F497108

General Info

Members Datasets Scaffolds Average Seq Length
2859 1184 2031 324

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100108590|Ga0307409_1001085903
Length 350
Sequence MPAFPAWWILPPFDKPQKTSIDMVQVLIIGGAGMLGRKLAERLSADGQIGGKAISRLHLADMFTPTAPAGAPFEVTTTTGDFSEAGEAERLIADRPEIIFHLAAIVSGEAEADFDKGYRINLDGTRLLLDAIRAAGNYHPRLVFTSSIAVFGAPFPSEIPDEFHHTPLTSYGTQKAIGELLLSDYSRRGILDGVGIRLPTICVRPGKPNKAASGFFSGIIREPLNGMEAILPVPTDVRHWFASPRAAVQFMVHAATIDTAKVGPRRNLTMPGVAATVAEEIESLRRIAGEAAVKLIRHEPDATIMGIVKGWPQAFSPERALSLGFAADTDFDAIVRLYIEEELGGKIATA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
12 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
16 2512875024 Mesorhizobium loti R88b Isolate Nodule
17 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
26 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
29 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
30 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
31 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
32 2516143018 Ensifer sp. BR816 Isolate Nodule
33 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
34 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
35 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
36 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
37 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
38 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
39 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
40 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
41 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
42 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
43 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
44 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
45 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
46 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
47 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
48 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
49 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
50 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
51 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
52 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
53 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
54 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
55 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
56 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
57 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
58 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
59 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
60 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
61 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
62 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
63 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
64 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
65 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
66 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
67 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
68 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
69 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
70 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
71 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
72 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
73 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
74 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
75 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
76 2643221558 Rhizobium sp. Root149 Isolate Unclassified
77 2643221568 Rhizobium sp. Root564 Isolate Unclassified
78 2643221582 Rhizobium sp. Root651 Isolate Unclassified
79 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
80 2643221599 Rhizobium sp. Root708 Isolate Unclassified
81 2643221618 Ensifer sp. Root231 Isolate Unclassified
82 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
83 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
84 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
85 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
86 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
87 2643221655 Ensifer sp. Root1252 Isolate Unclassified
88 2643221659 Ensifer sp. Root127 Isolate Unclassified
89 2643221688 Rhizobium sp. Root482 Isolate Unclassified
90 2643221693 Rhizobium sp. Root491 Isolate Unclassified
91 2643221698 Ensifer sp. Root142 Isolate Unclassified
92 2643221712 Ensifer sp. Root258 Isolate Unclassified
93 2643221719 Rhizobium sp. Root274 Isolate Unclassified
94 2643221734 Bosea sp. Root670 Isolate Unclassified
95 2643221736 Bosea sp. Root483D1 Isolate Unclassified
96 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
97 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
98 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
99 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
100 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
101 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
102 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
103 2738541293 Rhizobium sp. GV031 Isolate Unclassified
104 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
105 2738543024 Aminobacter sp. AP02 Isolate Unclassified
106 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
107 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
108 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
109 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
110 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
111 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
112 2773857925 Microvirga vignae BR3299 Isolate Unclassified
113 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
114 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
115 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
116 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
117 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
118 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
119 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
120 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
121 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
122 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
123 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
124 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
125 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
126 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
127 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
128 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
129 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
130 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
131 2818991467 Bosea vestrisii 3192 Isolate Unclassified
132 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
133 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
134 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
135 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
136 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
137 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
138 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
139 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
140 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
141 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
142 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
143 2841760612 Bosea sp. Tri-49 Isolate Nodule
144 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
145 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
146 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
147 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
148 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
149 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
150 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
151 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
152 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
153 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
154 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
155 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
156 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
157 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
158 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
159 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
160 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
161 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
162 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
163 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
164 2842694124 Methylopila sp. R-72369 Isolate Unclassified
165 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
166 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
167 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
168 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
169 2844104063 Bosea sp. Tri-39 Isolate Nodule
170 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
171 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
172 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
173 2851182111 Bosea sp. Tri-44 Isolate Nodule
174 2851246043 Bosea sp. Tri-54 Isolate Nodule
175 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
176 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
177 2854911287 Brucella lupini LUP21 Isolate Unclassified
178 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
179 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
180 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
181 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
182 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
183 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
184 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
185 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
186 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
187 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
188 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
189 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
190 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
191 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
192 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
193 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
194 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
195 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
196 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
197 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
198 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
199 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
200 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
201 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
202 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
203 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
204 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
205 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
206 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
207 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
208 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
209 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
210 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
211 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
212 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
213 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
214 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
215 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
216 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
217 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
218 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
219 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
220 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
221 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
222 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
223 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
224 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
225 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
226 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
227 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
228 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
229 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
230 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
231 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
232 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
233 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
234 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
235 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
236 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
237 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
238 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
239 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
240 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
241 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
242 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
243 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
244 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
245 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
246 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
247 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
248 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
249 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
250 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
251 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
252 2902330777 Methylobacterium sp. 2A Isolate Unclassified
253 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
254 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
255 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
256 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
257 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
258 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
259 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
260 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
261 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
262 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
263 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
264 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
265 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
266 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
267 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
268 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
269 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
270 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
271 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
272 2909042592 Labrys sp. LIt4 Isolate Nodule
273 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
274 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
275 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
276 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
277 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
278 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
279 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
