteria 366870
1820 Ga0453684_0001818 3300044712 Bacteria 56168
1821 Ga0453684_0002009 3300044712 Bacteria 52070
1822 Ga0453684_0004267 3300044712 Bacteria 30523
1823 Ga0453684_0006939 3300044712 Bacteria 21203
1824 Ga0453684_0008446 3300044712 Bacteria 18443
1825 Ga0453684_0032887 3300044712 Bacteria 7243
1826 Ga0453684_0042955 3300044712 Bacteria 6084
1827 Ga0453684_0204987 3300044712 Bacteria 2296
1828 Ga0466971_0000153 3300044719 Bacteria 25681
1829 Ga0466971_0023044 3300044719 Bacteria 2774
1830 Ga0466971_0025213 3300044719 Bacteria 2655
1831 Ga0466968_0003419 3300044735 Bacteria 5870
1832 Ga0466968_0012277 3300044735 Bacteria 3349
1833 Ga0466968_0077668 3300044735 Bacteria 1454
1834 Ga0466970_0016246 3300044765 Bacteria 3835
1835 Ga0466970_0023831 3300044765 Bacteria 3200
1836 Ga0466957_0010086 3300044842 Bacteria 5406
1837 Ga0466957_0022537 3300044842 Bacteria 3717
1838 Ga0466957_0067690 3300044842 Bacteria 2203
1839 Ga0466957_0203345 3300044842 Bacteria 1302
1840 Ga0466960_0069588 3300044901 Bacteria 1749
1841 Ga0466959_0000635 3300045049 Bacteria 20406
1842 Ga0466959_0017523 3300045049 Bacteria 5251
1843 Ga0466959_0023955 3300045049 Bacteria 4519
1844 Ga0466959_0051603 3300045049 Bacteria 3015
1845 Ga0466959_0055317 3300045049 Bacteria 2897
1846 Ga0466959_0074059 3300045049 Bacteria 2462
1847 Ga0466959_0091554 3300045049 Bacteria 2183
1848 Ga0451576_0000418 3300045051 Bacteria 98732
1849 Ga0451576_0011954 3300045051 Bacteria 9811
1850 Ga0451576_0029765 3300045051 Bacteria 5841
1851 Ga0451576_0069452 3300045051 Bacteria 3666
1852 Ga0451576_0163759 3300045051 Bacteria 2321
1853 Ga0451576_0165428 3300045051 Bacteria 2308
1854 Ga0451576_0181840 3300045051 Bacteria 2195
1855 Ga0451576_0218773 3300045051 Bacteria 1989
1856 Ga0451576_0393624 3300045051 Bacteria 1452
1857 Ga0466958_0007558 3300045836 Bacteria 5983
1858 Ga0466958_0016770 3300045836 Bacteria 4223
1859 Ga0466958_0018580 3300045836 Bacteria 4036
1860 Ga0466958_0066602 3300045836 Bacteria 2199
1861 Ga0466967_0347094 3300045976 Bacteria 1436
1862 Ga0495617_000008 3300046452 Bacteria 340369
1863 Ga0495617_000232 3300046452 Bacteria 33751
1864 Ga0495627_000005 3300046453 Bacteria 630805
1865 Ga0495627_000083 3300046453 Bacteria 113227
1866 Ga0495627_003344 3300046453 Bacteria 7130
1867 Ga0495592_0005360 3300046454 Bacteria 9466
1868 Ga0495592_0013646 3300046454 Bacteria 6178
1869 Ga0495592_0184436 3300046454 Bacteria 1419
1870 Ga0495603_0003068 3300046455 Bacteria 9916
1871 Ga0495603_0023358 3300046455 Bacteria 3742
1872 Ga0495603_0115023 3300046455 Bacteria 1568
1873 Ga0495590_0000003 3300046457 Bacteria 478593
1874 Ga0495590_0000766 3300046457 Bacteria 14614
1875 Ga0495590_0004970 3300046457 Bacteria 5308
1876 Ga0495590_0018341 3300046457 Bacteria 2506
1877 Ga0495590_0052213 3300046457 Bacteria 1428
1878 Ga0495590_0056971 3300046457 Bacteria 1366
1879 Ga0495591_000037 3300046458 Bacteria 158323
1880 Ga0495591_000807 3300046458 Bacteria 22188
1881 Ga0495591_002170 3300046458 Bacteria 11235
1882 Ga0495591_008775 3300046458 Bacteria 4100
1883 Ga0495629_0000127 3300046459 Bacteria 66745
1884 Ga0495629_0000603 3300046459 Bacteria 29262
1885 Ga0495629_0016511 3300046459 Bacteria 5300
1886 Ga0495629_0021985 3300046459 Bacteria 4550
1887 Ga0495629_0044549 3300046459 Bacteria 3113
1888 Ga0495629_0053693 3300046459 Bacteria 2818
1889 Ga0495638_0000219 3300046460 Bacteria 79660
1890 Ga0495638_0005430 3300046460 Bacteria 9483
1891 Ga0495638_0018651 3300046460 Bacteria 4603
1892 Ga0495638_0036792 3300046460 Bacteria 3116
1893 Ga0495638_0040786 3300046460 Bacteria 2940
1894 Ga0495638_0043569 3300046460 Bacteria 2830
1895 Ga0495638_0135448 3300046460 Bacteria 1443
1896 Ga0495641_0052156 3300046461 Bacteria 1865
1897 Ga0495653_0000013 3300046463 Bacteria 250453
1898 Ga0495653_0002324 3300046463 Bacteria 15084
1899 Ga0495653_0015485 3300046463 Bacteria 6215
1900 Ga0495653_0020036 3300046463 Bacteria 5420
1901 Ga0495653_0020729 3300046463 Bacteria 5324
1902 Ga0495653_0031809 3300046463 Bacteria 4192
1903 Ga0495653_0086012 3300046463 Bacteria 2311
1904 Ga0495650_0000131 3300046471 Bacteria 174698
1905 Ga0495650_0001004 3300046471 Bacteria 31821
1906 Ga0495650_0004275 3300046471 Bacteria 9863
1907 Ga0495650_0004651 3300046471 Bacteria 9277
1908 Ga0495650_0004783 3300046471 Bacteria 9092
1909 Ga0495650_0011499 3300046471 Bacteria 4842
1910 Ga0495580_0001549 3300046472 Bacteria 20228
1911 Ga0495580_0006350 3300046472 Bacteria 9643
1912 Ga0495580_0010497 3300046472 Bacteria 7212
1913 Ga0495580_0016212 3300046472 Bacteria 5599
1914 Ga0495580_0067107 3300046472 Bacteria 2510
1915 Ga0495580_0080841 3300046472 Bacteria 2265
1916 Ga0495582_0000248 3300046473 Bacteria 30008
1917 Ga0495582_0044760 3300046473 Bacteria 2437
1918 Ga0495582_0075613 3300046473 Bacteria 1865
1919 Ga0495605_0000036 3300046474 Bacteria 203902
1920 Ga0495605_0000096 3300046474 Bacteria 111460
1921 Ga0495605_0000944 3300046474 Bacteria 19826
1922 Ga0495605_0003657 3300046474 Bacteria 9127
1923 Ga0495605_0005881 3300046474 Bacteria 7088
1924 Ga0495605_0007447 3300046474 Bacteria 6212
1925 Ga0495605_0015538 3300046474 Bacteria 4136
1926 Ga0495605_0027713 3300046474 Bacteria 2932
1927 Ga0495605_0044375 3300046474 Bacteria 2198
1928 Ga0495605_0053891 3300046474 Bacteria 1949
1929 Ga0495662_0037844 3300046476 Bacteria 2331
1930 Ga0495664_0064212 3300046477 Bacteria 2188
1931 Ga0495584_0000484 3300046491 Bacteria 27371
1932 Ga0495584_0004012 3300046491 Bacteria 7941
1933 Ga0495584_0004299 3300046491 Bacteria 7679
1934 Ga0495584_0005522 3300046491 Bacteria 6696
1935 Ga0495584_0018125 3300046491 Bacteria 3579
1936 Ga0495584_0090447 3300046491 Bacteria 1543
1937 Ga0495585_0000175 3300046492 Bacteria 69100
1938 Ga0495585_0004132 3300046492 Bacteria 9496
1939 Ga0495585_0004576 3300046492 Bacteria 8943
1940 Ga0495585_0019130 3300046492 Bacteria 3952
1941 Ga0495585_0026864 3300046492 Bacteria 3286
1942 Ga0495585_0029592 3300046492 Bacteria 3116
1943 Ga0495585_0032120 3300046492 Bacteria 2975
1944 Ga0495585_0104903 3300046492 Bacteria 1508
1945 Ga0495585_0117750 3300046492 Bacteria 1407
1946 Ga0495585_0156447 3300046492 Bacteria 1185
1947 Ga0495594_0022659 3300046499 Bacteria 3359
1948 Ga0495594_0027831 3300046499 Bacteria 3047
1949 Ga0495594_0044100 3300046499 Bacteria 2445
1950 Ga0495594_0173019 3300046499 Bacteria 1228
1951 Ga0495596_0001166 3300046500 Bacteria 15402
1952 Ga0495596_0003971 3300046500 Bacteria 7310
1953 Ga0495596_0004411 3300046500 Bacteria 6864
1954 Ga0495596_0005835 3300046500 Bacteria 5762
1955 Ga0495596_0009835 3300046500 Bacteria 4192
1956 Ga0495596_0012755 3300046500 Bacteria 3584
1957 Ga0495596_0014611 3300046500 Bacteria 3306
1958 Ga0495596_0014719 3300046500 Bacteria 3292
1959 Ga0495596_0021942 3300046500 Bacteria 2601
1960 Ga0495596_0039700 3300046500 Bacteria 1859
1961 Ga0495607_0000177 3300046501 Bacteria 67452
1962 Ga0495607_0001076 3300046501 Bacteria 24950
1963 Ga0495607_0001388 3300046501 Bacteria 21548
1964 Ga0495607_0001576 3300046501 Bacteria 19907
1965 Ga0495607_0004260 3300046501 Bacteria 10594
1966 Ga0495607_0017421 3300046501 Bacteria 4611
1967 Ga0495607_0039808 3300046501 Bacteria 2804
1968 Ga0495583_0000028 3300046506 Bacteria 255787
1969 Ga0495583_0000068 3300046506 Bacteria 188922
1970 Ga0495583_0000141 3300046506 Bacteria 121899
1971 Ga0495583_0000208 3300046506 Bacteria 98726
1972 Ga0495583_0000436 3300046506 Bacteria 62784
1973 Ga0495583_0000820 3300046506 Bacteria 38035
1974 Ga0495583_0001464 3300046506 Bacteria 23751
1975 Ga0495583_0002629 3300046506 Bacteria 15017
1976 Ga0495583_0004447 3300046506 Bacteria 10026
1977 Ga0495583_0006743 3300046506 Bacteria 7428
1978 Ga0495583_0006790 3300046506 Bacteria 7395
1979 Ga0495583_0026237 3300046506 Bacteria 2893
1980 Ga0495583_0084864 3300046506 Bacteria 1371
1981 Ga0495606_0000068 3300046507 Bacteria 179653
1982 Ga0495606_0004199 3300046507 Bacteria 14579
1983 Ga0495606_0004548 3300046507 Bacteria 13788
1984 Ga0495606_0007686 3300046507 Bacteria 9557
1985 Ga0495606_0037277 3300046507 Bacteria 3303
1986 Ga0495608_0014707 3300046511 Bacteria 5430
1987 Ga0495608_0018972 3300046511 Bacteria 4740
1988 Ga0495608_0054010 3300046511 Bacteria 2656
1989 Ga0495610_0000003 3300046512 Bacteria 1203910
1990 Ga0495610_0002238 3300046512 Bacteria 16377
1991 Ga0495610_0002461 3300046512 Bacteria 15565
1992 Ga0495610_0017891 3300046512 Bacteria 4024
1993 Ga0495610_0031503 3300046512 Bacteria 2766
1994 Ga0495610_0089086 3300046512 Bacteria 1401
1995 Ga0495610_0094750 3300046512 Bacteria 1347
1996 Ga0495616_0006867 3300046513 Bacteria 6854
1997 Ga0495616_0022333 3300046513 Bacteria 3416
1998 Ga0495616_0023628 3300046513 Bacteria 3305
1999 Ga0495616_0129192 3300046513 Bacteria 1159
2000 Ga0495618_0045207 3300046514 Bacteria 2777
2001 Ga0495618_0085024 3300046514 Bacteria 2021
2002 Ga0495620_0000054 3300046515 Bacteria 100835
2003 Ga0495620_0000322 3300046515 Bacteria 33867
2004 Ga0495620_0080373 3300046515 Bacteria 1319
2005 Ga0495628_0005872 3300046516 Bacteria 10749
2006 Ga0495628_0009586 3300046516 Bacteria 8266
2007 Ga0495628_0015992 3300046516 Bacteria 6260
2008 Ga0495628_0017050 3300046516 Bacteria 6052
2009 Ga0495628_0036520 3300046516 Bacteria 3942
2010 Ga0495630_0006079 3300046517 Bacteria 8555
2011 Ga0495630_0170806 3300046517 Bacteria 1656
2012 Ga0495631_0002491 3300046518 Bacteria 10367
2013 Ga0495631_0004047 3300046518 Bacteria 7887
2014 Ga0495632_0000141 3300046519 Bacteria 73806
2015 Ga0495632_0053877 3300046519 Bacteria 1973
2016 Ga0495637_0007876 3300046520 Bacteria 5254
2017 Ga0495637_0033621 3300046520 Bacteria 2250
2018 Ga0495644_0015911 3300046523 Bacteria 2882
2019 Ga0495644_0020241 3300046523 Bacteria 2538
2020 Ga0495644_0026717 3300046523 Bacteria 2189
2021 Ga0495648_0000030 3300046524 Bacteria 216178
2022 Ga0495648_0000087 3300046524 Bacteria 116394
2023 Ga0495648_0001097 3300046524 Bacteria 27556
2024 Ga0495648_0003464 3300046524 Bacteria 13874
2025 Ga0495648_0006330 3300046524 Bacteria 9683
2026 Ga0495648_0013913 3300046524 Bacteria 5923
2027 Ga0495648_0026180 3300046524 Bacteria 3930
2028 Ga0495648_0032736 3300046524 Bacteria 3406
2029 Ga0495648_0051103 3300046524 Bacteria 2520
2030 Ga0495648_0078292 3300046524 Bacteria 1891
2031 Ga0495663_0014780 3300046525 Bacteria 2192
2032 Ga0495666_0002096 3300046526 Bacteria 9881
2033 Ga0495666_0016967 3300046526 Bacteria 3624
2034 Ga0495642_0000176 3300046528 Bacteria 37713
2035 Ga0495642_0004578 3300046528 Bacteria 5359
2036 Ga0495642_0004751 3300046528 Bacteria 5254
2037 Ga0495642_0012325 3300046528 Bacteria 3295
2038 Ga0495642_0038419 3300046528 Bacteria 1939
2039 Ga0495642_0069838 3300046528 Bacteria 1467
2040 Ga0495652_0005978 3300046529 Bacteria 11378
2041 Ga0495652_0218293 3300046529 Bacteria 1434
2042 Ga0495654_0000035 3300046530 Bacteria 192768
2043 Ga0495654_0008769 3300046530 Bacteria 5565
2044 Ga0495654_0022301 3300046530 Bacteria 3289
2045 Ga0495654_0038131 3300046530 Bacteria 2405
2046 Ga0495665_0000847 3300046531 Bacteria 16030
2047 Ga0495665_0082265 3300046531 Bacteria 1692
2048 Ga0495640_0003691 3300046533 Bacteria 12301
2049 Ga0495586_0009070 3300046535 Bacteria 5290
2050 Ga0495586_0011955 3300046535 Bacteria 4611
2051 Ga0495587_0009846 3300046536 Bacteria 6104
2052 Ga0495587_0020556 3300046536 Bacteria 4073
2053 Ga0495587_0042164 3300046536 Bacteria 2722
2054 Ga0495609_0000021 3300046538 Bacteria 281770
2055 Ga0495609_0000115 3300046538 Bacteria 93419
2056 Ga0495609_0000220 3300046538 Bacteria 56810
2057 Ga0495609_0001801 3300046538 Bacteria 13762
2058 Ga0495609_0002332 3300046538 Bacteria 11718
2059 Ga0495609_0002618 3300046538 Bacteria 10930
2060 Ga0495609_0007283 3300046538 Bacteria 5542
2061 Ga0495609_0008875 3300046538 Bacteria 4891
2062 Ga0495609_0014349 3300046538 Bacteria 3727
2063 Ga0495621_0006269 3300046539 Bacteria 3462
2064 Ga0495597_0000910 3300046542 Bacteria 22947
2065 Ga0495597_0001138 3300046542 Bacteria 20036
2066 Ga0495597_0001833 3300046542 Bacteria 14529
2067 Ga0495597_0005074 3300046542 Bacteria 7030
2068 Ga0495597_0005114 3300046542 Bacteria 7000
2069 Ga0495597_0010569 3300046542 Bacteria 4503
2070 Ga0495597_0011046 3300046542 Bacteria 4389
2071 Ga0495597_0043015 3300046542 Bacteria 2012
2072 Ga0495597_0071289 3300046542 Bacteria 1496
2073 Ga0495645_0002334 3300046543 Bacteria 12879
2074 Ga0495645_0049036 3300046543 Bacteria 3076
2075 Ga0495645_0054880 3300046543 Bacteria 2894
2076 Ga0495645_0067879 3300046543 Bacteria 2575
2077 Ga0495645_0152549 3300046543 Bacteria 1603
2078 Ga0495645_0172696 3300046543 Bacteria 1487
2079 Ga0495622_0000004 3300046557 Bacteria 258984
2080 Ga0495622_0000853 3300046557 Bacteria 16756
2081 Ga0495622_0000995 3300046557 Bacteria 15178
2082 Ga0495622_0002385 3300046557 Bacteria 9139
2083 Ga0495622_0023349 3300046557 Bacteria 2882
2084 Ga0495633_0000728 3300046558 Bacteria 29814
2085 Ga0495633_0001693 3300046558 Bacteria 16578
2086 Ga0495633_0002788 3300046558 Bacteria 12083
2087 Ga0495633_0007275 3300046558 Bacteria 6398
2088 Ga0495633_0007686 3300046558 Bacteria 6169
2089 Ga0495633_0008726 3300046558 Bacteria 5680
2090 Ga0495633_0009897 3300046558 Bacteria 5235
2091 Ga0495633_0028969 3300046558 Bacteria 2694
2092 Ga0495633_0062709 3300046558 Bacteria 1740
2093 Ga0495633_0085178 3300046558 Bacteria 1470
2094 Ga0495667_0039600 3300046559 Bacteria 3134
2095 Ga0495667_0051663 3300046559 Bacteria 2711
2096 Ga0495667_0168148 3300046559 Bacteria 1409
2097 Ga0495656_0000005 3300046615 Bacteria 238208
2098 Ga0495656_0001561 3300046615 Bacteria 7490
2099 Ga0495656_0008781 3300046615 Bacteria 3620
2100 Ga0495668_0000063 3300046616 Bacteria 184563
2101 Ga0495668_0000220 3300046616 Bacteria 83065
2102 Ga0495668_0001369 3300046616 Bacteria 23904
2103 Ga0495668_0003479 3300046616 Bacteria 11754
2104 Ga0495668_0004957 3300046616 Bacteria 9227
2105 Ga0495668_0011721 3300046616 Bacteria 5233
2106 Ga0495668_0016763 3300046616 Bacteria 4258
2107 Ga0495668_0028416 3300046616 Bacteria 3162
2108 Ga0495668_0057970 3300046616 Bacteria 2137
2109 Ga0495634_0006377 3300046642 Bacteria 8969
2110 Ga0495634_0058596 3300046642 Bacteria 2566
2111 Ga0495634_0081827 3300046642 Bacteria 2111
2112 Ga0495611_0007320 3300046648 Bacteria 4689
2113 Ga0495611_0027975 3300046648 Bacteria 2468
2114 Ga0495611_0033610 3300046648 Bacteria 2263
2115 Ga0495611_0034254 3300046648 Bacteria 2244
2116 Ga0495611_0038400 3300046648 Bacteria 2130
2117 Ga0495625_0000870 3300046660 Bacteria 41078
2118 Ga0495625_0002332 3300046660 Bacteria 20743
2119 Ga0495625_0009603 3300046660 Bacteria 8075
2120 Ga0495625_0025583 3300046660 Bacteria 4474
2121 Ga0495625_0027730 3300046660 Bacteria 4256
2122 Ga0495625_0038379 3300046660 Bacteria 3507
2123 Ga0495625_0086371 3300046660 Bacteria 2176
2124 Ga0495625_0160690 3300046660 Bacteria 1505
2125 Ga0495635_0005439 3300046663 Bacteria 8860
2126 Ga0495635_0035982 3300046663 Bacteria 3433
2127 Ga0495659_0000280 3300046664 Bacteria 20818
2128 Ga0495661_0000051 3300046665 Bacteria 140353
2129 Ga0495661_0000685 3300046665 Bacteria 33805
2130 Ga0495661_0000995 3300046665 Bacteria 25555
2131 Ga0495661_0005074 3300046665 Bacteria 9393
2132 Ga0495661_0005694 3300046665 Bacteria 8820
2133 Ga0495661_0005989 3300046665 Bacteria 8584
2134 Ga0495661_0008587 3300046665 Bacteria 7060
2135 Ga0495661_0010115 3300046665 Bacteria 6449
2136 Ga0495661_0040284 3300046665 Bacteria 2898
2137 Ga0495661_0052587 3300046665 Bacteria 2453
2138 Ga0495661_0053543 3300046665 Bacteria 2426
2139 Ga0495661_0077110 3300046665 Bacteria 1932
2140 Ga0495661_0121841 3300046665 Bacteria 1439
2141 Ga0495661_0131682 3300046665 Bacteria 1369
2142 Ga0495661_0179902 3300046665 Bacteria 1121
2143 Ga0495588_0000083 3300046674 Bacteria 197018
2144 Ga0495588_0012021 3300046674 Bacteria 4079
2145 Ga0495588_0069900 3300046674 Bacteria 1825
2146 Ga0495588_0116724 3300046674 Bacteria 1406
2147 Ga0495588_0128358 3300046674 Bacteria 1337
2148 Ga0495657_0064094 3300046675 Bacteria 2422
2149 Ga0495599_0024587 3300046678 Bacteria 3766
2150 Ga0495599_0028513 3300046678 Bacteria 3500
2151 Ga0495623_0007148 3300046679 Bacteria 7249
2152 Ga0495623_0011654 3300046679 Bacteria 5695
2153 Ga0495646_0001053 3300046680 Bacteria 15981
2154 Ga0495646_0054395 3300046680 Bacteria 2407
2155 Ga0495646_0167753 3300046680 Bacteria 1211
2156 Ga0495658_0017895 3300046683 Bacteria 3673
2157 Ga0495658_0028841 3300046683 Bacteria 2999
2158 Ga0495658_0098795 3300046683 Bacteria 1739
2159 Ga0495669_0000288 3300046684 Bacteria 28658
2160 Ga0495669_0005970 3300046684 Bacteria 5077
2161 Ga0495669_0017165 3300046684 Bacteria 3103
2162 Ga0495669_0043323 3300046684 Bacteria 2003
2163 Ga0495669_0049859 3300046684 Bacteria 1876
2164 Ga0495613_0003616 3300046689 Bacteria 11586
2165 Ga0495613_0004307 3300046689 Bacteria 10655
2166 Ga0495613_0147410 3300046689 Bacteria 1679
2167 Ga0495624_0003534 3300046690 Bacteria 11585
2168 Ga0495624_0023850 3300046690 Bacteria 4030
2169 Ga0495670_0001279 3300046691 Bacteria 12294
2170 Ga0495670_0003243 3300046691 Bacteria 8011
2171 Ga0495670_0010907 3300046691 Bacteria 4465
2172 Ga0495670_0029836 3300046691 Bacteria 2708
2173 Ga0495670_0052501 3300046691 Bacteria 2041
2174 Ga0495670_0052955 3300046691 Bacteria 2032
2175 Ga0495671_0000001 3300046692 Bacteria 1169494
2176 Ga0495671_0004208 3300046692 Bacteria 8668
2177 Ga0495671_0005046 3300046692 Bacteria 7777
2178 Ga0495671_0023100 3300046692 Bacteria 3251
2179 Ga0495671_0029286 3300046692 Bacteria 2828
2180 Ga0495671_0053175 3300046692 Bacteria 2010
2181 Ga0495671_0065072 3300046692 Bacteria 1794
2182 Ga0495671_0119602 3300046692 Bacteria 1285
2183 Ga0495649_0007229 3300046694 Bacteria 6802
2184 Ga0495649_0010296 3300046694 Bacteria 5522
2185 Ga0495649_0029327 3300046694 Bacteria 3044
2186 Ga0495649_0038398 3300046694 Bacteria 2627
2187 Ga0495649_0073104 3300046694 Bacteria 1837
2188 Ga0495649_0132944 3300046694 Bacteria 1312
2189 Ga0495589_0000012 3300046794 Bacteria 248641
2190 Ga0495589_0002083 3300046794 Bacteria 11314
2191 Ga0495589_0002836 3300046794 Bacteria 9585
2192 Ga0495589_0010151 3300046794 Bacteria 4891
2193 Ga0495589_0046958 3300046794 Bacteria 2141
2194 Ga0495589_0092691 3300046794 Bacteria 1466
2195 Ga0495600_0001244 3300046809 Bacteria 14007
2196 Ga0495600_0004954 3300046809 Bacteria 7995
2197 Ga0495600_0053336 3300046809 Bacteria 2641
2198 Ga0495660_0002549 3300046810 Bacteria 11612
2199 Ga0495660_0003619 3300046810 Bacteria 9523
2200 Ga0495660_0004329 3300046810 Bacteria 8598
2201 Ga0495660_0009675 3300046810 Bacteria 5616
2202 Ga0495660_0012183 3300046810 Bacteria 4989
2203 Ga0495660_0081951 3300046810 Bacteria 1690
2204 Ga0495581_0057125 3300047315 Bacteria 2252
2205 Ga0495581_0069493 3300047315 Bacteria 2036
2206 Ga0495636_0002382 3300047318 Bacteria 7217
2207 Ga0495636_0006299 3300047318 Bacteria 4659
2208 Ga0495636_0017797 3300047318 Bacteria 2847
2209 Ga0495636_0026826 3300047318 Bacteria 2344
2210 Ga0495674_0002133 3300047319 Bacteria 19420
2211 Ga0495674_0006203 3300047319 Bacteria 11470
2212 Ga0495674_0006309 3300047319 Bacteria 11367
2213 Ga0495674_0032001 3300047319 Bacteria 4773
2214 Ga0495674_0032757 3300047319 Bacteria 4710
2215 Ga0495674_0066742 3300047319 Bacteria 3119
2216 Ga0495674_0094383 3300047319 Bacteria 2551
2217 Ga0495672_0000032 3300047320 Bacteria 295356
2218 Ga0495672_0000514 3300047320 Bacteria 44474
2219 Ga0495672_0000956 3300047320 Bacteria 30049
2220 Ga0495672_0002479 3300047320 Bacteria 16940
2221 Ga0495672_0003922 3300047320 Bacteria 12486
2222 Ga0495672_0025842 3300047320 Bacteria 3753
2223 Ga0495672_0029549 3300047320 Bacteria 3450
2224 Ga0495676_0002177 3300047321 Bacteria 17357
2225 Ga0495676_0097937 3300047321 Bacteria 2177
2226 Ga0495676_0152427 3300047321 Bacteria 1643
2227 Ga0495680_0003170 3300047322 Bacteria 16372
2228 Ga0495680_0018118 3300047322 Bacteria 5988
2229 Ga0495680_0044601 3300047322 Bacteria 3505
2230 Ga0495680_0045191 3300047322 Bacteria 3478
2231 Ga0495680_0083821 3300047322 Bacteria 2403
2232 Ga0495680_0151348 3300047322 Bacteria 1691
2233 Ga0495683_0000035 3300047323 Bacteria 146394
2234 Ga0495683_0000129 3300047323 Bacteria 75590
2235 Ga0495683_0000507 3300047323 Bacteria 30072
2236 Ga0495683_0002835 3300047323 Bacteria 10261
2237 Ga0495683_0004111 3300047323 Bacteria 8333
2238 Ga0495683_0007116 3300047323 Bacteria 6071
2239 Ga0495683_0009929 3300047323 Bacteria 5055
2240 Ga0495683_0019584 3300047323 Bacteria 3492
2241 Ga0495683_0023152 3300047323 Bacteria 3193
2242 Ga0495683_0043357 3300047323 Bacteria 2265
2243 Ga0495687_000021 3300047443 Bacteria 334681
2244 Ga0495687_000214 3300047443 Bacteria 83035
2245 Ga0495687_000239 3300047443 Bacteria 75655
2246 Ga0495687_002698 3300047443 Bacteria 13771
2247 Ga0495687_002730 3300047443 Bacteria 13695
2248 Ga0495687_006024 3300047443 Bacteria 7556
2249 Ga0495687_009753 3300047443 Bacteria 5336
2250 Ga0495687_010273 3300047443 Bacteria 5144
2251 Ga0495687_022214 3300047443 Bacteria 3050
2252 Ga0495675_0014494 3300047444 Bacteria 4982
2253 Ga0495675_0017719 3300047444 Bacteria 4515
2254 Ga0495675_0050000 3300047444 Bacteria 2657
2255 Ga0495675_0163352 3300047444 Bacteria 1370
2256 Ga0495677_0002874 3300047445 Bacteria 6714
2257 Ga0495679_000104 3300047446 Bacteria 76092
2258 Ga0495679_000616 3300047446 Bacteria 24020
2259 Ga0495679_004270 3300047446 Bacteria 6632
2260 Ga0495679_010857 3300047446 Bacteria 3551
2261 Ga0495685_012167 3300047447 Bacteria 2912
2262 Ga0495685_016299 3300047447 Bacteria 2537
2263 Ga0495673_0000006 3300047469 Bacteria 908691
2264 Ga0495673_0008906 3300047469 Bacteria 5593
2265 Ga0495673_0020744 3300047469 Bacteria 3264
2266 Ga0495673_0039319 3300047469 Bacteria 2146
2267 Ga0495681_0005332 3300047470 Bacteria 8628
2268 Ga0495681_0006054 3300047470 Bacteria 7996
2269 Ga0495681_0008793 3300047470 Bacteria 6288
2270 Ga0495681_0028526 3300047470 Bacteria 2869
2271 Ga0495684_0072934 3300047471 Bacteria 2608
2272 Ga0495684_0124780 3300047471 Bacteria 1937
2273 Ga0495686_0000348 3300047472 Bacteria 75868
2274 Ga0495686_0000359 3300047472 Bacteria 73907
2275 Ga0495686_0000484 3300047472 Bacteria 59015
2276 Ga0495686_0002782 3300047472 Bacteria 15943
2277 Ga0495686_0005007 3300047472 Bacteria 10638
2278 Ga0495686_0039357 3300047472 Bacteria 3020
2279 Ga0495593_0003174 3300047673 Bacteria 9867
2280 Ga0495593_0005692 3300047673 Bacteria 7351
2281 Ga0495593_0010682 3300047673 Bacteria 5293
2282 Ga0495593_0044428 3300047673 Bacteria 2376
2283 Ga0495593_0138861 3300047673 Bacteria 1231
2284 Ga0495602_0007151 3300048088 Bacteria 11693
2285 Ga0495602_0082641 3300048088 Bacteria 2694
2286 Ga0495614_0002660 3300048089 Bacteria 7947
2287 Ga0495614_0003568 3300048089 Bacteria 6970
2288 Ga0495614_0018950 3300048089 Bacteria 2979
2289 Ga0495614_0064463 3300048089 Bacteria 1575
2290 Ga0495626_0020457 3300048091 Bacteria 3297
2291 Ga0495626_0039757 3300048091 Bacteria 2224
2292 Ga0495626_0045578 3300048091 Bacteria 2046
2293 Ga0495626_0057527 3300048091 Bacteria 1778
2294 Ga0496100_0004815 3300048903 Bacteria 7208
2295 Ga0496100_0006136 3300048903 Bacteria 6537
2296 Ga0496100_0039523 3300048903 Bacteria 2996
2297 Ga0496100_0075933 3300048903 Bacteria 2255
2298 Ga0496101_0002830 3300048904 Bacteria 10659
2299 Ga0496101_0021276 3300048904 Bacteria 4456
2300 Ga0496101_0055156 3300048904 Bacteria 2870
2301 Ga0496101_0057448 3300048904 Bacteria 2814
2302 Ga0496101_0136874 3300048904 Bacteria 1864
2303 Ga0496101_0198709 3300048904 Bacteria 1549
2304 Ga0496102_0000804 3300048905 Bacteria 30518
2305 Ga0496102_0001746 3300048905 Bacteria 18979
2306 Ga0496102_0013664 3300048905 Bacteria 7036
2307 Ga0496102_0014774 3300048905 Bacteria 6790
2308 Ga0496102_0017633 3300048905 Bacteria 6257
2309 Ga0496102_0019041 3300048905 Bacteria 6041
2310 Ga0496102_0077835 3300048905 Bacteria 3052
2311 Ga0496102_0089820 3300048905 Bacteria 2843
2312 Ga0496102_0198401 3300048905 Bacteria 1891
2313 Ga0496103_0001211 3300048906 Bacteria 17697
2314 Ga0496103_0015187 3300048906 Bacteria 4578
2315 Ga0496103_0019714 3300048906 Bacteria 4048
2316 Ga0496103_0022313 3300048906 Bacteria 3811
2317 Ga0496103_0083790 3300048906 Bacteria 2008
2318 Ga0496103_0109065 3300048906 Bacteria 1757
2319 Ga0496104_0031448 3300048907 Bacteria 4936
2320 Ga0496104_0060589 3300048907 Bacteria 3585
2321 Ga0496104_0076050 3300048907 Bacteria 3198
2322 Ga0496104_0317911 3300048907 Bacteria 1470
2323 Ga0496105_0035637 3300048908 Bacteria 4096
2324 Ga0496105_0103751 3300048908 Bacteria 2348
2325 Ga0496105_0130580 3300048908 Bacteria 2071
2326 Ga0496105_0153329 3300048908 Bacteria 1893
2327 Ga0496106_0000083 3300048909 Bacteria 75660
2328 Ga0496106_0006945 3300048909 Bacteria 8371
2329 Ga0496106_0025544 3300048909 Bacteria 4397
2330 Ga0496106_0085018 3300048909 Bacteria 2435
2331 Ga0496106_0086659 3300048909 Bacteria 2412
2332 Ga0496106_0094575 3300048909 Bacteria 2311
2333 Ga0496106_0139795 3300048909 Bacteria 1904
2334 Ga0496106_0277294 3300048909 Bacteria 1343
2335 Ga0496106_0278597 3300048909 Bacteria 1340
2336 Ga0496107_0008205 3300048910 Bacteria 7222
2337 Ga0496107_0010102 3300048910 Bacteria 6548
2338 Ga0496107_0023423 3300048910 Bacteria 4366
2339 Ga0496107_0043961 3300048910 Bacteria 3210
2340 Ga0496108_0007193 3300048911 Bacteria 9023
2341 Ga0496108_0032539 3300048911 Bacteria 4332
2342 Ga0496108_0050423 3300048911 Bacteria 3484
2343 Ga0496108_0085780 3300048911 Bacteria 2673
2344 Ga0496108_0144777 3300048911 Bacteria 2048
2345 Ga0496108_0377588 3300048911 Bacteria 1238
2346 Ga0496109_0018010 3300048912 Bacteria 6200
2347 Ga0496109_0031795 3300048912 Bacteria 4739
2348 Ga0496109_0065547 3300048912 Bacteria 3325
2349 Ga0496109_0130389 3300048912 Bacteria 2346
2350 Ga0496109_0205233 3300048912 Bacteria 1853
2351 Ga0496109_0241597 3300048912 Bacteria 1700
2352 Ga0496109_0277465 3300048912 Bacteria 1579
2353 Ga0496110_0008997 3300048913 Bacteria 8055
2354 Ga0496110_0017713 3300048913 Bacteria 5959
2355 Ga0496110_0026955 3300048913 Bacteria 4922
2356 Ga0496110_0028843 3300048913 Bacteria 4770
2357 Ga0496110_0063701 3300048913 Bacteria 3258
2358 Ga0496110_0100919 3300048913 Bacteria 2587
2359 Ga0496110_0241489 3300048913 Bacteria 1644
2360 Ga0496111_0028699 3300048914 Bacteria 3944
2361 Ga0496111_0080311 3300048914 Bacteria 2379
2362 Ga0496111_0126519 3300048914 Bacteria 1889
2363 Ga0496111_0137926 3300048914 Bacteria 1807
2364 Ga0496112_0001194 3300048915 Bacteria 19475
2365 Ga0496112_0006936 3300048915 Bacteria 9998
2366 Ga0496112_0007589 3300048915 Bacteria 9639
2367 Ga0496112_0028443 3300048915 Bacteria 5395
2368 Ga0496112_0030657 3300048915 Bacteria 5208
2369 Ga0496112_0074180 3300048915 Bacteria 3364
2370 Ga0496112_0077375 3300048915 Bacteria 3290
2371 Ga0496112_0089836 3300048915 Bacteria 3040
2372 Ga0496113_0043267 3300048916 Bacteria 3332
2373 Ga0496113_0045379 3300048916 Bacteria 3260
2374 Ga0496113_0056647 3300048916 Bacteria 2943
2375 Ga0496113_0197208 3300048916 Bacteria 1599
2376 Ga0496114_0004990 3300048917 Bacteria 10353
2377 Ga0496114_0010260 3300048917 Bacteria 7454
2378 Ga0496114_0020508 3300048917 Bacteria 5364
2379 Ga0496114_0024932 3300048917 Bacteria 4884
2380 Ga0496115_0025753 3300048918 Bacteria 4584
2381 Ga0496116_0000677 3300048919 Bacteria 44238
2382 Ga0496116_0027970 3300048919 Bacteria 4094
2383 Ga0496116_0064506 3300048919 Bacteria 2354
2384 Ga0496116_0114370 3300048919 Bacteria 1576
2385 Ga0496117_0000001 3300048920 Bacteria 2526244
2386 Ga0496117_0000524 3300048920 Bacteria 63297
2387 Ga0496117_0005871 3300048920 Bacteria 12690
2388 Ga0496117_0018774 3300048920 Bacteria 5712
2389 Ga0496117_0023689 3300048920 Bacteria 4881
2390 Ga0496117_0031107 3300048920 Bacteria 4081
2391 Ga0496117_0032959 3300048920 Bacteria 3925
2392 Ga0496117_0130393 3300048920 Bacteria 1525
2393 Ga0496118_0000008 3300048921 Bacteria 644537
2394 Ga0496118_0000495 3300048921 Bacteria 65385
2395 Ga0496118_0016310 3300048921 Bacteria 6822
2396 Ga0496118_0018668 3300048921 Bacteria 6235
2397 Ga0496118_0029594 3300048921 Bacteria 4589
2398 Ga0496118_0041496 3300048921 Bacteria 3642
2399 Ga0496118_0079849 3300048921 Bacteria 2305
2400 Ga0496119_0000943 3300048922 Bacteria 37460
2401 Ga0496120_0011781 3300048923 Bacteria 5985
2402 Ga0496121_0000299 3300048924 Bacteria 103000
2403 Ga0496121_0000776 3300048924 Bacteria 58521
2404 Ga0496121_0001969 3300048924 Bacteria 32683
2405 Ga0496121_0002626 3300048924 Bacteria 27109
2406 Ga0496121_0004727 3300048924 Bacteria 17990
2407 Ga0496121_0007566 3300048924 Bacteria 13087
2408 Ga0496121_0020186 3300048924 Bacteria 6612
2409 Ga0496121_0021219 3300048924 Bacteria 6374