280 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
281 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
282 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
283 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
284 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
285 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
286 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
287 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
288 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
289 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
290 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
291 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
292 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
293 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
294 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
295 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
296 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
297 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
298 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
299 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
300 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
301 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
302 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
303 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
304 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
305 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
306 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
307 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
308 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
309 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
310 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
311 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
312 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
313 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
314 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
315 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
316 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
317 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
318 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
319 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
320 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
321 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
322 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
323 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
324 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
325 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
326 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
327 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
328 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
329 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
330 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
331 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
332 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
333 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
334 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
335 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
336 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
337 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
338 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
339 2932401849 Devosia sp. 2618 Isolate Rhizosphere
340 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
341 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
342 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
343 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
344 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
345 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
346 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
347 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
348 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
349 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
350 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
351 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
352 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
353 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
354 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
355 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
356 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
357 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
358 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
359 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
360 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
361 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
362 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
363 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
364 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
365 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
366 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
367 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
368 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
369 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
370 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
371 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
372 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
373 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
374 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
375 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
376 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
377 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
378 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
379 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
380 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
381 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
382 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
383 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
384 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
385 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
386 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
387 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
388 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
389 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
390 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
391 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
392 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
393 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
394 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
395 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
396 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
397 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
398 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
399 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
400 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
401 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
402 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
403 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
404 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
405 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
406 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
407 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
408 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
409 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
410 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
411 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
412 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
413 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
414 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
415 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
416 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
417 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
418 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
419 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
420 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
421 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
422 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
423 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
424 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
425 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
426 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
427 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
428 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
429 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
430 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
431 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
432 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
433 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
434 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
435 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
436 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
437 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
438 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
439 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
440 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
441 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
442 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
443 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
444 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
445 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
446 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
447 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
448 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
449 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
450 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
451 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
452 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
453 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
454 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
455 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
456 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
457 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
458 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
459 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
460 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
461 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
462 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
463 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
464 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
465 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
466 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
467 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
468 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
469 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
470 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
471 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
472 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
473 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
474 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
475 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
476 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
477 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
478 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
479 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
480 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
481 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
482 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
483 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
484 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
485 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
486 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
487 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
488 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
489 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
490 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
491 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
492 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
493 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
494 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
495 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
496 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
497 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
498 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
499 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
500 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
501 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
502 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
503 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
504 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
505 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
506 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
507 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
508 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
509 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
510 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
511 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
512 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
513 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
514 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
515 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
516 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
517 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
518 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
519 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
520 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
521 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
522 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
523 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
524 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
525 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
526 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
527 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
528 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
529 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
530 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
531 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
532 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
533 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
534 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
535 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
536 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
537 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
538 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
539 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
540 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
541 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
542 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
543 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
544 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
545 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
546 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
547 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
548 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
549 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
550 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
551 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
552 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
553 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
554 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
555 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
556 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
557 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
558 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
559 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
560 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
561 2996887358 Rhizobium sp. R711 Isolate Nodule
562 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
563 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
564 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
565 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
566 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
567 3004167301 Mesorhizobium loti 582 Isolate Unclassified
568 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
569 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
570 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
571 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
572 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
573 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
574 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
575 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
576 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
577 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
578 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
579 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
580 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
581 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
582 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
583 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
584 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
585 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
586 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
587 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
588 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
589 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
590 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
591 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
592 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
593 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
594 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
595 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
596 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
597 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
598 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
599 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
600 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
601 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
602 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
603 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
604 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
605 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
606 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
607 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
608 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
609 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
610 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
611 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
612 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
613 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
614 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
615 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
616 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
617 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
618 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
619 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
620 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
621 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
622 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
623 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
624 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
625 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
626 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
627 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
628 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
629 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
630 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
631 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
632 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
633 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
634 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
635 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
636 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
637 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
638 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
639 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
640 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
641 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
642 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
643 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
644 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
645 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
646 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
647 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
648 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
649 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
650 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
651 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
652 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
653 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
654 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
655 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
656 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
657 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
658 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
659 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
660 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
661 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
662 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
663 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
664 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
665 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
666 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
667 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
668 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
669 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
670 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
671 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
672 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
673 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
674 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
675 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
676 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
677 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
678 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
679 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
680 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
681 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
682 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
683 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
684 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
685 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
686 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
687 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
688 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
689 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
690 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
691 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
692 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
693 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
694 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
695 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
696 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
697 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
698 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
699 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
700 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
701 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
702 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
703 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
704 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
705 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
706 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
707 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
708 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
709 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
710 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
711 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
712 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
713 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
714 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
715 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
716 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
717 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
718 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
719 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
720 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
721 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
722 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
723 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
724 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
725 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
726 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
727 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
728 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
729 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
730 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
731 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
732 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
733 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
734 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
735 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
736 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
737 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
738 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
739 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
740 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
741 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
742 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
743 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
744 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
745 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
746 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
747 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
748 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
749 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
750 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
751 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
752 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
753 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
754 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
755 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
756 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
757 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
758 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
759 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
760 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
761 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
762 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
763 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
764 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
765 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
766 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
767 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
768 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
769 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
770 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
774 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
775 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
776 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
777 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
778 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
779 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
780 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
781 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
782 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
783 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
784 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
785 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
786 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
787 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
788 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
789 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
790 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
791 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
792 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
793 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
794 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
795 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
796 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
797 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
798 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
799 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
800 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
801 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
802 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
803 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
804 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
805 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
806 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