2410 Ga0496121_0028128 3300048924 Bacteria 5240
2411 Ga0496121_0030135 3300048924 Bacteria 4991
2412 Ga0496121_0081141 3300048924 Bacteria 2568
2413 Ga0496121_0114940 3300048924 Bacteria 2044
2414 Ga0496121_0152013 3300048924 Bacteria 1702
2415 Ga0496121_0171172 3300048924 Bacteria 1577
2416 Ga0496122_0000254 3300048925 Bacteria 120401
2417 Ga0496122_0009618 3300048925 Bacteria 10124
2418 Ga0496122_0011407 3300048925 Bacteria 9002
2419 Ga0496122_0019133 3300048925 Bacteria 6278
2420 Ga0496122_0033707 3300048925 Bacteria 4205
2421 Ga0496122_0071194 3300048925 Bacteria 2479
2422 Ga0496122_0078692 3300048925 Bacteria 2308
2423 Ga0496122_0132691 3300048925 Bacteria 1578
2424 Ga0496123_0001037 3300048926 Bacteria 42105
2425 Ga0496123_0001681 3300048926 Bacteria 29611
2426 Ga0496123_0007082 3300048926 Bacteria 10658
2427 Ga0496123_0007411 3300048926 Bacteria 10346
2428 Ga0496123_0066778 3300048926 Bacteria 2276
2429 Ga0496124_0000004 3300048927 Bacteria 976131
2430 Ga0496124_0014034 3300048927 Bacteria 7772
2431 Ga0496124_0018411 3300048927 Bacteria 6540
2432 Ga0496124_0019995 3300048927 Bacteria 6206
2433 Ga0496124_0028627 3300048927 Bacteria 4981
2434 Ga0496124_0042297 3300048927 Bacteria 3924
2435 Ga0496124_0057862 3300048927 Bacteria 3264
2436 Ga0496124_0081500 3300048927 Bacteria 2659
2437 Ga0496124_0112415 3300048927 Bacteria 2190
2438 Ga0496124_0115607 3300048927 Bacteria 2152
2439 Ga0496125_0000042 3300048928 Bacteria 303305
2440 Ga0496125_0025416 3300048928 Bacteria 5422
2441 Ga0496125_0149864 3300048928 Bacteria 1604
2442 Ga0496126_0000032 3300048929 Bacteria 372456
2443 Ga0496126_0003005 3300048929 Bacteria 21885
2444 Ga0496126_0005317 3300048929 Bacteria 14770
2445 Ga0496126_0006439 3300048929 Bacteria 13084
2446 Ga0496126_0031317 3300048929 Bacteria 5028
2447 Ga0501309_000918 3300049129 Bacteria 2658
2448 Ga0501310_001182 3300049130 Bacteria 2347
2449 Ga0495678_000016 3300049459 Bacteria 303426
2450 Ga0495678_000020 3300049459 Bacteria 253654
2451 Ga0495678_000629 3300049459 Bacteria 32776
2452 Ga0495678_000758 3300049459 Bacteria 29313
2453 Ga0495678_002055 3300049459 Bacteria 14395
2454 Ga0495678_002346 3300049459 Bacteria 13008
2455 Ga0495678_004649 3300049459 Bacteria 7873
2456 Ga0495682_0000183 3300049460 Bacteria 51600
2457 Ga0495682_0000840 3300049460 Bacteria 19225
2458 Ga0495682_0005062 3300049460 Bacteria 5535
2459 Ga0501291_002885 3300049514 Bacteria 2101
2460 Ga0501300_003060 3300049523 Bacteria 2496
2461 Ga0501031_0133431 3300049568 Bacteria 1622
2462 Ga0501032_0046669 3300049569 Bacteria 2927
2463 Ga0501033_0022128 3300049570 Bacteria 4797
2464 Ga0501033_0028921 3300049570 Bacteria 4164
2465 Ga0501033_0063841 3300049570 Bacteria 2710
2466 Ga0501034_0000325 3300049571 Bacteria 83662
2467 Ga0501034_0004348 3300049571 Bacteria 15792
2468 Ga0501034_0018188 3300049571 Bacteria 7210
2469 Ga0501034_0033736 3300049571 Bacteria 5189
2470 Ga0501036_0137839 3300049572 Bacteria 2059
2471 Ga0501036_0168657 3300049572 Bacteria 1845
2472 Ga0501037_0035337 3300049573 Bacteria 3685
2473 Ga0501037_0058387 3300049573 Bacteria 2816
2474 Ga0501037_0058556 3300049573 Bacteria 2811
2475 Ga0501037_0086222 3300049573 Bacteria 2273
2476 Ga0501038_0069053 3300049574 Bacteria 3003
2477 Ga0501038_0126007 3300049574 Bacteria 2108
2478 Ga0501039_0009457 3300049575 Bacteria 7431
2479 Ga0501039_0017413 3300049575 Bacteria 5511
2480 Ga0501039_0029343 3300049575 Bacteria 4236
2481 Ga0501039_0331448 3300049575 Bacteria 1196
2482 Ga0501040_0000023 3300049576 Bacteria 69444
2483 Ga0501040_0004940 3300049576 Bacteria 8630
2484 Ga0501041_0010068 3300049577 Bacteria 5571
2485 Ga0501041_0039883 3300049577 Bacteria 2849
2486 Ga0501042_0000263 3300049578 Bacteria 25646
2487 Ga0501042_0032308 3300049578 Bacteria 3706
2488 Ga0501042_0051821 3300049578 Bacteria 2927
2489 Ga0501042_0056816 3300049578 Bacteria 2792
2490 Ga0501042_0108481 3300049578 Bacteria 1999
2491 Ga0501043_0021241 3300049579 Bacteria 5089
2492 Ga0501043_0112963 3300049579 Bacteria 2133
2493 Ga0501046_0192913 3300049580 Bacteria 1519
2494 Ga0501046_0264053 3300049580 Bacteria 1264
2495 Ga0501047_0044167 3300049581 Bacteria 4305
2496 Ga0501067_0048559 3300049583 Bacteria 2353
2497 Ga0501067_0078301 3300049583 Bacteria 1832
2498 Ga0501068_0026085 3300049584 Bacteria 3441
2499 Ga0501069_0030692 3300049585 Bacteria 2953
2500 Ga0501069_0064120 3300049585 Bacteria 2053
2501 Ga0501070_0005677 3300049586 Bacteria 10639
2502 Ga0501070_0024508 3300049586 Bacteria 5059
2503 Ga0501071_0013247 3300049587 Bacteria 5618
2504 Ga0501071_0031635 3300049587 Bacteria 3753
2505 Ga0501072_0024742 3300049588 Bacteria 4673
2506 Ga0501072_0077408 3300049588 Bacteria 2633
2507 Ga0501073_0000189 3300049589 Bacteria 40569
2508 Ga0501073_0022806 3300049589 Bacteria 4503
2509 Ga0501073_0046711 3300049589 Bacteria 3044
2510 Ga0501074_0001067 3300049590 Bacteria 17861
2511 Ga0501074_0047894 3300049590 Bacteria 3089
2512 Ga0501075_0011104 3300049591 Bacteria 6362
2513 Ga0501075_0014198 3300049591 Bacteria 5707
2514 Ga0501076_0005898 3300049592 Bacteria 8838
2515 Ga0501076_0019023 3300049592 Bacteria 5241
2516 Ga0501076_0042824 3300049592 Bacteria 3566
2517 Ga0501076_0066837 3300049592 Bacteria 2870
2518 Ga0501076_0216884 3300049592 Bacteria 1564
2519 Ga0501198_000004 3300049649 Bacteria 175146
2520 Ga0501222_000038 3300049662 Bacteria 51424
2521 Ga0501222_002709 3300049662 Bacteria 2454
2522 Ga0501227_009002 3300049665 Bacteria 2147
2523 Ga0501233_003515 3300049668 Bacteria 2821
2524 Ga0501249_012475 3300049679 Bacteria 1796
2525 Ga0501221_001013 3300049704 Bacteria 4613
2526 Ga0501225_0003990 3300049705 Bacteria 4417
2527 Ga0501229_000157 3300049706 Bacteria 7041
2528 Ga0501079_0005012 3300049741 Bacteria 9821
2529 Ga0501079_0014077 3300049741 Bacteria 6099
2530 Ga0501079_0018633 3300049741 Bacteria 5303
2531 Ga0501079_0019840 3300049741 Bacteria 5136
2532 Ga0501079_0259604 3300049741 Bacteria 1358
2533 Ga0501080_0003496 3300049742 Bacteria 13842
2534 Ga0501080_0005517 3300049742 Bacteria 11294
2535 Ga0501080_0008234 3300049742 Bacteria 9440
2536 Ga0501080_0045006 3300049742 Bacteria 4108
2537 Ga0501080_0294988 3300049742 Bacteria 1471
2538 Ga0501081_0000666 3300049743 Bacteria 19677
2539 Ga0501083_0004415 3300049744 Bacteria 9923
2540 Ga0501083_0156158 3300049744 Bacteria 1493
2541 Ga0501083_0178755 3300049744 Bacteria 1386
2542 Ga0501262_003082 3300049759 Bacteria 1901
2543 Ga0501264_002653 3300049761 Bacteria 1648
2544 Ga0501269_000568 3300049766 Bacteria 6942
2545 Ga0501279_003201 3300049775 Bacteria 2133
2546 Ga0501279_005182 3300049775 Bacteria 1711
2547 Ga0501279_007334 3300049775 Bacteria 1464
2548 Ga0501280_000378 3300049776 Bacteria 10860
2549 Ga0501282_002864 3300049778 Bacteria 1871
2550 Ga0501035_0003915 3300049822 Bacteria 14197
2551 Ga0501035_0008356 3300049822 Bacteria 9636
2552 Ga0501035_0024654 3300049822 Bacteria 5515
2553 Ga0501035_0028978 3300049822 Bacteria 5050
2554 Ga0501035_0197095 3300049822 Bacteria 1729
2555 Ga0501035_0253617 3300049822 Bacteria 1493
2556 Ga0501044_0000419 3300049823 Bacteria 52441
2557 Ga0501044_0002972 3300049823 Bacteria 19247
2558 Ga0501044_0004821 3300049823 Bacteria 15088
2559 Ga0501044_0012890 3300049823 Bacteria 9049
2560 Ga0501045_0008546 3300049824 Bacteria 7138
2561 Ga0501045_0118766 3300049824 Bacteria 1963
2562 nmdc:mga03683_21215_c1 3300050489 Bacteria 2501
2563 nmdc:mga03683_44243_c1 3300050489 Bacteria 1839
2564 nmdc:mga03683_55821_c1 3300050489 Bacteria 1659
2565 nmdc:mga03683_6401_c1 3300050489 Bacteria 4029
2566 nmdc:mga03n38_16858_c1 3300050490 Bacteria 2850
2567 nmdc:mga00v17_142282_c1 3300050491 Bacteria 1538
2568 nmdc:mga00v17_4245_c1 3300050491 Bacteria 7438
2569 nmdc:mga00v17_47086_c1 3300050491 Bacteria 2611
2570 nmdc:mga00v17_86679_c1 3300050491 Bacteria 1962
2571 nmdc:mga0yw44_49460_c1 3300050492 Bacteria 2538
2572 nmdc:mga0yw44_52474_c1 3300050492 Bacteria 2472
2573 nmdc:mga0k408_11748_c1 3300050493 Bacteria 4777
2574 nmdc:mga0k408_12277_c1 3300050493 Bacteria 4681
2575 nmdc:mga0k408_1829_c1 3300050493 Bacteria 11414
2576 nmdc:mga0k408_25018_c1 3300050493 Bacteria 3378
2577 nmdc:mga0k408_298_c1 3300050493 Bacteria 26818
2578 nmdc:mga0k408_34295_c1 3300050493 Bacteria 2905
2579 nmdc:mga0k408_41198_c1 3300050493 Bacteria 2659
2580 nmdc:mga0k408_791_c1 3300050493 Bacteria 17435
2581 nmdc:mga0k408_86937_c1 3300050493 Bacteria 1836
2582 nmdc:mga04h51_13634_c1 3300050495 Bacteria 2305
2583 nmdc:mga07m45_12471_c1 3300050496 Bacteria 4494
2584 nmdc:mga07m45_1275_c1 3300050496 Bacteria 5984
2585 nmdc:mga07m45_151358_c1 3300050496 Bacteria 1346
2586 nmdc:mga07m45_174548_c1 3300050496 Bacteria 1250
2587 nmdc:mga07m45_24148_c1 3300050496 Bacteria 3328
2588 nmdc:mga07m45_332_c1 3300050496 Bacteria 19157
2589 nmdc:mga07m45_35051_c1 3300050496 Bacteria 2791
2590 nmdc:mga07m45_410_c1 3300050496 Bacteria 17752
2591 nmdc:mga07m45_4153_c1 3300050496 Bacteria 7072
2592 nmdc:mga07m45_4482_c1 3300050496 Bacteria 6833
2593 nmdc:mga07m45_4548_c1 3300050496 Bacteria 6792
2594 nmdc:mga07m45_46645_c2 3300050496 Bacteria 2096
2595 nmdc:mga07m45_610_c1 3300050496 Bacteria 15213
2596 nmdc:mga07m45_64052_c1 3300050496 Bacteria 2086
2597 nmdc:mga05p37_127918_c1 3300050507 Bacteria 3118
2598 nmdc:mga05p37_131854_c1 3300050507 Bacteria 3066
2599 nmdc:mga05p37_17046_c1 3300050507 Bacteria 8761
2600 nmdc:mga05p37_277915_c1 3300050507 Bacteria 1998
2601 nmdc:mga05p37_352353_c1 3300050507 Bacteria 1733
2602 nmdc:mga05p37_976_c1 3300050507 Bacteria 32490
2603 nmdc:mga09592_13427_c1 3300050508 Bacteria 6687
2604 nmdc:mga09592_16417_c1 3300050508 Bacteria 6056
2605 nmdc:mga09592_355_c1 3300050508 Bacteria 33629
2606 nmdc:mga09592_36495_c1 3300050508 Bacteria 4117
2607 nmdc:mga09592_4010_c1 3300050508 Bacteria 11878
2608 nmdc:mga09592_47591_c1 3300050508 Bacteria 3614
2609 nmdc:mga0qj67_22259_c1 3300050509 Bacteria 4868
2610 nmdc:mga0qj67_42987_c1 3300050509 Bacteria 3559
2611 nmdc:mga06r32_1279_c1 3300050510 Bacteria 22640
2612 nmdc:mga06r32_43165_c1 3300050510 Bacteria 4290
2613 nmdc:mga08y16_171440_c1 3300050511 Bacteria 2254
2614 nmdc:mga08y16_182274_c1 3300050511 Bacteria 2180
2615 nmdc:mga08y16_199641_c1 3300050511 Bacteria 2073
2616 nmdc:mga08y16_245589_c1 3300050511 Bacteria 1850
2617 nmdc:mga08y16_25043_c1 3300050511 Bacteria 6295
2618 nmdc:mga08y16_388305_c1 3300050511 Bacteria 1430
2619 nmdc:mga08y16_4046_c1 3300050511 Bacteria 15302
2620 nmdc:mga08y16_426211_c1 3300050511 Bacteria 1355
2621 nmdc:mga08y16_49132_c1 3300050511 Bacteria 4415
2622 nmdc:mga08y16_530669_c1 3300050511 Bacteria 1193
2623 nmdc:mga08y16_591_c1 3300050511 Bacteria 33813
2624 nmdc:mga08y16_72625_c1 3300050511 Bacteria 3585
2625 nmdc:mga08y16_873_c1 3300050511 Bacteria 29066
2626 nmdc:mga0n895_129951_c1 3300050512 Bacteria 2543
2627 nmdc:mga0n895_252610_c1 3300050512 Bacteria 1789
2628 nmdc:mga0n895_288716_c1 3300050512 Bacteria 1663
2629 nmdc:mga0n895_361065_c1 3300050512 Bacteria 1471
2630 nmdc:mga0n895_6286_c1 3300050512 Bacteria 10068
2631 nmdc:mga0n895_63369_c1 3300050512 Bacteria 3655
2632 nmdc:mga0rr50_181472_c1 3300050513 Bacteria 1721
2633 nmdc:mga0rr50_49023_c1 3300050513 Bacteria 3125
2634 nmdc:mga0a205_154048_c1 3300050515 Bacteria 2197
2635 nmdc:mga0a205_17391_c1 3300050515 Bacteria 6738
2636 nmdc:mga0a205_27430_c1 3300050515 Bacteria 5438
2637 Ga0495601_0077856 3300053077 Bacteria 2124
2638 Ga0495619_0019309 3300053085 Bacteria 4331
2639 Ga0500578_0088218 3300053086 Bacteria 1970
2640 Ga0500641_0039912 3300053096 Bacteria 1893
2641 Ga0500593_000173 3300053117 Bacteria 26150
2642 Ga0500594_0006579 3300053118 Bacteria 2615
2643 Ga0500618_009034 3300053125 Bacteria 2743
2644 Ga0500568_0001605 3300053139 Bacteria 14305
2645 Ga0500586_001463 3300053145 Bacteria 4985
2646 Ga0500604_0029274 3300053151 Bacteria 1604
2647 Ga0500616_0011259 3300053153 Bacteria 5297
2648 Ga0500619_000394 3300053154 Bacteria 7993
2649 Ga0500622_0000001 3300053156 Bacteria 657715
2650 Ga0500622_0012212 3300053156 Bacteria 4658
2651 Ga0500636_0000058 3300053177 Bacteria 53244
2652 Ga0500625_012178 3300053729 Bacteria 3927
2653 Ga0500645_003628 3300053730 Bacteria 6182
2654 Ga0500645_005621 3300053730 Bacteria 4585
2655 Ga0500645_016712 3300053730 Bacteria 2307
2656 Ga0500587_002202 3300053739 Bacteria 2779
2657 Ga0501084_0007225 3300054114 Bacteria 9153
2658 Ga0501084_0028916 3300054114 Bacteria 4634
2659 Ga0501084_0117524 3300054114 Bacteria 2236
2660 Ga0501084_0148374 3300054114 Bacteria 1976
2661 Ga0501082_0014469 3300060353 Bacteria 6792
2662 Ga0501082_0262554 3300060353 Bacteria 1502
2663 Ga0466962_0001449 3300061719 Bacteria 11067
2664 Ga0466962_0001737 3300061719 Bacteria 10246
2665 Ga0466962_0011034 3300061719 Bacteria 4349
2666 Ga0466962_0047359 3300061719 Bacteria 2054
2667 Ga0530510_0035073 3300061734 Bacteria 3615

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0178755 Ga0501083_0178755_105_1067 306
2 3300050509 nmdc:mga0qj67_42987_c1 nmdc:mga0qj67_42987_c1_2580_3542 306
3 iso_pu_bacteria 8016728285 8016729079 310
4 iso_pu_bacteria 2784132072 2784314075 320
5 3300039447 Ga0436361_0072935 Ga0436361_0072935_23_1012 321
6 3300046491 Ga0495584_0090447 Ga0495584_0090447_532_1521 321
7 3300046512 Ga0495610_0000003 Ga0495610_0000003_39_1028 321
8 3300046512 Ga0495610_0002238 Ga0495610_0002238_15350_16339 321
9 3300046513 Ga0495616_0129192 Ga0495616_0129192_156_1145 321
10 3300048924 Ga0496121_0028128 Ga0496121_0028128_4229_5218 321
11 3300013104 Ga0157370_10610209 Ga0157370_106102091 324
12 3300038705 Ga0237819_00787 Ga0237819_00787_42_1016 324
13 3300046557 Ga0495622_0000853 Ga0495622_0000853_8844_9818 324
14 3300046692 Ga0495671_0053175 Ga0495671_0053175_30_1004 324
15 3300046810 Ga0495660_0012183 Ga0495660_0012183_57_1031 324
16 3300048924 Ga0496121_0171172 Ga0496121_0171172_17_991 324
17 3300037466 Ga0395898_0059986 Ga0395898_0059986_46_1053 328
18 3300046674 Ga0495588_0116724 Ga0495588_0116724_14_1045 335
19 3300048091 Ga0495626_0045578 Ga0495626_0045578_587_1624 337
20 3300046665 Ga0495661_0179902 Ga0495661_0179902_13_1029 338
21 3300003758 Ga0055532_1000069 Ga0055532_100006979 345
22 3300003760 Ga0055527_1000034 Ga0055527_100003479 345
23 3300003761 Ga0055535_1000049 Ga0055535_100004979 345
24 3300003762 Ga0055542_1000077 Ga0055542_100007754 345
25 3300003763 Ga0055529_1000090 Ga0055529_100009078 345
26 3300025228 Ga0209672_100002 Ga0209672_1000021423 345
27 3300025229 Ga0209147_100003 Ga0209147_1000031423 345
28 3300025242 Ga0209258_100077 Ga0209258_10007778 345
29 3300025254 Ga0209148_1000006 Ga0209148_10000061423 345
30 3300025272 Ga0209455_1000140 Ga0209455_100014052 345
31 3300046615 Ga0495656_0000005 Ga0495656_0000005_84713_85831 345
32 3300046459 Ga0495629_0053693 Ga0495629_0053693_129_1193 347
33 3300046514 Ga0495618_0085024 Ga0495618_0085024_912_1976 347
34 3300046689 Ga0495613_0003616 Ga0495613_0003616_4560_5624 347
35 3300046794 Ga0495589_0002083 Ga0495589_0002083_4273_5337 347
36 3300046809 Ga0495600_0004954 Ga0495600_0004954_6567_7631 347
37 3300047319 Ga0495674_0066742 Ga0495674_0066742_1846_2910 347
38 3300047673 Ga0495593_0005692 Ga0495593_0005692_129_1193 347
39 3300048089 Ga0495614_0018950 Ga0495614_0018950_1849_2913 347
40 3300014326 Ga0157380_10031639 Ga0157380_100316392 349
41 3300035116 Ga0373945_0030690 Ga0373945_0030690_483_1535 349
42 3300046492 Ga0495585_0156447 Ga0495585_0156447_29_1102 349
43 3300046515 Ga0495620_0080373 Ga0495620_0080373_111_1184 349
44 3300048911 Ga0496108_0085780 Ga0496108_0085780_445_1509 349
45 3300050511 nmdc:mga08y16_530669_c1 nmdc:mga08y16_530669_c1_78_1172 349
46 3300009036 Ga0105244_10119247 Ga0105244_101192471 350
47 3300045051 Ga0451576_0393624 Ga0451576_0393624_18_1079 350
48 3300046506 Ga0495583_0084864 Ga0495583_0084864_236_1312 350
49 3300046660 Ga0495625_0038379 Ga0495625_0038379_1217_2293 350
50 3300047318 Ga0495636_0026826 Ga0495636_0026826_1212_2288 350
51 3300047321 Ga0495676_0097937 Ga0495676_0097937_335_1411 350
52 3300047447 Ga0495685_016299 Ga0495685_016299_1448_2524 350
53 3300047673 Ga0495593_0010682 Ga0495593_0010682_11_1084 350
54 3300053145 Ga0500586_001463 Ga0500586_001463_3195_4271 350
55 3300009551 Ga0105238_10059536 Ga0105238_100595363 351
56 3300010375 Ga0105239_10139903 Ga0105239_101399032 351
57 3300044658 Ga0466972_0000221 Ga0466972_0000221_29761_30846 351
58 3300044693 Ga0466961_0053620 Ga0466961_0053620_515_1591 351
59 3300049570 Ga0501033_0028921 Ga0501033_0028921_3046_4122 351
60 3300009094 Ga0111539_10198755 Ga0111539_101987552 352
61 3300014968 Ga0157379_10111752 Ga0157379_101117522 352
62 3300036401 Ga0373937_0210726 Ga0373937_0210726_488_1549 352
63 3300039437 Ga0436365_1492911 Ga0436365_1492911_10_1098 352
64 3300048913 Ga0496110_0028843 Ga0496110_0028843_297_1385 352
65 3300049573 Ga0501037_0058387 Ga0501037_0058387_86_1147 352
66 iso_pu_bacteria 2501025501 2501076436 352
67 iso_pu_bacteria 2501025502 2501079869 352
68 iso_pu_bacteria 2501025504 2501413502 352
69 iso_pu_bacteria 2519103095 2519461992 352
70 iso_pu_bacteria 2643221645 2644254102 352
71 iso_pu_bacteria 2718217991 2719643370 352
72 iso_pu_bacteria 2738541280 2738741429 352
73 iso_pu_bacteria 2808606384 2808967915 352
74 iso_pu_bacteria 2808606390 2809002746 352
75 iso_pu_bacteria 2808606391 2809010024 352
76 iso_pu_bacteria 2816332253 2817258849 352
77 iso_pu_bacteria 2816332256 2817280721 352
78 iso_pu_bacteria 2904424332 2904426554 352
79 iso_pu_bacteria 639633007 639786171 352
80 iso_pu_bacteria 641736154 642418851 352
81 3300009036 Ga0105244_10035145 Ga0105244_100351453 353
82 3300046648 Ga0495611_0007320 Ga0495611_0007320_1142_2203 353
83 3300047321 Ga0495676_0002177 Ga0495676_0002177_8627_9688 353
84 iso_pu_bacteria 2643221654 2644302084 353
85 3300017792 Ga0163161_10012343 Ga0163161_100123434 355
86 3300025295 Ga0209564_1002900 Ga0209564_10029006 355
87 3300026075 Ga0207708_10078304 Ga0207708_100783042 355
88 3300036401 Ga0373937_0018133 Ga0373937_0018133_5094_6179 355
89 3300042127 Ga0450890_000361 Ga0450890_000361_4074_5150 355
90 3300042129 Ga0450891_002062 Ga0450891_002062_550_1626 355
91 3300042130 Ga0450892_000087 Ga0450892_000087_8046_9122 355
92 3300046452 Ga0495617_000232 Ga0495617_000232_7921_9012 355
93 3300046460 Ga0495638_0135448 Ga0495638_0135448_95_1186 355
94 3300046492 Ga0495585_0004576 Ga0495585_0004576_4803_5894 355
95 3300046500 Ga0495596_0012755 Ga0495596_0012755_278_1369 355
96 3300046501 Ga0495607_0039808 Ga0495607_0039808_1476_2567 355
97 3300046506 Ga0495583_0006743 Ga0495583_0006743_3357_4448 355
98 3300046507 Ga0495606_0037277 Ga0495606_0037277_694_1785 355
99 3300046513 Ga0495616_0006867 Ga0495616_0006867_2314_3405 355
100 3300046520 Ga0495637_0033621 Ga0495637_0033621_1002_2093 355
101 3300046524 Ga0495648_0000030 Ga0495648_0000030_108389_109480 355
102 3300046528 Ga0495642_0004578 Ga0495642_0004578_2226_3317 355
103 3300046528 Ga0495642_0038419 Ga0495642_0038419_356_1447 355
104 3300046530 Ga0495654_0008769 Ga0495654_0008769_576_1667 355
105 3300046535 Ga0495586_0011955 Ga0495586_0011955_2415_3518 355
106 3300046536 Ga0495587_0020556 Ga0495587_0020556_30_1133 355
107 3300046542 Ga0495597_0005114 Ga0495597_0005114_4318_5409 355
108 3300046558 Ga0495633_0009897 Ga0495633_0009897_3534_4625 355
109 3300046616 Ga0495668_0000220 Ga0495668_0000220_60226_61317 355
110 3300046665 Ga0495661_0131682 Ga0495661_0131682_129_1220 355
111 3300046674 Ga0495588_0012021 Ga0495588_0012021_2714_3805 355
112 3300046692 Ga0495671_0119602 Ga0495671_0119602_155_1246 355
113 3300046694 Ga0495649_0073104 Ga0495649_0073104_467_1558 355
114 3300046810 Ga0495660_0081951 Ga0495660_0081951_70_1161 355
115 3300047320 Ga0495672_0003922 Ga0495672_0003922_3070_4161 355
116 3300047322 Ga0495680_0003170 Ga0495680_0003170_8826_9929 355
117 3300047443 Ga0495687_000214 Ga0495687_000214_67990_69081 355
118 3300048091 Ga0495626_0039757 Ga0495626_0039757_987_2078 355
119 3300049459 Ga0495678_004649 Ga0495678_004649_1046_2137 355
120 3300049460 Ga0495682_0000840 Ga0495682_0000840_1026_2117 355
121 3300050493 nmdc:mga0k408_1829_c1 nmdc:mga0k408_1829_c1_5380_6474 355
122 3300002067 JGI24735J21928_10001314 JGI24735J21928_100013149 356
123 3300005339 Ga0070660_100004790 Ga0070660_1000047902 356
124 3300005563 Ga0068855_100065466 Ga0068855_1000654662 356
125 3300009011 Ga0105251_10005346 Ga0105251_100053462 356
126 3300009036 Ga0105244_10003105 Ga0105244_100031059 356
127 3300009093 Ga0105240_10010361 Ga0105240_1001036111 356
128 3300009148 Ga0105243_10117663 Ga0105243_101176632 356
129 3300009174 Ga0105241_10018613 Ga0105241_100186132 356
130 3300009176 Ga0105242_10242276 Ga0105242_102422762 356
131 3300009545 Ga0105237_10279751 Ga0105237_102797512 356
132 3300009551 Ga0105238_10004929 Ga0105238_100049297 356
133 3300010375 Ga0105239_10009251 Ga0105239_100092513 356
134 3300010375 Ga0105239_10022811 Ga0105239_100228113 356
135 3300013100 Ga0157373_10145619 Ga0157373_101456192 356
136 3300013102 Ga0157371_10047612 Ga0157371_100476123 356
137 3300013104 Ga0157370_10035492 Ga0157370_100354921 356
138 3300013104 Ga0157370_10055120 Ga0157370_100551202 356
139 3300013104 Ga0157370_10116343 Ga0157370_101163432 356
140 3300013105 Ga0157369_10000847 Ga0157369_1000084716 356
141 3300013105 Ga0157369_10001910 Ga0157369_1000191021 356
142 3300013105 Ga0157369_10006399 Ga0157369_100063996 356
143 3300013296 Ga0157374_10000081 Ga0157374_1000008168 356
144 3300013296 Ga0157374_10014259 Ga0157374_100142592 356
145 3300013307 Ga0157372_10004504 Ga0157372_100045042 356
146 3300013307 Ga0157372_10408260 Ga0157372_104082601 356
147 3300014497 Ga0182008_10024473 Ga0182008_100244732 356
148 3300015261 Ga0182006_1000002 Ga0182006_1000002151 356
149 3300015261 Ga0182006_1000021 Ga0182006_1000021128 356
150 3300015262 Ga0182007_10000211 Ga0182007_100002118 356
151 3300015262 Ga0182007_10001036 Ga0182007_1000103615 356
152 3300015265 Ga0182005_1000020 Ga0182005_100002043 356
153 3300015265 Ga0182005_1000029 Ga0182005_100002925 356
154 3300015265 Ga0182005_1005819 Ga0182005_10058192 356
155 3300020081 Ga0206354_10762381 Ga0206354_107623812 356
156 3300020082 Ga0206353_11189317 Ga0206353_111893174 356
157 3300022467 Ga0224712_10029638 Ga0224712_100296381 356
158 3300025206 Ga0209435_104790 Ga0209435_1047902 356
159 3300025225 Ga0209566_100868 Ga0209566_1008683 356
160 3300025226 Ga0209674_100191 Ga0209674_10019112 356
161 3300025226 Ga0209674_102220 Ga0209674_1022203 356
162 3300025228 Ga0209672_100015 Ga0209672_100015441 356
163 3300025228 Ga0209672_100050 Ga0209672_100050204 356
164 3300025229 Ga0209147_100016 Ga0209147_10001622 356
165 3300025229 Ga0209147_100406 Ga0209147_10040622 356
166 3300025230 Ga0209563_100859 Ga0209563_1008592 356
167 3300025231 Ga0207427_100748 Ga0207427_10074812 356
168 3300025242 Ga0209258_100026 Ga0209258_100026441 356
169 3300025242 Ga0209258_100590 Ga0209258_10059016 356
170 3300025256 Ga0209759_1000528 Ga0209759_100052815 356
171 3300025256 Ga0209759_1004564 Ga0209759_10045646 356
172 3300025256 Ga0209759_1010048 Ga0209759_10100483 356
173 3300025273 Ga0209673_1000028 Ga0209673_1000028131 356
174 3300025284 Ga0209130_1008775 Ga0209130_10087752 356
175 3300025295 Ga0209564_1017151 Ga0209564_10171513 356
176 3300025711 Ga0207696_1017475 Ga0207696_10174752 356
177 3300025735 Ga0207713_1000201 Ga0207713_100020118 356
178 3300025904 Ga0207647_10007194 Ga0207647_100071943 356
179 3300025913 Ga0207695_10002871 Ga0207695_1000287120 356
180 3300025914 Ga0207671_10103515 Ga0207671_101035153 356
181 3300025919 Ga0207657_10000119 Ga0207657_1000011915 356
182 3300025932 Ga0207690_10000008 Ga0207690_1000000816 356
183 3300025981 Ga0207640_10218980 Ga0207640_102189802 356
184 3300026067 Ga0207678_10003293 Ga0207678_1000329312 356
185 3300026078 Ga0207702_10101427 Ga0207702_101014273 356
186 3300027312 Ga0209371_1000172 Ga0209371_100017273 356
187 3300027312 Ga0209371_1003240 Ga0209371_10032402 356
188 3300028800 Ga0265338_10003187 Ga0265338_100031871 356
189 3300030500 Ga0268256_1000144 Ga0268256_100014415 356
190 3300030500 Ga0268256_1002112 Ga0268256_10021122 356
191 3300031235 Ga0265330_10001258 Ga0265330_1000125813 356
192 3300031250 Ga0265331_10000810 Ga0265331_1000081022 356
193 3300036401 Ga0373937_0118340 Ga0373937_0118340_227_1306 356
194 3300037068 Ga0373925_0044804 Ga0373925_0044804_1097_2176 356
195 3300037312 Ga0395899_0000097 Ga0395899_0000097_21220_22311 356
196 3300037418 Ga0395900_0000015 Ga0395900_0000015_251522_252613 356
197 3300037418 Ga0395900_0000395 Ga0395900_0000395_21220_22311 356
198 3300037466 Ga0395898_0000407 Ga0395898_0000407_21015_22106 356
199 3300037466 Ga0395898_0009612 Ga0395898_0009612_35_1126 356
200 3300037466 Ga0395898_0182158 Ga0395898_0182158_867_1958 356
201 3300037471 Ga0395905_0000052 Ga0395905_0000052_207946_209037 356
202 3300037471 Ga0395905_0019820 Ga0395905_0019820_3814_4905 356
203 3300038443 Ga0395901_0000034 Ga0395901_0000034_161981_163072 356
204 3300038443 Ga0395901_0000286 Ga0395901_0000286_44111_45202 356
205 3300038443 Ga0395901_0000749 Ga0395901_0000749_10432_11523 356
206 3300038443 Ga0395901_0030281 Ga0395901_0030281_845_1936 356
207 3300038443 Ga0395901_0057877 Ga0395901_0057877_2163_3254 356
208 3300038443 Ga0395901_0192851 Ga0395901_0192851_733_1821 356
209 3300039447 Ga0436361_0503231 Ga0436361_0503231_12825_13919 356
210 3300039447 Ga0436361_1210742 Ga0436361_1210742_31836_32930 356
211 3300042005 Ga0439448_0002009 Ga0439448_0002009_2101_3192 356
212 3300042876 Ga0451577_0000635 Ga0451577_0000635_25159_26232 356
213 3300044656 Ga0466969_0000058 Ga0466969_0000058_7389_8480 356
214 3300044656 Ga0466969_0005424 Ga0466969_0005424_2281_3372 356
215 3300044656 Ga0466969_0019267 Ga0466969_0019267_927_2018 356
216 3300044659 Ga0466973_0055731 Ga0466973_0055731_1735_2826 356
217 3300044666 Ga0466977_0030250 Ga0466977_0030250_1843_2940 356
218 3300044683 Ga0466965_0008016 Ga0466965_0008016_1298_2389 356
219 3300044683 Ga0466965_0032081 Ga0466965_0032081_1330_2421 356
220 3300044684 Ga0466966_0002897 Ga0466966_0002897_3507_4598 356
221 3300044684 Ga0466966_0008239 Ga0466966_0008239_1505_2596 356
222 3300044684 Ga0466966_0008930 Ga0466966_0008930_72_1163 356
223 3300044693 Ga0466961_0005091 Ga0466961_0005091_68_1159 356
224 3300044693 Ga0466961_0014542 Ga0466961_0014542_3537_4628 356
225 3300044693 Ga0466961_0054733 Ga0466961_0054733_957_2048 356
226 3300044693 Ga0466961_0114382 Ga0466961_0114382_544_1635 356
227 3300044694 Ga0466963_0002853 Ga0466963_0002853_1204_2295 356
228 3300044694 Ga0466963_0005442 Ga0466963_0005442_6288_7379 356
229 3300044712 Ga0453684_0000005 Ga0453684_0000005_1119700_1120773 356
230 3300044719 Ga0466971_0000153 Ga0466971_0000153_1050_2141 356
231 3300044719 Ga0466971_0025213 Ga0466971_0025213_272_1363 356
232 3300044735 Ga0466968_0003419 Ga0466968_0003419_154_1263 356
233 3300044735 Ga0466968_0077668 Ga0466968_0077668_56_1147 356
234 3300044765 Ga0466970_0016246 Ga0466970_0016246_1677_2768 356
235 3300044765 Ga0466970_0023831 Ga0466970_0023831_671_1762 356
236 3300044842 Ga0466957_0010086 Ga0466957_0010086_789_1880 356
237 3300044842 Ga0466957_0022537 Ga0466957_0022537_2419_3510 356
238 3300045049 Ga0466959_0017523 Ga0466959_0017523_3270_4361 356
239 3300045049 Ga0466959_0023955 Ga0466959_0023955_825_1916 356
240 3300045049 Ga0466959_0051603 Ga0466959_0051603_1780_2871 356
241 3300045049 Ga0466959_0074059 Ga0466959_0074059_509_1600 356
242 3300045836 Ga0466958_0007558 Ga0466958_0007558_360_1451 356
243 3300045836 Ga0466958_0016770 Ga0466958_0016770_624_1715 356
244 3300045836 Ga0466958_0066602 Ga0466958_0066602_976_2067 356
245 3300046453 Ga0495627_000005 Ga0495627_000005_322727_323821 356
246 3300046454 Ga0495592_0005360 Ga0495592_0005360_4149_5240 356
247 3300046454 Ga0495592_0184436 Ga0495592_0184436_225_1316 356
248 3300046455 Ga0495603_0115023 Ga0495603_0115023_192_1283 356
249 3300046457 Ga0495590_0000003 Ga0495590_0000003_288856_289950 356
250 3300046457 Ga0495590_0004970 Ga0495590_0004970_2619_3710 356
251 3300046459 Ga0495629_0000127 Ga0495629_0000127_102_1193 356
252 3300046459 Ga0495629_0016511 Ga0495629_0016511_3019_4113 356
253 3300046459 Ga0495629_0021985 Ga0495629_0021985_533_1624 356
254 3300046459 Ga0495629_0044549 Ga0495629_0044549_1658_2749 356
255 3300046460 Ga0495638_0000219 Ga0495638_0000219_52945_54039 356
256 3300046460 Ga0495638_0036792 Ga0495638_0036792_1874_2968 356
257 3300046460 Ga0495638_0040786 Ga0495638_0040786_1039_2130 356
258 3300046461 Ga0495641_0052156 Ga0495641_0052156_67_1158 356
259 3300046463 Ga0495653_0002324 Ga0495653_0002324_11729_12820 356