807 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
808 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
809 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
810 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
811 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
812 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
813 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
814 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
815 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
816 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
817 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
818 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
819 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
820 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
821 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
822 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
823 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
824 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
825 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
826 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
827 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
828 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
829 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
830 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
831 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
832 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
833 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
834 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
835 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
836 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
837 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
838 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
839 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
840 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
841 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
842 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
843 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
844 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
845 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
846 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
847 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
848 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
849 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
850 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
851 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
852 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
853 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
854 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
855 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
856 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
857 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
858 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
859 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
860 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
861 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
862 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
863 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
864 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
865 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
866 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
867 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
868 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
869 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
870 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
871 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
872 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
873 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
874 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
875 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
876 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
877 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
878 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
879 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
880 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
881 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
882 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
883 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
884 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
885 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
886 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
887 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
888 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
889 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
890 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
891 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
892 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
893 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
894 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
895 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
896 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
897 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
898 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
899 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
900 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
901 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
902 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
903 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
904 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
905 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
906 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
907 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
908 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
909 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
910 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
911 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
912 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
913 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
914 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
915 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
916 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
917 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
918 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
919 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
920 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
921 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
922 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
923 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
924 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
925 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
926 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
927 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
928 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
929 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
930 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
931 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
932 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
933 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
934 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
935 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
936 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
937 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
938 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
939 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
940 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
941 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
942 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
943 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
944 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
945 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
946 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
947 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
948 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
949 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
950 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
951 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
952 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
953 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
954 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
955 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
956 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
957 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
958 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
959 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
960 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
961 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
962 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
963 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
964 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
965 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
966 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
967 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
968 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
969 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
970 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
971 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
972 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
973 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
974 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
975 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
976 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
977 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
978 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
979 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
980 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
981 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
982 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
983 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
984 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
985 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
986 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
987 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
988 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
989 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
990 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
991 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
992 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
993 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
994 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
995 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
996 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
997 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
998 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
999 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1000 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1001 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1002 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1003 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1004 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1005 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1006 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1007 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1008 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1009 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1010 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1011 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1012 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1013 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1014 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1015 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1016 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1017 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1018 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1019 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1020 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1021 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1022 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1023 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1024 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1025 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1026 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1027 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1028 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1029 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1030 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1031 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1032 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1033 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1034 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1035 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1036 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1037 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1038 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1039 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1040 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1041 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1042 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1043 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1044 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1045 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1046 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1047 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1048 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1049 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1050 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1051 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1052 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1053 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1054 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1055 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1056 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1057 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1058 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1059 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1060 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1061 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1062 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1063 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1064 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1065 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1066 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1067 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1068 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1069 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1070 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1071 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1072 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1073 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1074 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1075 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1076 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1077 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1078 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1079 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1080 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1081 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1082 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1083 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1084 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1085 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1086 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1087 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1088 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1089 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1090 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1091 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1092 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1093 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1094 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1095 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1096 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1097 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1098 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1099 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1103 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1105 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1106 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1107 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1110 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1111 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1112 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1113 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1114 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
1115 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1116 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1117 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1118 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1119 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1120 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1121 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1122 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1123 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1124 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1125 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1126 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1127 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1128 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1129 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1131 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1133 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1134 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1135 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1137 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1139 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1140 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1141 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1142 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1143 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1145 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1150 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1151 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1152 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1153 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1154 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1155 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1156 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1157 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1158 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1159 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1160 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1161 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1162 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1163 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1164 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1165 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1166 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1167 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1168 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1169 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1170 8005258706 Rhizobium sp. R693 Isolate Nodule
1171 8005321885 Rhizobium sp. R72 Isolate Nodule
1172 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1173 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1174 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1175 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1176 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1177 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1178 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1179 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1180 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1181 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1182 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1183 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1184 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71
Metatranscriptomes 0.21
Isolates 28.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 7.56
Nodule 23.4
Rhizoplane 5.04
Rhizosphere 54.63
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021610 3300001979 Bacteria 2228
2 JGI24740J21852_10050296 3300001979 Bacteria 1199
3 JGI24751J29686_10002245 3300002459 Bacteria 3911
4 JGI24751J29686_10007661 3300002459 Bacteria 2207
5 JGI25156J39149_1004301 3300002705 Bacteria 4376
6 JGI25157J39369_1002383 3300002741 Bacteria 4776
7 JGI25152J39213_1000531 3300002773 Bacteria 21074
8 JGI25152J39213_1002315 3300002773 Bacteria 7348
9 JGI25150J39212_1000024 3300002774 Bacteria 129646
10 JGI25159J45721_1001556 3300002987 Bacteria 9403
11 JGI25151J46595_10000027 3300003187 Bacteria 208739
12 JGI25151J46595_10000069 3300003187 Bacteria 139420
13 JGI25406J46586_10013043 3300003203 Bacteria 3587
14 JGI25165J46597_1000042 3300003214 Bacteria 271606
15 JGI25165J46597_1006314 3300003214 Bacteria 2114
16 JGI25165J46597_1007664 3300003214 Bacteria 1768
17 JGI25153J46596_10000012 3300003215 Bacteria 308056
18 JGI25153J46596_10000517 3300003215 Bacteria 24352
19 JGI25153J46596_10002078 3300003215 Bacteria 11772
20 JGI25160J50197_1000001 3300003354 Bacteria 782301
21 JGI25161J50226_1000047 3300003374 Bacteria 113472
22 Ga0055542_1000761 3300003762 Bacteria 24456
23 Ga0055529_1001880 3300003763 Bacteria 4878
24 Ga0055526_1000017 3300003771 Bacteria 210613
25 Ga0055526_1013167 3300003771 Bacteria 3526
26 Ga0055526_1017984 3300003771 Bacteria 2665
27 Ga0055524_1000435 3300003775 Bacteria 34955
28 Ga0055524_1003714 3300003775 Bacteria 7299
29 Ga0055524_1013029 3300003775 Bacteria 3160
30 Ga0055536_1004308 3300003781 Bacteria 7321
31 Ga0055528_1000033 3300003790 Bacteria 119662
32 Ga0055528_1001182 3300003790 Bacteria 16852
33 Ga0055528_1011971 3300003790 Bacteria 3400
34 Ga0055528_1035106 3300003790 Bacteria 1223
35 Ga0055540_1000925 3300003792 Bacteria 19166
36 Ga0055531_10000685 3300003794 Bacteria 28855
37 Ga0055531_10013033 3300003794 Bacteria 3861
38 Ga0058692_1001178 3300003856 Bacteria 10036
39 Ga0058692_1001422 3300003856 Bacteria 8814
40 Ga0058692_1001511 3300003856 Bacteria 8500
41 Ga0055543_1000007 3300004625 Bacteria 204042
42 Ga0055543_1013268 3300004625 Bacteria 1633
43 Ga0065165_1000231 3300005262 Bacteria 97237
44 Ga0065165_1000313 3300005262 Bacteria 79494
45 Ga0065165_1000357 3300005262 Bacteria 75030
46 Ga0065165_1008048 3300005262 Bacteria 5035
47 Ga0065165_1008460 3300005262 Bacteria 4807
48 Ga0065707_10134610 3300005295 Bacteria 1862
49 Ga0065707_10146168 3300005295 Bacteria 1711
50 Ga0070658_10000595 3300005327 Bacteria 31313
51 Ga0070658_10040997 3300005327 Bacteria 3735
52 Ga0070658_10322566 3300005327 Bacteria 1319
53 Ga0070676_10071503 3300005328 Bacteria 2084
54 Ga0070683_100105930 3300005329 Bacteria 2651
55 Ga0070683_100133616 3300005329 Bacteria 2349
56 Ga0070690_100000472 3300005330 Bacteria 20208
57 Ga0070690_100020090 3300005330 Bacteria 4066
58 Ga0070690_100026997 3300005330 Bacteria 3546
59 Ga0070690_100176522 3300005330 Bacteria 1474
60 Ga0070670_100011566 3300005331 Bacteria 7545
61 Ga0070670_100079159 3300005331 Bacteria 2824
62 Ga0070670_100130783 3300005331 Bacteria 2168
63 Ga0070670_100459691 3300005331 Bacteria 1129
64 Ga0068869_100010254 3300005334 Bacteria 6104
65 Ga0068869_100021520 3300005334 Bacteria 4438
66 Ga0068869_100143106 3300005334 Bacteria 1848
67 Ga0068869_100151919 3300005334 Bacteria 1797
68 Ga0070666_10030238 3300005335 Bacteria 3567
69 Ga0070666_10210667 3300005335 Bacteria 1369
70 Ga0070666_10229508 3300005335 Bacteria 1311
71 Ga0070680_100006080 3300005336 Bacteria 9144
72 Ga0070680_100020436 3300005336 Bacteria 5256
73 Ga0070680_100020901 3300005336 Bacteria 5197
74 Ga0070680_100063360 3300005336 Bacteria 3028
75 Ga0070682_100003001 3300005337 Bacteria 9366
76 Ga0070682_100088567 3300005337 Bacteria 2020
77 Ga0068868_100000209 3300005338 Bacteria 39624
78 Ga0068868_100037635 3300005338 Bacteria 3752
79 Ga0068868_100064476 3300005338 Bacteria 2908
80 Ga0068868_100110568 3300005338 Bacteria 2232
81 Ga0070660_100015769 3300005339 Bacteria 5466
82 Ga0070660_100131859 3300005339 Bacteria 2000
83 Ga0070689_100000614 3300005340 Bacteria 21600
84 Ga0070689_100006652 3300005340 Bacteria 8027
85 Ga0070689_100007446 3300005340 Bacteria 7654
86 Ga0070689_100176001 3300005340 Bacteria 1735
87 Ga0070691_10035309 3300005341 Bacteria 2354
88 Ga0070691_10073615 3300005341 Bacteria 1661
89 Ga0070687_100000190 3300005343 Bacteria 21399
90 Ga0070687_100025536 3300005343 Bacteria 2836
91 Ga0070687_100099886 3300005343 Bacteria 1623
92 Ga0070661_100046657 3300005344 Bacteria 3170
93 Ga0070661_100054046 3300005344 Bacteria 2941
94 Ga0070692_10006738 3300005345 Bacteria 5006
95 Ga0070692_10038866 3300005345 Bacteria 2428
96 Ga0070692_10041373 3300005345 Bacteria 2360
97 Ga0070668_100033602 3300005347 Bacteria 3907
98 Ga0070668_100066458 3300005347 Bacteria 2798
99 Ga0070668_100098437 3300005347 Bacteria 2314
100 Ga0070668_100099546 3300005347 Bacteria 2302
101 Ga0070668_100156759 3300005347 Bacteria 1845
102 Ga0070668_100190190 3300005347 Bacteria 1681
103 Ga0070668_100308329 3300005347 Bacteria 1329
104 Ga0070668_100329184 3300005347 Bacteria 1288
105 Ga0070669_100003300 3300005353 Bacteria 11600
106 Ga0070669_100124486 3300005353 Bacteria 1971
107 Ga0070675_100002866 3300005354 Bacteria 12996
108 Ga0070675_100021212 3300005354 Bacteria 5189
109 Ga0070675_100154306 3300005354 Bacteria 1971
110 Ga0070671_100009666 3300005355 Bacteria 7748
111 Ga0070671_100078678 3300005355 Bacteria 2756
112 Ga0070671_100094543 3300005355 Bacteria 2505
113 Ga0070674_100025155 3300005356 Bacteria 3872
114 Ga0070674_100048660 3300005356 Bacteria 2910
115 Ga0070673_100044693 3300005364 Bacteria 3431
116 Ga0070688_100012599 3300005365 Bacteria 4740
117 Ga0070688_100018867 3300005365 Bacteria 3988
118 Ga0070688_100104138 3300005365 Bacteria 1876
119 Ga0070688_100168955 3300005365 Bacteria 1508
120 Ga0070659_100119241 3300005366 Bacteria 2135
121 Ga0070659_100129972 3300005366 Bacteria 2045
122 Ga0070667_100005456 3300005367 Bacteria 10623
123 Ga0070709_10005929 3300005434 Bacteria 6630
124 Ga0070709_10028611 3300005434 Bacteria 3325
125 Ga0070709_10034343 3300005434 Bacteria 3074
126 Ga0070709_10152872 3300005434 Bacteria 1597
127 Ga0070714_100016855 3300005435 Bacteria 5909
128 Ga0070714_100022579 3300005435 Bacteria 5159
129 Ga0070714_100037888 3300005435 Bacteria 4054
130 Ga0070714_100167505 3300005435 Bacteria 1992
131 Ga0070714_100560028 3300005435 Bacteria 1095
132 Ga0070713_100025577 3300005436 Bacteria 4617
133 Ga0070713_100025962 3300005436 Bacteria 4590
134 Ga0070713_100074693 3300005436 Bacteria 2873
135 Ga0070713_100104650 3300005436 Bacteria 2457
136 Ga0070713_100376483 3300005436 Bacteria 1322
137 Ga0070710_10004764 3300005437 Bacteria 6420
138 Ga0070710_10022918 3300005437 Bacteria 3274
139 Ga0070710_10141687 3300005437 Bacteria 1475
140 Ga0070701_10162829 3300005438 Bacteria 1294
141 Ga0070711_100000801 3300005439 Bacteria 16448
142 Ga0070711_100036220 3300005439 Bacteria 3305
143 Ga0070711_100076598 3300005439 Bacteria 2372
144 Ga0070711_100124150 3300005439 Bacteria 1914
145 Ga0070711_100191666 3300005439 Bacteria 1572
146 Ga0070711_100250879 3300005439 Bacteria 1388
147 Ga0070711_100350158 3300005439 Bacteria 1187
148 Ga0070705_100000101 3300005440 Bacteria 48577
149 Ga0070705_100000320 3300005440 Bacteria 28430
150 Ga0070705_100109820 3300005440 Bacteria 1760
151 Ga0070700_100000571 3300005441 Bacteria 18444
152 Ga0070700_100000733 3300005441 Bacteria 16216
153 Ga0070700_100027128 3300005441 Bacteria 3393
154 Ga0070700_100129628 3300005441 Bacteria 1700
155 Ga0070700_100134966 3300005441 Bacteria 1670
156 Ga0070694_100000321 3300005444 Bacteria 25869
157 Ga0070694_100081356 3300005444 Bacteria 2253
158 Ga0070708_100074256 3300005445 Bacteria 3067
159 Ga0070663_100010835 3300005455 Bacteria 5696
160 Ga0070663_100025745 3300005455 Bacteria 3975
161 Ga0070663_100027751 3300005455 Bacteria 3848
162 Ga0070663_100141408 3300005455 Bacteria 1838
163 Ga0070663_100199670 3300005455 Bacteria 1560
164 Ga0070663_100243504 3300005455 Bacteria 1420
165 Ga0070678_100003166 3300005456 Bacteria 9114
166 Ga0070678_100011827 3300005456 Bacteria 5399
167 Ga0070678_100043922 3300005456 Bacteria 3187
168 Ga0070678_100230417 3300005456 Bacteria 1544
169 Ga0070678_100525533 3300005456 Bacteria 1047
170 Ga0070681_10016232 3300005458 Bacteria 7428
171 Ga0070681_10120549 3300005458 Bacteria 2558
172 Ga0070681_10130087 3300005458 Bacteria 2449
173 Ga0070681_10158097 3300005458 Bacteria 2190
174 Ga0070681_10507171 3300005458 Bacteria 1120
175 Ga0068867_100000417 3300005459 Bacteria 28383
176 Ga0068867_100016190 3300005459 Bacteria 5295
177 Ga0068867_100080280 3300005459 Bacteria 2456
178 Ga0068867_100113901 3300005459 Bacteria 2081
179 Ga0068867_100169625 3300005459 Bacteria 1727
180 Ga0068867_100355548 3300005459 Bacteria 1223
181 Ga0070685_10067945 3300005466 Bacteria 2104
182 Ga0070706_100182407 3300005467 Bacteria 1960
183 Ga0070707_100039104 3300005468 Bacteria 4534
184 Ga0070707_100232121 3300005468 Bacteria 1796
185 Ga0070707_100234729 3300005468 Bacteria 1785
186 Ga0070698_100319420 3300005471 Bacteria 1483
187 Ga0070699_100000281 3300005518 Bacteria 48573
188 Ga0070699_100006683 3300005518 Bacteria 10030
189 Ga0070699_100021616 3300005518 Bacteria 5549