260 3300046463 Ga0495653_0015485 Ga0495653_0015485_347_1438 356
261 3300046463 Ga0495653_0031809 Ga0495653_0031809_2054_3148 356
262 3300046471 Ga0495650_0000131 Ga0495650_0000131_2380_3474 356
263 3300046471 Ga0495650_0004275 Ga0495650_0004275_744_1838 356
264 3300046471 Ga0495650_0004651 Ga0495650_0004651_6188_7279 356
265 3300046471 Ga0495650_0004783 Ga0495650_0004783_5521_6615 356
266 3300046472 Ga0495580_0001549 Ga0495580_0001549_5717_6808 356
267 3300046472 Ga0495580_0016212 Ga0495580_0016212_2014_3105 356
268 3300046473 Ga0495582_0044760 Ga0495582_0044760_814_1905 356
269 3300046473 Ga0495582_0075613 Ga0495582_0075613_688_1779 356
270 3300046474 Ga0495605_0000944 Ga0495605_0000944_5960_7051 356
271 3300046474 Ga0495605_0027713 Ga0495605_0027713_1401_2495 356
272 3300046474 Ga0495605_0044375 Ga0495605_0044375_71_1165 356
273 3300046474 Ga0495605_0053891 Ga0495605_0053891_312_1403 356
274 3300046477 Ga0495664_0064212 Ga0495664_0064212_89_1180 356
275 3300046491 Ga0495584_0004012 Ga0495584_0004012_5589_6683 356
276 3300046491 Ga0495584_0004299 Ga0495584_0004299_5567_6661 356
277 3300046491 Ga0495584_0005522 Ga0495584_0005522_3274_4368 356
278 3300046491 Ga0495584_0018125 Ga0495584_0018125_501_1595 356
279 3300046492 Ga0495585_0000175 Ga0495585_0000175_11444_12538 356
280 3300046492 Ga0495585_0004132 Ga0495585_0004132_3753_4847 356
281 3300046492 Ga0495585_0019130 Ga0495585_0019130_2669_3763 356
282 3300046492 Ga0495585_0104903 Ga0495585_0104903_71_1162 356
283 3300046499 Ga0495594_0022659 Ga0495594_0022659_492_1586 356
284 3300046499 Ga0495594_0027831 Ga0495594_0027831_1493_2587 356
285 3300046499 Ga0495594_0173019 Ga0495594_0173019_39_1133 356
286 3300046500 Ga0495596_0001166 Ga0495596_0001166_9114_10208 356
287 3300046500 Ga0495596_0004411 Ga0495596_0004411_4174_5268 356
288 3300046500 Ga0495596_0005835 Ga0495596_0005835_3277_4368 356
289 3300046500 Ga0495596_0009835 Ga0495596_0009835_891_1985 356
290 3300046500 Ga0495596_0014611 Ga0495596_0014611_1253_2344 356
291 3300046500 Ga0495596_0021942 Ga0495596_0021942_816_1910 356
292 3300046500 Ga0495596_0039700 Ga0495596_0039700_273_1364 356
293 3300046501 Ga0495607_0004260 Ga0495607_0004260_6002_7096 356
294 3300046506 Ga0495583_0000068 Ga0495583_0000068_88173_89267 356
295 3300046506 Ga0495583_0000141 Ga0495583_0000141_16274_17368 356
296 3300046506 Ga0495583_0000436 Ga0495583_0000436_25451_26545 356
297 3300046506 Ga0495583_0000820 Ga0495583_0000820_17555_18649 356
298 3300046506 Ga0495583_0001464 Ga0495583_0001464_4587_5693 356
299 3300046506 Ga0495583_0002629 Ga0495583_0002629_4541_5632 356
300 3300046506 Ga0495583_0006790 Ga0495583_0006790_2880_3971 356
301 3300046507 Ga0495606_0000068 Ga0495606_0000068_94401_95495 356
302 3300046507 Ga0495606_0004199 Ga0495606_0004199_4487_5581 356
303 3300046507 Ga0495606_0004548 Ga0495606_0004548_10981_12075 356
304 3300046507 Ga0495606_0007686 Ga0495606_0007686_7778_8872 356
305 3300046511 Ga0495608_0018972 Ga0495608_0018972_773_1864 356
306 3300046511 Ga0495608_0054010 Ga0495608_0054010_1207_2298 356
307 3300046512 Ga0495610_0002461 Ga0495610_0002461_10355_11449 356
308 3300046512 Ga0495610_0089086 Ga0495610_0089086_281_1372 356
309 3300046513 Ga0495616_0022333 Ga0495616_0022333_2116_3210 356
310 3300046513 Ga0495616_0023628 Ga0495616_0023628_1431_2522 356
311 3300046514 Ga0495618_0045207 Ga0495618_0045207_137_1228 356
312 3300046516 Ga0495628_0005872 Ga0495628_0005872_2644_3735 356
313 3300046516 Ga0495628_0017050 Ga0495628_0017050_46_1137 356
314 3300046517 Ga0495630_0170806 Ga0495630_0170806_33_1124 356
315 3300046520 Ga0495637_0007876 Ga0495637_0007876_3750_4844 356
316 3300046523 Ga0495644_0015911 Ga0495644_0015911_1483_2577 356
317 3300046523 Ga0495644_0026717 Ga0495644_0026717_940_2031 356
318 3300046524 Ga0495648_0000087 Ga0495648_0000087_108484_109578 356
319 3300046524 Ga0495648_0003464 Ga0495648_0003464_7490_8581 356
320 3300046524 Ga0495648_0013913 Ga0495648_0013913_3381_4472 356
321 3300046524 Ga0495648_0026180 Ga0495648_0026180_1890_2984 356
322 3300046524 Ga0495648_0032736 Ga0495648_0032736_412_1506 356
323 3300046524 Ga0495648_0051103 Ga0495648_0051103_199_1290 356
324 3300046524 Ga0495648_0078292 Ga0495648_0078292_233_1324 356
325 3300046525 Ga0495663_0014780 Ga0495663_0014780_703_1797 356
326 3300046528 Ga0495642_0012325 Ga0495642_0012325_825_1919 356
327 3300046528 Ga0495642_0069838 Ga0495642_0069838_21_1115 356
328 3300046529 Ga0495652_0005978 Ga0495652_0005978_7400_8491 356
329 3300046529 Ga0495652_0218293 Ga0495652_0218293_87_1178 356
330 3300046530 Ga0495654_0000035 Ga0495654_0000035_6660_7754 356
331 3300046530 Ga0495654_0022301 Ga0495654_0022301_601_1695 356
332 3300046531 Ga0495665_0000847 Ga0495665_0000847_14011_15102 356
333 3300046531 Ga0495665_0082265 Ga0495665_0082265_545_1636 356
334 3300046536 Ga0495587_0009846 Ga0495587_0009846_1678_2772 356
335 3300046538 Ga0495609_0000021 Ga0495609_0000021_170352_171443 356
336 3300046538 Ga0495609_0002332 Ga0495609_0002332_10091_11185 356
337 3300046538 Ga0495609_0002618 Ga0495609_0002618_6369_7463 356
338 3300046538 Ga0495609_0007283 Ga0495609_0007283_1042_2136 356
339 3300046538 Ga0495609_0014349 Ga0495609_0014349_874_1968 356
340 3300046542 Ga0495597_0000910 Ga0495597_0000910_13486_14580 356
341 3300046542 Ga0495597_0001138 Ga0495597_0001138_16608_17702 356
342 3300046542 Ga0495597_0001833 Ga0495597_0001833_12217_13311 356
343 3300046542 Ga0495597_0010569 Ga0495597_0010569_984_2090 356
344 3300046542 Ga0495597_0011046 Ga0495597_0011046_163_1254 356
345 3300046542 Ga0495597_0043015 Ga0495597_0043015_739_1833 356
346 3300046543 Ga0495645_0002334 Ga0495645_0002334_4665_5756 356
347 3300046557 Ga0495622_0000004 Ga0495622_0000004_7507_8601 356
348 3300046557 Ga0495622_0000995 Ga0495622_0000995_10690_11781 356
349 3300046557 Ga0495622_0002385 Ga0495622_0002385_7860_8954 356
350 3300046557 Ga0495622_0023349 Ga0495622_0023349_1483_2577 356
351 3300046558 Ga0495633_0000728 Ga0495633_0000728_12850_13944 356
352 3300046558 Ga0495633_0002788 Ga0495633_0002788_3779_4873 356
353 3300046558 Ga0495633_0007275 Ga0495633_0007275_4910_6004 356
354 3300046558 Ga0495633_0007686 Ga0495633_0007686_4544_5638 356
355 3300046558 Ga0495633_0028969 Ga0495633_0028969_234_1328 356
356 3300046558 Ga0495633_0085178 Ga0495633_0085178_234_1328 356
357 3300046559 Ga0495667_0039600 Ga0495667_0039600_1013_2104 356
358 3300046616 Ga0495668_0000063 Ga0495668_0000063_108716_109810 356
359 3300046616 Ga0495668_0001369 Ga0495668_0001369_6567_7661 356
360 3300046616 Ga0495668_0003479 Ga0495668_0003479_7204_8298 356
361 3300046616 Ga0495668_0004957 Ga0495668_0004957_436_1530 356
362 3300046616 Ga0495668_0016763 Ga0495668_0016763_161_1255 356
363 3300046616 Ga0495668_0028416 Ga0495668_0028416_57_1151 356
364 3300046616 Ga0495668_0057970 Ga0495668_0057970_21_1115 356
365 3300046642 Ga0495634_0081827 Ga0495634_0081827_960_2051 356
366 3300046648 Ga0495611_0027975 Ga0495611_0027975_833_1924 356
367 3300046648 Ga0495611_0033610 Ga0495611_0033610_1149_2243 356
368 3300046648 Ga0495611_0034254 Ga0495611_0034254_984_2078 356
369 3300046660 Ga0495625_0002332 Ga0495625_0002332_949_2043 356
370 3300046660 Ga0495625_0160690 Ga0495625_0160690_229_1320 356
371 3300046663 Ga0495635_0005439 Ga0495635_0005439_1587_2678 356
372 3300046664 Ga0495659_0000280 Ga0495659_0000280_16802_17896 356
373 3300046665 Ga0495661_0000995 Ga0495661_0000995_18999_20090 356
374 3300046665 Ga0495661_0005074 Ga0495661_0005074_3354_4445 356
375 3300046665 Ga0495661_0005694 Ga0495661_0005694_4217_5308 356
376 3300046665 Ga0495661_0052587 Ga0495661_0052587_417_1511 356
377 3300046665 Ga0495661_0121841 Ga0495661_0121841_72_1166 356
378 3300046674 Ga0495588_0000083 Ga0495588_0000083_75164_76255 356
379 3300046674 Ga0495588_0069900 Ga0495588_0069900_376_1467 356
380 3300046674 Ga0495588_0128358 Ga0495588_0128358_40_1131 356
381 3300046675 Ga0495657_0064094 Ga0495657_0064094_1052_2143 356
382 3300046678 Ga0495599_0024587 Ga0495599_0024587_386_1477 356
383 3300046679 Ga0495623_0007148 Ga0495623_0007148_5466_6557 356
384 3300046679 Ga0495623_0011654 Ga0495623_0011654_4531_5622 356
385 3300046680 Ga0495646_0001053 Ga0495646_0001053_10947_12038 356
386 3300046680 Ga0495646_0054395 Ga0495646_0054395_755_1846 356
387 3300046680 Ga0495646_0167753 Ga0495646_0167753_28_1119 356
388 3300046684 Ga0495669_0000288 Ga0495669_0000288_25977_27071 356
389 3300046684 Ga0495669_0049859 Ga0495669_0049859_44_1135 356
390 3300046689 Ga0495613_0147410 Ga0495613_0147410_205_1299 356
391 3300046690 Ga0495624_0003534 Ga0495624_0003534_7170_8261 356
392 3300046690 Ga0495624_0023850 Ga0495624_0023850_17_1111 356
393 3300046691 Ga0495670_0001279 Ga0495670_0001279_7171_8265 356
394 3300046691 Ga0495670_0052955 Ga0495670_0052955_349_1443 356
395 3300046692 Ga0495671_0000001 Ga0495671_0000001_648251_649345 356
396 3300046692 Ga0495671_0065072 Ga0495671_0065072_392_1483 356
397 3300046694 Ga0495649_0010296 Ga0495649_0010296_1407_2498 356
398 3300046694 Ga0495649_0132944 Ga0495649_0132944_121_1212 356
399 3300046794 Ga0495589_0000012 Ga0495589_0000012_170191_171282 356
400 3300046794 Ga0495589_0010151 Ga0495589_0010151_173_1264 356
401 3300046794 Ga0495589_0046958 Ga0495589_0046958_614_1708 356
402 3300046794 Ga0495589_0092691 Ga0495589_0092691_47_1138 356
403 3300046809 Ga0495600_0001244 Ga0495600_0001244_6345_7439 356
404 3300046810 Ga0495660_0002549 Ga0495660_0002549_8342_9436 356
405 3300046810 Ga0495660_0009675 Ga0495660_0009675_1209_2303 356
406 3300047315 Ga0495581_0057125 Ga0495581_0057125_176_1270 356
407 3300047315 Ga0495581_0069493 Ga0495581_0069493_653_1747 356
408 3300047318 Ga0495636_0002382 Ga0495636_0002382_3753_4847 356
409 3300047318 Ga0495636_0017797 Ga0495636_0017797_1356_2450 356
410 3300047319 Ga0495674_0002133 Ga0495674_0002133_4569_5663 356
411 3300047319 Ga0495674_0006309 Ga0495674_0006309_6361_7452 356
412 3300047319 Ga0495674_0032001 Ga0495674_0032001_143_1234 356
413 3300047319 Ga0495674_0032757 Ga0495674_0032757_83_1174 356
414 3300047319 Ga0495674_0094383 Ga0495674_0094383_1269_2360 356
415 3300047320 Ga0495672_0000032 Ga0495672_0000032_209617_210711 356
416 3300047320 Ga0495672_0000514 Ga0495672_0000514_35495_36589 356
417 3300047320 Ga0495672_0002479 Ga0495672_0002479_2476_3567 356
418 3300047320 Ga0495672_0025842 Ga0495672_0025842_1169_2260 356
419 3300047321 Ga0495676_0152427 Ga0495676_0152427_32_1126 356
420 3300047322 Ga0495680_0045191 Ga0495680_0045191_959_2050 356
421 3300047323 Ga0495683_0000035 Ga0495683_0000035_41691_42785 356
422 3300047323 Ga0495683_0002835 Ga0495683_0002835_7337_8431 356
423 3300047323 Ga0495683_0007116 Ga0495683_0007116_4677_5768 356
424 3300047323 Ga0495683_0009929 Ga0495683_0009929_121_1212 356
425 3300047323 Ga0495683_0019584 Ga0495683_0019584_543_1634 356
426 3300047323 Ga0495683_0023152 Ga0495683_0023152_687_1778 356
427 3300047443 Ga0495687_000021 Ga0495687_000021_293451_294542 356
428 3300047443 Ga0495687_002730 Ga0495687_002730_9987_11081 356
429 3300047444 Ga0495675_0017719 Ga0495675_0017719_2799_3893 356
430 3300047444 Ga0495675_0163352 Ga0495675_0163352_23_1114 356
431 3300047446 Ga0495679_000104 Ga0495679_000104_74900_75991 356
432 3300047446 Ga0495679_010857 Ga0495679_010857_102_1193 356
433 3300047469 Ga0495673_0000006 Ga0495673_0000006_517462_518556 356
434 3300047469 Ga0495673_0020744 Ga0495673_0020744_1975_3066 356
435 3300047470 Ga0495681_0006054 Ga0495681_0006054_6697_7791 356
436 3300047470 Ga0495681_0008793 Ga0495681_0008793_260_1354 356
437 3300047471 Ga0495684_0072934 Ga0495684_0072934_122_1213 356
438 3300047472 Ga0495686_0000348 Ga0495686_0000348_62000_63088 356
439 3300047472 Ga0495686_0002782 Ga0495686_0002782_8478_9572 356
440 3300047472 Ga0495686_0039357 Ga0495686_0039357_1389_2480 356
441 3300047673 Ga0495593_0003174 Ga0495593_0003174_110_1204 356
442 3300047673 Ga0495593_0044428 Ga0495593_0044428_702_1793 356
443 3300047673 Ga0495593_0138861 Ga0495593_0138861_102_1193 356
444 3300048088 Ga0495602_0007151 Ga0495602_0007151_8712_9803 356
445 3300048088 Ga0495602_0082641 Ga0495602_0082641_225_1316 356
446 3300048089 Ga0495614_0002660 Ga0495614_0002660_1498_2592 356
447 3300048089 Ga0495614_0003568 Ga0495614_0003568_5717_6808 356
448 3300048089 Ga0495614_0064463 Ga0495614_0064463_15_1106 356
449 3300048091 Ga0495626_0020457 Ga0495626_0020457_401_1495 356
450 3300048091 Ga0495626_0057527 Ga0495626_0057527_72_1166 356
451 3300048903 Ga0496100_0004815 Ga0496100_0004815_6085_7176 356
452 3300048903 Ga0496100_0006136 Ga0496100_0006136_102_1193 356
453 3300048903 Ga0496100_0075933 Ga0496100_0075933_342_1433 356
454 3300048904 Ga0496101_0002830 Ga0496101_0002830_3985_5076 356
455 3300048904 Ga0496101_0198709 Ga0496101_0198709_33_1124 356
456 3300048905 Ga0496102_0000804 Ga0496102_0000804_1205_2296 356
457 3300048905 Ga0496102_0001746 Ga0496102_0001746_1867_2961 356
458 3300048905 Ga0496102_0019041 Ga0496102_0019041_3378_4469 356
459 3300048905 Ga0496102_0077835 Ga0496102_0077835_225_1316 356
460 3300048905 Ga0496102_0089820 Ga0496102_0089820_1496_2587 356
461 3300048905 Ga0496102_0198401 Ga0496102_0198401_101_1195 356
462 3300048906 Ga0496103_0001211 Ga0496103_0001211_13521_14612 356
463 3300048906 Ga0496103_0015187 Ga0496103_0015187_1573_2664 356
464 3300048906 Ga0496103_0022313 Ga0496103_0022313_2112_3221 356
465 3300048906 Ga0496103_0083790 Ga0496103_0083790_598_1689 356
466 3300048907 Ga0496104_0317911 Ga0496104_0317911_59_1150 356
467 3300048909 Ga0496106_0000083 Ga0496106_0000083_15790_16881 356
468 3300048909 Ga0496106_0086659 Ga0496106_0086659_1034_2125 356
469 3300048910 Ga0496107_0010102 Ga0496107_0010102_2613_3704 356
470 3300048912 Ga0496109_0031795 Ga0496109_0031795_3428_4519 356
471 3300048913 Ga0496110_0017713 Ga0496110_0017713_1957_3048 356
472 3300048914 Ga0496111_0126519 Ga0496111_0126519_546_1640 356
473 3300048914 Ga0496111_0137926 Ga0496111_0137926_606_1697 356
474 3300048915 Ga0496112_0006936 Ga0496112_0006936_3083_4174 356
475 3300048915 Ga0496112_0030657 Ga0496112_0030657_2882_3973 356
476 3300048915 Ga0496112_0089836 Ga0496112_0089836_1288_2379 356
477 3300048916 Ga0496113_0056647 Ga0496113_0056647_658_1749 356
478 3300048916 Ga0496113_0197208 Ga0496113_0197208_186_1277 356
479 3300048920 Ga0496117_0000001 Ga0496117_0000001_1912974_1914068 356
480 3300048920 Ga0496117_0000524 Ga0496117_0000524_59166_60257 356
481 3300048920 Ga0496117_0031107 Ga0496117_0031107_2298_3389 356
482 3300048920 Ga0496117_0032959 Ga0496117_0032959_1065_2156 356
483 3300048921 Ga0496118_0000008 Ga0496118_0000008_31267_32361 356
484 3300048921 Ga0496118_0000495 Ga0496118_0000495_5282_6373 356
485 3300048921 Ga0496118_0016310 Ga0496118_0016310_4531_5622 356
486 3300048921 Ga0496118_0018668 Ga0496118_0018668_2766_3857 356
487 3300048921 Ga0496118_0029594 Ga0496118_0029594_1734_2825 356
488 3300048921 Ga0496118_0041496 Ga0496118_0041496_93_1184 356
489 3300048921 Ga0496118_0079849 Ga0496118_0079849_878_1969 356
490 3300048924 Ga0496121_0001969 Ga0496121_0001969_6972_8063 356
491 3300048924 Ga0496121_0002626 Ga0496121_0002626_21682_22773 356
492 3300048924 Ga0496121_0004727 Ga0496121_0004727_3007_4098 356
493 3300048924 Ga0496121_0007566 Ga0496121_0007566_11346_12437 356
494 3300048924 Ga0496121_0021219 Ga0496121_0021219_96_1187 356
495 3300048924 Ga0496121_0030135 Ga0496121_0030135_2785_3876 356
496 3300048924 Ga0496121_0152013 Ga0496121_0152013_322_1413 356
497 3300048925 Ga0496122_0011407 Ga0496122_0011407_5716_6807 356
498 3300048925 Ga0496122_0019133 Ga0496122_0019133_119_1213 356
499 3300048925 Ga0496122_0033707 Ga0496122_0033707_1949_3040 356
500 3300048925 Ga0496122_0132691 Ga0496122_0132691_454_1548 356
501 3300048926 Ga0496123_0007082 Ga0496123_0007082_2365_3459 356
502 3300048926 Ga0496123_0007411 Ga0496123_0007411_7927_9021 356
503 3300048927 Ga0496124_0014034 Ga0496124_0014034_6198_7289 356
504 3300048927 Ga0496124_0042297 Ga0496124_0042297_78_1172 356
505 3300048927 Ga0496124_0081500 Ga0496124_0081500_974_2065 356
506 3300048928 Ga0496125_0025416 Ga0496125_0025416_955_2046 356
507 3300048928 Ga0496125_0149864 Ga0496125_0149864_338_1429 356
508 3300048929 Ga0496126_0000032 Ga0496126_0000032_204682_205773 356
509 3300048929 Ga0496126_0003005 Ga0496126_0003005_13792_14883 356
510 3300048929 Ga0496126_0005317 Ga0496126_0005317_5999_7090 356
511 3300048929 Ga0496126_0006439 Ga0496126_0006439_7850_8941 356
512 3300048929 Ga0496126_0031317 Ga0496126_0031317_3177_4307 356
513 3300049460 Ga0495682_0005062 Ga0495682_0005062_1474_2565 356
514 3300049766 Ga0501269_000568 Ga0501269_000568_4958_6052 356
515 3300049775 Ga0501279_003201 Ga0501279_003201_835_1929 356
516 3300049775 Ga0501279_007334 Ga0501279_007334_281_1375 356
517 3300049822 Ga0501035_0008356 Ga0501035_0008356_5596_6687 356
518 3300050496 nmdc:mga07m45_332_c1 nmdc:mga07m45_332_c1_3100_4176 356
519 3300053125 Ga0500618_009034 Ga0500618_009034_1458_2546 356
520 3300061719 Ga0466962_0001449 Ga0466962_0001449_272_1363 356
521 3300061719 Ga0466962_0001737 Ga0466962_0001737_925_2016 356
522 3300003187 JGI25151J46595_10028913 JGI25151J46595_100289132 357
523 3300003771 Ga0055526_1001331 Ga0055526_100133113 357
524 3300003792 Ga0055540_1015007 Ga0055540_10150073 357
525 3300005355 Ga0070671_100041440 Ga0070671_1000414405 357
526 3300005455 Ga0070663_100000305 Ga0070663_1000003059 357
527 3300005456 Ga0070678_100136361 Ga0070678_1001363612 357
528 3300005459 Ga0068867_100003899 Ga0068867_1000038994 357
529 3300005549 Ga0070704_100272532 Ga0070704_1002725321 357
530 3300005578 Ga0068854_100203477 Ga0068854_1002034772 357
531 3300005842 Ga0068858_100221396 Ga0068858_1002213961 357
532 3300005937 Ga0081455_10094358 Ga0081455_100943582 357
533 3300006042 Ga0075368_10032173 Ga0075368_100321731 357
534 3300006048 Ga0075363_100000866 Ga0075363_1000008662 357
535 3300006051 Ga0075364_10022977 Ga0075364_100229772 357
536 3300006051 Ga0075364_10025570 Ga0075364_100255704 357
537 3300006177 Ga0075362_10005165 Ga0075362_100051652 357
538 3300006178 Ga0075367_10023082 Ga0075367_100230822 357
539 3300006178 Ga0075367_10084050 Ga0075367_100840502 357
540 3300006195 Ga0075366_10001156 Ga0075366_100011564 357
541 3300006195 Ga0075366_10018664 Ga0075366_100186642 357
542 3300006195 Ga0075366_10027288 Ga0075366_100272882 357
543 3300006353 Ga0075370_10000326 Ga0075370_100003264 357
544 3300006353 Ga0075370_10001766 Ga0075370_100017663 357
545 3300006353 Ga0075370_10002642 Ga0075370_100026422 357
546 3300006944 Ga0099823_1000985 Ga0099823_100098510 357
547 3300009093 Ga0105240_10003889 Ga0105240_1000388917 357
548 3300009093 Ga0105240_10110953 Ga0105240_101109532 357
549 3300009094 Ga0111539_10062315 Ga0111539_100623153 357
550 3300009147 Ga0114129_10057890 Ga0114129_100578904 357
551 3300009148 Ga0105243_10057175 Ga0105243_100571752 357
552 3300009148 Ga0105243_10115223 Ga0105243_101152232 357
553 3300009545 Ga0105237_10010664 Ga0105237_100106644 357
554 3300009545 Ga0105237_10046192 Ga0105237_100461922 357
555 3300009551 Ga0105238_10016518 Ga0105238_100165182 357
556 3300009553 Ga0105249_10378957 Ga0105249_103789571 357
557 3300010375 Ga0105239_10000366 Ga0105239_1000036655 357
558 3300011119 Ga0105246_10150949 Ga0105246_101509491 357
559 3300013297 Ga0157378_10022412 Ga0157378_100224124 357
560 3300013297 Ga0157378_10196957 Ga0157378_101969572 357
561 3300013306 Ga0163162_10014327 Ga0163162_100143274 357
562 3300013306 Ga0163162_10115905 Ga0163162_101159052 357
563 3300013308 Ga0157375_10145408 Ga0157375_101454082 357
564 3300013308 Ga0157375_10165477 Ga0157375_101654772 357
565 3300013308 Ga0157375_10457343 Ga0157375_104573431 357
566 3300014326 Ga0157380_10027607 Ga0157380_100276074 357
567 3300014968 Ga0157379_10007711 Ga0157379_100077112 357
568 3300014969 Ga0157376_10013067 Ga0157376_100130671 357
569 3300014969 Ga0157376_10131397 Ga0157376_101313971 357
570 3300015683 Ga0183362_10001 Ga0183362_1000182 357
571 3300017792 Ga0163161_10070470 Ga0163161_100704702 357
572 3300025273 Ga0209673_1005752 Ga0209673_10057524 357
573 3300025273 Ga0209673_1007796 Ga0209673_10077964 357
574 3300025295 Ga0209564_1000003 Ga0209564_10000031347 357
575 3300025299 Ga0209256_1006842 Ga0209256_10068425 357
576 3300025303 Ga0209051_1003352 Ga0209051_10033526 357
577 3300025304 Ga0209257_1001931 Ga0209257_10019312 357
578 3300025315 Ga0207697_10006462 Ga0207697_100064624 357
579 3300025893 Ga0207682_10001232 Ga0207682_100012327 357
580 3300025901 Ga0207688_10007576 Ga0207688_100075762 357
581 3300025908 Ga0207643_10029178 Ga0207643_100291783 357
582 3300025913 Ga0207695_10152276 Ga0207695_101522762 357
583 3300025914 Ga0207671_10010367 Ga0207671_100103677 357
584 3300025918 Ga0207662_10018159 Ga0207662_100181594 357
585 3300025925 Ga0207650_10029250 Ga0207650_100292502 357
586 3300025933 Ga0207706_10005729 Ga0207706_100057293 357
587 3300025933 Ga0207706_10009403 Ga0207706_100094034 357
588 3300025933 Ga0207706_10009658 Ga0207706_100096588 357
589 3300025941 Ga0207711_10004990 Ga0207711_100049906 357
590 3300025941 Ga0207711_10069096 Ga0207711_100690962 357
591 3300025949 Ga0207667_10212257 Ga0207667_102122572 357
592 3300025981 Ga0207640_10030172 Ga0207640_100301722 357
593 3300025981 Ga0207640_10057661 Ga0207640_100576614 357
594 3300026023 Ga0207677_10054457 Ga0207677_100544572 357
595 3300026067 Ga0207678_10001071 Ga0207678_1000107118 357
596 3300026075 Ga0207708_10036835 Ga0207708_100368354 357
597 3300026089 Ga0207648_10044589 Ga0207648_100445892 357
598 3300026116 Ga0207674_10011524 Ga0207674_100115247 357
599 3300026116 Ga0207674_10026126 Ga0207674_100261262 357
600 3300026118 Ga0207675_100005635 Ga0207675_1000056354 357
601 3300026121 Ga0207683_10066054 Ga0207683_100660542 357
602 3300026121 Ga0207683_10214809 Ga0207683_102148092 357
603 3300026142 Ga0207698_10078042 Ga0207698_100780422 357
604 3300026142 Ga0207698_10093741 Ga0207698_100937412 357
605 3300026142 Ga0207698_10131537 Ga0207698_101315372 357
606 3300027866 Ga0209813_10015332 Ga0209813_100153322 357
607 3300028577 Ga0265318_10006724 Ga0265318_100067244 357
608 3300028794 Ga0307515_10000265 Ga0307515_1000026599 357
609 3300028794 Ga0307515_10208759 Ga0307515_102087591 357
610 3300030731 Ga0316177_1019555 Ga0316177_10195552 357
611 3300030732 Ga0316176_1074634 Ga0316176_10746341 357
612 3300030744 Ga0316181_1030642 Ga0316181_10306422 357
613 3300031239 Ga0265328_10002006 Ga0265328_100020068 357
614 3300031250 Ga0265331_10001587 Ga0265331_1000158712 357
615 3300031711 Ga0265314_10003409 Ga0265314_1000340911 357
616 3300037312 Ga0395899_0001141 Ga0395899_0001141_6111_7214 357
617 3300037418 Ga0395900_0000054 Ga0395900_0000054_102884_103978 357
618 3300037418 Ga0395900_0013213 Ga0395900_0013213_4816_5919 357
619 3300037466 Ga0395898_0004344 Ga0395898_0004344_9284_10378 357
620 3300037466 Ga0395898_0014059 Ga0395898_0014059_4346_5449 357
621 3300037471 Ga0395905_0001910 Ga0395905_0001910_150_1253 357
622 3300037471 Ga0395905_0007546 Ga0395905_0007546_5175_6278 357
623 3300038742 Ga0400486_09343 Ga0400486_09343_7813_8895 357
624 3300039062 Ga0400483_083197 Ga0400483_083197_25983_27065 357
625 3300039447 Ga0436361_0796155 Ga0436361_0796155_7289_8383 357
626 3300044656 Ga0466969_0012113 Ga0466969_0012113_979_2073 357
627 3300044658 Ga0466972_0002680 Ga0466972_0002680_4994_6088 357
628 3300044683 Ga0466965_0003407 Ga0466965_0003407_2792_3886 357
629 3300044684 Ga0466966_0018078 Ga0466966_0018078_2742_3845 357
630 3300044693 Ga0466961_0029845 Ga0466961_0029845_1265_2359 357
631 3300044694 Ga0466963_0005576 Ga0466963_0005576_3040_4134 357
632 3300044706 Ga0466964_0012450 Ga0466964_0012450_462_1556 357
633 3300044712 Ga0453684_0042955 Ga0453684_0042955_4571_5662 357
634 3300044719 Ga0466971_0023044 Ga0466971_0023044_138_1232 357
635 3300044735 Ga0466968_0012277 Ga0466968_0012277_141_1235 357
636 3300044901 Ga0466960_0069588 Ga0466960_0069588_240_1343 357
637 3300045049 Ga0466959_0000635 Ga0466959_0000635_7304_8398 357
638 3300045049 Ga0466959_0055317 Ga0466959_0055317_1614_2717 357
639 3300045051 Ga0451576_0218773 Ga0451576_0218773_491_1582 357
640 3300046457 Ga0495590_0056971 Ga0495590_0056971_256_1353 357
641 3300046519 Ga0495632_0053877 Ga0495632_0053877_366_1463 357
642 3300046648 Ga0495611_0038400 Ga0495611_0038400_991_2088 357
643 3300046660 Ga0495625_0025583 Ga0495625_0025583_3175_4272 357
644 3300046665 Ga0495661_0005989 Ga0495661_0005989_16_1119 357
645 3300046692 Ga0495671_0005046 Ga0495671_0005046_6251_7360 357
646 3300046694 Ga0495649_0038398 Ga0495649_0038398_680_1777 357
647 3300047443 Ga0495687_002698 Ga0495687_002698_4944_6038 357
648 3300047443 Ga0495687_009753 Ga0495687_009753_3214_4311 357
649 3300048905 Ga0496102_0014774 Ga0496102_0014774_4778_5872 357
650 3300048908 Ga0496105_0035637 Ga0496105_0035637_1217_2320 357
651 3300048909 Ga0496106_0139795 Ga0496106_0139795_129_1232 357
652 3300048911 Ga0496108_0050423 Ga0496108_0050423_2316_3419 357
653 3300048914 Ga0496111_0028699 Ga0496111_0028699_1893_2996 357
654 3300048915 Ga0496112_0028443 Ga0496112_0028443_3182_4315 357
655 3300048916 Ga0496113_0043267 Ga0496113_0043267_1729_2862 357
656 3300048919 Ga0496116_0027970 Ga0496116_0027970_156_1250 357
657 3300048919 Ga0496116_0114370 Ga0496116_0114370_319_1413 357
658 3300048920 Ga0496117_0018774 Ga0496117_0018774_4444_5538 357
659 3300048920 Ga0496117_0130393 Ga0496117_0130393_80_1174 357
660 3300048924 Ga0496121_0000776 Ga0496121_0000776_15279_16373 357
661 3300048924 Ga0496121_0020186 Ga0496121_0020186_3345_4439 357
662 3300048925 Ga0496122_0000254 Ga0496122_0000254_117536_118630 357
663 3300048925 Ga0496122_0071194 Ga0496122_0071194_1341_2435 357
664 3300048926 Ga0496123_0001681 Ga0496123_0001681_1513_2607 357
665 3300048926 Ga0496123_0066778 Ga0496123_0066778_737_1831 357
666 3300048927 Ga0496124_0000004 Ga0496124_0000004_14934_16028 357
667 3300048927 Ga0496124_0115607 Ga0496124_0115607_331_1425 357
668 3300048928 Ga0496125_0000042 Ga0496125_0000042_165824_166918 357
669 3300049568 Ga0501031_0133431 Ga0501031_0133431_517_1611 357
670 3300049572 Ga0501036_0168657 Ga0501036_0168657_288_1382 357
671 3300049573 Ga0501037_0035337 Ga0501037_0035337_871_1965 357
672 3300050489 nmdc:mga03683_44243_c1 nmdc:mga03683_44243_c1_199_1293 357
673 3300050491 nmdc:mga00v17_142282_c1 nmdc:mga00v17_142282_c1_80_1174 357
674 3300050493 nmdc:mga0k408_11748_c1 nmdc:mga0k408_11748_c1_1589_2683 357
675 3300050493 nmdc:mga0k408_25018_c1 nmdc:mga0k408_25018_c1_1722_2816 357
676 3300050493 nmdc:mga0k408_298_c1 nmdc:mga0k408_298_c1_10018_11115 357
677 3300050493 nmdc:mga0k408_34295_c1 nmdc:mga0k408_34295_c1_146_1243 357
678 3300050493 nmdc:mga0k408_791_c1 nmdc:mga0k408_791_c1_9776_10870 357
679 3300050493 nmdc:mga0k408_86937_c1 nmdc:mga0k408_86937_c1_357_1454 357
680 3300050495 nmdc:mga04h51_13634_c1 nmdc:mga04h51_13634_c1_1088_2182 357
681 3300050496 nmdc:mga07m45_151358_c1 nmdc:mga07m45_151358_c1_167_1264 357
682 3300050496 nmdc:mga07m45_174548_c1 nmdc:mga07m45_174548_c1_20_1114 357
683 3300050496 nmdc:mga07m45_24148_c1 nmdc:mga07m45_24148_c1_492_1586 357
684 3300050496 nmdc:mga07m45_410_c1 nmdc:mga07m45_410_c1_1906_3000 357
685 3300050496 nmdc:mga07m45_4482_c1 nmdc:mga07m45_4482_c1_4234_5331 357
686 3300050496 nmdc:mga07m45_610_c1 nmdc:mga07m45_610_c1_9878_10975 357
687 3300050507 nmdc:mga05p37_131854_c1 nmdc:mga05p37_131854_c1_1456_2550 357
688 3300050511 nmdc:mga08y16_199641_c1 nmdc:mga08y16_199641_c1_267_1361 357
689 3300050511 nmdc:mga08y16_49132_c1 nmdc:mga08y16_49132_c1_2655_3731 357
690 3300053086 Ga0500578_0088218 Ga0500578_0088218_536_1630 357
691 3300053730 Ga0500645_003628 Ga0500645_003628_317_1411 357
692 3300061719 Ga0466962_0011034 Ga0466962_0011034_473_1567 357
693 3300061719 Ga0466962_0047359 Ga0466962_0047359_610_1713 357
694 3300003203 JGI25406J46586_10002230 JGI25406J46586_100022304 358
695 3300005328 Ga0070676_10000988 Ga0070676_100009889 358
696 3300005334 Ga0068869_100016264 Ga0068869_1000162642 358
697 3300005335 Ga0070666_10001990 Ga0070666_100019903 358
698 3300005340 Ga0070689_100013590 Ga0070689_1000135905 358
699 3300005347 Ga0070668_100012610 Ga0070668_1000126106 358
700 3300005354 Ga0070675_100024778 Ga0070675_1000247782 358
701 3300005356 Ga0070674_100111794 Ga0070674_1001117941 358
702 3300005364 Ga0070673_100001549 Ga0070673_1000015497 358
703 3300005364 Ga0070673_100028508 Ga0070673_1000285082 358
704 3300005367 Ga0070667_100115702 Ga0070667_1001157022 358
705 3300005456 Ga0070678_100001068 Ga0070678_10000106810 358
706 3300005459 Ga0068867_100001735 Ga0068867_10000173511 358