190 Ga0070699_100272384 3300005518 Bacteria 1515
191 Ga0070699_100296574 3300005518 Bacteria 1450
192 Ga0070679_100002529 3300005530 Bacteria 16578
193 Ga0070679_100006164 3300005530 Bacteria 11159
194 Ga0070679_100103918 3300005530 Bacteria 2827
195 Ga0070679_100215188 3300005530 Bacteria 1884
196 Ga0070679_100532617 3300005530 Bacteria 1118
197 Ga0070684_100047934 3300005535 Bacteria 3705
198 Ga0070684_100155473 3300005535 Bacteria 2074
199 Ga0070684_100229585 3300005535 Bacteria 1694
200 Ga0070697_100003354 3300005536 Bacteria 12307
201 Ga0070697_100228438 3300005536 Bacteria 1587
202 Ga0068853_100014287 3300005539 Bacteria 6498
203 Ga0068853_100160368 3300005539 Bacteria 2029
204 Ga0068853_100204447 3300005539 Bacteria 1798
205 Ga0068853_100401731 3300005539 Bacteria 1282
206 Ga0070672_100049162 3300005543 Bacteria 3279
207 Ga0070672_100151621 3300005543 Bacteria 1918
208 Ga0070686_100000825 3300005544 Bacteria 17899
209 Ga0070686_100075392 3300005544 Bacteria 2219
210 Ga0070686_100262069 3300005544 Bacteria 1267
211 Ga0070695_100000120 3300005545 Bacteria 35206
212 Ga0070695_100000457 3300005545 Bacteria 21293
213 Ga0070695_100091171 3300005545 Bacteria 2035
214 Ga0070696_100000478 3300005546 Bacteria 25109
215 Ga0070696_100003819 3300005546 Bacteria 10057
216 Ga0070696_100005170 3300005546 Bacteria 8723
217 Ga0070693_100001007 3300005547 Bacteria 12571
218 Ga0070693_100060331 3300005547 Bacteria 2201
219 Ga0070693_100064052 3300005547 Bacteria 2145
220 Ga0070665_100000961 3300005548 Bacteria 36670
221 Ga0070665_100012792 3300005548 Bacteria 8455
222 Ga0070665_100026701 3300005548 Bacteria 5815
223 Ga0070665_100075185 3300005548 Bacteria 3385
224 Ga0070665_100076161 3300005548 Bacteria 3362
225 Ga0070665_100441668 3300005548 Bacteria 1310
226 Ga0070665_100491879 3300005548 Bacteria 1238
227 Ga0070704_100002732 3300005549 Bacteria 9977
228 Ga0070704_100008897 3300005549 Bacteria 6045
229 Ga0068855_100013001 3300005563 Bacteria 10045
230 Ga0068855_100053304 3300005563 Bacteria 4759
231 Ga0068855_100099355 3300005563 Bacteria 3352
232 Ga0068855_100236476 3300005563 Bacteria 2043
233 Ga0068855_100465137 3300005563 Bacteria 1378
234 Ga0068855_100629172 3300005563 Bacteria 1155
235 Ga0070664_100120215 3300005564 Bacteria 2299
236 Ga0070664_100338396 3300005564 Bacteria 1366
237 Ga0068857_100006107 3300005577 Bacteria 10289
238 Ga0068857_100092451 3300005577 Bacteria 2709
239 Ga0068857_100443489 3300005577 Bacteria 1213
240 Ga0068854_100021398 3300005578 Bacteria 4388
241 Ga0068854_100069934 3300005578 Bacteria 2564
242 Ga0068854_100107749 3300005578 Bacteria 2098
243 Ga0068856_100006239 3300005614 Bacteria 11699
244 Ga0068856_100386344 3300005614 Bacteria 1419
245 Ga0070702_100000050 3300005615 Bacteria 32860
246 Ga0070702_100003946 3300005615 Bacteria 6729
247 Ga0070702_100057852 3300005615 Bacteria 2243
248 Ga0070702_100093894 3300005615 Bacteria 1825
249 Ga0070702_100107193 3300005615 Bacteria 1725
250 Ga0068852_100009087 3300005616 Bacteria 7358
251 Ga0068852_100016572 3300005616 Bacteria 5753
252 Ga0068852_100064598 3300005616 Bacteria 3191
253 Ga0068852_100096341 3300005616 Bacteria 2659
254 Ga0068852_100235654 3300005616 Bacteria 1747
255 Ga0068852_100366447 3300005616 Bacteria 1410
256 Ga0068859_100000332 3300005617 Bacteria 47130
257 Ga0068859_100006827 3300005617 Bacteria 11597
258 Ga0068859_100024736 3300005617 Bacteria 6026
259 Ga0068859_100586192 3300005617 Bacteria 1208
260 Ga0068864_100012375 3300005618 Bacteria 7054
261 Ga0068864_100038504 3300005618 Bacteria 4084
262 Ga0068864_100489587 3300005618 Bacteria 1182
263 Ga0068866_10027915 3300005718 Bacteria 2684
264 Ga0068861_100007871 3300005719 Bacteria 7333
265 Ga0068861_100008854 3300005719 Bacteria 6937
266 Ga0068861_100112174 3300005719 Bacteria 2186
267 Ga0068861_100148020 3300005719 Bacteria 1924
268 Ga0068861_100189179 3300005719 Bacteria 1719
269 Ga0068861_100364620 3300005719 Bacteria 1272
270 Ga0068851_10006256 3300005834 Bacteria 5432
271 Ga0068870_10001906 3300005840 Bacteria 8609
272 Ga0068870_10018860 3300005840 Bacteria 3338
273 Ga0068870_10040967 3300005840 Bacteria 2404
274 Ga0068870_10124167 3300005840 Bacteria 1491
275 Ga0068863_100009237 3300005841 Bacteria 9620
276 Ga0068863_100040400 3300005841 Bacteria 4435
277 Ga0068863_100108817 3300005841 Bacteria 2638
278 Ga0068863_100209174 3300005841 Bacteria 1878
279 Ga0068863_100214375 3300005841 Bacteria 1854
280 Ga0068858_100004862 3300005842 Bacteria 13176
281 Ga0068858_100019146 3300005842 Bacteria 6404
282 Ga0068858_100031069 3300005842 Bacteria 4960
283 Ga0068858_100105377 3300005842 Bacteria 2631
284 Ga0068858_100169232 3300005842 Bacteria 2060
285 Ga0068860_100000900 3300005843 Bacteria 32980
286 Ga0068860_100079823 3300005843 Bacteria 3111
287 Ga0068860_100088103 3300005843 Bacteria 2955
288 Ga0068860_100388544 3300005843 Bacteria 1378
289 Ga0068862_100001691 3300005844 Bacteria 19990
290 Ga0068862_100010969 3300005844 Bacteria 7483
291 Ga0068862_100062409 3300005844 Bacteria 3205
292 Ga0068862_100172162 3300005844 Bacteria 1939
293 Ga0068862_100284438 3300005844 Bacteria 1516
294 Ga0081455_10000160 3300005937 Bacteria 82166
295 Ga0081455_10003542 3300005937 Bacteria 17909
296 Ga0081455_10053792 3300005937 Bacteria 3437
297 Ga0081455_10054052 3300005937 Bacteria 3426
298 Ga0081455_10264540 3300005937 Bacteria 1251
299 Ga0081538_10024573 3300005981 Bacteria 4288
300 Ga0081540_1000032 3300005983 Bacteria 144522
301 Ga0081540_1002311 3300005983 Bacteria 15633
302 Ga0081540_1012683 3300005983 Bacteria 5529
303 Ga0081539_10000856 3300005985 Bacteria 58246
304 Ga0081539_10013687 3300005985 Bacteria 6092
305 Ga0070717_10016310 3300006028 Bacteria 5757
306 Ga0070717_10048238 3300006028 Bacteria 3492
307 Ga0075365_10007299 3300006038 Bacteria 6179
308 Ga0075365_10014030 3300006038 Bacteria 4811
309 Ga0075365_10027063 3300006038 Bacteria 3645
310 Ga0075365_10036306 3300006038 Bacteria 3192
311 Ga0075365_10041629 3300006038 Bacteria 3002
312 Ga0075365_10090389 3300006038 Bacteria 2085
313 Ga0075365_10121269 3300006038 Bacteria 1804
314 Ga0075365_10144556 3300006038 Bacteria 1652
315 Ga0075365_10289032 3300006038 Bacteria 1153
316 Ga0075368_10006600 3300006042 Bacteria 4064
317 Ga0075368_10034380 3300006042 Bacteria 1975
318 Ga0075368_10050834 3300006042 Bacteria 1647
319 Ga0075368_10056250 3300006042 Bacteria 1569
320 Ga0075368_10068508 3300006042 Bacteria 1430
321 Ga0075363_100008322 3300006048 Bacteria 4824
322 Ga0075363_100034177 3300006048 Bacteria 2653
323 Ga0075364_10014940 3300006051 Bacteria 4806
324 Ga0075364_10035025 3300006051 Bacteria 3243
325 Ga0075364_10097233 3300006051 Bacteria 1958
326 Ga0075364_10159130 3300006051 Bacteria 1524
327 Ga0070715_10001875 3300006163 Bacteria 6301
328 Ga0070716_100020794 3300006173 Bacteria 3450
329 Ga0070712_100002508 3300006175 Bacteria 11319
330 Ga0070712_100004561 3300006175 Bacteria 8553
331 Ga0070712_100136445 3300006175 Bacteria 1866
332 Ga0070712_100171482 3300006175 Bacteria 1684
333 Ga0070712_100339038 3300006175 Bacteria 1227
334 Ga0075362_10020700 3300006177 Bacteria 2751
335 Ga0075367_10002480 3300006178 Bacteria 8449
336 Ga0075367_10022341 3300006178 Bacteria 3547
337 Ga0075367_10039443 3300006178 Bacteria 2754
338 Ga0075367_10071339 3300006178 Bacteria 2089
339 Ga0075367_10164023 3300006178 Bacteria 1382
340 Ga0075369_10009394 3300006186 Bacteria 3797
341 Ga0075369_10014037 3300006186 Bacteria 3193
342 Ga0075369_10020387 3300006186 Bacteria 2715
343 Ga0075369_10033295 3300006186 Bacteria 2184
344 Ga0097621_100009027 3300006237 Bacteria 7220
345 Ga0097621_100051087 3300006237 Bacteria 3363
346 Ga0097621_100113558 3300006237 Bacteria 2291
347 Ga0068871_100002899 3300006358 Bacteria 11767
348 Ga0068871_100005378 3300006358 Bacteria 8971
349 Ga0068871_100020899 3300006358 Bacteria 5021
350 Ga0075428_100001220 3300006844 Bacteria 27537
351 Ga0075428_100005911 3300006844 Bacteria 13598
352 Ga0075428_100020360 3300006844 Bacteria 7347
353 Ga0075428_100053554 3300006844 Bacteria 4422
354 Ga0075428_100159065 3300006844 Bacteria 2452
355 Ga0075428_100159870 3300006844 Bacteria 2445
356 Ga0075428_100203688 3300006844 Bacteria 2139
357 Ga0075428_100227622 3300006844 Bacteria 2012
358 Ga0075428_100259450 3300006844 Bacteria 1872
359 Ga0075430_100001639 3300006846 Bacteria 18299
360 Ga0075430_100002472 3300006846 Bacteria 15389
361 Ga0075430_100082381 3300006846 Bacteria 2696
362 Ga0075430_100086622 3300006846 Bacteria 2622
363 Ga0075430_100087775 3300006846 Bacteria 2603
364 Ga0075430_100129831 3300006846 Bacteria 2100
365 Ga0075430_100312493 3300006846 Bacteria 1299
366 Ga0075430_100363525 3300006846 Bacteria 1195
367 Ga0075431_100000109 3300006847 Bacteria 52399
368 Ga0075431_100003545 3300006847 Bacteria 15109
369 Ga0075431_100005435 3300006847 Bacteria 12587
370 Ga0075431_100020612 3300006847 Bacteria 6737
371 Ga0075431_100064679 3300006847 Bacteria 3777
372 Ga0075431_100084861 3300006847 Bacteria 3269
373 Ga0075431_100092037 3300006847 Bacteria 3129
374 Ga0075431_100146448 3300006847 Bacteria 2434
375 Ga0075431_100337982 3300006847 Bacteria 1516
376 Ga0075431_100350704 3300006847 Bacteria 1484
377 Ga0075434_100000211 3300006871 Bacteria 39638
378 Ga0075434_100000371 3300006871 Bacteria 32625
379 Ga0075434_100001777 3300006871 Bacteria 18583
380 Ga0075434_100006290 3300006871 Bacteria 10880
381 Ga0075434_100023631 3300006871 Bacteria 5994
382 Ga0075434_100045576 3300006871 Bacteria 4350
383 Ga0075429_100001213 3300006880 Bacteria 20918
384 Ga0075429_100022955 3300006880 Bacteria 5409
385 Ga0075429_100053625 3300006880 Bacteria 3508
386 Ga0075429_100090593 3300006880 Bacteria 2667
387 Ga0068865_100021004 3300006881 Bacteria 4243
388 Ga0068865_100038875 3300006881 Bacteria 3223
389 Ga0075436_100003794 3300006914 Bacteria 10365
390 Ga0075436_100014215 3300006914 Bacteria 5450
391 Ga0075436_100064857 3300006914 Bacteria 2525
392 Ga0075436_100168696 3300006914 Bacteria 1545
393 Ga0097620_100000332 3300006931 Bacteria 47130
394 Ga0097620_100006827 3300006931 Bacteria 11597
395 Ga0097620_100024736 3300006931 Bacteria 6026
396 Ga0097620_100586186 3300006931 Bacteria 1208
397 Ga0079104_1000063 3300006946 Bacteria 159519
398 Ga0079104_1007401 3300006946 Bacteria 3989
399 Ga0079104_1009774 3300006946 Bacteria 3221
400 Ga0099826_10000120 3300006948 Bacteria 35923
401 Ga0099826_10010203 3300006948 Bacteria 7033
402 Ga0099826_10079759 3300006948 Bacteria 2044
403 Ga0075435_100006459 3300007076 Bacteria 8292
404 Ga0075435_100008023 3300007076 Bacteria 7557
405 Ga0075435_100130816 3300007076 Bacteria 2100
406 Ga0075435_100197824 3300007076 Bacteria 1702
407 Ga0099794_10018011 3300007265 Bacteria 3159
408 Ga0099794_10087406 3300007265 Bacteria 1544
409 Ga0099795_10006137 3300007788 Bacteria 3255
410 Ga0105251_10031021 3300009011 Bacteria 2678
411 Ga0105251_10065134 3300009011 Bacteria 1706
412 Ga0105244_10078544 3300009036 Bacteria 1636
413 Ga0105250_10026489 3300009092 Bacteria 2335
414 Ga0105250_10058295 3300009092 Bacteria 1550
415 Ga0105240_10016012 3300009093 Bacteria 10165
416 Ga0105240_10044678 3300009093 Bacteria 5626
417 Ga0105240_10059935 3300009093 Bacteria 4747
418 Ga0105240_10087081 3300009093 Bacteria 3825
419 Ga0105240_10161270 3300009093 Bacteria 2663
420 Ga0105240_10194622 3300009093 Bacteria 2382
421 Ga0105240_10211647 3300009093 Bacteria 2265
422 Ga0105240_10259473 3300009093 Bacteria 2005
423 Ga0105240_10305535 3300009093 Bacteria 1818
424 Ga0105240_10357390 3300009093 Bacteria 1656
425 Ga0111539_10001777 3300009094 Bacteria 28667
426 Ga0111539_10024409 3300009094 Bacteria 7420
427 Ga0111539_10061693 3300009094 Bacteria 4441
428 Ga0111539_10077044 3300009094 Bacteria 3925
429 Ga0111539_10081452 3300009094 Bacteria 3807
430 Ga0111539_10148301 3300009094 Bacteria 2746
431 Ga0105245_10000115 3300009098 Bacteria 77632
432 Ga0105245_10007590 3300009098 Bacteria 9496
433 Ga0105245_10137928 3300009098 Bacteria 2294
434 Ga0105247_10011005 3300009101 Bacteria 5460
435 Ga0105247_10028530 3300009101 Bacteria 3378
436 Ga0114129_10000425 3300009147 Bacteria 50146
437 Ga0114129_10028829 3300009147 Bacteria 7865
438 Ga0114129_10039454 3300009147 Bacteria 6657
439 Ga0114129_10089914 3300009147 Bacteria 4256
440 Ga0114129_10107117 3300009147 Bacteria 3861
441 Ga0114129_10157237 3300009147 Bacteria 3107
442 Ga0114129_10160953 3300009147 Bacteria 3066
443 Ga0114129_10281742 3300009147 Bacteria 2221
444 Ga0114129_10295577 3300009147 Bacteria 2160
445 Ga0114129_10341581 3300009147 Bacteria 1986
446 Ga0114129_10387854 3300009147 Bacteria 1843
447 Ga0105243_10001566 3300009148 Bacteria 19983
448 Ga0105243_10002537 3300009148 Bacteria 15248
449 Ga0105243_10058123 3300009148 Bacteria 3081
450 Ga0105243_10128637 3300009148 Bacteria 2146
451 Ga0105241_10033070 3300009174 Bacteria 3881
452 Ga0105241_10159157 3300009174 Bacteria 1855
453 Ga0105241_10182951 3300009174 Bacteria 1740
454 Ga0105242_10127953 3300009176 Bacteria 2188
455 Ga0105248_10002392 3300009177 Bacteria 20840
456 Ga0105248_10047992 3300009177 Bacteria 4789
457 Ga0105248_10098637 3300009177 Bacteria 3292
458 Ga0105248_10243132 3300009177 Bacteria 2026
459 Ga0105248_10339674 3300009177 Bacteria 1691
460 Ga0105237_10056057 3300009545 Bacteria 3946
461 Ga0105237_10132128 3300009545 Bacteria 2490
462 Ga0105237_10199693 3300009545 Bacteria 1999
463 Ga0105237_10262249 3300009545 Bacteria 1730
464 Ga0105238_10012662 3300009551 Bacteria 8513
465 Ga0105238_10013423 3300009551 Bacteria 8270
466 Ga0105238_10038211 3300009551 Bacteria 4875
467 Ga0105238_10088560 3300009551 Bacteria 3082
468 Ga0105238_10124082 3300009551 Bacteria 2562
469 Ga0105238_10246639 3300009551 Bacteria 1764
470 Ga0105238_10292662 3300009551 Bacteria 1611
471 Ga0105238_10309527 3300009551 Bacteria 1564
472 Ga0105238_10512926 3300009551 Bacteria 1201
473 Ga0105238_10569175 3300009551 Bacteria 1138
474 Ga0105249_10001691 3300009553 Bacteria 19321
475 Ga0105249_10001995 3300009553 Bacteria 17726
476 Ga0105249_10008449 3300009553 Bacteria 8970
477 Ga0105249_10081287 3300009553 Bacteria 3012
478 Ga0105249_10134656 3300009553 Bacteria 2363
479 Ga0105249_10311215 3300009553 Bacteria 1583
480 Ga0105249_10330206 3300009553 Bacteria 1539
481 Ga0105249_10548771 3300009553 Bacteria 1206
482 Ga0099796_10058848 3300010159 Bacteria 1356
483 Ga0105239_10103610 3300010375 Bacteria 3149
484 Ga0105239_10148418 3300010375 Bacteria 2616
485 Ga0105239_10157282 3300010375 Bacteria 2539
486 Ga0105239_10163319 3300010375 Bacteria 2489
487 Ga0105239_10177443 3300010375 Bacteria 2383
488 Ga0105239_10200602 3300010375 Bacteria 2235
489 Ga0105239_10206328 3300010375 Bacteria 2202
490 Ga0105239_10248504 3300010375 Bacteria 1998
491 Ga0105239_10260239 3300010375 Bacteria 1950
492 Ga0105239_10264833 3300010375 Bacteria 1932
493 Ga0105239_10326482 3300010375 Bacteria 1731
494 Ga0105246_10003706 3300011119 Bacteria 9251
495 Ga0105246_10008619 3300011119 Bacteria 6272
496 Ga0105246_10024155 3300011119 Bacteria 3945
497 Ga0105246_10066455 3300011119 Bacteria 2525
498 Ga0105246_10211931 3300011119 Bacteria 1513
499 Ga0105246_10213339 3300011119 Bacteria 1508
500 Ga0105246_10316084 3300011119 Bacteria 1267
501 Ga0157373_10049569 3300013100 Bacteria 2992