707 3300005471 Ga0070698_100046097 Ga0070698_1000460972 358
708 3300005543 Ga0070672_100003763 Ga0070672_1000037635 358
709 3300005548 Ga0070665_100005754 Ga0070665_1000057547 358
710 3300005563 Ga0068855_100168393 Ga0068855_1001683932 358
711 3300005614 Ga0068856_100297940 Ga0068856_1002979402 358
712 3300005617 Ga0068859_100016536 Ga0068859_1000165362 358
713 3300005617 Ga0068859_100151990 Ga0068859_1001519901 358
714 3300005618 Ga0068864_100002543 Ga0068864_10000254315 358
715 3300005834 Ga0068851_10048420 Ga0068851_100484202 358
716 3300005841 Ga0068863_100005626 Ga0068863_1000056263 358
717 3300005842 Ga0068858_100001792 Ga0068858_1000017929 358
718 3300005842 Ga0068858_100115186 Ga0068858_1001151862 358
719 3300005843 Ga0068860_100001537 Ga0068860_10000153712 358
720 3300005844 Ga0068862_100027273 Ga0068862_1000272732 358
721 3300005844 Ga0068862_100037792 Ga0068862_1000377923 358
722 3300005985 Ga0081539_10000013 Ga0081539_10000013246 358
723 3300005985 Ga0081539_10011451 Ga0081539_100114512 358
724 3300006358 Ga0068871_100001990 Ga0068871_1000019905 358
725 3300006358 Ga0068871_100016365 Ga0068871_1000163652 358
726 3300006881 Ga0068865_100009716 Ga0068865_1000097162 358
727 3300006931 Ga0097620_100016535 Ga0097620_1000165352 358
728 3300006931 Ga0097620_100151984 Ga0097620_1001519843 358
729 3300009094 Ga0111539_10035448 Ga0111539_100354486 358
730 3300009098 Ga0105245_10000358 Ga0105245_1000035823 358
731 3300009098 Ga0105245_10025288 Ga0105245_100252885 358
732 3300009098 Ga0105245_10054046 Ga0105245_100540461 358
733 3300009098 Ga0105245_10260960 Ga0105245_102609602 358
734 3300009098 Ga0105245_10354457 Ga0105245_103544572 358
735 3300009101 Ga0105247_10010457 Ga0105247_100104574 358
736 3300009101 Ga0105247_10060564 Ga0105247_100605642 358
737 3300009101 Ga0105247_10110743 Ga0105247_101107431 358
738 3300009147 Ga0114129_10084138 Ga0114129_100841383 358
739 3300009147 Ga0114129_10171110 Ga0114129_101711104 358
740 3300009148 Ga0105243_10086629 Ga0105243_100866292 358
741 3300009176 Ga0105242_10023140 Ga0105242_100231402 358
742 3300009176 Ga0105242_10253015 Ga0105242_102530152 358
743 3300009177 Ga0105248_10010615 Ga0105248_100106158 358
744 3300009177 Ga0105248_10027737 Ga0105248_100277375 358
745 3300009177 Ga0105248_10053488 Ga0105248_100534883 358
746 3300009177 Ga0105248_10140656 Ga0105248_101406562 358
747 3300009177 Ga0105248_10182585 Ga0105248_101825851 358
748 3300009553 Ga0105249_10012011 Ga0105249_100120116 358
749 3300009553 Ga0105249_10212544 Ga0105249_102125441 358
750 3300009553 Ga0105249_10415242 Ga0105249_104152422 358
751 3300011119 Ga0105246_10075538 Ga0105246_100755382 358
752 3300011119 Ga0105246_10280340 Ga0105246_102803401 358
753 3300013104 Ga0157370_10023394 Ga0157370_100233942 358
754 3300013104 Ga0157370_10281064 Ga0157370_102810641 358
755 3300013104 Ga0157370_10286837 Ga0157370_102868371 358
756 3300013296 Ga0157374_10002680 Ga0157374_1000268012 358
757 3300013296 Ga0157374_10014722 Ga0157374_100147225 358
758 3300013296 Ga0157374_10219454 Ga0157374_102194541 358
759 3300013297 Ga0157378_10073012 Ga0157378_100730121 358
760 3300013297 Ga0157378_10073621 Ga0157378_100736211 358
761 3300013306 Ga0163162_10000874 Ga0163162_100008747 358
762 3300013306 Ga0163162_10040114 Ga0163162_100401141 358
763 3300013306 Ga0163162_10045027 Ga0163162_100450274 358
764 3300013306 Ga0163162_10046883 Ga0163162_100468832 358
765 3300013306 Ga0163162_10110970 Ga0163162_101109702 358
766 3300013306 Ga0163162_10190315 Ga0163162_101903152 358
767 3300013307 Ga0157372_10020695 Ga0157372_100206952 358
768 3300013307 Ga0157372_10134547 Ga0157372_101345471 358
769 3300013308 Ga0157375_10002680 Ga0157375_100026808 358
770 3300013308 Ga0157375_10315094 Ga0157375_103150941 358
771 3300013308 Ga0157375_10450862 Ga0157375_104508622 358
772 3300013308 Ga0157375_10514553 Ga0157375_105145532 358
773 3300013308 Ga0157375_10530653 Ga0157375_105306531 358
774 3300014325 Ga0163163_10004930 Ga0163163_100049307 358
775 3300014325 Ga0163163_10022124 Ga0163163_100221244 358
776 3300014325 Ga0163163_10059999 Ga0163163_100599992 358
777 3300014325 Ga0163163_10078197 Ga0163163_100781972 358
778 3300014325 Ga0163163_10140690 Ga0163163_101406902 358
779 3300014325 Ga0163163_10255595 Ga0163163_102555951 358
780 3300014326 Ga0157380_10077987 Ga0157380_100779872 358
781 3300014745 Ga0157377_10001448 Ga0157377_100014487 358
782 3300014968 Ga0157379_10009027 Ga0157379_100090272 358
783 3300014968 Ga0157379_10016512 Ga0157379_100165123 358
784 3300014968 Ga0157379_10020826 Ga0157379_100208264 358
785 3300014969 Ga0157376_10020343 Ga0157376_100203435 358
786 3300014969 Ga0157376_10150952 Ga0157376_101509522 358
787 3300025907 Ga0207645_10002076 Ga0207645_100020769 358
788 3300025907 Ga0207645_10039500 Ga0207645_100395001 358
789 3300025908 Ga0207643_10011643 Ga0207643_100116432 358
790 3300025918 Ga0207662_10174300 Ga0207662_101743002 358
791 3300025923 Ga0207681_10025718 Ga0207681_100257182 358
792 3300025925 Ga0207650_10173856 Ga0207650_101738562 358
793 3300025931 Ga0207644_10069583 Ga0207644_100695832 358
794 3300025936 Ga0207670_10072199 Ga0207670_100721992 358
795 3300025937 Ga0207669_10083766 Ga0207669_100837662 358
796 3300025940 Ga0207691_10000560 Ga0207691_1000056022 358
797 3300025941 Ga0207711_10044576 Ga0207711_100445762 358
798 3300025941 Ga0207711_10122871 Ga0207711_101228712 358
799 3300025942 Ga0207689_10000354 Ga0207689_100003542 358
800 3300025942 Ga0207689_10010118 Ga0207689_100101183 358
801 3300025960 Ga0207651_10135151 Ga0207651_101351511 358
802 3300025972 Ga0207668_10008553 Ga0207668_100085533 358
803 3300025972 Ga0207668_10117769 Ga0207668_101177692 358
804 3300025986 Ga0207658_10014187 Ga0207658_100141871 358
805 3300026035 Ga0207703_10008714 Ga0207703_100087144 358
806 3300026078 Ga0207702_10166875 Ga0207702_101668752 358
807 3300026088 Ga0207641_10001267 Ga0207641_1000126717 358
808 3300026089 Ga0207648_10000715 Ga0207648_1000071522 358
809 3300026095 Ga0207676_10002448 Ga0207676_100024486 358
810 3300026118 Ga0207675_100046280 Ga0207675_1000462802 358
811 3300026121 Ga0207683_10000219 Ga0207683_1000021926 358
812 3300026121 Ga0207683_10078408 Ga0207683_100784082 358
813 3300028380 Ga0268265_10030331 Ga0268265_100303312 358
814 3300028381 Ga0268264_10002307 Ga0268264_1000230713 358
815 3300028381 Ga0268264_10012192 Ga0268264_100121925 358
816 3300031251 Ga0265327_10001663 Ga0265327_1000166316 358
817 3300032002 Ga0307416_100054240 Ga0307416_1000542402 358
818 3300035086 Ga0373934_0012312 Ga0373934_0012312_700_1779 358
819 3300035119 Ga0373956_0013846 Ga0373956_0013846_351_1430 358
820 3300035120 Ga0373957_0012296 Ga0373957_0012296_1424_2503 358
821 3300035172 Ga0373955_0008896 Ga0373955_0008896_1197_2276 358
822 3300035410 Ga0373924_0005899 Ga0373924_0005899_2171_3253 358
823 3300035410 Ga0373924_0021947 Ga0373924_0021947_1377_2456 358
824 3300035691 Ga0373931_0044034 Ga0373931_0044034_736_1827 358
825 3300036401 Ga0373937_0217664 Ga0373937_0217664_477_1556 358
826 3300037068 Ga0373925_0096098 Ga0373925_0096098_815_1894 358
827 3300042876 Ga0451577_0136449 Ga0451577_0136449_335_1426 358
828 3300046472 Ga0495580_0067107 Ga0495580_0067107_1058_2137 358
829 3300046536 Ga0495587_0042164 Ga0495587_0042164_773_1852 358
830 3300046539 Ga0495621_0006269 Ga0495621_0006269_904_2004 358
831 3300046543 Ga0495645_0054880 Ga0495645_0054880_1451_2530 358
832 3300047444 Ga0495675_0050000 Ga0495675_0050000_1565_2644 358
833 3300048904 Ga0496101_0021276 Ga0496101_0021276_1346_2425 358
834 3300048904 Ga0496101_0057448 Ga0496101_0057448_1042_2142 358
835 3300048906 Ga0496103_0019714 Ga0496103_0019714_646_1728 358
836 3300048907 Ga0496104_0076050 Ga0496104_0076050_1393_2493 358
837 3300048908 Ga0496105_0153329 Ga0496105_0153329_104_1204 358
838 3300048909 Ga0496106_0025544 Ga0496106_0025544_190_1269 358
839 3300048909 Ga0496106_0094575 Ga0496106_0094575_662_1741 358
840 3300048909 Ga0496106_0278597 Ga0496106_0278597_81_1181 358
841 3300048910 Ga0496107_0023423 Ga0496107_0023423_1472_2572 358
842 3300048911 Ga0496108_0032539 Ga0496108_0032539_512_1594 358
843 3300048912 Ga0496109_0018010 Ga0496109_0018010_1418_2518 358
844 3300048912 Ga0496109_0065547 Ga0496109_0065547_1625_2707 358
845 3300048912 Ga0496109_0241597 Ga0496109_0241597_213_1304 358
846 3300048913 Ga0496110_0026955 Ga0496110_0026955_1134_2234 358
847 3300048915 Ga0496112_0077375 Ga0496112_0077375_1824_2915 358
848 3300048917 Ga0496114_0010260 Ga0496114_0010260_4921_6021 358
849 3300048917 Ga0496114_0024932 Ga0496114_0024932_3483_4574 358
850 3300048918 Ga0496115_0025753 Ga0496115_0025753_614_1693 358
851 3300049571 Ga0501034_0004348 Ga0501034_0004348_7234_8328 358
852 3300049573 Ga0501037_0086222 Ga0501037_0086222_710_1801 358
853 3300049575 Ga0501039_0017413 Ga0501039_0017413_4031_5149 358
854 3300049575 Ga0501039_0331448 Ga0501039_0331448_49_1128 358
855 3300049577 Ga0501041_0039883 Ga0501041_0039883_92_1216 358
856 3300049578 Ga0501042_0056816 Ga0501042_0056816_857_1975 358
857 3300049587 Ga0501071_0013247 Ga0501071_0013247_1858_2949 358
858 3300049589 Ga0501073_0046711 Ga0501073_0046711_1053_2144 358
859 3300049590 Ga0501074_0047894 Ga0501074_0047894_288_1406 358
860 3300049591 Ga0501075_0014198 Ga0501075_0014198_2226_3317 358
861 3300049592 Ga0501076_0019023 Ga0501076_0019023_1481_2599 358
862 3300049741 Ga0501079_0014077 Ga0501079_0014077_1355_2473 358
863 3300049741 Ga0501079_0018633 Ga0501079_0018633_3696_4787 358
864 3300049742 Ga0501080_0003496 Ga0501080_0003496_4132_5223 358
865 3300049822 Ga0501035_0197095 Ga0501035_0197095_191_1282 358
866 3300049824 Ga0501045_0008546 Ga0501045_0008546_3723_4841 358
867 3300050507 nmdc:mga05p37_17046_c1 nmdc:mga05p37_17046_c1_1261_2379 358
868 3300050507 nmdc:mga05p37_277915_c1 nmdc:mga05p37_277915_c1_790_1908 358
869 3300050508 nmdc:mga09592_16417_c1 nmdc:mga09592_16417_c1_1861_2979 358
870 3300050508 nmdc:mga09592_36495_c1 nmdc:mga09592_36495_c1_1185_2303 358
871 3300050510 nmdc:mga06r32_43165_c1 nmdc:mga06r32_43165_c1_149_1267 358
872 3300050511 nmdc:mga08y16_245589_c1 nmdc:mga08y16_245589_c1_624_1724 358
873 3300050511 nmdc:mga08y16_388305_c1 nmdc:mga08y16_388305_c1_143_1270 358
874 3300050512 nmdc:mga0n895_129951_c1 nmdc:mga0n895_129951_c1_394_1482 358
875 3300050515 nmdc:mga0a205_154048_c1 nmdc:mga0a205_154048_c1_308_1435 358
876 3300053077 Ga0495601_0077856 Ga0495601_0077856_283_1362 358
877 3300053096 Ga0500641_0039912 Ga0500641_0039912_17_1105 358
878 3300053729 Ga0500625_012178 Ga0500625_012178_2392_3486 358
879 3300054114 Ga0501084_0007225 Ga0501084_0007225_4580_5698 358
880 3300054114 Ga0501084_0028916 Ga0501084_0028916_1108_2199 358
881 3300061734 Ga0530510_0035073 Ga0530510_0035073_2411_3529 358
882 3300042010 Ga0439452_001971 Ga0439452_001971_510_1589 359
883 3300046453 Ga0495627_000083 Ga0495627_000083_85509_86588 359
884 3300046458 Ga0495591_000037 Ga0495591_000037_30463_31542 359
885 3300046458 Ga0495591_002170 Ga0495591_002170_10142_11221 359
886 3300046474 Ga0495605_0015538 Ga0495605_0015538_682_1761 359
887 3300046501 Ga0495607_0001076 Ga0495607_0001076_8498_9577 359
888 3300046501 Ga0495607_0001388 Ga0495607_0001388_709_1788 359
889 3300047320 Ga0495672_0029549 Ga0495672_0029549_570_1679 359
890 3300048920 Ga0496117_0005871 Ga0496117_0005871_38_1117 359
891 3300048925 Ga0496122_0009618 Ga0496122_0009618_8295_9374 359
892 3300048926 Ga0496123_0001037 Ga0496123_0001037_15366_16445 359
893 3300050491 nmdc:mga00v17_86679_c1 nmdc:mga00v17_86679_c1_137_1237 359
894 3300050512 nmdc:mga0n895_6286_c1 nmdc:mga0n895_6286_c1_6546_7640 359
895 3300050515 nmdc:mga0a205_27430_c1 nmdc:mga0a205_27430_c1_3110_4204 359
896 iso_pu_bacteria 2508501125 2509130933 362
897 iso_pu_bacteria 2510065045 2510248201 362
898 iso_pu_bacteria 2510917013 2511087764 362
899 iso_pu_bacteria 2510917014 2511101742 362
900 iso_pu_bacteria 2510917015 2511107750 362
901 iso_pu_bacteria 2512047030 2512349870 362
902 iso_pu_bacteria 2513237082 2513553474 362
903 iso_pu_bacteria 2513237083 2513559600 362
904 iso_pu_bacteria 2513237151 2513962743 362
905 iso_pu_bacteria 2513237166 2514054429 362
906 iso_pu_bacteria 2515154122 2515684999 362
907 iso_pu_bacteria 2515154123 2515690302 362
908 iso_pu_bacteria 2515154189 2516018037 362
909 iso_pu_bacteria 2526164713 2527079649 362
910 iso_pu_bacteria 2562617112 2563058365 362
911 iso_pu_bacteria 2582581311 2585290192 362
912 iso_pu_bacteria 2599185239 2599735399 362
913 iso_pu_bacteria 2599185240 2599748551 362
914 iso_pu_bacteria 2599185355 2600210461 362
915 iso_pu_bacteria 2600255067 2600814079 362
916 iso_pu_bacteria 2675903129 2676746642 362
917 iso_pu_bacteria 2711768613 2713475096 362
918 iso_pu_bacteria 2738541296 2738823654 362
919 iso_pu_bacteria 2738541298 2738836082 362
920 iso_pu_bacteria 2738541306 2738877612 362
921 iso_pu_bacteria 2738543002 2739189281 362
922 iso_pu_bacteria 2738543008 2739224205 362
923 iso_pu_bacteria 2744054900 2746090745 362
924 iso_pu_bacteria 2744054901 2746092394 362
925 iso_pu_bacteria 2751185846 2753567445 362
926 iso_pu_bacteria 2791355137 2792836248 362
927 iso_pu_bacteria 2816332286 2817454771 362
928 iso_pu_bacteria 2818991450 2819623812 362
929 iso_pu_bacteria 2818991452 2819630581 362
930 iso_pu_bacteria 2842324504 2842326094 362
931 iso_pu_bacteria 2842348783 2842351386 362
932 iso_pu_bacteria 2842454564 2842455414 362
933 iso_pu_bacteria 2856287931 2856289740 362
934 iso_pu_bacteria 2857357740 2857363221 362
935 iso_pu_bacteria 2863421361 2863426071 362
936 iso_pu_bacteria 2870068957 2870075028 362
937 iso_pu_bacteria 2883087390 2883088342 362
938 iso_pu_bacteria 2885270888 2885276522 362
939 iso_pu_bacteria 2900634093 2900639404 362
940 iso_pu_bacteria 2902682994 2902684030 362
941 iso_pu_bacteria 2904483920 2904490303 362
942 iso_pu_bacteria 2904564687 2904565332 362
943 iso_pu_bacteria 2904571731 2904571972 362
944 iso_pu_bacteria 2904615490 2904616079 362
945 iso_pu_bacteria 2919527303 2919533473 362
946 iso_pu_bacteria 2921643360 2921655241 362
947 iso_pu_bacteria 2928108538 2928112923 362
948 iso_pu_bacteria 2928135762 2928139852 362
949 iso_pu_bacteria 2928157003 2928157498 362
950 iso_pu_bacteria 2928163908 2928165312 362
951 iso_pu_bacteria 2928170801 2928174350 362
952 iso_pu_bacteria 2928503688 2928506986 362
953 iso_pu_bacteria 2928536128 2928537291 362
954 iso_pu_bacteria 2945934425 2945941031 362
955 iso_pu_bacteria 2981990288 2981990479 362
956 iso_pu_bacteria 2990703756 2990708075 362
957 iso_pu_bacteria 641736151 642421892 362
958 iso_pu_bacteria 642555112 642596124 362
959 iso_pu_bacteria 642555113 642617873 362
960 iso_pu_bacteria 8003955200 8003956557 362
961 iso_pu_bacteria 8018845410 8018846456 362
962 iso_pu_bacteria 8020807995 8020808445 362
963 iso_pu_bacteria 8020938398 8020944018 362
964 iso_pu_bacteria 8020945358 8020948638 362
965 iso_pu_bacteria 8020953355 8020956121 362
966 iso_pu_bacteria 8021120328 8021120887 362
967 iso_pu_bacteria 8039098773 8039100572 362
968 iso_pu_bacteria 8040167225 8040168138 362
969 iso_pu_bacteria 8040173305 8040174403 362
970 iso_pu_bacteria 8055266321 8055271019 362
971 iso_pu_bacteria 8055301274 8055307203 362
972 3300046463 Ga0495653_0020729 Ga0495653_0020729_866_1993 363
973 iso_pu_bacteria 2526164512 2526213102 363
974 iso_pu_bacteria 2547132512 2548846089 363
975 iso_pu_bacteria 2574179768 2574431033 363
976 iso_pu_bacteria 2600255292 2601667224 363
977 iso_pu_bacteria 2643221544 2643745583 363
978 iso_pu_bacteria 2643221554 2643787483 363
979 iso_pu_bacteria 2643221638 2644213999 363
980 iso_pu_bacteria 2643221664 2644356911 363
981 iso_pu_bacteria 2738541300 2738846809 363
982 iso_pu_bacteria 2738543018 2739276976 363
983 iso_pu_bacteria 2738543030 2739346083 363
984 iso_pu_bacteria 2808606418 2809144969 363
985 iso_pu_bacteria 2821131069 2821131114 363
986 iso_pu_bacteria 2842711865 2842718182 363
987 iso_pu_bacteria 2857547612 2857552585 363
988 iso_pu_bacteria 2857553236 2857553587 363
989 iso_pu_bacteria 2857558681 2857561337 363
990 iso_pu_bacteria 2857564685 2857565229 363
991 iso_pu_bacteria 2885080285 2885085681 363
992 iso_pu_bacteria 2891633521 2891634686 363
993 iso_pu_bacteria 2919476304 2919481203 363
994 iso_pu_bacteria 2932410948 2932414898 363
995 iso_pu_bacteria 2932416698 2932419584 363
996 3300001979 JGI24740J21852_10004706 JGI24740J21852_100047062 364
997 3300001989 JGI24739J22299_10012110 JGI24739J22299_100121102 364
998 3300001989 JGI24739J22299_10015834 JGI24739J22299_100158342 364
999 3300001990 JGI24737J22298_10006638 JGI24737J22298_100066382 364
1000 3300001990 JGI24737J22298_10011636 JGI24737J22298_100116362 364
1001 3300002067 JGI24735J21928_10001818 JGI24735J21928_100018182 364
1002 3300002067 JGI24735J21928_10005308 JGI24735J21928_100053082 364
1003 3300003354 JGI25160J50197_1000124 JGI25160J50197_100012413 364
1004 3300003759 Ga0055525_1001805 Ga0055525_10018052 364
1005 3300003790 Ga0055528_1000692 Ga0055528_100069220 364
1006 3300005262 Ga0065165_1002627 Ga0065165_10026279 364
1007 3300005262 Ga0065165_1005461 Ga0065165_10054614 364
1008 3300005327 Ga0070658_10010460 Ga0070658_100104603 364
1009 3300005327 Ga0070658_10022790 Ga0070658_100227902 364
1010 3300005366 Ga0070659_100000072 Ga0070659_10000007216 364
1011 3300005366 Ga0070659_100013071 Ga0070659_1000130713 364
1012 3300005367 Ga0070667_100026791 Ga0070667_1000267913 364
1013 3300005455 Ga0070663_100001712 Ga0070663_10000171211 364
1014 3300005563 Ga0068855_100004370 Ga0068855_1000043704 364
1015 3300005563 Ga0068855_100019291 Ga0068855_1000192912 364
1016 3300006195 Ga0075366_10001005 Ga0075366_100010057 364
1017 3300006844 Ga0075428_100002002 Ga0075428_10000200211 364
1018 3300006871 Ga0075434_100265699 Ga0075434_1002656991 364
1019 3300006880 Ga0075429_100157573 Ga0075429_1001575732 364
1020 3300009094 Ga0111539_10001653 Ga0111539_1000165311 364
1021 3300013306 Ga0163162_10014382 Ga0163162_100143822 364
1022 3300013306 Ga0163162_10114283 Ga0163162_101142832 364
1023 3300016635 Ga0183361_10029 Ga0183361_1002930 364
1024 3300020070 Ga0206356_11155722 Ga0206356_111557226 364
1025 3300020081 Ga0206354_11476839 Ga0206354_114768392 364
1026 3300020082 Ga0206353_11427262 Ga0206353_114272623 364
1027 3300022467 Ga0224712_10001206 Ga0224712_100012062 364
1028 3300025226 Ga0209674_100139 Ga0209674_10013950 364
1029 3300025228 Ga0209672_100667 Ga0209672_1006675 364
1030 3300025256 Ga0209759_1000170 Ga0209759_100017050 364
1031 3300025256 Ga0209759_1000225 Ga0209759_100022561 364
1032 3300025261 Ga0209233_1000177 Ga0209233_100017750 364
1033 3300025302 Ga0207426_1000020 Ga0207426_1000020510 364
1034 3300025302 Ga0207426_1002025 Ga0207426_100202512 364
1035 3300025735 Ga0207713_1005031 Ga0207713_10050316 364
1036 3300025904 Ga0207647_10000377 Ga0207647_100003773 364
1037 3300025904 Ga0207647_10008442 Ga0207647_100084425 364
1038 3300025909 Ga0207705_10001325 Ga0207705_100013252 364
1039 3300025913 Ga0207695_10040042 Ga0207695_100400422 364
1040 3300025919 Ga0207657_10008836 Ga0207657_100088362 364
1041 3300025919 Ga0207657_10088684 Ga0207657_100886843 364
1042 3300025932 Ga0207690_10013177 Ga0207690_100131773 364
1043 3300025949 Ga0207667_10021965 Ga0207667_100219651 364
1044 3300025949 Ga0207667_10044647 Ga0207667_100446473 364
1045 3300025986 Ga0207658_10056931 Ga0207658_100569312 364
1046 3300025986 Ga0207658_10066205 Ga0207658_100662053 364
1047 3300026121 Ga0207683_10062219 Ga0207683_100622192 364
1048 3300027907 Ga0207428_10015306 Ga0207428_100153065 364
1049 3300028800 Ga0265338_10000120 Ga0265338_10000120153 364
1050 3300030083 Ga0237817_11503 Ga0237817_115031 364
1051 3300031548 Ga0307408_100006963 Ga0307408_1000069632 364
1052 3300031911 Ga0307412_10000064 Ga0307412_1000006439 364
1053 3300032002 Ga0307416_100064650 Ga0307416_1000646502 364
1054 3300032004 Ga0307414_10004874 Ga0307414_100048744 364
1055 3300032005 Ga0307411_10000234 Ga0307411_1000023421 364
1056 3300037471 Ga0395905_0001278 Ga0395905_0001278_16678_17793 364
1057 3300044842 Ga0466957_0067690 Ga0466957_0067690_570_1685 364
1058 3300044842 Ga0466957_0203345 Ga0466957_0203345_164_1285 364
1059 3300046452 Ga0495617_000008 Ga0495617_000008_297012_298136 364
1060 3300046453 Ga0495627_003344 Ga0495627_003344_500_1624 364
1061 3300046455 Ga0495603_0003068 Ga0495603_0003068_2088_3209 364
1062 3300046457 Ga0495590_0000766 Ga0495590_0000766_12168_13298 364
1063 3300046459 Ga0495629_0000603 Ga0495629_0000603_25122_26243 364
1064 3300046463 Ga0495653_0020036 Ga0495653_0020036_3825_4961 364
1065 3300046463 Ga0495653_0086012 Ga0495653_0086012_206_1342 364
1066 3300046471 Ga0495650_0001004 Ga0495650_0001004_2887_4008 364
1067 3300046472 Ga0495580_0006350 Ga0495580_0006350_6541_7662 364
1068 3300046472 Ga0495580_0010497 Ga0495580_0010497_4011_5147 364
1069 3300046473 Ga0495582_0000248 Ga0495582_0000248_12031_13167 364
1070 3300046474 Ga0495605_0000096 Ga0495605_0000096_42234_43358 364
1071 3300046476 Ga0495662_0037844 Ga0495662_0037844_804_1925 364
1072 3300046499 Ga0495594_0044100 Ga0495594_0044100_734_1870 364
1073 3300046500 Ga0495596_0003971 Ga0495596_0003971_5483_6607 364
1074 3300046501 Ga0495607_0001576 Ga0495607_0001576_8741_9865 364
1075 3300046516 Ga0495628_0009586 Ga0495628_0009586_1686_2807 364
1076 3300046519 Ga0495632_0000141 Ga0495632_0000141_20413_21537 364
1077 3300046523 Ga0495644_0020241 Ga0495644_0020241_891_2015 364
1078 3300046524 Ga0495648_0001097 Ga0495648_0001097_20865_21989 364
1079 3300046528 Ga0495642_0000176 Ga0495642_0000176_15596_16720 364
1080 3300046530 Ga0495654_0038131 Ga0495654_0038131_75_1196 364
1081 3300046542 Ga0495597_0005074 Ga0495597_0005074_545_1669 364
1082 3300046543 Ga0495645_0152549 Ga0495645_0152549_408_1529 364
1083 3300046642 Ga0495634_0006377 Ga0495634_0006377_6438_7574 364
1084 3300046665 Ga0495661_0010115 Ga0495661_0010115_4182_5306 364
1085 3300046665 Ga0495661_0053543 Ga0495661_0053543_377_1504 364
1086 3300046684 Ga0495669_0043323 Ga0495669_0043323_539_1660 364
1087 3300046692 Ga0495671_0004208 Ga0495671_0004208_3267_4391 364
1088 3300046794 Ga0495589_0002836 Ga0495589_0002836_589_1713 364
1089 3300046809 Ga0495600_0053336 Ga0495600_0053336_680_1801 364
1090 3300047319 Ga0495674_0006203 Ga0495674_0006203_4564_5685 364
1091 3300047443 Ga0495687_010273 Ga0495687_010273_553_1674 364
1092 3300047472 Ga0495686_0000359 Ga0495686_0000359_26685_27806 364
1093 3300047472 Ga0495686_0000484 Ga0495686_0000484_7610_8728 364
1094 3300047472 Ga0495686_0005007 Ga0495686_0005007_3424_4548 364
1095 3300048911 Ga0496108_0377588 Ga0496108_0377588_74_1195 364
1096 3300048913 Ga0496110_0008997 Ga0496110_0008997_3679_4809 364
1097 3300048917 Ga0496114_0020508 Ga0496114_0020508_2612_3733 364
1098 3300049129 Ga0501309_000918 Ga0501309_000918_1135_2250 364
1099 3300049130 Ga0501310_001182 Ga0501310_001182_1184_2299 364
1100 3300049459 Ga0495678_000758 Ga0495678_000758_4667_5797 364
1101 3300049514 Ga0501291_002885 Ga0501291_002885_697_1812 364
1102 3300049523 Ga0501300_003060 Ga0501300_003060_718_1833 364
1103 3300049662 Ga0501222_002709 Ga0501222_002709_722_1837 364
1104 3300049668 Ga0501233_003515 Ga0501233_003515_1029_2144 364
1105 3300049679 Ga0501249_012475 Ga0501249_012475_143_1258 364
1106 3300049704 Ga0501221_001013 Ga0501221_001013_2826_3941 364
1107 3300049706 Ga0501229_000157 Ga0501229_000157_5230_6345 364
1108 3300049759 Ga0501262_003082 Ga0501262_003082_213_1328 364
1109 3300049761 Ga0501264_002653 Ga0501264_002653_185_1300 364
1110 3300050508 nmdc:mga09592_4010_c1 nmdc:mga09592_4010_c1_10151_11332 364
1111 3300050511 nmdc:mga08y16_4046_c1 nmdc:mga08y16_4046_c1_6628_7809 364
1112 3300050511 nmdc:mga08y16_426211_c1 nmdc:mga08y16_426211_c1_193_1296 364
1113 3300050512 nmdc:mga0n895_288716_c1 nmdc:mga0n895_288716_c1_27_1202 364
1114 iso_pu_bacteria 2643221603 2644029031 364
1115 iso_pu_bacteria 2643221660 2644337437 364
1116 iso_pu_bacteria 2857576091 2857581040 364
1117 iso_pu_bacteria 8055225921 8055226540 364
1118 3300002773 JGI25152J39213_1000132 JGI25152J39213_100013242 365
1119 3300002774 JGI25150J39212_1000962 JGI25150J39212_10009628 365
1120 3300002987 JGI25159J45721_1003158 JGI25159J45721_10031586 365
1121 3300002987 JGI25159J45721_1003317 JGI25159J45721_10033172 365
1122 3300003215 JGI25153J46596_10005422 JGI25153J46596_100054222 365
1123 3300003354 JGI25160J50197_1001366 JGI25160J50197_10013662 365
1124 3300003374 JGI25161J50226_1000925 JGI25161J50226_10009252 365
1125 3300003374 JGI25161J50226_1001458 JGI25161J50226_10014582 365
1126 3300003575 Ga0007409J51694_1011434 Ga0007409J51694_10114345 365
1127 3300003763 Ga0055529_1000129 Ga0055529_100012974 365
1128 3300003771 Ga0055526_1000748 Ga0055526_100074822 365
1129 3300003771 Ga0055526_1000779 Ga0055526_10007796 365
1130 3300003771 Ga0055526_1035299 Ga0055526_10352991 365
1131 3300003775 Ga0055524_1000007 Ga0055524_100000734 365
1132 3300003775 Ga0055524_1015450 Ga0055524_10154502 365
1133 3300003784 Ga0055534_1000521 Ga0055534_100052115 365
1134 3300003790 Ga0055528_1000249 Ga0055528_100024926 365
1135 3300003790 Ga0055528_1008308 Ga0055528_10083082 365
1136 3300003794 Ga0055531_10040736 Ga0055531_100407361 365
1137 3300004625 Ga0055543_1002030 Ga0055543_10020302 365
1138 3300005262 Ga0065165_1000364 Ga0065165_100036458 365
1139 3300005262 Ga0065165_1008873 Ga0065165_10088735 365
1140 3300005288 Ga0065714_10086124 Ga0065714_100861242 365
1141 3300005328 Ga0070676_10003580 Ga0070676_100035807 365
1142 3300005330 Ga0070690_100044208 Ga0070690_1000442082 365
1143 3300005331 Ga0070670_100004564 Ga0070670_10000456410 365
1144 3300005334 Ga0068869_100000287 Ga0068869_10000028711 365
1145 3300005334 Ga0068869_100186793 Ga0068869_1001867931 365
1146 3300005335 Ga0070666_10006955 Ga0070666_100069554 365
1147 3300005335 Ga0070666_10118503 Ga0070666_101185032 365
1148 3300005336 Ga0070680_100026564 Ga0070680_1000265642 365
1149 3300005338 Ga0068868_100004791 Ga0068868_1000047913 365
1150 3300005338 Ga0068868_100023471 Ga0068868_1000234712 365
1151 3300005340 Ga0070689_100038320 Ga0070689_1000383202 365
1152 3300005347 Ga0070668_100006437 Ga0070668_1000064373 365
1153 3300005347 Ga0070668_100113900 Ga0070668_1001139001 365
1154 3300005353 Ga0070669_100006180 Ga0070669_1000061808 365
1155 3300005354 Ga0070675_100000322 Ga0070675_1000003222 365
1156 3300005354 Ga0070675_100103932 Ga0070675_1001039322 365
1157 3300005355 Ga0070671_100014031 Ga0070671_1000140312 365
1158 3300005355 Ga0070671_100020624 Ga0070671_1000206243 365
1159 3300005355 Ga0070671_100027578 Ga0070671_1000275784 365
1160 3300005355 Ga0070671_100061393 Ga0070671_1000613933 365
1161 3300005355 Ga0070671_100152674 Ga0070671_1001526742 365
1162 3300005364 Ga0070673_100041413 Ga0070673_1000414132 365
1163 3300005364 Ga0070673_100046510 Ga0070673_1000465102 365
1164 3300005365 Ga0070688_100012626 Ga0070688_1000126262 365
1165 3300005366 Ga0070659_100082544 Ga0070659_1000825441 365
1166 3300005367 Ga0070667_100004438 Ga0070667_1000044386 365
1167 3300005367 Ga0070667_100009358 Ga0070667_1000093584 365
1168 3300005441 Ga0070700_100004808 Ga0070700_1000048085 365
1169 3300005455 Ga0070663_100152246 Ga0070663_1001522461 365
1170 3300005456 Ga0070678_100028500 Ga0070678_1000285002 365
1171 3300005457 Ga0070662_100003698 Ga0070662_1000036982 365
1172 3300005457 Ga0070662_100071391 Ga0070662_1000713912 365
1173 3300005458 Ga0070681_10075195 Ga0070681_100751953 365
1174 3300005530 Ga0070679_100025724 Ga0070679_1000257245 365
1175 3300005535 Ga0070684_100056915 Ga0070684_1000569151 365
1176 3300005539 Ga0068853_100109362 Ga0068853_1001093621 365
1177 3300005543 Ga0070672_100010706 Ga0070672_1000107065 365
1178 3300005543 Ga0070672_100233025 Ga0070672_1002330252 365
1179 3300005547 Ga0070693_100183855 Ga0070693_1001838551 365
1180 3300005563 Ga0068855_100032268 Ga0068855_1000322682 365
1181 3300005564 Ga0070664_100074305 Ga0070664_1000743053 365
1182 3300005578 Ga0068854_100142836 Ga0068854_1001428362 365
1183 3300005616 Ga0068852_100042495 Ga0068852_1000424953 365
1184 3300005616 Ga0068852_100058885 Ga0068852_1000588854 365
1185 3300005616 Ga0068852_100155101 Ga0068852_1001551012 365
1186 3300005617 Ga0068859_100008152 Ga0068859_1000081526 365
1187 3300005617 Ga0068859_100054834 Ga0068859_1000548342 365
1188 3300005618 Ga0068864_100002923 Ga0068864_1000029233 365
1189 3300005618 Ga0068864_100006810 Ga0068864_1000068106 365
1190 3300005618 Ga0068864_100056840 Ga0068864_1000568402 365
1191 3300005718 Ga0068866_10022836 Ga0068866_100228362 365
1192 3300005719 Ga0068861_100009353 Ga0068861_1000093532 365
1193 3300005719 Ga0068861_100038101 Ga0068861_1000381012 365
1194 3300005841 Ga0068863_100007955 Ga0068863_1000079558 365
1195 3300005841 Ga0068863_100008722 Ga0068863_1000087225 365
1196 3300005842 Ga0068858_100004522 Ga0068858_1000045225 365
1197 3300005842 Ga0068858_100018565 Ga0068858_1000185656 365
1198 3300005843 Ga0068860_100017156 Ga0068860_1000171565 365
1199 3300005843 Ga0068860_100054936 Ga0068860_1000549364 365
1200 3300005844 Ga0068862_100050610 Ga0068862_1000506102 365
1201 3300006237 Ga0097621_100010887 Ga0097621_1000108876 365
1202 3300006237 Ga0097621_100062504 Ga0097621_1000625042 365
1203 3300006358 Ga0068871_100035145 Ga0068871_1000351452 365
1204 3300006358 Ga0068871_100074125 Ga0068871_1000741252 365
1205 3300006358 Ga0068871_100077529 Ga0068871_1000775292 365
1206 3300006881 Ga0068865_100177878 Ga0068865_1001778781 365
1207 3300006931 Ga0097620_100008153 Ga0097620_1000081536 365
1208 3300006931 Ga0097620_100054834 Ga0097620_1000548342 365
1209 3300006948 Ga0099826_10000052 Ga0099826_1000005222 365
1210 3300009093 Ga0105240_10376309 Ga0105240_103763092 365
1211 3300009098 Ga0105245_10035610 Ga0105245_100356102 365
1212 3300009176 Ga0105242_10068905 Ga0105242_100689051 365
1213 3300009177 Ga0105248_10043169 Ga0105248_100431694 365
1214 3300009545 Ga0105237_10029850 Ga0105237_100298502 365
1215 3300009551 Ga0105238_10023750 Ga0105238_100237504 365
1216 3300009551 Ga0105238_10125378 Ga0105238_101253781 365
1217 3300009553 Ga0105249_10085998 Ga0105249_100859982 365
1218 3300010375 Ga0105239_10258521 Ga0105239_102585212 365
1219 3300010375 Ga0105239_10394711 Ga0105239_103947111 365
1220 3300013102 Ga0157371_10000001 Ga0157371_10000001298 365
1221 3300013102 Ga0157371_10081997 Ga0157371_100819972 365
1222 3300013296 Ga0157374_10278607 Ga0157374_102786071 365
1223 3300013297 Ga0157378_10403762 Ga0157378_104037622 365
1224 3300013306 Ga0163162_10005793 Ga0163162_100057932 365
1225 3300013306 Ga0163162_10024652 Ga0163162_100246524 365
1226 3300013306 Ga0163162_10100244 Ga0163162_101002442 365
1227 3300013308 Ga0157375_10069553 Ga0157375_100695532 365
1228 3300013308 Ga0157375_10078718 Ga0157375_100787181 365
1229 3300013308 Ga0157375_10111272 Ga0157375_101112722 365
1230 3300014325 Ga0163163_10043369 Ga0163163_100433691 365
1231 3300014325 Ga0163163_10539809 Ga0163163_105398091 365
1232 3300014326 Ga0157380_10001456 Ga0157380_100014566 365
1233 3300014745 Ga0157377_10012258 Ga0157377_100122582 365
1234 3300014968 Ga0157379_10013776 Ga0157379_100137762 365
1235 3300014968 Ga0157379_10063912 Ga0157379_100639121 365
1236 3300014969 Ga0157376_10008997 Ga0157376_100089973 365
1237 3300014969 Ga0157376_10036360 Ga0157376_100363602 365
1238 3300021361 Ga0213872_10000048 Ga0213872_1000004891 365
1239 3300021361 Ga0213872_10000089 Ga0213872_1000008932 365
1240 3300021361 Ga0213872_10000647 Ga0213872_1000064717 365
1241 3300021361 Ga0213872_10002492 Ga0213872_100024929 365
1242 3300025230 Ga0209563_100007 Ga0209563_1000071078 365
1243 3300025245 Ga0207425_1000001 Ga0207425_10000011863 365
1244 3300025245 Ga0207425_1000140 Ga0207425_100014039 365
1245 3300025245 Ga0207425_1003719 Ga0207425_10037193 365
1246 3300025246 Ga0209646_1000087 Ga0209646_100008797 365
1247 3300025253 Ga0209677_106170 Ga0209677_1061702 365
1248 3300025254 Ga0209148_1000211 Ga0209148_100021113 365
1249 3300025258 Ga0209129_1000001 Ga0209129_10000011040 365
1250 3300025263 Ga0209565_1000009 Ga0209565_1000009289 365
1251 3300025263 Ga0209565_1002632 Ga0209565_10026324 365
1252 3300025272 Ga0209455_1000175 Ga0209455_100017575 365
1253 3300025273 Ga0209673_1000019 Ga0209673_100001993 365
1254 3300025273 Ga0209673_1003115 Ga0209673_10031155 365
1255 3300025284 Ga0209130_1000179 Ga0209130_100017968 365
1256 3300025284 Ga0209130_1000278 Ga0209130_10002782 365
1257 3300025284 Ga0209130_1001480 Ga0209130_100148014 365
1258 3300025284 Ga0209130_1004158 Ga0209130_10041582 365
1259 3300025291 Ga0209675_1000013 Ga0209675_1000013393 365
1260 3300025291 Ga0209675_1001061 Ga0209675_100106113 365
1261 3300025294 Ga0209025_1013171 Ga0209025_10131712 365
1262 3300025295 Ga0209564_1000009 Ga0209564_1000009695 365
1263 3300025295 Ga0209564_1000045 Ga0209564_1000045128 365
1264 3300025295 Ga0209564_1000058 Ga0209564_100005831 365
1265 3300025295 Ga0209564_1000447 Ga0209564_100044719 365
1266 3300025297 Ga0209758_1000166 Ga0209758_100016693 365
1267 3300025297 Ga0209758_1000513 Ga0209758_100051344 365
1268 3300025298 Ga0209050_1000435 Ga0209050_100043550 365
1269 3300025299 Ga0209256_1000005 Ga0209256_1000005458 365
1270 3300025299 Ga0209256_1000052 Ga0209256_1000052123 365
1271 3300025299 Ga0209256_1000568 Ga0209256_10005686 365
1272 3300025299 Ga0209256_1001880 Ga0209256_10018804 365
1273 3300025302 Ga0207426_1001461 Ga0207426_10014614 365
1274 3300025303 Ga0209051_1041597 Ga0209051_10415972 365
1275 3300025304 Ga0209257_1000107 Ga0209257_1000107102 365
1276 3300025728 Ga0207655_1013236 Ga0207655_10132362 365
1277 3300025901 Ga0207688_10140150 Ga0207688_101401501 365
1278 3300025903 Ga0207680_10016706 Ga0207680_100167064 365
1279 3300025903 Ga0207680_10069034 Ga0207680_100690342 365
1280 3300025907 Ga0207645_10006800 Ga0207645_100068001 365
1281 3300025907 Ga0207645_10069092 Ga0207645_100690922 365
1282 3300025908 Ga0207643_10026801 Ga0207643_100268012 365
1283 3300025909 Ga0207705_10015699 Ga0207705_100156992 365
1284 3300025912 Ga0207707_10060072 Ga0207707_100600722 365
1285 3300025914 Ga0207671_10038886 Ga0207671_100388862 365
1286 3300025917 Ga0207660_10009561 Ga0207660_100095613 365
1287 3300025918 Ga0207662_10031171 Ga0207662_100311712 365
1288 3300025920 Ga0207649_10107147 Ga0207649_101071472 365
1289 3300025921 Ga0207652_10006543 Ga0207652_100065433 365
1290 3300025923 Ga0207681_10000205 Ga0207681_1000020511 365
1291 3300025925 Ga0207650_10002265 Ga0207650_100022656 365
1292 3300025925 Ga0207650_10011131 Ga0207650_100111312 365
1293 3300025926 Ga0207659_10010965 Ga0207659_100109653 365
1294 3300025926 Ga0207659_10042085 Ga0207659_100420851 365
1295 3300025927 Ga0207687_10044741 Ga0207687_100447412 365
1296 3300025931 Ga0207644_10030542 Ga0207644_100305424 365
1297 3300025931 Ga0207644_10045043 Ga0207644_100450433 365
1298 3300025933 Ga0207706_10045443 Ga0207706_100454434 365
1299 3300025933 Ga0207706_10346463 Ga0207706_103464631 365
1300 3300025934 Ga0207686_10053243 Ga0207686_100532432 365
1301 3300025935 Ga0207709_10020396 Ga0207709_100203962 365
1302 3300025935 Ga0207709_10062840 Ga0207709_100628402 365
1303 3300025935 Ga0207709_10086292 Ga0207709_100862922 365
1304 3300025937 Ga0207669_10047302 Ga0207669_100473022 365
1305 3300025938 Ga0207704_10054287 Ga0207704_100542872 365
1306 3300025938 Ga0207704_10071465 Ga0207704_100714652 365
1307 3300025940 Ga0207691_10028589 Ga0207691_100285892 365
1308 3300025941 Ga0207711_10003680 Ga0207711_100036802 365
1309 3300025941 Ga0207711_10006526 Ga0207711_100065264 365
1310 3300025941 Ga0207711_10032423 Ga0207711_100324232 365
1311 3300025942 Ga0207689_10000612 Ga0207689_1000061223 365
1312 3300025942 Ga0207689_10033000 Ga0207689_100330002 365
1313 3300025945 Ga0207679_10010614 Ga0207679_100106142 365
1314 3300025949 Ga0207667_10074493 Ga0207667_100744934 365
1315 3300025960 Ga0207651_10040363 Ga0207651_100403632 365
1316 3300025960 Ga0207651_10148424 Ga0207651_101484242 365
1317 3300025961 Ga0207712_10070647 Ga0207712_100706472 365
1318 3300025986 Ga0207658_10001252 Ga0207658_1000125213 365
1319 3300025986 Ga0207658_10012973 Ga0207658_100129734 365
1320 3300026023 Ga0207677_10001106 Ga0207677_100011068 365
1321 3300026023 Ga0207677_10042551 Ga0207677_100425512 365
1322 3300026035 Ga0207703_10007447 Ga0207703_100074474 365
1323 3300026035 Ga0207703_10014143 Ga0207703_100141434 365
1324 3300026041 Ga0207639_10019392 Ga0207639_100193922 365
1325 3300026041 Ga0207639_10066858 Ga0207639_100668582 365
1326 3300026041 Ga0207639_10199624 Ga0207639_101996242 365
1327 3300026075 Ga0207708_10025273 Ga0207708_100252732 365
1328 3300026088 Ga0207641_10007661 Ga0207641_100076618 365
1329 3300026088 Ga0207641_10010832 Ga0207641_100108322 365
1330 3300026095 Ga0207676_10002033 Ga0207676_100020333 365
1331 3300026095 Ga0207676_10002699 Ga0207676_100026996 365
1332 3300026116 Ga0207674_10092788 Ga0207674_100927881 365
1333 3300026116 Ga0207674_10099739 Ga0207674_100997391 365
1334 3300026118 Ga0207675_100002511 Ga0207675_10000251113 365
1335 3300026118 Ga0207675_100018129 Ga0207675_1000181294 365
1336 3300026121 Ga0207683_10042403 Ga0207683_100424032 365
1337 3300026121 Ga0207683_10049439 Ga0207683_100494392 365
1338 3300026121 Ga0207683_10092320 Ga0207683_100923202 365
1339 3300027666 Ga0209282_1000001 Ga0209282_10000012283 365
1340 3300028380 Ga0268265_10041969 Ga0268265_100419691 365
1341 3300028381 Ga0268264_10001585 Ga0268264_100015857 365
1342 3300028381 Ga0268264_10004874 Ga0268264_100048743 365
1343 3300028653 Ga0265323_10010139 Ga0265323_100101394 365
1344 3300028794 Ga0307515_10007308 Ga0307515_100073084 365
1345 3300028794 Ga0307515_10041356 Ga0307515_100413567 365
1346 3300028794 Ga0307515_10081014 Ga0307515_100810142 365
1347 3300030731 Ga0316177_1039113 Ga0316177_10391133 365
1348 3300030736 Ga0316180_1019713 Ga0316180_10197132 365
1349 3300030745 Ga0316182_1113191 Ga0316182_11131912 365
1350 3300031238 Ga0265332_10000013 Ga0265332_10000013152 365
1351 3300031250 Ga0265331_10003982 Ga0265331_100039822 365
1352 3300031251 Ga0265327_10000311 Ga0265327_1000031132 365
1353 3300031344 Ga0265316_10082035 Ga0265316_100820351 365
1354 3300031344 Ga0265316_10180019 Ga0265316_101800192 365
1355 3300031507 Ga0307509_10000006 Ga0307509_10000006385 365
1356 3300031548 Ga0307408_100000030 Ga0307408_10000003073 365
1357 3300031548 Ga0307408_100007900 Ga0307408_1000079003 365
1358 3300031548 Ga0307408_100019680 Ga0307408_1000196805 365
1359 3300031838 Ga0307518_10093464 Ga0307518_100934641 365
1360 3300032002 Ga0307416_100016000 Ga0307416_1000160002 365
1361 3300032126 Ga0307415_100048172 Ga0307415_1000481722 365
1362 3300034817 Ga0373948_0003324 Ga0373948_0003324_679_1794 365
1363 3300035091 Ga0373951_0016480 Ga0373951_0016480_229_1344 365
1364 3300035114 Ga0373939_0000062 Ga0373939_0000062_14506_15621 365
1365 3300035119 Ga0373956_0093886 Ga0373956_0093886_248_1375 365
1366 3300035121 Ga0373960_0002471 Ga0373960_0002471_810_1925 365
1367 3300035691 Ga0373931_0018762 Ga0373931_0018762_381_1505 365
1368 3300035725 Ga0373947_0057839 Ga0373947_0057839_857_1981 365
1369 3300036401 Ga0373937_0017870 Ga0373937_0017870_4284_5411 365
1370 3300037068 Ga0373925_0089772 Ga0373925_0089772_62_1186 365
1371 3300037312 Ga0395899_0000028 Ga0395899_0000028_105930_107063 365
1372 3300037312 Ga0395899_0006490 Ga0395899_0006490_4444_5565 365
1373 3300037418 Ga0395900_0139757 Ga0395900_0139757_735_1859 365
1374 3300039447 Ga0436361_0071281 Ga0436361_0071281_1028_2152 365
1375 3300039447 Ga0436361_0172012 Ga0436361_0172012_23080_24219 365
1376 3300039447 Ga0436361_0882487 Ga0436361_0882487_20559_21674 365
1377 3300039450 Ga0436363_0570022 Ga0436363_0570022_886_2010 365
1378 3300042876 Ga0451577_0060411 Ga0451577_0060411_740_1867 365
1379 3300042876 Ga0451577_0095252 Ga0451577_0095252_671_1783 365
1380 3300044693 Ga0466961_0085185 Ga0466961_0085185_151_1293 365
1381 3300044712 Ga0453684_0002009 Ga0453684_0002009_11112_12245 365
1382 3300044712 Ga0453684_0008446 Ga0453684_0008446_2648_3781 365
1383 3300045051 Ga0451576_0181840 Ga0451576_0181840_37_1176 365
1384 3300046457 Ga0495590_0052213 Ga0495590_0052213_283_1410 365
1385 3300046460 Ga0495638_0018651 Ga0495638_0018651_2892_4019 365
1386 3300046460 Ga0495638_0043569 Ga0495638_0043569_1373_2500 365
1387 3300046463 Ga0495653_0000013 Ga0495653_0000013_77167_78294 365
1388 3300046474 Ga0495605_0003657 Ga0495605_0003657_4823_5950 365
1389 3300046474 Ga0495605_0005881 Ga0495605_0005881_530_1657 365
1390 3300046474 Ga0495605_0007447 Ga0495605_0007447_5052_6179 365
1391 3300046491 Ga0495584_0000484 Ga0495584_0000484_2329_3456 365
1392 3300046492 Ga0495585_0026864 Ga0495585_0026864_1253_2380 365
1393 3300046492 Ga0495585_0029592 Ga0495585_0029592_484_1617 365
1394 3300046492 Ga0495585_0032120 Ga0495585_0032120_496_1629 365
1395 3300046492 Ga0495585_0117750 Ga0495585_0117750_187_1314 365
1396 3300046500 Ga0495596_0014719 Ga0495596_0014719_350_1483 365
1397 3300046501 Ga0495607_0017421 Ga0495607_0017421_741_1868 365
1398 3300046506 Ga0495583_0000208 Ga0495583_0000208_7681_8808 365
1399 3300046506 Ga0495583_0026237 Ga0495583_0026237_43_1170 365
1400 3300046516 Ga0495628_0036520 Ga0495628_0036520_2215_3339 365
1401 3300046518 Ga0495631_0004047 Ga0495631_0004047_24_1151 365
1402 3300046524 Ga0495648_0006330 Ga0495648_0006330_51_1178 365
1403 3300046526 Ga0495666_0002096 Ga0495666_0002096_751_1881 365
1404 3300046538 Ga0495609_0000220 Ga0495609_0000220_48100_49227 365
1405 3300046538 Ga0495609_0001801 Ga0495609_0001801_4142_5269 365
1406 3300046538 Ga0495609_0008875 Ga0495609_0008875_1867_2994 365
1407 3300046542 Ga0495597_0071289 Ga0495597_0071289_15_1148 365
1408 3300046543 Ga0495645_0049036 Ga0495645_0049036_207_1334 365
1409 3300046558 Ga0495633_0008726 Ga0495633_0008726_3685_4812 365
1410 3300046558 Ga0495633_0062709 Ga0495633_0062709_348_1478 365
1411 3300046559 Ga0495667_0051663 Ga0495667_0051663_1096_2220 365
1412 3300046615 Ga0495656_0008781 Ga0495656_0008781_952_2082 365
1413 3300046616 Ga0495668_0011721 Ga0495668_0011721_3597_4724 365
1414 3300046660 Ga0495625_0027730 Ga0495625_0027730_2686_3813 365
1415 3300046663 Ga0495635_0035982 Ga0495635_0035982_670_1794 365
1416 3300046665 Ga0495661_0040284 Ga0495661_0040284_1133_2260 365
1417 3300046665 Ga0495661_0077110 Ga0495661_0077110_533_1660 365
1418 3300046683 Ga0495658_0017895 Ga0495658_0017895_724_1848 365
1419 3300046683 Ga0495658_0098795 Ga0495658_0098795_278_1405 365
1420 3300046684 Ga0495669_0005970 Ga0495669_0005970_245_1372 365
1421 3300046691 Ga0495670_0010907 Ga0495670_0010907_1801_2931 365
1422 3300046691 Ga0495670_0029836 Ga0495670_0029836_335_1462 365
1423 3300046691 Ga0495670_0052501 Ga0495670_0052501_452_1585 365
1424 3300046694 Ga0495649_0029327 Ga0495649_0029327_444_1571 365
1425 3300046810 Ga0495660_0003619 Ga0495660_0003619_6039_7166 365
1426 3300046810 Ga0495660_0004329 Ga0495660_0004329_4323_5450 365
1427 3300047318 Ga0495636_0006299 Ga0495636_0006299_2991_4118 365
1428 3300047320 Ga0495672_0000956 Ga0495672_0000956_304_1437 365
1429 3300047322 Ga0495680_0083821 Ga0495680_0083821_739_1866 365
1430 3300047322 Ga0495680_0151348 Ga0495680_0151348_64_1191 365
1431 3300047323 Ga0495683_0004111 Ga0495683_0004111_4834_5961 365
1432 3300047323 Ga0495683_0043357 Ga0495683_0043357_401_1528 365
1433 3300047443 Ga0495687_000239 Ga0495687_000239_13744_14871 365
1434 3300047443 Ga0495687_022214 Ga0495687_022214_470_1597 365
1435 3300047445 Ga0495677_0002874 Ga0495677_0002874_73_1200 365
1436 3300047446 Ga0495679_004270 Ga0495679_004270_2333_3460 365
1437 3300047447 Ga0495685_012167 Ga0495685_012167_909_2036 365
1438 3300047469 Ga0495673_0039319 Ga0495673_0039319_381_1508 365
1439 3300047470 Ga0495681_0005332 Ga0495681_0005332_7452_8579 365
1440 3300047470 Ga0495681_0028526 Ga0495681_0028526_1667_2800 365
1441 3300047471 Ga0495684_0124780 Ga0495684_0124780_729_1853 365
1442 3300048904 Ga0496101_0055156 Ga0496101_0055156_948_2072 365
1443 3300048907 Ga0496104_0031448 Ga0496104_0031448_2695_3819 365
1444 3300048907 Ga0496104_0060589 Ga0496104_0060589_1855_2982 365
1445 3300048908 Ga0496105_0130580 Ga0496105_0130580_286_1413 365
1446 3300048910 Ga0496107_0043961 Ga0496107_0043961_529_1653 365
1447 3300048911 Ga0496108_0144777 Ga0496108_0144777_354_1532 365
1448 3300048912 Ga0496109_0205233 Ga0496109_0205233_331_1509 365
1449 3300048913 Ga0496110_0241489 Ga0496110_0241489_219_1343 365
1450 3300048915 Ga0496112_0007589 Ga0496112_0007589_7589_8737 365
1451 3300048915 Ga0496112_0074180 Ga0496112_0074180_1756_2880 365
1452 3300048927 Ga0496124_0057862 Ga0496124_0057862_1088_2215 365
1453 3300048927 Ga0496124_0112415 Ga0496124_0112415_350_1474 365
1454 3300049459 Ga0495678_000016 Ga0495678_000016_296462_297589 365
1455 3300049459 Ga0495678_000629 Ga0495678_000629_3064_4197 365
1456 3300049459 Ga0495678_002055 Ga0495678_002055_5191_6318 365
1457 3300049459 Ga0495678_002346 Ga0495678_002346_256_1383 365
1458 3300049460 Ga0495682_0000183 Ga0495682_0000183_45941_47068 365
1459 3300049665 Ga0501227_009002 Ga0501227_009002_438_1565 365
1460 3300049775 Ga0501279_005182 Ga0501279_005182_44_1171 365
1461 3300053085 Ga0495619_0019309 Ga0495619_0019309_2592_3719 365
1462 iso_pu_bacteria 2547132374 2548499978 365
1463 iso_pu_bacteria 2599185292 2599906741 365
1464 iso_pu_bacteria 2643221569 2643862816 365
1465 iso_pu_bacteria 2643221570 2643868214 365
1466 iso_pu_bacteria 2643221585 2643935982 365
1467 iso_pu_bacteria 2643221594 2643978245 365
1468 iso_pu_bacteria 2643221596 2643993792 365
1469 iso_pu_bacteria 2643221609 2644059772 365
1470 iso_pu_bacteria 2643221611 2644074915 365
1471 iso_pu_bacteria 2643221621 2644123791 365
1472 iso_pu_bacteria 2643221652 2644293818 365
1473 iso_pu_bacteria 2643221656 2644317765 365
1474 iso_pu_bacteria 2643221717 2644644704 365
1475 iso_pu_bacteria 2721755763 2723877104 365
1476 iso_pu_bacteria 2738543012 2739241300 365
1477 iso_pu_bacteria 2738543013 2739248186 365
1478 iso_pu_bacteria 2739367655 2739613148 365
1479 iso_pu_bacteria 2808606395 2809031442 365
1480 iso_pu_bacteria 2816332133 2816473466 365
1481 iso_pu_bacteria 2831864461 2831869962 365
1482 iso_pu_bacteria 2842718218 2842721333 365
1483 iso_pu_bacteria 2855730933 2855734225 365
1484 iso_pu_bacteria 2855767633 2855769815 365
1485 iso_pu_bacteria 2857537821 2857539478 365
1486 iso_pu_bacteria 2857542790 2857545524 365
1487 iso_pu_bacteria 2858950400 2858951085 365
1488 iso_pu_bacteria 2881412998 2881414070 365
1489 iso_pu_bacteria 2881927736 2881931002 365
1490 iso_pu_bacteria 2886848708 2886851874 365
1491 iso_pu_bacteria 2887375801 2887378682 365
1492 iso_pu_bacteria 2894023352 2894026898 365
1493 iso_pu_bacteria 2895511927 2895515733 365
1494 iso_pu_bacteria 2919704043 2919707265 365
1495 iso_pu_bacteria 2928115317 2928115637 365
1496 iso_pu_bacteria 2941479691 2941485771 365
1497 iso_pu_bacteria 2974320154 2974322583 365
1498 iso_pu_bacteria 2990710928 2990713428 365
1499 3300002077 JGI24744J21845_10015985 JGI24744J21845_100159852 366
1500 3300002705 JGI25156J39149_1004470 JGI25156J39149_10044705 366
1501 3300003187 JGI25151J46595_10000402 JGI25151J46595_1000040235 366
1502 3300003759 Ga0055525_1000021 Ga0055525_1000021172 366
1503 3300003763 Ga0055529_1001098 Ga0055529_10010984 366
1504 3300003775 Ga0055524_1000079 Ga0055524_1000079103 366
1505 3300003775 Ga0055524_1004293 Ga0055524_10042932 366
1506 3300003791 Ga0055530_10005712 Ga0055530_100057122 366
1507 3300003792 Ga0055540_1000004 Ga0055540_1000004134 366
1508 3300003792 Ga0055540_1021258 Ga0055540_10212581 366
1509 3300003794 Ga0055531_10000641 Ga0055531_1000064115 366
1510 3300003794 Ga0055531_10011782 Ga0055531_100117821 366
1511 3300005262 Ga0065165_1000395 Ga0065165_100039553 366
1512 3300005327 Ga0070658_10121841 Ga0070658_101218412 366
1513 3300005328 Ga0070676_10018195 Ga0070676_100181952 366
1514 3300005329 Ga0070683_100321596 Ga0070683_1003215962 366
1515 3300005331 Ga0070670_100130268 Ga0070670_1001302682 366
1516 3300005333 Ga0070677_10039286 Ga0070677_100392862 366
1517 3300005337 Ga0070682_100026086 Ga0070682_1000260862 366
1518 3300005339 Ga0070660_100002267 Ga0070660_1000022676 366
1519 3300005344 Ga0070661_100001326 Ga0070661_10000132612 366
1520 3300005344 Ga0070661_100005785 Ga0070661_1000057855 366
1521 3300005353 Ga0070669_100104200 Ga0070669_1001042002 366
1522 3300005355 Ga0070671_100078228 Ga0070671_1000782282 366
1523 3300005364 Ga0070673_100035795 Ga0070673_1000357952 366
1524 3300005366 Ga0070659_100000336 Ga0070659_10000033627 366
1525 3300005367 Ga0070667_100055069 Ga0070667_1000550692 366
1526 3300005457 Ga0070662_100020105 Ga0070662_1000201052 366
1527 3300005457 Ga0070662_100032740 Ga0070662_1000327403 366
1528 3300005458 Ga0070681_10165264 Ga0070681_101652642 366
1529 3300005459 Ga0068867_100072862 Ga0068867_1000728622 366
1530 3300005539 Ga0068853_100019807 Ga0068853_1000198073 366
1531 3300005543 Ga0070672_100090157 Ga0070672_1000901572 366
1532 3300005564 Ga0070664_100005656 Ga0070664_1000056562 366
1533 3300005617 Ga0068859_100061388 Ga0068859_1000613882 366
1534 3300005617 Ga0068859_100133764 Ga0068859_1001337642 366
1535 3300005618 Ga0068864_100006813 Ga0068864_1000068138 366
1536 3300005718 Ga0068866_10015305 Ga0068866_100153053 366
1537 3300005719 Ga0068861_100001256 Ga0068861_1000012565 366
1538 3300005719 Ga0068861_100026499 Ga0068861_1000264994 366
1539 3300005841 Ga0068863_100021758 Ga0068863_1000217585 366
1540 3300005842 Ga0068858_100224657 Ga0068858_1002246572 366
1541 3300005843 Ga0068860_100000989 Ga0068860_10000098913 366
1542 3300005843 Ga0068860_100069562 Ga0068860_1000695622 366
1543 3300005843 Ga0068860_100225851 Ga0068860_1002258512 366
1544 3300005844 Ga0068862_100016414 Ga0068862_1000164144 366
1545 3300005844 Ga0068862_100017615 Ga0068862_1000176152 366
1546 3300006048 Ga0075363_100012195 Ga0075363_1000121952 366
1547 3300006051 Ga0075364_10002918 Ga0075364_100029185 366
1548 3300006051 Ga0075364_10041067 Ga0075364_100410672 366
1549 3300006051 Ga0075364_10086969 Ga0075364_100869691 366
1550 3300006178 Ga0075367_10020957 Ga0075367_100209572 366
1551 3300006195 Ga0075366_10029398 Ga0075366_100293982 366
1552 3300006353 Ga0075370_10009379 Ga0075370_100093794 366
1553 3300006353 Ga0075370_10017190 Ga0075370_100171903 366
1554 3300006353 Ga0075370_10019615 Ga0075370_100196152 366
1555 3300006353 Ga0075370_10069668 Ga0075370_100696682 366
1556 3300006880 Ga0075429_100005458 Ga0075429_1000054584 366
1557 3300006931 Ga0097620_100061386 Ga0097620_1000613862 366
1558 3300006946 Ga0079104_1000352 Ga0079104_100035234 366
1559 3300009094 Ga0111539_10017371 Ga0111539_100173715 366
1560 3300009148 Ga0105243_10083722 Ga0105243_100837222 366
1561 3300009148 Ga0105243_10109379 Ga0105243_101093792 366
1562 3300009553 Ga0105249_10223221 Ga0105249_102232211 366
1563 3300012497 Ga0157319_1000006 Ga0157319_100000693 366
1564 3300013308 Ga0157375_10173714 Ga0157375_101737142 366
1565 3300014326 Ga0157380_10351228 Ga0157380_103512281 366
1566 3300014968 Ga0157379_10111542 Ga0157379_101115422 366
1567 3300021361 Ga0213872_10000090 Ga0213872_1000009067 366
1568 3300025230 Ga0209563_100005 Ga0209563_100005155 366
1569 3300025242 Ga0209258_105139 Ga0209258_1051392 366
1570 3300025272 Ga0209455_1001930 Ga0209455_10019308 366
1571 3300025273 Ga0209673_1015853 Ga0209673_10158532 366
1572 3300025292 Ga0209676_1004219 Ga0209676_10042195 366
1573 3300025294 Ga0209025_1000003 Ga0209025_1000003828 366
1574 3300025298 Ga0209050_1003226 Ga0209050_10032265 366
1575 3300025298 Ga0209050_1003660 Ga0209050_10036605 366
1576 3300025299 Ga0209256_1000011 Ga0209256_1000011104 366
1577 3300025299 Ga0209256_1002401 Ga0209256_10024014 366
1578 3300025303 Ga0209051_1000016 Ga0209051_1000016226 366
1579 3300025303 Ga0209051_1007299 Ga0209051_10072995 366
1580 3300025303 Ga0209051_1011396 Ga0209051_10113962 366
1581 3300025303 Ga0209051_1016469 Ga0209051_10164692 366
1582 3300025304 Ga0209257_1000017 Ga0209257_1000017710 366
1583 3300025304 Ga0209257_1000102 Ga0209257_100010267 366
1584 3300025304 Ga0209257_1008671 Ga0209257_10086714 366
1585 3300025304 Ga0209257_1018727 Ga0209257_10187272 366
1586 3300025899 Ga0207642_10086416 Ga0207642_100864161 366
1587 3300025907 Ga0207645_10008242 Ga0207645_100082425 366
1588 3300025913 Ga0207695_10004334 Ga0207695_100043348 366
1589 3300025914 Ga0207671_10007955 Ga0207671_100079553 366
1590 3300025919 Ga0207657_10025210 Ga0207657_100252102 366
1591 3300025920 Ga0207649_10002483 Ga0207649_100024833 366
1592 3300025924 Ga0207694_10005611 Ga0207694_100056115 366
1593 3300025925 Ga0207650_10212254 Ga0207650_102122542 366
1594 3300025931 Ga0207644_10110008 Ga0207644_101100081 366
1595 3300025932 Ga0207690_10014970 Ga0207690_100149705 366
1596 3300025934 Ga0207686_10035550 Ga0207686_100355502 366
1597 3300025935 Ga0207709_10076547 Ga0207709_100765472 366
1598 3300025938 Ga0207704_10053681 Ga0207704_100536812 366
1599 3300025940 Ga0207691_10068248 Ga0207691_100682483 366
1600 3300025940 Ga0207691_10079106 Ga0207691_100791062 366
1601 3300025940 Ga0207691_10113760 Ga0207691_101137602 366
1602 3300025942 Ga0207689_10055805 Ga0207689_100558052 366
1603 3300025945 Ga0207679_10000526 Ga0207679_1000052619 366
1604 3300025945 Ga0207679_10002757 Ga0207679_100027577 366
1605 3300025986 Ga0207658_10062968 Ga0207658_100629682 366
1606 3300025986 Ga0207658_10120780 Ga0207658_101207802 366
1607 3300026023 Ga0207677_10115179 Ga0207677_101151792 366
1608 3300026088 Ga0207641_10073262 Ga0207641_100732622 366
1609 3300026088 Ga0207641_10318037 Ga0207641_103180371 366
1610 3300026089 Ga0207648_10000310 Ga0207648_1000031026 366
1611 3300026089 Ga0207648_10087839 Ga0207648_100878392 366
1612 3300026089 Ga0207648_10097092 Ga0207648_100970923 366
1613 3300026095 Ga0207676_10230700 Ga0207676_102307001 366
1614 3300026118 Ga0207675_100012910 Ga0207675_1000129102 366
1615 3300026118 Ga0207675_100137700 Ga0207675_1001377002 366
1616 3300026121 Ga0207683_10017541 Ga0207683_100175414 366
1617 3300027111 Ga0209281_1000454 Ga0209281_100045423 366
1618 3300027252 Ga0209973_1004069 Ga0209973_10040692 366
1619 3300027360 Ga0209969_1001247 Ga0209969_10012472 366
1620 3300027471 Ga0209995_1002155 Ga0209995_10021552 366
1621 3300027526 Ga0209968_1000410 Ga0209968_10004103 366
1622 3300027543 Ga0209999_1001968 Ga0209999_10019683 366
1623 3300027614 Ga0209970_1000226 Ga0209970_10002267 366
1624 3300027665 Ga0209983_1007661 Ga0209983_10076613 366
1625 3300027682 Ga0209971_1002317 Ga0209971_10023172 366
1626 3300027682 Ga0209971_1004307 Ga0209971_10043072 366
1627 3300027695 Ga0209966_1000013 Ga0209966_100001339 366
1628 3300027876 Ga0209974_10001761 Ga0209974_100017612 366
1629 3300027876 Ga0209974_10008251 Ga0209974_100082512 366
1630 3300027876 Ga0209974_10017172 Ga0209974_100171722 366
1631 3300027876 Ga0209974_10022047 Ga0209974_100220472 366
1632 3300028379 Ga0268266_10017134 Ga0268266_100171345 366
1633 3300028380 Ga0268265_10014749 Ga0268265_100147493 366
1634 3300028380 Ga0268265_10036644 Ga0268265_100366442 366
1635 3300028381 Ga0268264_10265504 Ga0268264_102655042 366
1636 3300028786 Ga0307517_10066072 Ga0307517_100660722 366
1637 3300028794 Ga0307515_10001533 Ga0307515_1000153339 366
1638 3300028794 Ga0307515_10002116 Ga0307515_1000211616 366
1639 3300028794 Ga0307515_10002409 Ga0307515_1000240913 366
1640 3300028794 Ga0307515_10006008 Ga0307515_100060084 366
1641 3300031235 Ga0265330_10000022 Ga0265330_1000002253 366
1642 3300031238 Ga0265332_10000001 Ga0265332_10000001562 366
1643 3300031238 Ga0265332_10000009 Ga0265332_1000000973 366
1644 3300031240 Ga0265320_10026638 Ga0265320_100266383 366
1645 3300031241 Ga0265325_10003565 Ga0265325_100035652 366
1646 3300031241 Ga0265325_10023913 Ga0265325_100239132 366
1647 3300031250 Ga0265331_10028581 Ga0265331_100285812 366
1648 3300031251 Ga0265327_10000265 Ga0265327_1000026552 366
1649 3300031344 Ga0265316_10000168 Ga0265316_1000016863 366
1650 3300031344 Ga0265316_10003746 Ga0265316_1000374610 366
1651 3300031456 Ga0307513_10023326 Ga0307513_100233261 366
1652 3300031456 Ga0307513_10037880 Ga0307513_100378802 366
1653 3300031456 Ga0307513_10278117 Ga0307513_102781171 366
1654 3300031507 Ga0307509_10004944 Ga0307509_1000494411 366
1655 3300031548 Ga0307408_100000874 Ga0307408_1000008746 366
1656 3300031616 Ga0307508_10000140 Ga0307508_1000014039 366
1657 3300031616 Ga0307508_10002594 Ga0307508_100025946 366
1658 3300031649 Ga0307514_10000906 Ga0307514_1000090616 366
1659 3300031649 Ga0307514_10014842 Ga0307514_100148422 366
1660 3300031711 Ga0265314_10000013 Ga0265314_10000013255 366
1661 3300031711 Ga0265314_10007174 Ga0265314_100071746 366
1662 3300031712 Ga0265342_10031385 Ga0265342_100313852 366
1663 3300031727 Ga0316576_10034981 Ga0316576_100349812 366
1664 3300031727 Ga0316576_10080536 Ga0316576_100805361 366
1665 3300031728 Ga0316578_10066424 Ga0316578_100664242 366
1666 3300031730 Ga0307516_10000698 Ga0307516_100006982 366
1667 3300031730 Ga0307516_10001303 Ga0307516_1000130315 366
1668 3300031901 Ga0307406_10004610 Ga0307406_100046104 366
1669 3300031911 Ga0307412_10028329 Ga0307412_100283292 366
1670 3300032004 Ga0307414_10118569 Ga0307414_101185692 366