502 Ga0157373_10071974 3300013100 Bacteria 2441
503 Ga0157373_10261002 3300013100 Bacteria 1226
504 Ga0157371_10069114 3300013102 Bacteria 2501
505 Ga0157371_10111413 3300013102 Bacteria 1942
506 Ga0157371_10123827 3300013102 Bacteria 1839
507 Ga0157371_10274742 3300013102 Bacteria 1216
508 Ga0157370_10000324 3300013104 Bacteria 59791
509 Ga0157370_10026364 3300013104 Bacteria 5740
510 Ga0157370_10216944 3300013104 Bacteria 1773
511 Ga0157370_10224216 3300013104 Bacteria 1740
512 Ga0157370_10306328 3300013104 Bacteria 1466
513 Ga0157369_10005525 3300013105 Bacteria 14679
514 Ga0157369_10117120 3300013105 Bacteria 2828
515 Ga0157369_10195153 3300013105 Bacteria 2126
516 Ga0157369_10202001 3300013105 Bacteria 2086
517 Ga0157369_10273617 3300013105 Bacteria 1759
518 Ga0157369_10421652 3300013105 Bacteria 1383
519 Ga0171462_1008 3300013250 Bacteria 384318
520 Ga0157374_10006468 3300013296 Bacteria 9945
521 Ga0157374_10006671 3300013296 Bacteria 9807
522 Ga0157374_10073552 3300013296 Bacteria 3226
523 Ga0157374_10163290 3300013296 Bacteria 2170
524 Ga0157378_10001030 3300013297 Bacteria 25495
525 Ga0157378_10035361 3300013297 Bacteria 4418
526 Ga0157378_10111532 3300013297 Bacteria 2508
527 Ga0163162_10045343 3300013306 Bacteria 4405
528 Ga0163162_10092574 3300013306 Bacteria 3107
529 Ga0163162_10099294 3300013306 Bacteria 3002
530 Ga0163162_10112611 3300013306 Bacteria 2820
531 Ga0163162_10263359 3300013306 Bacteria 1855
532 Ga0157372_10096778 3300013307 Bacteria 3365
533 Ga0157372_10171317 3300013307 Bacteria 2511
534 Ga0157372_10232610 3300013307 Bacteria 2137
535 Ga0157372_10587039 3300013307 Bacteria 1299
536 Ga0157375_10011994 3300013308 Bacteria 7674
537 Ga0157375_10035164 3300013308 Bacteria 4780
538 Ga0157375_10096756 3300013308 Bacteria 3025
539 Ga0157375_10125566 3300013308 Bacteria 2680
540 Ga0157375_10163308 3300013308 Bacteria 2371
541 Ga0163163_10000150 3300014325 Bacteria 72638
542 Ga0163163_10010637 3300014325 Bacteria 8290
543 Ga0163163_10102773 3300014325 Bacteria 2882
544 Ga0163163_10104374 3300014325 Bacteria 2859
545 Ga0163163_10119349 3300014325 Bacteria 2670
546 Ga0163163_10662111 3300014325 Bacteria 1108
547 Ga0157380_10008288 3300014326 Bacteria 7406
548 Ga0157380_10030596 3300014326 Bacteria 4125
549 Ga0157380_10080263 3300014326 Bacteria 2666
550 Ga0182008_10042480 3300014497 Bacteria 2264
551 Ga0157377_10004065 3300014745 Bacteria 6675
552 Ga0157377_10008042 3300014745 Bacteria 5127
553 Ga0157377_10024575 3300014745 Bacteria 3204
554 Ga0157379_10010439 3300014968 Bacteria 8094
555 Ga0157379_10098205 3300014968 Bacteria 2629
556 Ga0157379_10187602 3300014968 Bacteria 1869
557 Ga0157379_10474868 3300014968 Bacteria 1157
558 Ga0157376_10002960 3300014969 Bacteria 11654
559 Ga0157376_10381377 3300014969 Bacteria 1358
560 Ga0182006_1014659 3300015261 Bacteria 3374
561 Ga0182005_1029798 3300015265 Bacteria 1488
562 Ga0163161_10057076 3300017792 Bacteria 2837
563 Ga0206356_10305157 3300020070 Bacteria 1604
564 Ga0206356_10632670 3300020070 Bacteria 2430
565 Ga0206354_10039477 3300020081 Bacteria 1390
566 Ga0206353_10339595 3300020082 Bacteria 1855
567 Ga0206353_10593657 3300020082 Bacteria 1511
568 Ga0206353_11216187 3300020082 Bacteria 1260
569 Ga0213873_10004680 3300021358 Bacteria 2573
570 Ga0213874_10022715 3300021377 Bacteria 1743
571 Ga0213876_10000260 3300021384 Bacteria 48782
572 Ga0213876_10018209 3300021384 Bacteria 3707
573 Ga0213876_10074564 3300021384 Bacteria 1792
574 Ga0213876_10181579 3300021384 Bacteria 1119
575 Ga0213875_10000046 3300021388 Bacteria 149850
576 Ga0213875_10013299 3300021388 Bacteria 4045
577 Ga0213875_10014809 3300021388 Bacteria 3800
578 Ga0213875_10156609 3300021388 Bacteria 1068
579 Ga0213871_10051334 3300021441 Bacteria 1131
580 Ga0228711_1000045 3300022739 Bacteria 85435
581 Ga0228711_1000184 3300022739 Bacteria 62108
582 Ga0228710_1000036 3300022740 Bacteria 91904
583 Ga0228710_1000177 3300022740 Bacteria 62984
584 Ga0207425_1000043 3300025245 Bacteria 208791
585 Ga0207425_1002206 3300025245 Bacteria 7076
586 Ga0209026_1000029 3300025250 Bacteria 337109
587 Ga0209148_1000080 3300025254 Bacteria 277806
588 Ga0209148_1001606 3300025254 Bacteria 10541
589 Ga0209759_1000040 3300025256 Bacteria 254501
590 Ga0209129_1000072 3300025258 Bacteria 208805
591 Ga0209129_1000226 3300025258 Bacteria 63537
592 Ga0209129_1001403 3300025258 Bacteria 13475
593 Ga0209129_1002679 3300025258 Bacteria 8410
594 Ga0209233_1000028 3300025261 Bacteria 642062
595 Ga0209233_1000613 3300025261 Bacteria 18219
596 Ga0209233_1003389 3300025261 Bacteria 5620
597 Ga0209455_1000171 3300025272 Bacteria 109696
598 Ga0209455_1001291 3300025272 Bacteria 11697
599 Ga0209673_1000157 3300025273 Bacteria 144747
600 Ga0209673_1000239 3300025273 Bacteria 105502
601 Ga0209673_1014457 3300025273 Bacteria 3052
602 Ga0209673_1028115 3300025273 Bacteria 1817
603 Ga0209130_1000145 3300025284 Bacteria 113201
604 Ga0209130_1000209 3300025284 Bacteria 78300
605 Ga0209130_1015990 3300025284 Bacteria 1831
606 Ga0209025_1000008 3300025294 Bacteria 1130876
607 Ga0209025_1000120 3300025294 Bacteria 208791
608 Ga0209025_1001416 3300025294 Bacteria 31774
609 Ga0209025_1001755 3300025294 Bacteria 25992
610 Ga0209025_1010153 3300025294 Bacteria 6423
611 Ga0209025_1014358 3300025294 Bacteria 4879
612 Ga0209025_1014934 3300025294 Bacteria 4729
613 Ga0209025_1022482 3300025294 Bacteria 3340
614 Ga0209025_1032144 3300025294 Bacteria 2462
615 Ga0209564_1000237 3300025295 Bacteria 120540
616 Ga0209564_1003161 3300025295 Bacteria 11595
617 Ga0209564_1014218 3300025295 Bacteria 3326
618 Ga0209758_1000059 3300025297 Bacteria 328458
619 Ga0209758_1000111 3300025297 Bacteria 208790
620 Ga0209758_1000130 3300025297 Bacteria 184456
621 Ga0209758_1012600 3300025297 Bacteria 4712
622 Ga0209758_1012869 3300025297 Bacteria 4633
623 Ga0209758_1020840 3300025297 Bacteria 3081
624 Ga0209758_1022623 3300025297 Bacteria 2872
625 Ga0209758_1028720 3300025297 Bacteria 2344
626 Ga0209050_1004722 3300025298 Bacteria 9025
627 Ga0209256_1000185 3300025299 Bacteria 120265
628 Ga0209256_1000619 3300025299 Bacteria 49078
629 Ga0209256_1008788 3300025299 Bacteria 4594
630 Ga0209256_1013348 3300025299 Bacteria 3052
631 Ga0207426_1000011 3300025302 Bacteria 791203
632 Ga0207426_1006212 3300025302 Bacteria 5246
633 Ga0207426_1009460 3300025302 Bacteria 3855
634 Ga0209051_1004806 3300025303 Bacteria 8147
635 Ga0209051_1005181 3300025303 Bacteria 7720
636 Ga0209051_1008002 3300025303 Bacteria 5673
637 Ga0209051_1027204 3300025303 Bacteria 2284
638 Ga0209257_1000997 3300025304 Bacteria 38352
639 Ga0209257_1003615 3300025304 Bacteria 13025
640 Ga0207697_10026362 3300025315 Bacteria 2376
641 Ga0207656_10014795 3300025321 Bacteria 3014
642 Ga0207656_10032864 3300025321 Bacteria 2157
643 Ga0207692_10000504 3300025898 Bacteria 13779
644 Ga0207692_10151304 3300025898 Bacteria 1329
645 Ga0207642_10056938 3300025899 Bacteria 1795
646 Ga0207642_10162803 3300025899 Bacteria 1200
647 Ga0207710_10004939 3300025900 Bacteria 5778
648 Ga0207710_10051552 3300025900 Bacteria 1848
649 Ga0207688_10000213 3300025901 Bacteria 25981
650 Ga0207688_10000344 3300025901 Bacteria 21559
651 Ga0207688_10002122 3300025901 Bacteria 10654
652 Ga0207688_10238146 3300025901 Bacteria 1100
653 Ga0207680_10038874 3300025903 Bacteria 2757
654 Ga0207680_10292765 3300025903 Bacteria 1133
655 Ga0207647_10015916 3300025904 Bacteria 5146
656 Ga0207647_10030957 3300025904 Bacteria 3448
657 Ga0207647_10086211 3300025904 Bacteria 1877
658 Ga0207699_10000508 3300025906 Bacteria 19334
659 Ga0207699_10026433 3300025906 Bacteria 3200
660 Ga0207699_10096390 3300025906 Bacteria 1867
661 Ga0207645_10007988 3300025907 Bacteria 7422
662 Ga0207645_10013416 3300025907 Bacteria 5521
663 Ga0207645_10066685 3300025907 Bacteria 2301
664 Ga0207643_10000218 3300025908 Bacteria 40287
665 Ga0207643_10008419 3300025908 Bacteria 5535
666 Ga0207643_10045427 3300025908 Bacteria 2481
667 Ga0207705_10001941 3300025909 Bacteria 16155
668 Ga0207705_10021988 3300025909 Bacteria 4551
669 Ga0207684_10193153 3300025910 Bacteria 1756
670 Ga0207684_10203617 3300025910 Bacteria 1707
671 Ga0207654_10122151 3300025911 Bacteria 1637
672 Ga0207654_10239484 3300025911 Bacteria 1212
673 Ga0207707_10065174 3300025912 Bacteria 3173
674 Ga0207707_10069552 3300025912 Bacteria 3068
675 Ga0207707_10133884 3300025912 Bacteria 2167
676 Ga0207707_10298046 3300025912 Bacteria 1394
677 Ga0207707_10456026 3300025912 Bacteria 1094
678 Ga0207695_10023254 3300025913 Bacteria 7010
679 Ga0207695_10051716 3300025913 Bacteria 4311
680 Ga0207695_10067364 3300025913 Bacteria 3673
681 Ga0207695_10123834 3300025913 Bacteria 2550
682 Ga0207695_10127350 3300025913 Bacteria 2507
683 Ga0207695_10146155 3300025913 Bacteria 2308
684 Ga0207695_10406203 3300025913 Bacteria 1246
685 Ga0207695_10428145 3300025913 Bacteria 1207
686 Ga0207695_10435917 3300025913 Bacteria 1194
687 Ga0207671_10017102 3300025914 Bacteria 5606
688 Ga0207671_10144931 3300025914 Bacteria 1832
689 Ga0207671_10174406 3300025914 Bacteria 1671
690 Ga0207671_10210293 3300025914 Bacteria 1521
691 Ga0207693_10004810 3300025915 Bacteria 11361
692 Ga0207693_10009374 3300025915 Bacteria 7984
693 Ga0207693_10012513 3300025915 Bacteria 6854
694 Ga0207693_10021771 3300025915 Bacteria 5097
695 Ga0207693_10100901 3300025915 Bacteria 2263
696 Ga0207693_10127360 3300025915 Bacteria 2001
697 Ga0207693_10160234 3300025915 Bacteria 1770
698 Ga0207693_10229138 3300025915 Unclassified 1459
699 Ga0207663_10000732 3300025916 Bacteria 14686
700 Ga0207663_10023281 3300025916 Bacteria 3552
701 Ga0207663_10034225 3300025916 Bacteria 3036
702 Ga0207663_10045565 3300025916 Bacteria 2698
703 Ga0207663_10054062 3300025916 Bacteria 2512
704 Ga0207663_10072744 3300025916 Bacteria 2223
705 Ga0207663_10163460 3300025916 Bacteria 1574
706 Ga0207660_10001765 3300025917 Bacteria 14471
707 Ga0207660_10002161 3300025917 Bacteria 13042
708 Ga0207660_10024327 3300025917 Bacteria 4100
709 Ga0207660_10194260 3300025917 Bacteria 1582
710 Ga0207662_10005862 3300025918 Bacteria 6590
711 Ga0207662_10047533 3300025918 Bacteria 2542
712 Ga0207662_10091273 3300025918 Bacteria 1874
713 Ga0207662_10140258 3300025918 Bacteria 1531
714 Ga0207662_10176713 3300025918 Bacteria 1372
715 Ga0207657_10011619 3300025919 Bacteria 8731
716 Ga0207657_10024387 3300025919 Bacteria 5603
717 Ga0207657_10030427 3300025919 Bacteria 4900
718 Ga0207657_10034378 3300025919 Bacteria 4558
719 Ga0207649_10007165 3300025920 Bacteria 6061
720 Ga0207649_10108977 3300025920 Bacteria 1847
721 Ga0207649_10118222 3300025920 Bacteria 1783
722 Ga0207652_10029701 3300025921 Bacteria 4573
723 Ga0207652_10196331 3300025921 Bacteria 1816
724 Ga0207652_10280474 3300025921 Bacteria 1503
725 Ga0207652_10401741 3300025921 Bacteria 1236
726 Ga0207646_10007326 3300025922 Bacteria 11239
727 Ga0207646_10103953 3300025922 Bacteria 2547
728 Ga0207646_10245445 3300025922 Bacteria 1617
729 Ga0207681_10008264 3300025923 Bacteria 6363
730 Ga0207681_10028104 3300025923 Bacteria 3642
731 Ga0207681_10041178 3300025923 Bacteria 3079
732 Ga0207681_10144849 3300025923 Bacteria 1774
733 Ga0207694_10144217 3300025924 Bacteria 1916
734 Ga0207650_10022208 3300025925 Bacteria 4491
735 Ga0207650_10096013 3300025925 Bacteria 2273
736 Ga0207659_10019408 3300025926 Bacteria 4475
737 Ga0207659_10038536 3300025926 Bacteria 3326
738 Ga0207659_10083561 3300025926 Bacteria 2367
739 Ga0207687_10068045 3300025927 Bacteria 2536
740 Ga0207687_10084687 3300025927 Bacteria 2298
741 Ga0207700_10056062 3300025928 Bacteria 2965
742 Ga0207700_10065156 3300025928 Bacteria 2779
743 Ga0207700_10074501 3300025928 Bacteria 2626
744 Ga0207700_10111361 3300025928 Bacteria 2203
745 Ga0207700_10286364 3300025928 Bacteria 1419
746 Ga0207664_10018977 3300025929 Bacteria 5074
747 Ga0207664_10082568 3300025929 Bacteria 2618
748 Ga0207664_10085522 3300025929 Bacteria 2574
749 Ga0207664_10125164 3300025929 Bacteria 2157
750 Ga0207664_10131642 3300025929 Bacteria 2106
751 Ga0207664_10281055 3300025929 Bacteria 1460
752 Ga0207664_10350825 3300025929 Bacteria 1306
753 Ga0207644_10007463 3300025931 Bacteria 7130
754 Ga0207644_10008328 3300025931 Bacteria 6795
755 Ga0207644_10020710 3300025931 Bacteria 4474
756 Ga0207644_10053055 3300025931 Bacteria 2917
757 Ga0207644_10350477 3300025931 Bacteria 1199
758 Ga0207690_10296031 3300025932 Bacteria 1265
759 Ga0207706_10003979 3300025933 Bacteria 14003
760 Ga0207706_10078106 3300025933 Bacteria 2911
761 Ga0207706_10093359 3300025933 Bacteria 2646
762 Ga0207706_10377048 3300025933 Bacteria 1231
763 Ga0207686_10023021 3300025934 Bacteria 3594
764 Ga0207709_10000917 3300025935 Bacteria 22229
765 Ga0207709_10005103 3300025935 Bacteria 7495
766 Ga0207709_10005820 3300025935 Bacteria 6967
767 Ga0207709_10013217 3300025935 Bacteria 4554
768 Ga0207670_10004303 3300025936 Bacteria 7645
769 Ga0207670_10010975 3300025936 Bacteria 5236
770 Ga0207670_10042605 3300025936 Bacteria 2992
771 Ga0207670_10107671 3300025936 Bacteria 2002
772 Ga0207670_10279153 3300025936 Bacteria 1301
773 Ga0207670_10406824 3300025936 Bacteria 1089
774 Ga0207669_10145014 3300025937 Bacteria 1654
775 Ga0207704_10005069 3300025938 Bacteria 6061
776 Ga0207704_10010576 3300025938 Bacteria 4507
777 Ga0207704_10123145 3300025938 Bacteria 1779
778 Ga0207665_10018857 3300025939 Bacteria 4534
779 Ga0207665_10094554 3300025939 Bacteria 2076
780 Ga0207665_10148182 3300025939 Bacteria 1679
781 Ga0207665_10217331 3300025939 Bacteria 1399
782 Ga0207691_10005727 3300025940 Bacteria 12016
783 Ga0207691_10035136 3300025940 Bacteria 4656
784 Ga0207691_10080795 3300025940 Bacteria 2923
785 Ga0207691_10101354 3300025940 Bacteria 2569
786 Ga0207711_10116460 3300025941 Bacteria 2382
787 Ga0207711_10257644 3300025941 Bacteria 1603
788 Ga0207689_10000762 3300025942 Bacteria 30912
789 Ga0207689_10021922 3300025942 Bacteria 5372
790 Ga0207689_10023847 3300025942 Bacteria 5133
791 Ga0207689_10058267 3300025942 Bacteria 3177
792 Ga0207661_10135602 3300025944 Bacteria 2114
793 Ga0207661_10176323 3300025944 Unclassified 1864
794 Ga0207679_10005378 3300025945 Bacteria 8026
795 Ga0207667_10007911 3300025949 Bacteria 12694
796 Ga0207667_10127690 3300025949 Bacteria 2619
797 Ga0207667_10157624 3300025949 Bacteria 2336
798 Ga0207667_10308230 3300025949 Bacteria 1617
799 Ga0207651_10045102 3300025960 Bacteria 2955
800 Ga0207651_10067158 3300025960 Bacteria 2522
801 Ga0207651_10181570 3300025960 Bacteria 1670
802 Ga0207651_10341819 3300025960 Bacteria 1257
803 Ga0207712_10000763 3300025961 Bacteria 24183
804 Ga0207712_10001549 3300025961 Bacteria 15507
805 Ga0207712_10013285 3300025961 Bacteria 5279
806 Ga0207712_10080583 3300025961 Bacteria 2368
807 Ga0207712_10126412 3300025961 Bacteria 1942
808 Ga0207668_10053056 3300025972 Bacteria 2808
809 Ga0207668_10059474 3300025972 Bacteria 2678
810 Ga0207668_10137408 3300025972 Bacteria 1874
811 Ga0207640_10225598 3300025981 Bacteria 1437
812 Ga0207658_10155695 3300025986 Bacteria 1867
813 Ga0207658_10217649 3300025986 Bacteria 1605
814 Ga0207658_10433128 3300025986 Bacteria 1162
815 Ga0207677_10004998 3300026023 Bacteria 7160
816 Ga0207677_10579091 3300026023 Bacteria 982
817 Ga0207703_10001682 3300026035 Bacteria 19893