1671 3300032005 Ga0307411_10073360 Ga0307411_100733602 366
1672 3300032137 Ga0316585_10017931 Ga0316585_100179312 366
1673 3300035398 Ga0316574_0011523 Ga0316574_0011523_58_1176 366
1674 3300035691 Ga0373931_0057733 Ga0373931_0057733_186_1313 366
1675 3300036401 Ga0373937_0059355 Ga0373937_0059355_534_1670 366
1676 3300036712 Ga0316584_0020143 Ga0316584_0020143_1726_2844 366
1677 3300037418 Ga0395900_0004661 Ga0395900_0004661_6829_7959 366
1678 3300037418 Ga0395900_0070493 Ga0395900_0070493_2223_3359 366
1679 3300037466 Ga0395898_0266401 Ga0395898_0266401_76_1212 366
1680 3300037471 Ga0395905_0060830 Ga0395905_0060830_755_1888 366
1681 3300037471 Ga0395905_0196533 Ga0395905_0196533_148_1281 366
1682 3300039447 Ga0436361_0534908 Ga0436361_0534908_426_1583 366
1683 3300039447 Ga0436361_1043638 Ga0436361_1043638_8124_9254 366
1684 3300039447 Ga0436361_1091674 Ga0436361_1091674_5002_6129 366
1685 3300042531 Ga0450918_000265 Ga0450918_000265_7263_8396 366
1686 3300042876 Ga0451577_0000641 Ga0451577_0000641_48899_50029 366
1687 3300042876 Ga0451577_0001534 Ga0451577_0001534_14186_15361 366
1688 3300042876 Ga0451577_0010011 Ga0451577_0010011_6953_8080 366
1689 3300042876 Ga0451577_0044724 Ga0451577_0044724_1913_3040 366
1690 3300044656 Ga0466969_0000075 Ga0466969_0000075_47628_48755 366
1691 3300044673 Ga0453683_0004136 Ga0453683_0004136_6506_7681 366
1692 3300044684 Ga0466966_0022581 Ga0466966_0022581_2309_3436 366
1693 3300044712 Ga0453684_0001818 Ga0453684_0001818_6140_7270 366
1694 3300044712 Ga0453684_0204987 Ga0453684_0204987_1032_2159 366
1695 3300045049 Ga0466959_0091554 Ga0466959_0091554_655_1782 366
1696 3300045051 Ga0451576_0029765 Ga0451576_0029765_2422_3597 366
1697 3300045051 Ga0451576_0069452 Ga0451576_0069452_676_1803 366
1698 3300045836 Ga0466958_0018580 Ga0466958_0018580_601_1728 366
1699 3300046457 Ga0495590_0018341 Ga0495590_0018341_385_1515 366
1700 3300046501 Ga0495607_0000177 Ga0495607_0000177_23345_24478 366
1701 3300046512 Ga0495610_0031503 Ga0495610_0031503_1598_2719 366
1702 3300046528 Ga0495642_0004751 Ga0495642_0004751_323_1480 366
1703 3300046660 Ga0495625_0009603 Ga0495625_0009603_6557_7678 366
1704 3300047443 Ga0495687_006024 Ga0495687_006024_349_1506 366
1705 3300048909 Ga0496106_0085018 Ga0496106_0085018_440_1576 366
1706 3300048924 Ga0496121_0081141 Ga0496121_0081141_960_2087 366
1707 3300048927 Ga0496124_0018411 Ga0496124_0018411_430_1578 366
1708 3300049570 Ga0501033_0022128 Ga0501033_0022128_497_1612 366
1709 3300049570 Ga0501033_0063841 Ga0501033_0063841_1211_2341 366
1710 3300049571 Ga0501034_0018188 Ga0501034_0018188_2891_4021 366
1711 3300049572 Ga0501036_0137839 Ga0501036_0137839_343_1530 366
1712 3300049573 Ga0501037_0058556 Ga0501037_0058556_685_1815 366
1713 3300049574 Ga0501038_0069053 Ga0501038_0069053_1157_2287 366
1714 3300049575 Ga0501039_0009457 Ga0501039_0009457_5349_6536 366
1715 3300049576 Ga0501040_0004940 Ga0501040_0004940_7277_8464 366
1716 3300049577 Ga0501041_0010068 Ga0501041_0010068_293_1480 366
1717 3300049578 Ga0501042_0032308 Ga0501042_0032308_231_1418 366
1718 3300049579 Ga0501043_0112963 Ga0501043_0112963_345_1532 366
1719 3300049580 Ga0501046_0192913 Ga0501046_0192913_154_1341 366
1720 3300049581 Ga0501047_0044167 Ga0501047_0044167_1147_2262 366
1721 3300049591 Ga0501075_0011104 Ga0501075_0011104_146_1333 366
1722 3300049592 Ga0501076_0005898 Ga0501076_0005898_7373_8560 366
1723 3300049741 Ga0501079_0005012 Ga0501079_0005012_2909_4096 366
1724 3300049742 Ga0501080_0005517 Ga0501080_0005517_4968_6155 366
1725 3300049743 Ga0501081_0000666 Ga0501081_0000666_6747_7934 366
1726 3300049776 Ga0501280_000378 Ga0501280_000378_10_1125 366
1727 3300049778 Ga0501282_002864 Ga0501282_002864_585_1700 366
1728 3300049822 Ga0501035_0003915 Ga0501035_0003915_2929_4059 366
1729 3300049822 Ga0501035_0024654 Ga0501035_0024654_4016_5131 366
1730 3300049822 Ga0501035_0028978 Ga0501035_0028978_2087_3217 366
1731 3300049823 Ga0501044_0000419 Ga0501044_0000419_40864_41979 366
1732 3300049823 Ga0501044_0002972 Ga0501044_0002972_14460_15590 366
1733 3300049823 Ga0501044_0004821 Ga0501044_0004821_6666_7796 366
1734 3300049823 Ga0501044_0012890 Ga0501044_0012890_4783_5913 366
1735 3300049824 Ga0501045_0118766 Ga0501045_0118766_739_1863 366
1736 3300050489 nmdc:mga03683_21215_c1 nmdc:mga03683_21215_c1_870_1991 366
1737 3300050491 nmdc:mga00v17_4245_c1 nmdc:mga00v17_4245_c1_1755_2888 366
1738 3300050493 nmdc:mga0k408_41198_c1 nmdc:mga0k408_41198_c1_1022_2143 366
1739 3300050496 nmdc:mga07m45_35051_c1 nmdc:mga07m45_35051_c1_1454_2575 366
1740 3300050496 nmdc:mga07m45_64052_c1 nmdc:mga07m45_64052_c1_529_1650 366
1741 3300053139 Ga0500568_0001605 Ga0500568_0001605_10590_11723 366
1742 3300053154 Ga0500619_000394 Ga0500619_000394_2047_3180 366
1743 3300053156 Ga0500622_0012212 Ga0500622_0012212_2644_3792 366
1744 3300053739 Ga0500587_002202 Ga0500587_002202_40_1161 366
1745 3300060353 Ga0501082_0014469 Ga0501082_0014469_914_2101 366
1746 iso_pu_bacteria 2511231004 2511257603 366
1747 iso_pu_bacteria 2511231006 2511263661 366
1748 iso_pu_bacteria 2511231007 2511270263 366
1749 iso_pu_bacteria 2511231008 2511276453 366
1750 iso_pu_bacteria 2511231010 2511291003 366
1751 iso_pu_bacteria 2511231011 2511298476 366
1752 iso_pu_bacteria 2511231012 2511302438 366
1753 iso_pu_bacteria 2511231014 2511314035 366
1754 iso_pu_bacteria 2511231015 2511319994 366
1755 iso_pu_bacteria 2511231016 2511324783 366
1756 iso_pu_bacteria 2511231017 2511330328 366
1757 iso_pu_bacteria 2511231018 2511338018 366
1758 iso_pu_bacteria 2511231019 2511342829 366
1759 iso_pu_bacteria 2511231020 2511348797 366
1760 iso_pu_bacteria 2511231021 2511354863 366
1761 iso_pu_bacteria 2511231022 2511365898 366
1762 iso_pu_bacteria 2511231023 2511369956 366
1763 iso_pu_bacteria 2511231024 2511378090 366
1764 iso_pu_bacteria 2511231031 2511413253 366
1765 iso_pu_bacteria 2511231156 2511823898 366
1766 iso_pu_bacteria 2512047018 2512326843 366
1767 iso_pu_bacteria 2554235231 2555244896 366
1768 iso_pu_bacteria 2554235341 2555669057 366
1769 iso_pu_bacteria 2582580891 2583791475 366
1770 iso_pu_bacteria 2585428057 2587726330 366
1771 iso_pu_bacteria 2585428058 2587731760 366
1772 iso_pu_bacteria 2585428062 2587757637 366
1773 iso_pu_bacteria 2597489887 2597857197 366
1774 iso_pu_bacteria 2597489888 2597864880 366
1775 iso_pu_bacteria 2597489889 2597870756 366
1776 iso_pu_bacteria 2599185160 2599358051 366
1777 iso_pu_bacteria 2599185161 2599361809 366
1778 iso_pu_bacteria 2599185162 2599368130 366
1779 iso_pu_bacteria 2599185163 2599374919 366
1780 iso_pu_bacteria 2599185164 2599383216 366
1781 iso_pu_bacteria 2599185165 2599389401 366
1782 iso_pu_bacteria 2599185166 2599393777 366
1783 iso_pu_bacteria 2599185167 2599398062 366
1784 iso_pu_bacteria 2599185168 2599405544 366
1785 iso_pu_bacteria 2599185179 2599452519 366
1786 iso_pu_bacteria 2599185181 2599464866 366
1787 iso_pu_bacteria 2599185182 2599468418 366
1788 iso_pu_bacteria 2599185185 2599484219 366
1789 iso_pu_bacteria 2599185186 2599493890 366
1790 iso_pu_bacteria 2599185188 2599503147 366
1791 iso_pu_bacteria 2599185189 2599507065 366
1792 iso_pu_bacteria 2599185190 2599516183 366
1793 iso_pu_bacteria 2599185191 2599518387 366
1794 iso_pu_bacteria 2599185212 2599614835 366
1795 iso_pu_bacteria 2599185248 2599769708 366
1796 iso_pu_bacteria 2599185257 2599801869 366
1797 iso_pu_bacteria 2599185288 2599878221 366
1798 iso_pu_bacteria 2599185289 2599889028 366
1799 iso_pu_bacteria 2599185290 2599895519 366
1800 iso_pu_bacteria 2599185291 2599901610 366
1801 iso_pu_bacteria 2599185300 2599933653 366
1802 iso_pu_bacteria 2599185302 2599942834 366
1803 iso_pu_bacteria 2599185303 2599947414 366
1804 iso_pu_bacteria 2599185304 2599953583 366
1805 iso_pu_bacteria 2599185305 2599959269 366
1806 iso_pu_bacteria 2599185306 2599967424 366
1807 iso_pu_bacteria 2599185307 2599970520 366
1808 iso_pu_bacteria 2599185308 2599978666 366
1809 iso_pu_bacteria 2599185309 2599982158 366
1810 iso_pu_bacteria 2599185310 2599988961 366
1811 iso_pu_bacteria 2599185311 2599994716 366
1812 iso_pu_bacteria 2599185312 2599999576 366
1813 iso_pu_bacteria 2599185313 2600007317 366
1814 iso_pu_bacteria 2599185314 2600012734 366
1815 iso_pu_bacteria 2599185315 2600020508 366
1816 iso_pu_bacteria 2599185316 2600025241 366
1817 iso_pu_bacteria 2599185317 2600029750 366
1818 iso_pu_bacteria 2599185318 2600037820 366
1819 iso_pu_bacteria 2599185319 2600042003 366
1820 iso_pu_bacteria 2599185320 2600046910 366
1821 iso_pu_bacteria 2599185321 2600055021 366
1822 iso_pu_bacteria 2599185322 2600057769 366
1823 iso_pu_bacteria 2599185323 2600064784 366
1824 iso_pu_bacteria 2599185324 2600071671 366
1825 iso_pu_bacteria 2599185325 2600076034 366
1826 iso_pu_bacteria 2599185356 2600217597 366
1827 iso_pu_bacteria 2600254930 2600359345 366
1828 iso_pu_bacteria 2600254931 2600365448 366
1829 iso_pu_bacteria 2600255283 2601624911 366
1830 iso_pu_bacteria 2600255296 2601689843 366
1831 iso_pu_bacteria 2600255313 2601777765 366
1832 iso_pu_bacteria 2600255318 2601795820 366
1833 iso_pu_bacteria 2603880185 2606075333 366
1834 iso_pu_bacteria 2603880199 2606128196 366
1835 iso_pu_bacteria 2619619299 2621298527 366
1836 iso_pu_bacteria 2623620443 2624479757 366
1837 iso_pu_bacteria 2623620446 2624491412 366
1838 iso_pu_bacteria 2643221565 2643842573 366
1839 iso_pu_bacteria 2643221571 2643871583 366
1840 iso_pu_bacteria 2643221589 2643952950 366
1841 iso_pu_bacteria 2643221602 2644022712 366
1842 iso_pu_bacteria 2643221633 2644188885 366
1843 iso_pu_bacteria 2643221644 2644245428 366
1844 iso_pu_bacteria 2643221650 2644284962 366
1845 iso_pu_bacteria 2643221713 2644621638 366
1846 iso_pu_bacteria 2651869719 2652543895 366
1847 iso_pu_bacteria 2667528170 2671093479 366
1848 iso_pu_bacteria 2667528171 2671098448 366
1849 iso_pu_bacteria 2667528176 2671128309 366
1850 iso_pu_bacteria 2671180172 2671768818 366
1851 iso_pu_bacteria 2675903420 2677899637 366
1852 iso_pu_bacteria 2675903515 2678264260 366
1853 iso_pu_bacteria 2713897148 2715752528 366
1854 iso_pu_bacteria 2713897149 2715758025 366
1855 iso_pu_bacteria 2721755607 2723249637 366
1856 iso_pu_bacteria 2738541265 2738674563 366
1857 iso_pu_bacteria 2738541282 2738752956 366
1858 iso_pu_bacteria 2738541294 2738808698 366
1859 iso_pu_bacteria 2738541303 2738861997 366
1860 iso_pu_bacteria 2738541309 2738896058 366
1861 iso_pu_bacteria 2738543004 2739199797 366
1862 iso_pu_bacteria 2738543015 2739259438 366
1863 iso_pu_bacteria 2738543025 2739315784 366
1864 iso_pu_bacteria 2740892503 2743736613 366
1865 iso_pu_bacteria 2744054620 2745004715 366
1866 iso_pu_bacteria 2765235841 2765585225 366
1867 iso_pu_bacteria 2773857670 2774121003 366
1868 iso_pu_bacteria 2773857673 2774137338 366
1869 iso_pu_bacteria 2784132063 2784263648 366
1870 iso_pu_bacteria 2791355520 2794596653 366
1871 iso_pu_bacteria 2806310737 2807407431 366
1872 iso_pu_bacteria 2806310745 2807455759 366
1873 iso_pu_bacteria 2808606361 2808857646 366
1874 iso_pu_bacteria 2808606376 2808924738 366
1875 iso_pu_bacteria 2808606377 2808927741 366
1876 iso_pu_bacteria 2808606378 2808937816 366
1877 iso_pu_bacteria 2808606380 2808946840 366
1878 iso_pu_bacteria 2808606381 2808949719 366
1879 iso_pu_bacteria 2808606382 2808960255 366
1880 iso_pu_bacteria 2808606383 2808966130 366
1881 iso_pu_bacteria 2808606385 2808977169 366
1882 iso_pu_bacteria 2808606388 2808992324 366
1883 iso_pu_bacteria 2808606389 2809000980 366
1884 iso_pu_bacteria 2808606445 2809216708 366
1885 iso_pu_bacteria 2816332298 2817492325 366
1886 iso_pu_bacteria 2818991456 2819656458 366
1887 iso_pu_bacteria 2818991464 2819703528 366
1888 iso_pu_bacteria 2825651385 2825656800 366
1889 iso_pu_bacteria 2826581358 2826583070 366
1890 iso_pu_bacteria 2834028612 2834033741 366
1891 iso_pu_bacteria 2842815866 2842817524 366
1892 iso_pu_bacteria 2842826826 2842831124 366
1893 iso_pu_bacteria 2842832357 2842832370 366
1894 iso_pu_bacteria 2842837860 2842842383 366
1895 iso_pu_bacteria 2842843487 2842848649 366
1896 iso_pu_bacteria 2842849001 2842850675 366
1897 iso_pu_bacteria 2842854478 2842854793 366
1898 iso_pu_bacteria 2844665904 2844669496 366
1899 iso_pu_bacteria 2852612431 2852613477 366
1900 iso_pu_bacteria 2852657418 2852658276 366
1901 iso_pu_bacteria 2852667396 2852668787 366
1902 iso_pu_bacteria 2860339153 2860339628 366
1903 iso_pu_bacteria 2860867994 2860871390 366
1904 iso_pu_bacteria 2878029506 2878031769 366
1905 iso_pu_bacteria 2880230671 2880234280 366
1906 iso_pu_bacteria 2904518522 2904523604 366
1907 iso_pu_bacteria 2904550169 2904554300 366
1908 iso_pu_bacteria 2908446538 2908450765 366
1909 iso_pu_bacteria 2912963787 2912967489 366
1910 iso_pu_bacteria 2913036834 2913040737 366
1911 iso_pu_bacteria 2917070673 2917072854 366
1912 iso_pu_bacteria 2919063839 2919068243 366
1913 iso_pu_bacteria 2919155634 2919157322 366
1914 iso_pu_bacteria 2919385768 2919386735 366
1915 iso_pu_bacteria 2919456309 2919456720 366
1916 iso_pu_bacteria 2919481497 2919482145 366
1917 iso_pu_bacteria 2919487758 2919491516 366
1918 iso_pu_bacteria 2919697872 2919701029 366
1919 iso_pu_bacteria 2923153595 2923155629 366
1920 iso_pu_bacteria 2923586266 2923587710 366
1921 iso_pu_bacteria 2929144301 2929148233 366
1922 iso_pu_bacteria 2929189879 2929193410 366
1923 iso_pu_bacteria 2931369376 2931374354 366
1924 iso_pu_bacteria 2931390751 2931394720 366
1925 iso_pu_bacteria 2931396565 2931400487 366
1926 iso_pu_bacteria 2935353572 2935359282 366
1927 iso_pu_bacteria 2939636861 2939639269 366
1928 iso_pu_bacteria 2939651529 2939652997 366
1929 iso_pu_bacteria 2945928738 2945932569 366
1930 iso_pu_bacteria 2945961074 2945962476 366
1931 iso_pu_bacteria 2946006987 2946008812 366
1932 iso_pu_bacteria 2946027586 2946031884 366
1933 iso_pu_bacteria 2947233263 2947238712 366
1934 iso_pu_bacteria 2969304461 2969306563 366
1935 iso_pu_bacteria 2974289157 2974291750 366
1936 iso_pu_bacteria 2984286254 2984290390 366
1937 iso_pu_bacteria 2988728565 2988729880 366
1938 iso_pu_bacteria 2998139840 2998141949 366
1939 iso_pu_bacteria 3007395558 3007401213 366
1940 iso_pu_bacteria 3007419365 3007421599 366
1941 iso_pu_bacteria 3007511990 3007513369 366
1942 iso_pu_bacteria 3007614139 3007618394 366
1943 iso_pu_bacteria 3007619802 3007619863 366
1944 iso_pu_bacteria 3007718800 3007723705 366
1945 iso_pu_bacteria 3007803356 3007807724 366
1946 iso_pu_bacteria 3007855910 3007860669 366
1947 iso_pu_bacteria 3007861166 3007862824 366
1948 iso_pu_bacteria 3007866637 3007868308 366
1949 iso_pu_bacteria 637000220 637319406 366
1950 iso_pu_bacteria 8015687852 8015689887 366
1951 iso_pu_bacteria 8019769354 8019775264 366
1952 iso_pu_bacteria 8019775933 8019778307 366
1953 iso_pu_bacteria 8029995093 8029998749 366
1954 iso_pu_bacteria 8052494512 8052496152 366
1955 iso_pu_bacteria 8054285046 8054288216 366
1956 iso_pu_bacteria 8054347763 8054349184 366
1957 iso_pu_bacteria 8054503363 8054507259 366
1958 iso_pu_bacteria 8054929484 8054932870 366
1959 iso_pu_bacteria 8055770955 8055772992 366
1960 iso_pu_bacteria 8055817908 8055822164 366
1961 iso_pu_bacteria 8055878733 8055879635 366
1962 iso_pu_bacteria 8056115690 8056117865 366
1963 iso_pu_bacteria 8056120720 8056124455 366
1964 iso_pu_bacteria 8056125926 8056127919 366
1965 iso_pu_bacteria 8056131705 8056135649 366
1966 iso_pu_bacteria 8056137416 8056139068 366
1967 iso_pu_bacteria 8056143049 8056147121 366
1968 iso_pu_bacteria 8056148874 8056152950 366
1969 iso_pu_bacteria 8056155041 8056155981 366
1970 iso_pu_bacteria 8056161164 8056161849 366
1971 iso_pu_bacteria 8056166840 8056169052 366
1972 iso_pu_bacteria 8056172158 8056173523 366
1973 iso_pu_bacteria 8056177738 8056183524 366
1974 iso_pu_bacteria 8056569372 8056573007 366
1975 iso_pu_bacteria 8057798959 8057799423 366
1976 3300005289 Ga0065704_10007337 Ga0065704_100073371 367
1977 3300005336 Ga0070680_100060020 Ga0070680_1000600202 367
1978 3300005344 Ga0070661_100016406 Ga0070661_1000164064 367
1979 3300005354 Ga0070675_100173795 Ga0070675_1001737952 367
1980 3300005458 Ga0070681_10004241 Ga0070681_100042418 367
1981 3300005539 Ga0068853_100044919 Ga0068853_1000449192 367
1982 3300005564 Ga0070664_100039434 Ga0070664_1000394345 367
1983 3300014326 Ga0157380_10094634 Ga0157380_100946343 367
1984 3300025901 Ga0207688_10030832 Ga0207688_100308322 367
1985 3300025912 Ga0207707_10006527 Ga0207707_100065272 367
1986 3300025917 Ga0207660_10061073 Ga0207660_100610732 367
1987 3300025921 Ga0207652_10092429 Ga0207652_100924293 367
1988 3300025933 Ga0207706_10092786 Ga0207706_100927863 367
1989 3300025942 Ga0207689_10113631 Ga0207689_101136311 367
1990 3300025945 Ga0207679_10271530 Ga0207679_102715302 367
1991 3300026041 Ga0207639_10033342 Ga0207639_100333422 367
1992 3300026121 Ga0207683_10348761 Ga0207683_103487611 367
1993 3300031241 Ga0265325_10001755 Ga0265325_1000175516 367
1994 3300032133 Ga0316583_10000162 Ga0316583_100001629 367
1995 3300037471 Ga0395905_0082918 Ga0395905_0082918_823_1965 367
1996 3300044712 Ga0453684_0000102 Ga0453684_0000102_29664_30770 367
1997 3300044712 Ga0453684_0004267 Ga0453684_0004267_5071_6183 367
1998 3300044712 Ga0453684_0006939 Ga0453684_0006939_17474_18580 367
1999 3300044712 Ga0453684_0032887 Ga0453684_0032887_2245_3351 367
2000 3300045051 Ga0451576_0000418 Ga0451576_0000418_69001_70107 367
2001 3300045051 Ga0451576_0165428 Ga0451576_0165428_638_1750 367
2002 3300046543 Ga0495645_0067879 Ga0495645_0067879_1080_2204 367
2003 3300053151 Ga0500604_0029274 Ga0500604_0029274_126_1262 367
2004 iso_pu_bacteria 2893684298 2893685245 367
2005 iso_pu_bacteria 2939631187 2939631926 367
2006 3300001979 JGI24740J21852_10007323 JGI24740J21852_100073232 368
2007 3300001989 JGI24739J22299_10009518 JGI24739J22299_100095182 368
2008 3300002244 JGI24742J22300_10015301 JGI24742J22300_100153011 368
2009 3300002704 JGI25155J39150_1000041 JGI25155J39150_100004160 368
2010 3300002705 JGI25156J39149_1000031 JGI25156J39149_100003122 368
2011 3300002738 JGI25154J39366_1000049 JGI25154J39366_100004991 368
2012 3300002741 JGI25157J39369_1000041 JGI25157J39369_100004191 368
2013 3300002774 JGI25150J39212_1007732 JGI25150J39212_10077321 368
2014 3300002774 JGI25150J39212_1014290 JGI25150J39212_10142901 368
2015 3300002987 JGI25159J45721_1004771 JGI25159J45721_10047715 368
2016 3300002987 JGI25159J45721_1005227 JGI25159J45721_10052271 368
2017 3300003187 JGI25151J46595_10003385 JGI25151J46595_100033854 368
2018 3300003187 JGI25151J46595_10006301 JGI25151J46595_100063012 368
2019 3300003187 JGI25151J46595_10007084 JGI25151J46595_100070841 368
2020 3300003187 JGI25151J46595_10037290 JGI25151J46595_100372901 368
2021 3300003187 JGI25151J46595_10049901 JGI25151J46595_100499011 368
2022 3300003354 JGI25160J50197_1000474 JGI25160J50197_100047418 368
2023 3300003354 JGI25160J50197_1020580 JGI25160J50197_10205802 368
2024 3300003374 JGI25161J50226_1000042 JGI25161J50226_100004257 368
2025 3300003374 JGI25161J50226_1006124 JGI25161J50226_10061242 368
2026 3300003578 Ga0006562J51391_1016020 Ga0006562J51391_10160202 368
2027 3300003578 Ga0006562J51391_1016021 Ga0006562J51391_10160212 368
2028 3300003761 Ga0055535_1000318 Ga0055535_10003186 368
2029 3300003762 Ga0055542_1000022 Ga0055542_10000226 368
2030 3300003771 Ga0055526_1009402 Ga0055526_10094021 368
2031 3300003771 Ga0055526_1013907 Ga0055526_10139073 368
2032 3300003771 Ga0055526_1035710 Ga0055526_10357101 368
2033 3300003773 Ga0055537_1000138 Ga0055537_10001383 368
2034 3300003773 Ga0055537_1000434 Ga0055537_10004345 368
2035 3300003773 Ga0055537_1001500 Ga0055537_10015005 368
2036 3300003775 Ga0055524_1000228 Ga0055524_100022819 368
2037 3300003775 Ga0055524_1000271 Ga0055524_100027148 368
2038 3300003775 Ga0055524_1010499 Ga0055524_10104991 368
2039 3300003781 Ga0055536_1004622 Ga0055536_10046224 368
2040 3300003781 Ga0055536_1013007 Ga0055536_10130073 368
2041 3300003781 Ga0055536_1021766 Ga0055536_10217662 368
2042 3300003784 Ga0055534_1001244 Ga0055534_10012445 368
2043 3300003784 Ga0055534_1001329 Ga0055534_100132910 368
2044 3300003784 Ga0055534_1001472 Ga0055534_10014725 368
2045 3300003784 Ga0055534_1004870 Ga0055534_10048701 368
2046 3300003790 Ga0055528_1001186 Ga0055528_10011862 368
2047 3300003790 Ga0055528_1004556 Ga0055528_10045562 368
2048 3300003791 Ga0055530_10000666 Ga0055530_1000066619 368
2049 3300003792 Ga0055540_1000010 Ga0055540_100001065 368
2050 3300003792 Ga0055540_1004586 Ga0055540_10045865 368
2051 3300003794 Ga0055531_10001404 Ga0055531_100014047 368
2052 3300004625 Ga0055543_1001056 Ga0055543_100105610 368
2053 3300005262 Ga0065165_1041015 Ga0065165_10410151 368
2054 3300005262 Ga0065165_1041016 Ga0065165_10410161 368
2055 3300005262 Ga0065165_1047063 Ga0065165_10470631 368
2056 3300005288 Ga0065714_10013434 Ga0065714_100134341 368
2057 3300005289 Ga0065704_10095839 Ga0065704_100958392 368
2058 3300005293 Ga0065715_10196384 Ga0065715_101963842 368
2059 3300005327 Ga0070658_10015497 Ga0070658_100154977 368
2060 3300005327 Ga0070658_10027998 Ga0070658_100279982 368
2061 3300005327 Ga0070658_10199495 Ga0070658_101994952 368
2062 3300005327 Ga0070658_10230213 Ga0070658_102302132 368
2063 3300005328 Ga0070676_10003380 Ga0070676_100033807 368
2064 3300005329 Ga0070683_100097820 Ga0070683_1000978202 368
2065 3300005330 Ga0070690_100047934 Ga0070690_1000479342 368
2066 3300005331 Ga0070670_100004099 Ga0070670_1000040992 368
2067 3300005331 Ga0070670_100010058 Ga0070670_1000100582 368
2068 3300005331 Ga0070670_100020152 Ga0070670_1000201521 368
2069 3300005331 Ga0070670_100020245 Ga0070670_1000202452 368
2070 3300005331 Ga0070670_100042056 Ga0070670_1000420565 368
2071 3300005333 Ga0070677_10032718 Ga0070677_100327182 368
2072 3300005333 Ga0070677_10042262 Ga0070677_100422622 368
2073 3300005334 Ga0068869_100001687 Ga0068869_1000016872 368
2074 3300005334 Ga0068869_100005620 Ga0068869_1000056205 368
2075 3300005334 Ga0068869_100024270 Ga0068869_1000242701 368
2076 3300005334 Ga0068869_100030463 Ga0068869_1000304632 368
2077 3300005334 Ga0068869_100106337 Ga0068869_1001063372 368
2078 3300005335 Ga0070666_10028818 Ga0070666_100288181 368
2079 3300005335 Ga0070666_10190861 Ga0070666_101908612 368
2080 3300005336 Ga0070680_100149073 Ga0070680_1001490731 368
2081 3300005336 Ga0070680_100168611 Ga0070680_1001686112 368
2082 3300005338 Ga0068868_100003808 Ga0068868_1000038085 368
2083 3300005338 Ga0068868_100077888 Ga0068868_1000778882 368
2084 3300005338 Ga0068868_100141224 Ga0068868_1001412242 368
2085 3300005338 Ga0068868_100190031 Ga0068868_1001900312 368
2086 3300005339 Ga0070660_100018748 Ga0070660_1000187483 368
2087 3300005339 Ga0070660_100234046 Ga0070660_1002340461 368
2088 3300005340 Ga0070689_100017136 Ga0070689_1000171362 368
2089 3300005344 Ga0070661_100004253 Ga0070661_1000042535 368
2090 3300005344 Ga0070661_100023950 Ga0070661_1000239504 368
2091 3300005344 Ga0070661_100063264 Ga0070661_1000632642 368
2092 3300005347 Ga0070668_100001724 Ga0070668_10000172416 368
2093 3300005347 Ga0070668_100001943 Ga0070668_1000019438 368
2094 3300005347 Ga0070668_100002430 Ga0070668_1000024309 368
2095 3300005347 Ga0070668_100023333 Ga0070668_1000233333 368
2096 3300005347 Ga0070668_100052778 Ga0070668_1000527782 368
2097 3300005353 Ga0070669_100050841 Ga0070669_1000508412 368
2098 3300005353 Ga0070669_100109831 Ga0070669_1001098313 368
2099 3300005353 Ga0070669_100124536 Ga0070669_1001245362 368
2100 3300005354 Ga0070675_100003664 Ga0070675_1000036642 368
2101 3300005354 Ga0070675_100010007 Ga0070675_1000100072 368
2102 3300005354 Ga0070675_100018728 Ga0070675_1000187283 368
2103 3300005354 Ga0070675_100038440 Ga0070675_1000384402 368
2104 3300005354 Ga0070675_100154260 Ga0070675_1001542603 368
2105 3300005354 Ga0070675_100238334 Ga0070675_1002383342 368
2106 3300005355 Ga0070671_100000488 Ga0070671_10000048821 368
2107 3300005355 Ga0070671_100073967 Ga0070671_1000739672 368
2108 3300005355 Ga0070671_100088969 Ga0070671_1000889693 368
2109 3300005355 Ga0070671_100111872 Ga0070671_1001118721 368
2110 3300005356 Ga0070674_100012709 Ga0070674_1000127095 368
2111 3300005356 Ga0070674_100019632 Ga0070674_1000196325 368
2112 3300005356 Ga0070674_100062601 Ga0070674_1000626012 368
2113 3300005356 Ga0070674_100141590 Ga0070674_1001415902 368
2114 3300005364 Ga0070673_100000080 Ga0070673_1000000803 368
2115 3300005364 Ga0070673_100006472 Ga0070673_1000064723 368
2116 3300005364 Ga0070673_100243796 Ga0070673_1002437961 368
2117 3300005365 Ga0070688_100036993 Ga0070688_1000369933 368
2118 3300005366 Ga0070659_100018291 Ga0070659_1000182913 368
2119 3300005366 Ga0070659_100049532 Ga0070659_1000495322 368
2120 3300005366 Ga0070659_100093059 Ga0070659_1000930592 368
2121 3300005367 Ga0070667_100013717 Ga0070667_1000137177 368
2122 3300005367 Ga0070667_100071663 Ga0070667_1000716632 368
2123 3300005367 Ga0070667_100080779 Ga0070667_1000807792 368
2124 3300005367 Ga0070667_100081196 Ga0070667_1000811962 368
2125 3300005367 Ga0070667_100104466 Ga0070667_1001044662 368
2126 3300005434 Ga0070709_10011034 Ga0070709_100110345 368
2127 3300005435 Ga0070714_100006026 Ga0070714_1000060267 368
2128 3300005435 Ga0070714_100050384 Ga0070714_1000503843 368
2129 3300005435 Ga0070714_100056689 Ga0070714_1000566892 368
2130 3300005437 Ga0070710_10036465 Ga0070710_100364651 368
2131 3300005438 Ga0070701_10006118 Ga0070701_100061181 368
2132 3300005439 Ga0070711_100019617 Ga0070711_1000196173 368
2133 3300005439 Ga0070711_100133029 Ga0070711_1001330293 368
2134 3300005440 Ga0070705_100000108 Ga0070705_10000010817 368
2135 3300005440 Ga0070705_100108819 Ga0070705_1001088192 368
2136 3300005441 Ga0070700_100016130 Ga0070700_1000161305 368
2137 3300005444 Ga0070694_100001290 Ga0070694_1000012909 368
2138 3300005445 Ga0070708_100000012 Ga0070708_10000001228 368
2139 3300005455 Ga0070663_100105909 Ga0070663_1001059092 368
2140 3300005456 Ga0070678_100001964 Ga0070678_1000019649 368
2141 3300005456 Ga0070678_100117937 Ga0070678_1001179372 368
2142 3300005456 Ga0070678_100170188 Ga0070678_1001701882 368
2143 3300005457 Ga0070662_100000568 Ga0070662_10000056817 368
2144 3300005457 Ga0070662_100227904 Ga0070662_1002279041 368
2145 3300005457 Ga0070662_100249325 Ga0070662_1002493251 368
2146 3300005458 Ga0070681_10003650 Ga0070681_1000365011 368
2147 3300005458 Ga0070681_10109996 Ga0070681_101099963 368
2148 3300005459 Ga0068867_100019875 Ga0068867_1000198752 368
2149 3300005459 Ga0068867_100045619 Ga0068867_1000456192 368
2150 3300005459 Ga0068867_100088655 Ga0068867_1000886552 368
2151 3300005459 Ga0068867_100286989 Ga0068867_1002869891 368
2152 3300005466 Ga0070685_10036527 Ga0070685_100365273 368
2153 3300005468 Ga0070707_100008698 Ga0070707_1000086983 368
2154 3300005518 Ga0070699_100019534 Ga0070699_1000195345 368
2155 3300005530 Ga0070679_100015738 Ga0070679_1000157384 368
2156 3300005530 Ga0070679_100028949 Ga0070679_1000289495 368
2157 3300005530 Ga0070679_100105196 Ga0070679_1001051962 368
2158 3300005530 Ga0070679_100167370 Ga0070679_1001673702 368
2159 3300005530 Ga0070679_100206340 Ga0070679_1002063402 368
2160 3300005535 Ga0070684_100055475 Ga0070684_1000554754 368
2161 3300005535 Ga0070684_100123995 Ga0070684_1001239951 368
2162 3300005539 Ga0068853_100001464 Ga0068853_1000014649 368
2163 3300005539 Ga0068853_100015345 Ga0068853_1000153454 368
2164 3300005543 Ga0070672_100004825 Ga0070672_1000048252 368
2165 3300005543 Ga0070672_100030160 Ga0070672_1000301602 368
2166 3300005543 Ga0070672_100081637 Ga0070672_1000816371 368
2167 3300005543 Ga0070672_100118679 Ga0070672_1001186792 368
2168 3300005543 Ga0070672_100158193 Ga0070672_1001581932 368
2169 3300005544 Ga0070686_100070749 Ga0070686_1000707492 368
2170 3300005545 Ga0070695_100000539 Ga0070695_10000053921 368
2171 3300005546 Ga0070696_100000180 Ga0070696_1000001807 368
2172 3300005546 Ga0070696_100002306 Ga0070696_1000023064 368
2173 3300005546 Ga0070696_100035515 Ga0070696_1000355152 368
2174 3300005548 Ga0070665_100038724 Ga0070665_1000387242 368
2175 3300005548 Ga0070665_100049639 Ga0070665_1000496392 368
2176 3300005548 Ga0070665_100061491 Ga0070665_1000614912 368
2177 3300005548 Ga0070665_100139203 Ga0070665_1001392031 368
2178 3300005548 Ga0070665_100142441 Ga0070665_1001424412 368
2179 3300005549 Ga0070704_100016774 Ga0070704_1000167742 368
2180 3300005563 Ga0068855_100000634 Ga0068855_1000006341 368
2181 3300005563 Ga0068855_100038753 Ga0068855_1000387537 368
2182 3300005563 Ga0068855_100082132 Ga0068855_1000821322 368
2183 3300005563 Ga0068855_100167270 Ga0068855_1001672702 368
2184 3300005563 Ga0068855_100533479 Ga0068855_1005334791 368
2185 3300005564 Ga0070664_100000284 Ga0070664_10000028438 368
2186 3300005564 Ga0070664_100005623 Ga0070664_1000056232 368
2187 3300005564 Ga0070664_100024804 Ga0070664_1000248042 368
2188 3300005564 Ga0070664_100034311 Ga0070664_1000343112 368
2189 3300005564 Ga0070664_100037579 Ga0070664_1000375792 368
2190 3300005577 Ga0068857_100011768 Ga0068857_1000117687 368
2191 3300005577 Ga0068857_100013193 Ga0068857_1000131932 368
2192 3300005577 Ga0068857_100116282 Ga0068857_1001162822 368
2193 3300005578 Ga0068854_100013165 Ga0068854_1000131654 368
2194 3300005614 Ga0068856_100000238 Ga0068856_10000023858 368
2195 3300005614 Ga0068856_100013794 Ga0068856_1000137942 368
2196 3300005614 Ga0068856_100044443 Ga0068856_1000444432 368
2197 3300005615 Ga0070702_100004890 Ga0070702_1000048903 368
2198 3300005616 Ga0068852_100000705 Ga0068852_1000007052 368
2199 3300005616 Ga0068852_100005029 Ga0068852_1000050295 368
2200 3300005616 Ga0068852_100009984 Ga0068852_1000099846 368
2201 3300005617 Ga0068859_100030106 Ga0068859_1000301065 368
2202 3300005617 Ga0068859_100061628 Ga0068859_1000616282 368
2203 3300005617 Ga0068859_100160928 Ga0068859_1001609282 368
2204 3300005617 Ga0068859_100214280 Ga0068859_1002142802 368
2205 3300005618 Ga0068864_100047540 Ga0068864_1000475402 368
2206 3300005618 Ga0068864_100059436 Ga0068864_1000594362 368
2207 3300005718 Ga0068866_10092184 Ga0068866_100921841 368
2208 3300005719 Ga0068861_100009654 Ga0068861_1000096543 368
2209 3300005719 Ga0068861_100027128 Ga0068861_1000271282 368
2210 3300005719 Ga0068861_100145897 Ga0068861_1001458972 368
2211 3300005834 Ga0068851_10000160 Ga0068851_1000016013 368
2212 3300005834 Ga0068851_10007982 Ga0068851_100079821 368
2213 3300005834 Ga0068851_10015865 Ga0068851_100158653 368
2214 3300005834 Ga0068851_10017313 Ga0068851_100173132 368
2215 3300005840 Ga0068870_10013891 Ga0068870_100138912 368
2216 3300005841 Ga0068863_100003505 Ga0068863_1000035055 368
2217 3300005841 Ga0068863_100009999 Ga0068863_1000099992 368
2218 3300005841 Ga0068863_100080593 Ga0068863_1000805932 368
2219 3300005842 Ga0068858_100019791 Ga0068858_1000197914 368
2220 3300005842 Ga0068858_100021158 Ga0068858_1000211584 368
2221 3300005842 Ga0068858_100036739 Ga0068858_1000367392 368
2222 3300005843 Ga0068860_100005662 Ga0068860_1000056622 368
2223 3300005843 Ga0068860_100006245 Ga0068860_10000624510 368
2224 3300005843 Ga0068860_100007785 Ga0068860_1000077857 368
2225 3300005843 Ga0068860_100025155 Ga0068860_1000251554 368
2226 3300005843 Ga0068860_100028450 Ga0068860_1000284506 368
2227 3300006038 Ga0075365_10018967 Ga0075365_100189671 368
2228 3300006051 Ga0075364_10007984 Ga0075364_100079844 368
2229 3300006051 Ga0075364_10051873 Ga0075364_100518733 368
2230 3300006177 Ga0075362_10003366 Ga0075362_100033664 368
2231 3300006177 Ga0075362_10019631 Ga0075362_100196312 368
2232 3300006177 Ga0075362_10020316 Ga0075362_100203162 368
2233 3300006177 Ga0075362_10023544 Ga0075362_100235442 368
2234 3300006178 Ga0075367_10040905 Ga0075367_100409051 368
2235 3300006195 Ga0075366_10029410 Ga0075366_100294102 368
2236 3300006195 Ga0075366_10040244 Ga0075366_100402443 368
2237 3300006195 Ga0075366_10043469 Ga0075366_100434693 368
2238 3300006237 Ga0097621_100003209 Ga0097621_1000032095 368
2239 3300006237 Ga0097621_100022068 Ga0097621_1000220683 368
2240 3300006353 Ga0075370_10001401 Ga0075370_100014013 368
2241 3300006353 Ga0075370_10009130 Ga0075370_100091304 368
2242 3300006353 Ga0075370_10042744 Ga0075370_100427442 368
2243 3300006358 Ga0068871_100004593 Ga0068871_1000045932 368
2244 3300006844 Ga0075428_100008854 Ga0075428_1000088546 368
2245 3300006846 Ga0075430_100018051 Ga0075430_1000180514 368
2246 3300006847 Ga0075431_100000427 Ga0075431_10000042726 368
2247 3300006847 Ga0075431_100050350 Ga0075431_1000503503 368
2248 3300006852 Ga0075433_10016198 Ga0075433_100161982 368
2249 3300006871 Ga0075434_100041448 Ga0075434_1000414484 368
2250 3300006871 Ga0075434_100418333 Ga0075434_1004183331 368
2251 3300006880 Ga0075429_100003830 Ga0075429_1000038309 368
2252 3300006880 Ga0075429_100006119 Ga0075429_1000061199 368
2253 3300006880 Ga0075429_100073619 Ga0075429_1000736193 368
2254 3300006881 Ga0068865_100046457 Ga0068865_1000464572 368
2255 3300006931 Ga0097620_100030104 Ga0097620_1000301045 368
2256 3300006931 Ga0097620_100061626 Ga0097620_1000616262 368
2257 3300006931 Ga0097620_100160929 Ga0097620_1001609292 368
2258 3300006931 Ga0097620_100214295 Ga0097620_1002142952 368
2259 3300006946 Ga0079104_1008151 Ga0079104_10081512 368
2260 3300006948 Ga0099826_10013739 Ga0099826_100137397 368
2261 3300007076 Ga0075435_100025216 Ga0075435_1000252164 368
2262 3300007076 Ga0075435_100075759 Ga0075435_1000757592 368
2263 3300009036 Ga0105244_10005300 Ga0105244_100053004 368
2264 3300009093 Ga0105240_10006590 Ga0105240_100065901 368
2265 3300009093 Ga0105240_10026052 Ga0105240_100260523 368
2266 3300009093 Ga0105240_10435442 Ga0105240_104354421 368
2267 3300009094 Ga0111539_10001731 Ga0111539_1000173115 368
2268 3300009094 Ga0111539_10032347 Ga0111539_100323476 368
2269 3300009094 Ga0111539_10465433 Ga0111539_104654331 368
2270 3300009098 Ga0105245_10108891 Ga0105245_101088912 368
2271 3300009147 Ga0114129_10085267 Ga0114129_100852672 368
2272 3300009148 Ga0105243_10002789 Ga0105243_100027894 368
2273 3300009148 Ga0105243_10005689 Ga0105243_100056894 368
2274 3300009174 Ga0105241_10065270 Ga0105241_100652702 368
2275 3300009177 Ga0105248_10055961 Ga0105248_100559611 368
2276 3300009545 Ga0105237_10085194 Ga0105237_100851942 368
2277 3300009551 Ga0105238_10002245 Ga0105238_100022453 368
2278 3300009551 Ga0105238_10051771 Ga0105238_100517712 368
2279 3300009551 Ga0105238_10335129 Ga0105238_103351291 368
2280 3300013100 Ga0157373_10021191 Ga0157373_100211913 368
2281 3300013100 Ga0157373_10025001 Ga0157373_100250011 368
2282 3300013102 Ga0157371_10000174 Ga0157371_1000017436 368
2283 3300013102 Ga0157371_10024139 Ga0157371_100241392 368
2284 3300013104 Ga0157370_10027657 Ga0157370_100276572 368
2285 3300013104 Ga0157370_10030996 Ga0157370_100309964 368
2286 3300013105 Ga0157369_10018644 Ga0157369_100186445 368
2287 3300013307 Ga0157372_10025586 Ga0157372_100255865 368
2288 3300013307 Ga0157372_10073928 Ga0157372_100739284 368
2289 3300013307 Ga0157372_10199954 Ga0157372_101999543 368
2290 3300013308 Ga0157375_10017229 Ga0157375_100172296 368
2291 3300014497 Ga0182008_10006136 Ga0182008_100061363 368
2292 3300014497 Ga0182008_10014350 Ga0182008_100143503 368
2293 3300014969 Ga0157376_10120836 Ga0157376_101208362 368
2294 3300015261 Ga0182006_1008897 Ga0182006_10088973 368
2295 3300015262 Ga0182007_10002147 Ga0182007_100021477 368
2296 3300017792 Ga0163161_10036842 Ga0163161_100368421 368
2297 3300017792 Ga0163161_10243528 Ga0163161_102435281 368
2298 3300021384 Ga0213876_10024329 Ga0213876_100243292 368
2299 3300025206 Ga0209435_100014 Ga0209435_10001491 368
2300 3300025208 Ga0209436_105735 Ga0209436_1057352 368
2301 3300025228 Ga0209672_100852 Ga0209672_1008527 368
2302 3300025229 Ga0209147_101378 Ga0209147_1013786 368
2303 3300025242 Ga0209258_100009 Ga0209258_100009669 368
2304 3300025245 Ga0207425_1002423 Ga0207425_10024231 368
2305 3300025246 Ga0209646_1000001 Ga0209646_100000192 368
2306 3300025250 Ga0209026_1000073 Ga0209026_100007391 368
2307 3300025254 Ga0209148_1000007 Ga0209148_1000007669 368
2308 3300025256 Ga0209759_1000013 Ga0209759_100001392 368
2309 3300025258 Ga0209129_1008178 Ga0209129_10081782 368
2310 3300025263 Ga0209565_1000036 Ga0209565_1000036292 368
2311 3300025263 Ga0209565_1000046 Ga0209565_100004621 368
2312 3300025263 Ga0209565_1000518 Ga0209565_100051819 368
2313 3300025263 Ga0209565_1001213 Ga0209565_10012137 368
2314 3300025263 Ga0209565_1001975 Ga0209565_10019751 368
2315 3300025273 Ga0209673_1000008 Ga0209673_1000008482 368
2316 3300025273 Ga0209673_1000053 Ga0209673_100005357 368
2317 3300025273 Ga0209673_1002050 Ga0209673_100205010 368
2318 3300025284 Ga0209130_1000216 Ga0209130_100021619 368
2319 3300025284 Ga0209130_1000578 Ga0209130_100057819 368
2320 3300025284 Ga0209130_1001433 Ga0209130_10014336 368
2321 3300025284 Ga0209130_1004129 Ga0209130_10041295 368
2322 3300025291 Ga0209675_1000010 Ga0209675_1000010338 368
2323 3300025291 Ga0209675_1000942 Ga0209675_100094216 368
2324 3300025291 Ga0209675_1001188 Ga0209675_100118817 368
2325 3300025291 Ga0209675_1001338 Ga0209675_100133810 368
2326 3300025292 Ga0209676_1000007 Ga0209676_100000791 368
2327 3300025292 Ga0209676_1000108 Ga0209676_100010845 368
2328 3300025292 Ga0209676_1002730 Ga0209676_10027305 368
2329 3300025292 Ga0209676_1002788 Ga0209676_100278810 368
2330 3300025292 Ga0209676_1008915 Ga0209676_10089152 368
2331 3300025294 Ga0209025_1002450 Ga0209025_100245015 368
2332 3300025294 Ga0209025_1002457 Ga0209025_10024577 368
2333 3300025294 Ga0209025_1002889 Ga0209025_10028894 368
2334 3300025294 Ga0209025_1012482 Ga0209025_10124824 368
2335 3300025294 Ga0209025_1017450 Ga0209025_10174504 368
2336 3300025294 Ga0209025_1017725 Ga0209025_10177256 368
2337 3300025294 Ga0209025_1036082 Ga0209025_10360822 368
2338 3300025294 Ga0209025_1040850 Ga0209025_10408502 368
2339 3300025295 Ga0209564_1000633 Ga0209564_100063350 368
2340 3300025295 Ga0209564_1001853 Ga0209564_100185310 368
2341 3300025295 Ga0209564_1014134 Ga0209564_10141344 368
2342 3300025298 Ga0209050_1000002 Ga0209050_1000002303 368
2343 3300025298 Ga0209050_1000003 Ga0209050_10000031417 368
2344 3300025298 Ga0209050_1001046 Ga0209050_100104629 368
2345 3300025298 Ga0209050_1034848 Ga0209050_10348482 368
2346 3300025299 Ga0209256_1000001 Ga0209256_10000011419 368
2347 3300025299 Ga0209256_1000098 Ga0209256_10000986 368
2348 3300025302 Ga0207426_1000038 Ga0207426_10000386 368
2349 3300025302 Ga0207426_1000817 Ga0207426_100081726 368
2350 3300025302 Ga0207426_1003424 Ga0207426_10034244 368
2351 3300025303 Ga0209051_1000002 Ga0209051_100000271 368
2352 3300025303 Ga0209051_1000003 Ga0209051_10000031417 368
2353 3300025303 Ga0209051_1000976 Ga0209051_100097610 368
2354 3300025303 Ga0209051_1003196 Ga0209051_10031964 368
2355 3300025303 Ga0209051_1010309 Ga0209051_10103093 368
2356 3300025304 Ga0209257_1000002 Ga0209257_1000002212 368
2357 3300025304 Ga0209257_1000020 Ga0209257_100002091 368
2358 3300025304 Ga0209257_1003587 Ga0209257_10035877 368
2359 3300025315 Ga0207697_10001001 Ga0207697_100010012 368
2360 3300025321 Ga0207656_10006593 Ga0207656_100065934 368
2361 3300025728 Ga0207655_1003673 Ga0207655_10036734 368
2362 3300025893 Ga0207682_10000156 Ga0207682_1000015613 368
2363 3300025893 Ga0207682_10004086 Ga0207682_100040862 368
2364 3300025898 Ga0207692_10050193 Ga0207692_100501931 368
2365 3300025899 Ga0207642_10051048 Ga0207642_100510482 368
2366 3300025899 Ga0207642_10150172 Ga0207642_101501722 368
2367 3300025900 Ga0207710_10016391 Ga0207710_100163912 368
2368 3300025901 Ga0207688_10008649 Ga0207688_100086492 368
2369 3300025903 Ga0207680_10021098 Ga0207680_100210984 368
2370 3300025906 Ga0207699_10017562 Ga0207699_100175622 368
2371 3300025907 Ga0207645_10001112 Ga0207645_1000111213 368
2372 3300025907 Ga0207645_10001627 Ga0207645_100016272 368
2373 3300025907 Ga0207645_10086265 Ga0207645_100862651 368
2374 3300025908 Ga0207643_10000445 Ga0207643_100004459 368
2375 3300025908 Ga0207643_10002852 Ga0207643_100028527 368
2376 3300025909 Ga0207705_10024322 Ga0207705_100243222 368
2377 3300025909 Ga0207705_10050935 Ga0207705_100509351 368
2378 3300025909 Ga0207705_10078717 Ga0207705_100787172 368
2379 3300025909 Ga0207705_10090670 Ga0207705_100906701 368
2380 3300025910 Ga0207684_10152204 Ga0207684_101522042 368
2381 3300025911 Ga0207654_10091081 Ga0207654_100910812 368
2382 3300025912 Ga0207707_10084046 Ga0207707_100840463 368
2383 3300025913 Ga0207695_10012539 Ga0207695_100125395 368
2384 3300025913 Ga0207695_10023843 Ga0207695_100238432 368
2385 3300025913 Ga0207695_10204405 Ga0207695_102044052 368
2386 3300025914 Ga0207671_10092797 Ga0207671_100927973 368
2387 3300025914 Ga0207671_10107401 Ga0207671_101074012 368
2388 3300025916 Ga0207663_10033735 Ga0207663_100337351 368
2389 3300025916 Ga0207663_10188930 Ga0207663_101889301 368
2390 3300025917 Ga0207660_10240578 Ga0207660_102405782 368
2391 3300025918 Ga0207662_10005690 Ga0207662_100056902 368
2392 3300025919 Ga0207657_10000234 Ga0207657_1000023418 368
2393 3300025919 Ga0207657_10018689 Ga0207657_100186895 368
2394 3300025919 Ga0207657_10057178 Ga0207657_100571782 368
2395 3300025920 Ga0207649_10036098 Ga0207649_100360982 368
2396 3300025920 Ga0207649_10069097 Ga0207649_100690971 368
2397 3300025920 Ga0207649_10113717 Ga0207649_101137172 368
2398 3300025921 Ga0207652_10008656 Ga0207652_100086569 368
2399 3300025921 Ga0207652_10033197 Ga0207652_100331972 368
2400 3300025921 Ga0207652_10072047 Ga0207652_100720472 368
2401 3300025921 Ga0207652_10091327 Ga0207652_100913271 368
2402 3300025921 Ga0207652_10152433 Ga0207652_101524332 368
2403 3300025922 Ga0207646_10003730 Ga0207646_100037308 368
2404 3300025923 Ga0207681_10024951 Ga0207681_100249512 368
2405 3300025923 Ga0207681_10059594 Ga0207681_100595942 368
2406 3300025923 Ga0207681_10306395 Ga0207681_103063951 368
2407 3300025924 Ga0207694_10016228 Ga0207694_100162285 368
2408 3300025925 Ga0207650_10013910 Ga0207650_100139105 368
2409 3300025925 Ga0207650_10031362 Ga0207650_100313623 368
2410 3300025925 Ga0207650_10046965 Ga0207650_100469652 368
2411 3300025925 Ga0207650_10061153 Ga0207650_100611532 368
2412 3300025926 Ga0207659_10025791 Ga0207659_100257912 368
2413 3300025926 Ga0207659_10037177 Ga0207659_100371773 368
2414 3300025926 Ga0207659_10286633 Ga0207659_102866331 368
2415 3300025927 Ga0207687_10055637 Ga0207687_100556372 368
2416 3300025927 Ga0207687_10333747 Ga0207687_103337471 368
2417 3300025928 Ga0207700_10106107 Ga0207700_101061072 368
2418 3300025929 Ga0207664_10023687 Ga0207664_100236872 368
2419 3300025929 Ga0207664_10046620 Ga0207664_100466202 368
2420 3300025929 Ga0207664_10047911 Ga0207664_100479112 368
2421 3300025931 Ga0207644_10021664 Ga0207644_100216642 368
2422 3300025931 Ga0207644_10034352 Ga0207644_100343522 368
2423 3300025931 Ga0207644_10039289 Ga0207644_100392891 368
2424 3300025931 Ga0207644_10100718 Ga0207644_101007182 368
2425 3300025931 Ga0207644_10104938 Ga0207644_101049382 368
2426 3300025931 Ga0207644_10291120 Ga0207644_102911201 368
2427 3300025932 Ga0207690_10000627 Ga0207690_1000062717 368
2428 3300025932 Ga0207690_10082534 Ga0207690_100825342 368
2429 3300025932 Ga0207690_10204595 Ga0207690_102045951 368
2430 3300025933 Ga0207706_10000097 Ga0207706_1000009710 368
2431 3300025933 Ga0207706_10003177 Ga0207706_100031772 368
2432 3300025933 Ga0207706_10030578 Ga0207706_100305784 368
2433 3300025933 Ga0207706_10052295 Ga0207706_100522951 368
2434 3300025933 Ga0207706_10111170 Ga0207706_101111701 368
2435 3300025935 Ga0207709_10001396 Ga0207709_1000139612 368
2436 3300025935 Ga0207709_10001533 Ga0207709_100015336 368
2437 3300025935 Ga0207709_10006336 Ga0207709_100063361 368
2438 3300025935 Ga0207709_10292332 Ga0207709_102923321 368
2439 3300025937 Ga0207669_10066966 Ga0207669_100669662 368
2440 3300025937 Ga0207669_10092702 Ga0207669_100927022 368
2441 3300025938 Ga0207704_10101606 Ga0207704_101016062 368
2442 3300025940 Ga0207691_10000379 Ga0207691_1000037923 368
2443 3300025940 Ga0207691_10001443 Ga0207691_1000144313 368
2444 3300025940 Ga0207691_10002611 Ga0207691_1000261115 368
2445 3300025940 Ga0207691_10033839 Ga0207691_100338395 368
2446 3300025940 Ga0207691_10083473 Ga0207691_100834731 368
2447 3300025941 Ga0207711_10102996 Ga0207711_101029963 368
2448 3300025941 Ga0207711_10226826 Ga0207711_102268262 368
2449 3300025941 Ga0207711_10236964 Ga0207711_102369641 368
2450 3300025942 Ga0207689_10040531 Ga0207689_100405312 368
2451 3300025942 Ga0207689_10077170 Ga0207689_100771701 368
2452 3300025942 Ga0207689_10121857 Ga0207689_101218572 368
2453 3300025944 Ga0207661_10108785 Ga0207661_101087851 368
2454 3300025945 Ga0207679_10014592 Ga0207679_100145921 368
2455 3300025945 Ga0207679_10029495 Ga0207679_100294952 368
2456 3300025945 Ga0207679_10051583 Ga0207679_100515832 368
2457 3300025945 Ga0207679_10125651 Ga0207679_101256512 368
2458 3300025949 Ga0207667_10018784 Ga0207667_100187844 368
2459 3300025949 Ga0207667_10024510 Ga0207667_100245103 368
2460 3300025949 Ga0207667_10056334 Ga0207667_100563342 368
2461 3300025949 Ga0207667_10189972 Ga0207667_101899722 368
2462 3300025949 Ga0207667_10384176 Ga0207667_103841761 368
2463 3300025949 Ga0207667_10401541 Ga0207667_104015411 368
2464 3300025960 Ga0207651_10003368 Ga0207651_100033685 368
2465 3300025960 Ga0207651_10033658 Ga0207651_100336582 368
2466 3300025960 Ga0207651_10191975 Ga0207651_101919751 368
2467 3300025972 Ga0207668_10021244 Ga0207668_100212442 368
2468 3300025972 Ga0207668_10056464 Ga0207668_100564642 368
2469 3300025972 Ga0207668_10109639 Ga0207668_101096392 368
2470 3300025972 Ga0207668_10111859 Ga0207668_101118592 368
2471 3300025981 Ga0207640_10019600 Ga0207640_100196003 368
2472 3300025981 Ga0207640_10049656 Ga0207640_100496561 368
2473 3300025986 Ga0207658_10003819 Ga0207658_100038191 368
2474 3300025986 Ga0207658_10005575 Ga0207658_100055752 368
2475 3300025986 Ga0207658_10074285 Ga0207658_100742852 368
2476 3300025986 Ga0207658_10170607 Ga0207658_101706071 368
2477 3300025986 Ga0207658_10390197 Ga0207658_103901971 368
2478 3300026023 Ga0207677_10095683 Ga0207677_100956831 368
2479 3300026023 Ga0207677_10222553 Ga0207677_102225531 368
2480 3300026023 Ga0207677_10279817 Ga0207677_102798171 368
2481 3300026035 Ga0207703_10034602 Ga0207703_100346023 368
2482 3300026035 Ga0207703_10087658 Ga0207703_100876583 368
2483 3300026035 Ga0207703_10323430 Ga0207703_103234301 368
2484 3300026041 Ga0207639_10017922 Ga0207639_100179223 368
2485 3300026041 Ga0207639_10061127 Ga0207639_100611272 368
2486 3300026041 Ga0207639_10117172 Ga0207639_101171721 368
2487 3300026067 Ga0207678_10001111 Ga0207678_100011112 368
2488 3300026067 Ga0207678_10011773 Ga0207678_100117731 368
2489 3300026067 Ga0207678_10020332 Ga0207678_100203322 368
2490 3300026075 Ga0207708_10000507 Ga0207708_1000050725 368
2491 3300026075 Ga0207708_10041800 Ga0207708_100418004 368
2492 3300026078 Ga0207702_10008298 Ga0207702_100082982 368
2493 3300026078 Ga0207702_10258172 Ga0207702_102581722 368
2494 3300026088 Ga0207641_10003226 Ga0207641_100032265 368
2495 3300026088 Ga0207641_10033258 Ga0207641_100332582 368
2496 3300026088 Ga0207641_10037845 Ga0207641_100378452 368
2497 3300026088 Ga0207641_10132522 Ga0207641_101325222 368
2498 3300026089 Ga0207648_10001454 Ga0207648_1000145418 368
2499 3300026089 Ga0207648_10034496 Ga0207648_100344962 368
2500 3300026089 Ga0207648_10041225 Ga0207648_100412254 368
2501 3300026089 Ga0207648_10054187 Ga0207648_100541872 368
2502 3300026089 Ga0207648_10093563 Ga0207648_100935632 368
2503 3300026095 Ga0207676_10008507 Ga0207676_100085074 368
2504 3300026095 Ga0207676_10023700 Ga0207676_100237002 368
2505 3300026095 Ga0207676_10145554 Ga0207676_101455542 368
2506 3300026095 Ga0207676_10153440 Ga0207676_101534402 368
2507 3300026095 Ga0207676_10329576 Ga0207676_103295761 368
2508 3300026116 Ga0207674_10000302 Ga0207674_1000030231 368
2509 3300026116 Ga0207674_10006175 Ga0207674_100061752 368
2510 3300026116 Ga0207674_10019180 Ga0207674_100191802 368
2511 3300026116 Ga0207674_10025436 Ga0207674_100254361 368
2512 3300026116 Ga0207674_10062082 Ga0207674_100620823 368
2513 3300026116 Ga0207674_10098372 Ga0207674_100983721 368
2514 3300026118 Ga0207675_100007661 Ga0207675_1000076614 368
2515 3300026118 Ga0207675_100043683 Ga0207675_1000436832 368
2516 3300026118 Ga0207675_100054962 Ga0207675_1000549622 368
2517 3300026118 Ga0207675_100383368 Ga0207675_1003833682 368
2518 3300026121 Ga0207683_10001087 Ga0207683_1000108713 368
2519 3300026121 Ga0207683_10002982 Ga0207683_100029825 368
2520 3300026121 Ga0207683_10004264 Ga0207683_100042648 368
2521 3300026121 Ga0207683_10020412 Ga0207683_100204122 368
2522 3300026121 Ga0207683_10024997 Ga0207683_100249972 368
2523 3300026121 Ga0207683_10087225 Ga0207683_100872251 368
2524 3300026142 Ga0207698_10025605 Ga0207698_100256052 368
2525 3300026142 Ga0207698_10276039 Ga0207698_102760391 368
2526 3300027907 Ga0207428_10003029 Ga0207428_100030292 368
2527 3300027907 Ga0207428_10017334 Ga0207428_100173341 368
2528 3300028379 Ga0268266_10017399 Ga0268266_100173992 368
2529 3300028379 Ga0268266_10070292 Ga0268266_100702923 368
2530 3300028380 Ga0268265_10003310 Ga0268265_100033107 368
2531 3300028381 Ga0268264_10005529 Ga0268264_100055291 368
2532 3300028381 Ga0268264_10022198 Ga0268264_100221982 368
2533 3300028381 Ga0268264_10029677 Ga0268264_100296772 368
2534 3300028381 Ga0268264_10111632 Ga0268264_101116322 368
2535 3300028381 Ga0268264_10152367 Ga0268264_101523672 368
2536 3300030736 Ga0316180_1079513 Ga0316180_10795132 368
2537 3300031250 Ga0265331_10004504 Ga0265331_100045049 368
2538 3300031251 Ga0265327_10003678 Ga0265327_100036783 368
2539 3300031251 Ga0265327_10021283 Ga0265327_100212832 368
2540 3300031456 Ga0307513_10000011 Ga0307513_10000011349 368
2541 3300031456 Ga0307513_10000557 Ga0307513_1000055720 368
2542 3300031456 Ga0307513_10009083 Ga0307513_100090837 368
2543 3300031548 Ga0307408_100029205 Ga0307408_1000292052 368
2544 3300031548 Ga0307408_100047789 Ga0307408_1000477892 368
2545 3300031548 Ga0307408_100125979 Ga0307408_1001259792 368
2546 3300031649 Ga0307514_10052588 Ga0307514_100525883 368
2547 3300031691 Ga0316579_10033723 Ga0316579_100337232 368
2548 3300031711 Ga0265314_10005133 Ga0265314_100051332 368
2549 3300031730 Ga0307516_10000033 Ga0307516_1000003388 368
2550 3300031730 Ga0307516_10013118 Ga0307516_100131186 368
2551 3300031731 Ga0307405_10024390 Ga0307405_100243902 368
2552 3300031731 Ga0307405_10051815 Ga0307405_100518152 368
2553 3300031824 Ga0307413_10001172 Ga0307413_100011722 368
2554 3300031824 Ga0307413_10035257 Ga0307413_100352572 368
2555 3300031824 Ga0307413_10088161 Ga0307413_100881613 368
2556 3300031852 Ga0307410_10004386 Ga0307410_100043861 368
2557 3300031852 Ga0307410_10016464 Ga0307410_100164642 368
2558 3300031852 Ga0307410_10051418 Ga0307410_100514181 368
2559 3300031852 Ga0307410_10217706 Ga0307410_102177062 368
2560 3300031901 Ga0307406_10010021 Ga0307406_100100212 368
2561 3300031901 Ga0307406_10034775 Ga0307406_100347752 368
2562 3300031903 Ga0307407_10008901 Ga0307407_100089014 368
2563 3300031911 Ga0307412_10002780 Ga0307412_1000278010 368
2564 3300031911 Ga0307412_10017543 Ga0307412_100175434 368
2565 3300031911 Ga0307412_10021200 Ga0307412_100212002 368
2566 3300031911 Ga0307412_10051436 Ga0307412_100514362 368
2567 3300031911 Ga0307412_10121458 Ga0307412_101214582 368
2568 3300031911 Ga0307412_10201045 Ga0307412_102010451 368
2569 3300031995 Ga0307409_100021074 Ga0307409_1000210742 368
2570 3300031995 Ga0307409_100024696 Ga0307409_1000246964 368
2571 3300031995 Ga0307409_100033030 Ga0307409_1000330303 368
2572 3300031995 Ga0307409_100082791 Ga0307409_1000827912 368
2573 3300032002 Ga0307416_100036523 Ga0307416_1000365233 368
2574 3300032002 Ga0307416_100110632 Ga0307416_1001106322 368
2575 3300032002 Ga0307416_100205779 Ga0307416_1002057791 368
2576 3300032002 Ga0307416_100407944 Ga0307416_1004079441 368
2577 3300032004 Ga0307414_10162823 Ga0307414_101628232 368
2578 3300032005 Ga0307411_10009412 Ga0307411_100094124 368
2579 3300032005 Ga0307411_10011067 Ga0307411_100110672 368
2580 3300032126 Ga0307415_100005148 Ga0307415_1000051486 368
2581 3300032126 Ga0307415_100008810 Ga0307415_1000088102 368
2582 3300032126 Ga0307415_100243882 Ga0307415_1002438821 368
2583 3300037312 Ga0395899_0001726 Ga0395899_0001726_8258_9409 368
2584 3300037418 Ga0395900_0010181 Ga0395900_0010181_3261_4412 368
2585 3300037418 Ga0395900_0016288 Ga0395900_0016288_106_1251 368
2586 3300037418 Ga0395900_0032779 Ga0395900_0032779_1476_2624 368
2587 3300037418 Ga0395900_0091804 Ga0395900_0091804_551_1672 368
2588 3300037466 Ga0395898_0007404 Ga0395898_0007404_10148_11299 368
2589 3300037466 Ga0395898_0049947 Ga0395898_0049947_1792_2946 368
2590 3300037471 Ga0395905_0000407 Ga0395905_0000407_6710_7855 368
2591 3300037471 Ga0395905_0005404 Ga0395905_0005404_10212_11363 368
2592 3300037471 Ga0395905_0017695 Ga0395905_0017695_340_1485 368
2593 3300037471 Ga0395905_0066583 Ga0395905_0066583_730_1875 368
2594 3300037471 Ga0395905_0086481 Ga0395905_0086481_1220_2371 368
2595 3300037471 Ga0395905_0122835 Ga0395905_0122835_1190_2335 368
2596 3300038443 Ga0395901_0017987 Ga0395901_0017987_3051_4202 368
2597 3300038443 Ga0395901_0089915 Ga0395901_0089915_121_1242 368
2598 3300038726 Ga0400490_10538 Ga0400490_10538_4632_5744 368
2599 3300039437 Ga0436365_1835414 Ga0436365_1835414_459_1595 368
2600 3300041404 Ga0439436_0004259 Ga0439436_0004259_2195_3337 368
2601 3300041411 Ga0439466_0024004 Ga0439466_0024004_839_1981 368
2602 3300041413 Ga0439465_0003593 Ga0439465_0003593_2612_3754 368
2603 3300041999 Ga0439433_0005244 Ga0439433_0005244_506_1648 368
2604 3300042006 Ga0439432_005105 Ga0439432_005105_2805_3947 368
2605 3300042007 Ga0439449_0000273 Ga0439449_0000273_11831_12973 368
2606 3300042007 Ga0439449_0010454 Ga0439449_0010454_719_1861 368
2607 3300042134 Ga0450898_007031 Ga0450898_007031_190_1332 368
2608 3300042156 Ga0439446_0005918 Ga0439446_0005918_144_1292 368
2609 3300042184 Ga0450908_000485 Ga0450908_000485_2580_3722 368
2610 3300042435 Ga0439434_0002822 Ga0439434_0002822_1408_2550 368
2611 3300042435 Ga0439434_0014046 Ga0439434_0014046_1081_2223 368
2612 3300042436 Ga0439435_0010437 Ga0439435_0010437_966_2120 368
2613 3300042531 Ga0450918_002692 Ga0450918_002692_697_1839 368
2614 3300042876 Ga0451577_0005521 Ga0451577_0005521_851_1996 368
2615 3300044656 Ga0466969_0037128 Ga0466969_0037128_814_1959 368
2616 3300044656 Ga0466969_0052143 Ga0466969_0052143_511_1662 368
2617 3300045051 Ga0451576_0163759 Ga0451576_0163759_411_1559 368
2618 3300046512 Ga0495610_0094750 Ga0495610_0094750_172_1314 368
2619 3300046518 Ga0495631_0002491 Ga0495631_0002491_6986_8128 368
2620 3300046615 Ga0495656_0001561 Ga0495656_0001561_637_1779 368
2621 3300046660 Ga0495625_0000870 Ga0495625_0000870_39297_40439 368
2622 3300046660 Ga0495625_0086371 Ga0495625_0086371_42_1184 368
2623 3300048903 Ga0496100_0039523 Ga0496100_0039523_1449_2591 368
2624 3300048904 Ga0496101_0136874 Ga0496101_0136874_207_1349 368
2625 3300048905 Ga0496102_0013664 Ga0496102_0013664_1976_3118 368
2626 3300048905 Ga0496102_0017633 Ga0496102_0017633_870_1979 368
2627 3300048906 Ga0496103_0109065 Ga0496103_0109065_391_1500 368
2628 3300048908 Ga0496105_0103751 Ga0496105_0103751_696_1838 368
2629 3300048909 Ga0496106_0006945 Ga0496106_0006945_6332_7441 368
2630 3300048909 Ga0496106_0277294 Ga0496106_0277294_183_1304 368
2631 3300048910 Ga0496107_0008205 Ga0496107_0008205_1933_3042 368
2632 3300048912 Ga0496109_0277465 Ga0496109_0277465_262_1404 368
2633 3300048914 Ga0496111_0080311 Ga0496111_0080311_325_1467 368
2634 3300048915 Ga0496112_0001194 Ga0496112_0001194_2294_3421 368
2635 3300048916 Ga0496113_0045379 Ga0496113_0045379_1453_2595 368
2636 3300048919 Ga0496116_0064506 Ga0496116_0064506_1231_2340 368
2637 3300048920 Ga0496117_0023689 Ga0496117_0023689_1628_2773 368
2638 3300048924 Ga0496121_0114940 Ga0496121_0114940_119_1261 368
2639 3300049574 Ga0501038_0126007 Ga0501038_0126007_803_1948 368
2640 3300049578 Ga0501042_0108481 Ga0501042_0108481_688_1809 368
2641 3300049579 Ga0501043_0021241 Ga0501043_0021241_2499_3644 368
2642 3300049580 Ga0501046_0264053 Ga0501046_0264053_80_1213 368
2643 3300049583 Ga0501067_0048559 Ga0501067_0048559_472_1605 368
2644 3300049585 Ga0501069_0030692 Ga0501069_0030692_73_1206 368
2645 3300049586 Ga0501070_0024508 Ga0501070_0024508_2660_3793 368
2646 3300049587 Ga0501071_0031635 Ga0501071_0031635_487_1641 368
2647 3300049588 Ga0501072_0024742 Ga0501072_0024742_1264_2397 368
2648 3300049588 Ga0501072_0077408 Ga0501072_0077408_414_1568 368
2649 3300049589 Ga0501073_0022806 Ga0501073_0022806_1603_2736 368
2650 3300049592 Ga0501076_0042824 Ga0501076_0042824_1352_2473 368
2651 3300049592 Ga0501076_0216884 Ga0501076_0216884_270_1391 368
2652 3300049649 Ga0501198_000004 Ga0501198_000004_56022_57164 368
2653 3300049662 Ga0501222_000038 Ga0501222_000038_17834_18976 368
2654 3300049705 Ga0501225_0003990 Ga0501225_0003990_1949_3091 368
2655 3300049742 Ga0501080_0008234 Ga0501080_0008234_2658_3791 368
2656 3300049742 Ga0501080_0045006 Ga0501080_0045006_1246_2391 368
2657 3300049742 Ga0501080_0294988 Ga0501080_0294988_217_1350 368
2658 3300049744 Ga0501083_0156158 Ga0501083_0156158_227_1360 368
2659 3300049822 Ga0501035_0253617 Ga0501035_0253617_283_1416 368
2660 3300050489 nmdc:mga03683_6401_c1 nmdc:mga03683_6401_c1_1030_2172 368
2661 3300050490 nmdc:mga03n38_16858_c1 nmdc:mga03n38_16858_c1_1627_2769 368
2662 3300050492 nmdc:mga0yw44_49460_c1 nmdc:mga0yw44_49460_c1_1236_2378 368
2663 3300050492 nmdc:mga0yw44_52474_c1 nmdc:mga0yw44_52474_c1_1192_2364 368
2664 3300050496 nmdc:mga07m45_12471_c1 nmdc:mga07m45_12471_c1_2418_3563 368
2665 3300050496 nmdc:mga07m45_1275_c1 nmdc:mga07m45_1275_c1_2202_3344 368
2666 3300050496 nmdc:mga07m45_4153_c1 nmdc:mga07m45_4153_c1_1964_3106 368
2667 3300050496 nmdc:mga07m45_4548_c1 nmdc:mga07m45_4548_c1_1544_2686 368
2668 3300050496 nmdc:mga07m45_46645_c2 nmdc:mga07m45_46645_c2_464_1606 368
2669 3300050507 nmdc:mga05p37_352353_c1 nmdc:mga05p37_352353_c1_363_1520 368
2670 3300050508 nmdc:mga09592_13427_c1 nmdc:mga09592_13427_c1_2926_4083 368
2671 3300050511 nmdc:mga08y16_171440_c1 nmdc:mga08y16_171440_c1_719_1876 368
2672 3300050511 nmdc:mga08y16_25043_c1 nmdc:mga08y16_25043_c1_4892_6073 368
2673 3300050511 nmdc:mga08y16_72625_c1 nmdc:mga08y16_72625_c1_191_1300 368
2674 3300050511 nmdc:mga08y16_873_c1 nmdc:mga08y16_873_c1_16459_17613 368
2675 3300050512 nmdc:mga0n895_361065_c1 nmdc:mga0n895_361065_c1_230_1342 368
2676 3300050513 nmdc:mga0rr50_181472_c1 nmdc:mga0rr50_181472_c1_87_1199 368
2677 3300050513 nmdc:mga0rr50_49023_c1 nmdc:mga0rr50_49023_c1_1296_2405 368
2678 3300050515 nmdc:mga0a205_17391_c1 nmdc:mga0a205_17391_c1_3158_4270 368
2679 3300053117 Ga0500593_000173 Ga0500593_000173_369_1511 368
2680 3300053118 Ga0500594_0006579 Ga0500594_0006579_71_1213 368
2681 3300053153 Ga0500616_0011259 Ga0500616_0011259_3676_4818 368
2682 3300053730 Ga0500645_005621 Ga0500645_005621_948_2087 368
2683 3300053730 Ga0500645_016712 Ga0500645_016712_572_1711 368
2684 3300054114 Ga0501084_0117524 Ga0501084_0117524_157_1290 368
2685 3300060353 Ga0501082_0262554 Ga0501082_0262554_150_1325 368
2686 iso_pu_bacteria 2511231002 2511244155 368
2687 iso_pu_bacteria 2513020051 2513227821 368
2688 iso_pu_bacteria 2599185214 2599625433 368
2689 iso_pu_bacteria 2599185226 2599673446 368
2690 iso_pu_bacteria 2599185227 2599683116 368
2691 iso_pu_bacteria 2599185229 2599695396 368
2692 iso_pu_bacteria 2643221628 2644162415 368
2693 iso_pu_bacteria 2643221658 2644324584 368
2694 iso_pu_bacteria 2643221672 2644396436 368
2695 iso_pu_bacteria 2643221683 2644464532 368
2696 iso_pu_bacteria 2818991446 2819599539 368
2697 iso_pu_bacteria 2831265667 2831271188 368
2698 iso_pu_bacteria 2838054893 2838055776 368
2699 iso_pu_bacteria 2842677519 2842682025 368
2700 iso_pu_bacteria 2842733646 2842734328 368
2701 iso_pu_bacteria 2885192300 2885197913 368
2702 iso_pu_bacteria 2885198086 2885200671 368
2703 iso_pu_bacteria 2885211737 2885214546 368
2704 iso_pu_bacteria 2899924645 2899927831 368
2705 iso_pu_bacteria 2904449895 2904450500 368
2706 iso_pu_bacteria 2904456579 2904456676 368
2707 iso_pu_bacteria 2904541872 2904544478 368
2708 iso_pu_bacteria 2919462493 2919462961 368
2709 iso_pu_bacteria 2928037797 2928041891 368
2710 iso_pu_bacteria 2928044640 2928049455 368
2711 iso_pu_bacteria 2928051484 2928051869 368
2712 iso_pu_bacteria 2928064002 2928065438 368
2713 iso_pu_bacteria 2928084124 2928086673 368
2714 iso_pu_bacteria 2929160207 2929161952 368
2715 iso_pu_bacteria 2929520902 2929521215 368
2716 iso_pu_bacteria 2945909444 2945913637 368
2717 iso_pu_bacteria 2945945610 2945949235 368
2718 iso_pu_bacteria 2945984333 2945990965 368
2719 iso_pu_bacteria 2954767861 2954768599 368
2720 3300005330 Ga0070690_100030157 Ga0070690_1000301572 369
2721 3300005330 Ga0070690_100088004 Ga0070690_1000880041 369
2722 3300005331 Ga0070670_100023633 Ga0070670_1000236332 369
2723 3300005335 Ga0070666_10124419 Ga0070666_101244192 369
2724 3300005336 Ga0070680_100171546 Ga0070680_1001715461 369
2725 3300005337 Ga0070682_100024802 Ga0070682_1000248024 369
2726 3300005338 Ga0068868_100055464 Ga0068868_1000554642 369
2727 3300005339 Ga0070660_100013062 Ga0070660_1000130624 369
2728 3300005340 Ga0070689_100002878 Ga0070689_1000028785 369
2729 3300005340 Ga0070689_100007038 Ga0070689_1000070386 369
2730 3300005340 Ga0070689_100059588 Ga0070689_1000595882 369
2731 3300005345 Ga0070692_10008397 Ga0070692_100083972 369
2732 3300005347 Ga0070668_100002034 Ga0070668_1000020343 369
2733 3300005353 Ga0070669_100094559 Ga0070669_1000945592 369
2734 3300005354 Ga0070675_100025419 Ga0070675_1000254193 369
2735 3300005355 Ga0070671_100041232 Ga0070671_1000412322 369
2736 3300005364 Ga0070673_100009772 Ga0070673_1000097724 369
2737 3300005365 Ga0070688_100000431 Ga0070688_10000043117 369
2738 3300005366 Ga0070659_100192891 Ga0070659_1001928912 369
2739 3300005367 Ga0070667_100085610 Ga0070667_1000856102 369
2740 3300005435 Ga0070714_100005049 Ga0070714_1000050492 369
2741 3300005435 Ga0070714_100233217 Ga0070714_1002332171 369
2742 3300005436 Ga0070713_100000049 Ga0070713_10000004917 369
2743 3300005438 Ga0070701_10005119 Ga0070701_100051192 369
2744 3300005439 Ga0070711_100017761 Ga0070711_1000177612 369
2745 3300005440 Ga0070705_100049980 Ga0070705_1000499802 369
2746 3300005441 Ga0070700_100006243 Ga0070700_1000062432 369
2747 3300005444 Ga0070694_100051827 Ga0070694_1000518271 369
2748 3300005445 Ga0070708_100338356 Ga0070708_1003383561 369
2749 3300005455 Ga0070663_100108324 Ga0070663_1001083242 369
2750 3300005458 Ga0070681_10020863 Ga0070681_100208635 369
2751 3300005459 Ga0068867_100034777 Ga0068867_1000347771 369
2752 3300005466 Ga0070685_10000733 Ga0070685_1000073315 369
2753 3300005468 Ga0070707_100144388 Ga0070707_1001443882 369
2754 3300005518 Ga0070699_100054335 Ga0070699_1000543352 369
2755 3300005530 Ga0070679_100032744 Ga0070679_1000327443 369
2756 3300005530 Ga0070679_100152027 Ga0070679_1001520272 369
2757 3300005535 Ga0070684_100381885 Ga0070684_1003818851 369
2758 3300005544 Ga0070686_100014018 Ga0070686_1000140182 369
2759 3300005547 Ga0070693_100006997 Ga0070693_1000069973 369
2760 3300005547 Ga0070693_100017547 Ga0070693_1000175472 369
2761 3300005548 Ga0070665_100054971 Ga0070665_1000549712 369
2762 3300005548 Ga0070665_100209885 Ga0070665_1002098852 369
2763 3300005549 Ga0070704_100007805 Ga0070704_1000078052 369
2764 3300005549 Ga0070704_100021921 Ga0070704_1000219213 369
2765 3300005549 Ga0070704_100045028 Ga0070704_1000450282 369
2766 3300005549 Ga0070704_100046365 Ga0070704_1000463652 369
2767 3300005563 Ga0068855_100012566 Ga0068855_1000125668 369
2768 3300005563 Ga0068855_100195259 Ga0068855_1001952591 369
2769 3300005563 Ga0068855_100197180 Ga0068855_1001971802 369
2770 3300005577 Ga0068857_100054053 Ga0068857_1000540532 369
2771 3300005577 Ga0068857_100132228 Ga0068857_1001322283 369
2772 3300005614 Ga0068856_100031216 Ga0068856_1000312165 369
2773 3300005615 Ga0070702_100008271 Ga0070702_1000082711 369
2774 3300005616 Ga0068852_100003098 Ga0068852_10000309810 369
2775 3300005616 Ga0068852_100007035 Ga0068852_1000070353 369
2776 3300005616 Ga0068852_100202072 Ga0068852_1002020722 369
2777 3300005617 Ga0068859_100008875 Ga0068859_1000088753 369
2778 3300005617 Ga0068859_100009804 Ga0068859_1000098044 369
2779 3300005617 Ga0068859_100131691 Ga0068859_1001316912 369
2780 3300005718 Ga0068866_10001963 Ga0068866_100019635 369
2781 3300005719 Ga0068861_100123584 Ga0068861_1001235842 369
2782 3300005834 Ga0068851_10001255 Ga0068851_1000125513 369
2783 3300005841 Ga0068863_100006175 Ga0068863_1000061752 369
2784 3300005842 Ga0068858_100001168 Ga0068858_1000011687 369
2785 3300005842 Ga0068858_100016675 Ga0068858_1000166753 369
2786 3300005842 Ga0068858_100047116 Ga0068858_1000471162 369
2787 3300005843 Ga0068860_100054658 Ga0068860_1000546583 369
2788 3300005985 Ga0081539_10043559 Ga0081539_100435592 369
2789 3300006051 Ga0075364_10129903 Ga0075364_101299032 369
2790 3300006175 Ga0070712_100009598 Ga0070712_1000095983 369
2791 3300006177 Ga0075362_10098464 Ga0075362_100984641 369
2792 3300006195 Ga0075366_10011474 Ga0075366_100114742 369
2793 3300006237 Ga0097621_100036523 Ga0097621_1000365232 369
2794 3300006358 Ga0068871_100015028 Ga0068871_1000150284 369
2795 3300006358 Ga0068871_100022915 Ga0068871_1000229152 369
2796 3300006844 Ga0075428_100017952 Ga0075428_1000179522 369
2797 3300006846 Ga0075430_100030341 Ga0075430_1000303414 369
2798 3300006847 Ga0075431_100003962 Ga0075431_1000039625 369
2799 3300006847 Ga0075431_100014405 Ga0075431_1000144054 369
2800 3300006871 Ga0075434_100184161 Ga0075434_1001841611 369
2801 3300006880 Ga0075429_100000003 Ga0075429_100000003115 369
2802 3300006931 Ga0097620_100008875 Ga0097620_1000088753 369
2803 3300006931 Ga0097620_100009804 Ga0097620_1000098044 369
2804 3300006931 Ga0097620_100131690 Ga0097620_1001316902 369
2805 3300007076 Ga0075435_100177312 Ga0075435_1001773122 369
2806 3300009093 Ga0105240_10066924 Ga0105240_100669243 369
2807 3300009094 Ga0111539_10001974 Ga0111539_1000197421 369
2808 3300009147 Ga0114129_10017213 Ga0114129_100172136 369
2809 3300009147 Ga0114129_10038447 Ga0114129_100384475 369
2810 3300009147 Ga0114129_10235036 Ga0114129_102350361 369
2811 3300009148 Ga0105243_10186536 Ga0105243_101865362 369
2812 3300009148 Ga0105243_10390318 Ga0105243_103903181 369
2813 3300009176 Ga0105242_10033656 Ga0105242_100336562 369
2814 3300009177 Ga0105248_10064423 Ga0105248_100644232 369
2815 3300009177 Ga0105248_10153327 Ga0105248_101533273 369
2816 3300009551 Ga0105238_10047726 Ga0105238_100477262 369
2817 3300009551 Ga0105238_10047864 Ga0105238_100478642 369
2818 3300013104 Ga0157370_10059170 Ga0157370_100591702 369
2819 3300013104 Ga0157370_10064927 Ga0157370_100649272 369
2820 3300013105 Ga0157369_10019593 Ga0157369_100195935 369
2821 3300013105 Ga0157369_10057068 Ga0157369_100570684 369
2822 3300013296 Ga0157374_10000600 Ga0157374_1000060020 369
2823 3300013296 Ga0157374_10019413 Ga0157374_100194135 369
2824 3300013306 Ga0163162_10111874 Ga0163162_101118742 369
2825 3300013307 Ga0157372_10023447 Ga0157372_100234473 369
2826 3300013307 Ga0157372_10032003 Ga0157372_100320033 369
2827 3300013307 Ga0157372_10058323 Ga0157372_100583232 369
2828 3300013307 Ga0157372_10180277 Ga0157372_101802772 369
2829 3300013307 Ga0157372_10189282 Ga0157372_101892822 369
2830 3300014326 Ga0157380_10221022 Ga0157380_102210221 369
2831 3300017792 Ga0163161_10071418 Ga0163161_100714182 369
2832 3300025321 Ga0207656_10003515 Ga0207656_100035154 369
2833 3300025898 Ga0207692_10025121 Ga0207692_100251212 369
2834 3300025903 Ga0207680_10031705 Ga0207680_100317052 369
2835 3300025909 Ga0207705_10046680 Ga0207705_100466801 369
2836 3300025910 Ga0207684_10009722 Ga0207684_100097223 369
2837 3300025912 Ga0207707_10131426 Ga0207707_101314263 369
2838 3300025913 Ga0207695_10023511 Ga0207695_100235112 369
2839 3300025913 Ga0207695_10026262 Ga0207695_100262622 369
2840 3300025915 Ga0207693_10000913 Ga0207693_100009132 369
2841 3300025916 Ga0207663_10028531 Ga0207663_100285312 369
2842 3300025919 Ga0207657_10022056 Ga0207657_100220562 369
2843 3300025921 Ga0207652_10216129 Ga0207652_102161292 369
2844 3300025923 Ga0207681_10062354 Ga0207681_100623542 369
2845 3300025924 Ga0207694_10022482 Ga0207694_100224824 369
2846 3300025925 Ga0207650_10004376 Ga0207650_100043767 369
2847 3300025927 Ga0207687_10008206 Ga0207687_100082063 369
2848 3300025927 Ga0207687_10054860 Ga0207687_100548601 369
2849 3300025927 Ga0207687_10119217 Ga0207687_101192172 369
2850 3300025928 Ga0207700_10004038 Ga0207700_100040387 369
2851 3300025928 Ga0207700_10015961 Ga0207700_100159615 369
2852 3300025935 Ga0207709_10174546 Ga0207709_101745462 369
2853 3300025936 Ga0207670_10016406 Ga0207670_100164062 369
2854 3300025936 Ga0207670_10069548 Ga0207670_100695481 369
2855 3300025938 Ga0207704_10070761 Ga0207704_100707612 369
2856 3300025941 Ga0207711_10005367 Ga0207711_100053676 369
2857 3300025941 Ga0207711_10105929 Ga0207711_101059292 369
2858 3300025945 Ga0207679_10107972 Ga0207679_101079722 369
2859 3300025949 Ga0207667_10012400 Ga0207667_100124009 369
2860 3300025949 Ga0207667_10084145 Ga0207667_100841452 369
2861 3300025949 Ga0207667_10087708 Ga0207667_100877082 369
2862 3300025961 Ga0207712_10123361 Ga0207712_101233612 369
2863 3300025961 Ga0207712_10243709 Ga0207712_102437091 369
2864 3300025972 Ga0207668_10004059 Ga0207668_100040598 369
2865 3300026023 Ga0207677_10019405 Ga0207677_100194052 369
2866 3300026035 Ga0207703_10023553 Ga0207703_100235533 369
2867 3300026035 Ga0207703_10127492 Ga0207703_101274922 369
2868 3300026041 Ga0207639_10028968 Ga0207639_100289685 369
2869 3300026067 Ga0207678_10072223 Ga0207678_100722232 369
2870 3300026075 Ga0207708_10001176 Ga0207708_100011762 369
2871 3300026088 Ga0207641_10038623 Ga0207641_100386232 369
2872 3300026089 Ga0207648_10001816 Ga0207648_1000181618 369
2873 3300026116 Ga0207674_10016443 Ga0207674_100164438 369
2874 3300026116 Ga0207674_10320326 Ga0207674_103203262 369
2875 3300026118 Ga0207675_100003355 Ga0207675_1000033555 369
2876 3300026118 Ga0207675_100093683 Ga0207675_1000936832 369
2877 3300026142 Ga0207698_10003673 Ga0207698_100036732 369
2878 3300027682 Ga0209971_1013619 Ga0209971_10136192 369
2879 3300027907 Ga0207428_10127106 Ga0207428_101271062 369
2880 3300028379 Ga0268266_10160234 Ga0268266_101602342 369
2881 3300028381 Ga0268264_10095128 Ga0268264_100951281 369
2882 3300031239 Ga0265328_10000002 Ga0265328_10000002176 369
2883 3300031251 Ga0265327_10005658 Ga0265327_100056585 369
2884 3300035117 Ga0373953_0065934 Ga0373953_0065934_324_1454 369
2885 3300035692 Ga0373935_0007754 Ga0373935_0007754_3146_4267 369
2886 3300035695 Ga0373927_0001550 Ga0373927_0001550_11621_12811 369
2887 3300035695 Ga0373927_0068385 Ga0373927_0068385_744_1880 369
2888 3300035725 Ga0373947_0117200 Ga0373947_0117200_361_1503 369
2889 3300037068 Ga0373925_0011334 Ga0373925_0011334_3360_4481 369
2890 3300037068 Ga0373925_0047135 Ga0373925_0047135_1739_2875 369
2891 3300037471 Ga0395905_0045815 Ga0395905_0045815_2784_3926 369
2892 3300045051 Ga0451576_0011954 Ga0451576_0011954_8373_9503 369
2893 3300045976 Ga0466967_0347094 Ga0466967_0347094_66_1217 369
2894 3300046472 Ga0495580_0080841 Ga0495580_0080841_618_1793 369
2895 3300048911 Ga0496108_0007193 Ga0496108_0007193_65_1177 369
2896 3300048912 Ga0496109_0130389 Ga0496109_0130389_234_1346 369
2897 3300048913 Ga0496110_0100919 Ga0496110_0100919_371_1483 369
2898 3300048917 Ga0496114_0004990 Ga0496114_0004990_181_1293 369
2899 3300049569 Ga0501032_0046669 Ga0501032_0046669_883_1995 369
2900 3300049575 Ga0501039_0029343 Ga0501039_0029343_1956_3068 369
2901 3300049576 Ga0501040_0000023 Ga0501040_0000023_31542_32654 369
2902 3300049578 Ga0501042_0000263 Ga0501042_0000263_719_1831 369
2903 3300049578 Ga0501042_0051821 Ga0501042_0051821_134_1246 369
2904 3300049583 Ga0501067_0078301 Ga0501067_0078301_366_1541 369
2905 3300049584 Ga0501068_0026085 Ga0501068_0026085_2186_3325 369
2906 3300049585 Ga0501069_0064120 Ga0501069_0064120_747_1886 369
2907 3300049586 Ga0501070_0005677 Ga0501070_0005677_105_1244 369
2908 3300049589 Ga0501073_0000189 Ga0501073_0000189_35466_36605 369
2909 3300049590 Ga0501074_0001067 Ga0501074_0001067_8761_9900 369
2910 3300049741 Ga0501079_0019840 Ga0501079_0019840_1626_2765 369
2911 3300049741 Ga0501079_0259604 Ga0501079_0259604_89_1246 369
2912 3300049744 Ga0501083_0004415 Ga0501083_0004415_7832_8971 369
2913 3300050489 nmdc:mga03683_55821_c1 nmdc:mga03683_55821_c1_457_1578 369
2914 3300050491 nmdc:mga00v17_47086_c1 nmdc:mga00v17_47086_c1_1430_2551 369
2915 3300050493 nmdc:mga0k408_12277_c1 nmdc:mga0k408_12277_c1_1248_2390 369
2916 3300050507 nmdc:mga05p37_127918_c1 nmdc:mga05p37_127918_c1_1648_2823 369
2917 3300050507 nmdc:mga05p37_976_c1 nmdc:mga05p37_976_c1_9965_11095 369
2918 3300050508 nmdc:mga09592_355_c1 nmdc:mga09592_355_c1_27987_29117 369
2919 3300050508 nmdc:mga09592_47591_c1 nmdc:mga09592_47591_c1_1760_2899 369
2920 3300050509 nmdc:mga0qj67_22259_c1 nmdc:mga0qj67_22259_c1_1234_2358 369
2921 3300050510 nmdc:mga06r32_1279_c1 nmdc:mga06r32_1279_c1_15069_16199 369
2922 3300050511 nmdc:mga08y16_182274_c1 nmdc:mga08y16_182274_c1_25_1161 369
2923 3300050511 nmdc:mga08y16_591_c1 nmdc:mga08y16_591_c1_24890_26029 369
2924 3300050512 nmdc:mga0n895_252610_c1 nmdc:mga0n895_252610_c1_118_1293 369
2925 3300050512 nmdc:mga0n895_63369_c1 nmdc:mga0n895_63369_c1_965_2104 369
2926 3300053156 Ga0500622_0000001 Ga0500622_0000001_557788_558900 369
2927 3300053177 Ga0500636_0000058 Ga0500636_0000058_48933_50060 369
2928 3300054114 Ga0501084_0148374 Ga0501084_0148374_805_1944 369
2929 2124908027 MRS2a_Contig_6331 MRS2a_00230180 370
2930 3300002737 JGI25162J39368_1000795 JGI25162J39368_100079516 370
2931 3300002737 JGI25162J39368_1000824 JGI25162J39368_100082414 370
2932 3300002738 JGI25154J39366_1004894 JGI25154J39366_10048942 370
2933 3300002772 JGI25164J39214_1000456 JGI25164J39214_100045616 370
2934 3300002772 JGI25164J39214_1000464 JGI25164J39214_100046415 370
2935 3300003214 JGI25165J46597_1000888 JGI25165J46597_100088816 370
2936 3300003214 JGI25165J46597_1000906 JGI25165J46597_100090615 370
2937 3300003578 Ga0006562J51391_1079329 Ga0006562J51391_10793292 370
2938 3300003751 Ga0055538_1000093 Ga0055538_100009352 370
2939 3300003752 Ga0055539_1000138 Ga0055539_100013852 370
2940 3300003756 Ga0055533_1000142 Ga0055533_100014252 370
2941 3300003758 Ga0055532_1000152 Ga0055532_100015223 370
2942 3300003759 Ga0055525_1000342 Ga0055525_100034220 370
2943 3300003791 Ga0055530_10002384 Ga0055530_100023846 370
2944 3300003792 Ga0055540_1001801 Ga0055540_10018016 370
2945 3300003794 Ga0055531_10004937 Ga0055531_100049373 370
2946 3300003841 Ga0055541_1000091 Ga0055541_100009140 370
2947 3300005288 Ga0065714_10000386 Ga0065714_100003863 370
2948 3300005289 Ga0065704_10007257 Ga0065704_100072571 370
2949 3300005289 Ga0065704_10019402 Ga0065704_100194022 370
2950 3300005290 Ga0065712_10000132 Ga0065712_100001323 370
2951 3300005295 Ga0065707_10091360 Ga0065707_100913604 370
2952 3300005344 Ga0070661_100000961 Ga0070661_1000009618 370
2953 3300005353 Ga0070669_100000904 Ga0070669_1000009049 370
2954 3300005457 Ga0070662_100002124 Ga0070662_1000021243 370
2955 3300005539 Ga0068853_100008919 Ga0068853_1000089192 370
2956 3300005564 Ga0070664_100010006 Ga0070664_1000100066 370
2957 3300005578 Ga0068854_100034285 Ga0068854_1000342852 370
2958 3300006944 Ga0099823_1031074 Ga0099823_10310745 370
2959 3300006946 Ga0079104_1000375 Ga0079104_100037515 370
2960 3300006946 Ga0079104_1000920 Ga0079104_100092013 370
2961 3300006946 Ga0079104_1016517 Ga0079104_10165172 370
2962 3300006948 Ga0099826_10001328 Ga0099826_1000132811 370
2963 3300009011 Ga0105251_10001251 Ga0105251_1000125113 370
2964 3300009011 Ga0105251_10032414 Ga0105251_100324142 370
2965 3300009148 Ga0105243_10002510 Ga0105243_100025105 370
2966 3300009148 Ga0105243_10045098 Ga0105243_100450983 370
2967 3300009176 Ga0105242_10019163 Ga0105242_100191633 370
2968 3300009177 Ga0105248_10142733 Ga0105248_101427332 370
2969 3300009545 Ga0105237_10000335 Ga0105237_1000033545 370
2970 3300011119 Ga0105246_10029356 Ga0105246_100293562 370
2971 3300011119 Ga0105246_10152498 Ga0105246_101524981 370
2972 3300011119 Ga0105246_10306551 Ga0105246_103065511 370
2973 3300025206 Ga0209435_103278 Ga0209435_1032782 370
2974 3300025207 Ga0209760_100079 Ga0209760_10007917 370
2975 3300025207 Ga0209760_100211 Ga0209760_10021116 370
2976 3300025224 Ga0209784_100128 Ga0209784_10012840 370
2977 3300025225 Ga0209566_100157 Ga0209566_10015739 370
2978 3300025226 Ga0209674_100180 Ga0209674_10018040 370
2979 3300025229 Ga0209147_100183 Ga0209147_10018351 370
2980 3300025230 Ga0209563_100144 Ga0209563_10014440 370
2981 3300025230 Ga0209563_100667 Ga0209563_1006677 370
2982 3300025231 Ga0207427_100001 Ga0207427_1000011324 370
2983 3300025231 Ga0207427_100048 Ga0207427_10004811 370
2984 3300025233 Ga0209437_100003 Ga0209437_10000348 370
2985 3300025233 Ga0209437_100094 Ga0209437_10009411 370
2986 3300025242 Ga0209258_100310 Ga0209258_10031039 370
2987 3300025246 Ga0209646_1000355 Ga0209646_100035519 370
2988 3300025253 Ga0209677_100127 Ga0209677_10012740 370
2989 3300025261 Ga0209233_1000007 Ga0209233_10000071324 370
2990 3300025261 Ga0209233_1000106 Ga0209233_1000106246 370
2991 3300025291 Ga0209675_1013977 Ga0209675_10139772 370
2992 3300025292 Ga0209676_1000055 Ga0209676_1000055148 370
2993 3300025292 Ga0209676_1000959 Ga0209676_100095918 370
2994 3300025292 Ga0209676_1001598 Ga0209676_100159822 370
2995 3300025298 Ga0209050_1000079 Ga0209050_1000079185 370
2996 3300025298 Ga0209050_1000606 Ga0209050_100060613 370
2997 3300025303 Ga0209051_1000054 Ga0209051_1000054188 370
2998 3300025303 Ga0209051_1000083 Ga0209051_100008344 370
2999 3300025303 Ga0209051_1000429 Ga0209051_100042918 370
3000 3300025304 Ga0209257_1000175 Ga0209257_100017595 370
3001 3300025711 Ga0207696_1000019 Ga0207696_1000019208 370
3002 3300025711 Ga0207696_1000175 Ga0207696_100017592 370
3003 3300025711 Ga0207696_1000426 Ga0207696_100042627 370
3004 3300025711 Ga0207696_1006503 Ga0207696_10065034 370
3005 3300025728 Ga0207655_1000019 Ga0207655_100001910 370
3006 3300025728 Ga0207655_1000434 Ga0207655_100043449 370
3007 3300025728 Ga0207655_1000972 Ga0207655_10009723 370
3008 3300025728 Ga0207655_1001025 Ga0207655_100102512 370
3009 3300025728 Ga0207655_1001801 Ga0207655_10018013 370
3010 3300025728 Ga0207655_1001882 Ga0207655_10018824 370
3011 3300025728 Ga0207655_1008926 Ga0207655_10089263 370
3012 3300025728 Ga0207655_1026927 Ga0207655_10269271 370
3013 3300025728 Ga0207655_1027485 Ga0207655_10274853 370
3014 3300025735 Ga0207713_1000207 Ga0207713_100020710 370
3015 3300025735 Ga0207713_1000299 Ga0207713_100029955 370
3016 3300025735 Ga0207713_1002659 Ga0207713_10026598 370
3017 3300025903 Ga0207680_10208989 Ga0207680_102089891 370
3018 3300025914 Ga0207671_10000018 Ga0207671_10000018288 370
3019 3300025920 Ga0207649_10000008 Ga0207649_10000008277 370
3020 3300025923 Ga0207681_10002297 Ga0207681_1000229710 370
3021 3300025925 Ga0207650_10002243 Ga0207650_100022439 370
3022 3300025929 Ga0207664_10231314 Ga0207664_102313142 370
3023 3300025933 Ga0207706_10001633 Ga0207706_100016339 370
3024 3300025934 Ga0207686_10010975 Ga0207686_100109753 370
3025 3300025935 Ga0207709_10000089 Ga0207709_1000008974 370
3026 3300025935 Ga0207709_10001814 Ga0207709_100018144 370
3027 3300025935 Ga0207709_10034506 Ga0207709_100345062 370
3028 3300025945 Ga0207679_10000008 Ga0207679_10000008112 370
3029 3300026041 Ga0207639_10043030 Ga0207639_100430301 370
3030 3300027111 Ga0209281_1000018 Ga0209281_1000018171 370
3031 3300027111 Ga0209281_1000391 Ga0209281_100039116 370
3032 3300027111 Ga0209281_1002058 Ga0209281_10020585 370
3033 3300027296 Ga0209389_1000037 Ga0209389_1000037104 370
3034 3300027312 Ga0209371_1006324 Ga0209371_10063243 370
3035 3300028379 Ga0268266_10018069 Ga0268266_100180693 370
3036 3300030500 Ga0268256_1006351 Ga0268256_10063513 370
3037 3300030742 Ga0316183_1009536 Ga0316183_10095361 370
3038 3300035691 Ga0373931_0040429 Ga0373931_0040429_640_1773 370
3039 3300046454 Ga0495592_0013646 Ga0495592_0013646_3931_5070 370
3040 3300046455 Ga0495603_0023358 Ga0495603_0023358_380_1492 370
3041 3300046458 Ga0495591_000807 Ga0495591_000807_271_1383 370
3042 3300046458 Ga0495591_008775 Ga0495591_008775_1562_2674 370
3043 3300046460 Ga0495638_0005430 Ga0495638_0005430_2229_3341 370
3044 3300046471 Ga0495650_0011499 Ga0495650_0011499_792_1904 370
3045 3300046474 Ga0495605_0000036 Ga0495605_0000036_12147_13259 370
3046 3300046506 Ga0495583_0000028 Ga0495583_0000028_25395_26507 370
3047 3300046506 Ga0495583_0004447 Ga0495583_0004447_8189_9301 370
3048 3300046511 Ga0495608_0014707 Ga0495608_0014707_3573_4712 370
3049 3300046512 Ga0495610_0017891 Ga0495610_0017891_1562_2674 370
3050 3300046515 Ga0495620_0000054 Ga0495620_0000054_40868_41980 370
3051 3300046515 Ga0495620_0000322 Ga0495620_0000322_15848_16960 370
3052 3300046516 Ga0495628_0015992 Ga0495628_0015992_3678_4817 370
3053 3300046517 Ga0495630_0006079 Ga0495630_0006079_3946_5085 370
3054 3300046526 Ga0495666_0016967 Ga0495666_0016967_617_1756 370
3055 3300046533 Ga0495640_0003691 Ga0495640_0003691_2803_3942 370
3056 3300046535 Ga0495586_0009070 Ga0495586_0009070_1355_2494 370
3057 3300046538 Ga0495609_0000115 Ga0495609_0000115_12147_13259 370
3058 3300046543 Ga0495645_0172696 Ga0495645_0172696_267_1406 370
3059 3300046558 Ga0495633_0001693 Ga0495633_0001693_12712_13824 370
3060 3300046559 Ga0495667_0168148 Ga0495667_0168148_24_1163 370
3061 3300046642 Ga0495634_0058596 Ga0495634_0058596_303_1442 370
3062 3300046665 Ga0495661_0000051 Ga0495661_0000051_17919_19031 370
3063 3300046665 Ga0495661_0000685 Ga0495661_0000685_15828_16940 370
3064 3300046665 Ga0495661_0008587 Ga0495661_0008587_5931_7043 370
3065 3300046678 Ga0495599_0028513 Ga0495599_0028513_582_1721 370
3066 3300046683 Ga0495658_0028841 Ga0495658_0028841_529_1668 370
3067 3300046684 Ga0495669_0017165 Ga0495669_0017165_701_1828 370
3068 3300046689 Ga0495613_0004307 Ga0495613_0004307_6142_7281 370
3069 3300046691 Ga0495670_0003243 Ga0495670_0003243_1507_2619 370
3070 3300046692 Ga0495671_0023100 Ga0495671_0023100_666_1778 370
3071 3300046692 Ga0495671_0029286 Ga0495671_0029286_800_1912 370
3072 3300046694 Ga0495649_0007229 Ga0495649_0007229_4441_5553 370
3073 3300047322 Ga0495680_0018118 Ga0495680_0018118_2360_3472 370
3074 3300047322 Ga0495680_0044601 Ga0495680_0044601_1258_2397 370
3075 3300047323 Ga0495683_0000129 Ga0495683_0000129_41174_42286 370
3076 3300047323 Ga0495683_0000507 Ga0495683_0000507_12151_13263 370
3077 3300047444 Ga0495675_0014494 Ga0495675_0014494_3236_4348 370
3078 3300047446 Ga0495679_000616 Ga0495679_000616_4731_5843 370
3079 3300047469 Ga0495673_0008906 Ga0495673_0008906_119_1231 370
3080 3300048913 Ga0496110_0063701 Ga0496110_0063701_140_1252 370
3081 3300048919 Ga0496116_0000677 Ga0496116_0000677_36339_37451 370
3082 3300048922 Ga0496119_0000943 Ga0496119_0000943_22843_23955 370
3083 3300048923 Ga0496120_0011781 Ga0496120_0011781_3291_4403 370
3084 3300048924 Ga0496121_0000299 Ga0496121_0000299_95092_96204 370
3085 3300048925 Ga0496122_0078692 Ga0496122_0078692_547_1659 370
3086 3300048927 Ga0496124_0019995 Ga0496124_0019995_229_1341 370
3087 3300048927 Ga0496124_0028627 Ga0496124_0028627_2635_3747 370
3088 3300049459 Ga0495678_000020 Ga0495678_000020_15787_16899 370
3089 3300049571 Ga0501034_0000325 Ga0501034_0000325_82257_83369 370
3090 3300049571 Ga0501034_0033736 Ga0501034_0033736_3210_4370 370
3091 3300049592 Ga0501076_0066837 Ga0501076_0066837_197_1363 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

133

344

0.97

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

1

111

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pqu-assembly2.cif.gz_B crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate 0.9967 1 364
3pzr-assembly1.cif.gz_A crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with nadp and product of s-carbamoyl-l-cysteine 0.9937 3 365
6bac-assembly1.cif.gz_A crystal structure of aspartate-semialdehyde dehydrogenase from neisseria gonorrhoeae 0.9912 2 365
7skb-assembly2.cif.gz_C crystal structure of aspartate-semialdehyde dehydrogenase from acinetobacter baumannii 0.9904 1 365
3uw3-assembly1.cif.gz_A crystal structure of an aspartate-semialdehyde dehydrogenase from burkholderia thailandensis 0.9895 2 364
ID Description Score Start End Superfamily
1ozaA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9963 133 347 3.30.360.10
af_P0A9Q9_5_251_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9911 5 247 3.90.180.10
af_P0A9Q9_3_137_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9801 4 134 3.40.50.720
1ozaA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9782 133 347 3.30.360.10
af_P0A9Q9_5_251_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9712 5 247 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A353NG78-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 1.005 273 352 GO:0004073
GO:0008652
GO:0046983
AF-A0A2J4QDW8-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 1.004 289 363 GO:0004073
GO:0008652
GO:0046983
AF-A0A522BPK9-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 1.002 272 366 GO:0004073
GO:0008652
GO:0046983
AF-A0A7Y8B9Z8-F1-model_v4 deleted 1.001 1 139
AF-A0A496N637-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 1.001 233 364 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661

Feature Viewer

pLDDT pTM Quality
96.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map