818 Ga0207703_10011007 3300026035 Bacteria 7048
819 Ga0207703_10100954 3300026035 Bacteria 2446
820 Ga0207703_10112645 3300026035 Bacteria 2324
821 Ga0207639_10011475 3300026041 Bacteria 6156
822 Ga0207639_10076759 3300026041 Bacteria 2631
823 Ga0207639_10087124 3300026041 Bacteria 2488
824 Ga0207678_10000245 3300026067 Bacteria 49012
825 Ga0207678_10010214 3300026067 Bacteria 8241
826 Ga0207678_10079912 3300026067 Bacteria 2799
827 Ga0207678_10111326 3300026067 Bacteria 2335
828 Ga0207678_10133405 3300026067 Bacteria 2119
829 Ga0207678_10338031 3300026067 Bacteria 1297
830 Ga0207678_10535513 3300026067 Bacteria 1023
831 Ga0207708_10000114 3300026075 Bacteria 61971
832 Ga0207708_10003612 3300026075 Bacteria 11400
833 Ga0207708_10005145 3300026075 Bacteria 9649
834 Ga0207708_10055868 3300026075 Bacteria 3011
835 Ga0207708_10177349 3300026075 Bacteria 1690
836 Ga0207708_10229961 3300026075 Bacteria 1489
837 Ga0207702_10006836 3300026078 Bacteria 9782
838 Ga0207702_10008706 3300026078 Bacteria 8559
839 Ga0207702_10029050 3300026078 Bacteria 4599
840 Ga0207702_10054191 3300026078 Bacteria 3398
841 Ga0207702_10120775 3300026078 Bacteria 2345
842 Ga0207641_10008353 3300026088 Bacteria 8555
843 Ga0207641_10010010 3300026088 Bacteria 7800
844 Ga0207641_10250705 3300026088 Bacteria 1653
845 Ga0207648_10001736 3300026089 Bacteria 23850
846 Ga0207648_10216150 3300026089 Bacteria 1702
847 Ga0207676_10001967 3300026095 Bacteria 14966
848 Ga0207676_10036284 3300026095 Bacteria 3749
849 Ga0207676_10233222 3300026095 Bacteria 1647
850 Ga0207674_10001070 3300026116 Bacteria 35647
851 Ga0207674_10022820 3300026116 Bacteria 6715
852 Ga0207674_10176613 3300026116 Bacteria 2088
853 Ga0207674_10181948 3300026116 Bacteria 2053
854 Ga0207675_100009348 3300026118 Bacteria 9187
855 Ga0207675_100012148 3300026118 Bacteria 8044
856 Ga0207675_100062369 3300026118 Bacteria 3481
857 Ga0207675_100206359 3300026118 Bacteria 1888
858 Ga0207675_100373408 3300026118 Bacteria 1401
859 Ga0207683_10000454 3300026121 Bacteria 38017
860 Ga0207683_10008437 3300026121 Bacteria 8820
861 Ga0207683_10225670 3300026121 Bacteria 1708
862 Ga0207683_10287481 3300026121 Bacteria 1503
863 Ga0207698_10011789 3300026142 Bacteria 5685
864 Ga0207698_10144721 3300026142 Bacteria 2054
865 Ga0207698_10266057 3300026142 Bacteria 1578
866 Ga0209281_1000082 3300027111 Bacteria 257684
867 Ga0209281_1000110 3300027111 Bacteria 215631
868 Ga0209281_1000178 3300027111 Bacteria 148152
869 Ga0209281_1000417 3300027111 Bacteria 64228
870 Ga0209281_1000459 3300027111 Bacteria 57396
871 Ga0209371_1000037 3300027312 Bacteria 367074
872 Ga0209371_1000534 3300027312 Bacteria 36079
873 Ga0209371_1000686 3300027312 Bacteria 29005
874 Ga0209371_1006547 3300027312 Bacteria 4287
875 Ga0209969_1009492 3300027360 Bacteria 1388
876 Ga0209967_1001984 3300027364 Bacteria 2638
877 Ga0209981_1007998 3300027378 Bacteria 1431
878 Ga0210000_1000744 3300027462 Bacteria 4520
879 Ga0209995_1004105 3300027471 Bacteria 2324
880 Ga0209282_1000006 3300027666 Bacteria 276998
881 Ga0209282_1000023 3300027666 Bacteria 173309
882 Ga0209282_1003316 3300027666 Bacteria 9548
883 Ga0209282_1015395 3300027666 Bacteria 4867
884 Ga0209588_1031076 3300027671 Bacteria 1707
885 Ga0209971_1005098 3300027682 Bacteria 3120
886 Ga0209971_1013510 3300027682 Bacteria 1935
887 Ga0209813_10003330 3300027866 Bacteria 3753
888 Ga0209813_10005127 3300027866 Bacteria 3167
889 Ga0209813_10056536 3300027866 Bacteria 1242
890 Ga0207428_10000624 3300027907 Bacteria 41590
891 Ga0207428_10006066 3300027907 Bacteria 11172
892 Ga0207428_10007115 3300027907 Bacteria 10236
893 Ga0207428_10025045 3300027907 Bacteria 4999
894 Ga0207428_10040791 3300027907 Bacteria 3761
895 Ga0207428_10111880 3300027907 Bacteria 2101
896 Ga0268266_10000594 3300028379 Bacteria 49521
897 Ga0268266_10001956 3300028379 Bacteria 23149
898 Ga0268266_10002242 3300028379 Bacteria 21057
899 Ga0268266_10090419 3300028379 Bacteria 2683
900 Ga0268266_10113076 3300028379 Bacteria 2407
901 Ga0268266_10116611 3300028379 Bacteria 2372
902 Ga0268266_10251918 3300028379 Bacteria 1633
903 Ga0268266_10277140 3300028379 Bacteria 1558
904 Ga0268266_10280692 3300028379 Bacteria 1549
905 Ga0268265_10010310 3300028380 Bacteria 6309
906 Ga0268265_10013313 3300028380 Bacteria 5588
907 Ga0268265_10173588 3300028380 Bacteria 1845
908 Ga0268264_10002112 3300028381 Bacteria 17710
909 Ga0268264_10008605 3300028381 Bacteria 8480
910 Ga0268264_10054830 3300028381 Bacteria 3330
911 Ga0268264_10092980 3300028381 Bacteria 2604
912 Ga0265337_1027756 3300028556 Bacteria 1704
913 Ga0265318_10046624 3300028577 Bacteria 1635
914 Ga0307515_10001890 3300028794 Bacteria 46604
915 Ga0307515_10004497 3300028794 Bacteria 28840
916 Ga0307515_10012438 3300028794 Bacteria 16010
917 Ga0307515_10048889 3300028794 Bacteria 6384
918 Ga0307515_10138425 3300028794 Bacteria 2628
919 Ga0307515_10300625 3300028794 Bacteria 1290
920 Ga0265338_10001544 3300028800 Bacteria 37206
921 Ga0268256_1000039 3300030500 Bacteria 354969
922 Ga0268256_1001706 3300030500 Bacteria 12533
923 Ga0268256_1004290 3300030500 Bacteria 5971
924 Ga0268256_1005810 3300030500 Bacteria 4744
925 Ga0307512_10145519 3300030522 Bacteria 1435
926 Ga0316181_1049652 3300030744 Bacteria 4297
927 Ga0265330_10039535 3300031235 Bacteria 2095
928 Ga0265332_10027782 3300031238 Bacteria 2478
929 Ga0265332_10028322 3300031238 Bacteria 2453
930 Ga0265332_10088275 3300031238 Bacteria 1312
931 Ga0265325_10000034 3300031241 Bacteria 99371
932 Ga0265325_10001708 3300031241 Bacteria 15269
933 Ga0265325_10004418 3300031241 Bacteria 8892
934 Ga0265325_10014336 3300031241 Bacteria 4483
935 Ga0265325_10015145 3300031241 Bacteria 4344
936 Ga0265325_10021210 3300031241 Bacteria 3574
937 Ga0265325_10054261 3300031241 Bacteria 2052
938 Ga0265340_10000573 3300031247 Bacteria 20425
939 Ga0265340_10005082 3300031247 Bacteria 7317
940 Ga0265340_10009717 3300031247 Bacteria 5157
941 Ga0265340_10009784 3300031247 Bacteria 5139
942 Ga0265340_10016580 3300031247 Bacteria 3814
943 Ga0265340_10022812 3300031247 Bacteria 3196
944 Ga0265340_10036542 3300031247 Bacteria 2434
945 Ga0265339_10001994 3300031249 Bacteria 14995
946 Ga0265331_10016364 3300031250 Bacteria 3895
947 Ga0265316_10004461 3300031344 Bacteria 13928
948 Ga0265316_10163938 3300031344 Bacteria 1661
949 Ga0307513_10008284 3300031456 Bacteria 13326
950 Ga0307513_10065459 3300031456 Bacteria 3824
951 Ga0307513_10175906 3300031456 Bacteria 2011
952 Ga0307513_10327763 3300031456 Bacteria 1287
953 Ga0307509_10037843 3300031507 Bacteria 5271
954 Ga0307408_100033455 3300031548 Bacteria 3592
955 Ga0265313_10000176 3300031595 Bacteria 68037
956 Ga0265313_10006492 3300031595 Bacteria 8266
957 Ga0265313_10009374 3300031595 Bacteria 6360
958 Ga0265313_10025763 3300031595 Bacteria 3110
959 Ga0265313_10053957 3300031595 Bacteria 1911
960 Ga0316575_10023815 3300031665 Bacteria 2368
961 Ga0265314_10001108 3300031711 Bacteria 31108
962 Ga0265314_10038822 3300031711 Bacteria 3437
963 Ga0265314_10042680 3300031711 Bacteria 3232
964 Ga0265314_10084309 3300031711 Bacteria 2086
965 Ga0265342_10000175 3300031712 Bacteria 71083
966 Ga0265342_10000203 3300031712 Bacteria 66540
967 Ga0265342_10004092 3300031712 Bacteria 11625
968 Ga0265342_10015115 3300031712 Bacteria 5091
969 Ga0265342_10027918 3300031712 Bacteria 3520
970 Ga0316576_10025908 3300031727 Bacteria 4109
971 Ga0316578_10019852 3300031728 Bacteria 3707
972 Ga0307516_10149293 3300031730 Bacteria 2100
973 Ga0307405_10021829 3300031731 Bacteria 3606
974 Ga0307405_10091050 3300031731 Bacteria 2020
975 Ga0307406_10208623 3300031901 Bacteria 1444
976 Ga0307412_10004632 3300031911 Bacteria 7665
977 Ga0315914_1000003 3300031967 Bacteria 314370
978 Ga0315914_1000016 3300031967 Bacteria 126814
979 Ga0307409_100037634 3300031995 Bacteria 3569
980 Ga0307409_100108590 3300031995 Bacteria 2321
981 Ga0307409_100540779 3300031995 Bacteria 1142
982 Ga0307416_100248534 3300032002 Bacteria 1729
983 Ga0307414_10037748 3300032004 Bacteria 3237
984 Ga0307414_10150389 3300032004 Bacteria 1836
985 Ga0307414_10225659 3300032004 Bacteria 1541
986 Ga0307411_10027540 3300032005 Bacteria 3441
987 Ga0307510_10137701 3300033180 Bacteria 2094
988 Ga0315913_1000001 3300033430 Bacteria 284459
989 Ga0315913_1000027 3300033430 Bacteria 83484
990 Ga0315915_1000007 3300033464 Bacteria 319225
991 Ga0315915_1000008 3300033464 Bacteria 258517
992 Ga0373948_0011197 3300034817 Bacteria 1581
993 Ga0373926_0001015 3300035083 Bacteria 8216
994 Ga0373928_0024966 3300035084 Bacteria 1285
995 Ga0373944_0008316 3300035089 Bacteria 2803
996 Ga0373949_0000224 3300035090 Bacteria 21520
997 Ga0373951_0005963 3300035091 Bacteria 2809
998 Ga0373952_0006162 3300035092 Bacteria 2211
999 Ga0373932_0013433 3300035112 Bacteria 2037
1000 Ga0373936_0002485 3300035113 Bacteria 6905
1001 Ga0373936_0004827 3300035113 Bacteria 5084
1002 Ga0373936_0006776 3300035113 Bacteria 4312
1003 Ga0373936_0008659 3300035113 Bacteria 3832
1004 Ga0373945_0011091 3300035116 Bacteria 2974
1005 Ga0373945_0105284 3300035116 Bacteria 1108
1006 Ga0373953_0003117 3300035117 Bacteria 5110
1007 Ga0373954_0000001 3300035118 Bacteria 158201
1008 Ga0373954_0001191 3300035118 Bacteria 10445
1009 Ga0373954_0006503 3300035118 Bacteria 5095
1010 Ga0373954_0019863 3300035118 Bacteria 3033
1011 Ga0373956_0001924 3300035119 Bacteria 8571
1012 Ga0373956_0017449 3300035119 Bacteria 3026
1013 Ga0373956_0048977 3300035119 Bacteria 1894
1014 Ga0373957_0014910 3300035120 Bacteria 2664
1015 Ga0373957_0093016 3300035120 Bacteria 1200
1016 Ga0373960_0003540 3300035121 Bacteria 3539
1017 Ga0373960_0035704 3300035121 Bacteria 1412
1018 Ga0373943_0072402 3300035170 Bacteria 1748
1019 Ga0373943_0113654 3300035170 Bacteria 1431
1020 Ga0373943_0120506 3300035170 Bacteria 1394
1021 Ga0373946_0007686 3300035171 Bacteria 3949
1022 Ga0373946_0024197 3300035171 Bacteria 2378
1023 Ga0373946_0047267 3300035171 Bacteria 1787
1024 Ga0373955_0000211 3300035172 Bacteria 24370
1025 Ga0373955_0004010 3300035172 Bacteria 6498
1026 Ga0373955_0062921 3300035172 Bacteria 2053
1027 Ga0373955_0078198 3300035172 Bacteria 1864
1028 Ga0373955_0146999 3300035172 Bacteria 1385
1029 Ga0373955_0159577 3300035172 Bacteria 1330
1030 Ga0373942_0004211 3300035207 Bacteria 3351
1031 Ga0373942_0048976 3300035207 Bacteria 1179
1032 Ga0373961_0002900 3300035241 Bacteria 4345
1033 Ga0373961_0098378 3300035241 Bacteria 944
1034 Ga0373962_0005517 3300035242 Bacteria 3060
1035 Ga0373962_0015800 3300035242 Bacteria 1940
1036 Ga0316574_0166237 3300035398 Bacteria 1421
1037 Ga0373924_0005832 3300035410 Bacteria 4384
1038 Ga0373924_0031279 3300035410 Bacteria 2139
1039 Ga0373924_0066750 3300035410 Bacteria 1513
1040 Ga0373931_0000263 3300035691 Bacteria 22257
1041 Ga0373931_0005290 3300035691 Bacteria 5952
1042 Ga0373931_0015912 3300035691 Bacteria 3694
1043 Ga0373931_0025006 3300035691 Bacteria 3031
1044 Ga0373931_0033418 3300035691 Bacteria 2665
1045 Ga0373931_0084866 3300035691 Bacteria 1754
1046 Ga0373931_0216702 3300035691 Bacteria 1151
1047 Ga0373935_0049269 3300035692 Bacteria 2669
1048 Ga0373935_0121849 3300035692 Bacteria 1743
1049 Ga0373935_0205609 3300035692 Bacteria 1362
1050 Ga0373927_0000307 3300035695 Bacteria 38435
1051 Ga0373927_0007289 3300035695 Bacteria 7502
1052 Ga0373927_0011842 3300035695 Bacteria 5810
1053 Ga0373927_0021393 3300035695 Bacteria 4239
1054 Ga0373927_0060671 3300035695 Bacteria 2447
1055 Ga0373927_0095942 3300035695 Bacteria 1927
1056 Ga0373933_0002515 3300035724 Bacteria 10296
1057 Ga0373933_0004328 3300035724 Bacteria 7796
1058 Ga0373933_0014895 3300035724 Bacteria 4329
1059 Ga0373933_0023829 3300035724 Bacteria 3500
1060 Ga0373933_0050166 3300035724 Bacteria 2490
1061 Ga0373933_0052376 3300035724 Bacteria 2442
1062 Ga0373933_0124702 3300035724 Bacteria 1615
1063 Ga0373933_0229299 3300035724 Bacteria 1193
1064 Ga0373947_0025815 3300035725 Bacteria 3427
1065 Ga0373947_0032636 3300035725 Bacteria 3070
1066 Ga0373947_0052934 3300035725 Bacteria 2446
1067 Ga0373947_0084848 3300035725 Bacteria 1966
1068 Ga0373947_0099733 3300035725 Bacteria 1823
1069 Ga0373947_0126297 3300035725 Bacteria 1629
1070 Ga0373947_0287859 3300035725 Bacteria 1093
1071 Ga0373937_0000009 3300036401 Bacteria 169521
1072 Ga0373937_0000524 3300036401 Bacteria 34277
1073 Ga0373937_0001146 3300036401 Bacteria 22227
1074 Ga0373937_0052053 3300036401 Bacteria 3753
1075 Ga0373937_0088397 3300036401 Bacteria 2868
1076 Ga0373937_0201561 3300036401 Bacteria 1870
1077 Ga0373937_0318568 3300036401 Bacteria 1471
1078 Ga0316582_0222298 3300036647 Bacteria 1291
1079 Ga0373925_0000194 3300037068 Bacteria 66124
1080 Ga0373925_0003316 3300037068 Bacteria 12509
1081 Ga0373925_0022002 3300037068 Bacteria 4647
1082 Ga0373925_0027273 3300037068 Bacteria 4182
1083 Ga0373925_0113013 3300037068 Bacteria 2100
1084 Ga0373925_0125977 3300037068 Bacteria 1993
1085 Ga0373925_0330582 3300037068 Bacteria 1235
1086 Ga0395899_0033298 3300037312 Bacteria 3870
1087 Ga0395899_0089182 3300037312 Bacteria 2237
1088 Ga0395899_0169900 3300037312 Bacteria 1536
1089 Ga0395900_0004702 3300037418 Bacteria 14395
1090 Ga0395900_0105149 3300037418 Bacteria 2900
1091 Ga0395900_0120084 3300037418 Bacteria 2697
1092 Ga0395900_0162899 3300037418 Bacteria 2274
1093 Ga0395900_0185454 3300037418 Bacteria 2112
1094 Ga0395900_0452707 3300037418 Bacteria 1240
1095 Ga0395898_0029116 3300037466 Bacteria 5532
1096 Ga0395898_0036536 3300037466 Bacteria 4877
1097 Ga0395898_0059206 3300037466 Bacteria 3727
1098 Ga0395898_0466985 3300037466 Bacteria 1201
1099 Ga0395905_0000247 3300037471 Bacteria 81281
1100 Ga0395905_0072572 3300037471 Bacteria 3227
1101 Ga0395905_0087942 3300037471 Bacteria 2913
1102 Ga0395905_0108653 3300037471 Bacteria 2604
1103 Ga0395905_0109022 3300037471 Bacteria 2599
1104 Ga0436364_0031070 3300037853 Bacteria 2089
1105 Ga0436364_0115455 3300037853 Bacteria 6268
1106 Ga0436364_0155142 3300037853 Bacteria 1787
1107 Ga0436364_0774424 3300037853 Bacteria 7548
1108 Ga0436364_0976983 3300037853 Bacteria 1284
1109 Ga0436364_0990934 3300037853 Bacteria 27491
1110 Ga0436364_1147744 3300037853 Bacteria 3523
1111 Ga0395901_0019114 3300038443 Bacteria 7006
1112 Ga0395901_0056175 3300038443 Bacteria 4095
1113 Ga0395901_0074592 3300038443 Bacteria 3539
1114 Ga0395901_0095982 3300038443 Bacteria 3107
1115 Ga0395901_0153653 3300038443 Bacteria 2417
1116 Ga0395901_0200004 3300038443 Bacteria 2095
1117 Ga0395901_0316458 3300038443 Bacteria 1616
1118 Ga0395901_0581085 3300038443 Bacteria 1132
1119 Ga0400483_016265 3300039062 Bacteria 1736
1120 Ga0400483_150203 3300039062 Bacteria 1773
1121 Ga0436365_0017591 3300039437 Bacteria 2538
1122 Ga0436365_0536235 3300039437 Bacteria 9986
1123 Ga0436365_0582386 3300039437 Bacteria 49347
1124 Ga0436365_0836133 3300039437 Bacteria 111215
1125 Ga0436365_0920082 3300039437 Bacteria 14215
1126 Ga0436365_1093511 3300039437 Bacteria 15092
1127 Ga0436365_1332159 3300039437 Bacteria 25414
1128 Ga0436365_1445989 3300039437 Bacteria 1494
1129 Ga0436365_1644321 3300039437 Bacteria 2850
1130 Ga0436365_1673482 3300039437 Bacteria 1548
1131 Ga0436360_0436684 3300039438 Bacteria 1208
1132 Ga0436360_0621837 3300039438 Bacteria 1579
1133 Ga0436360_1072416 3300039438 Bacteria 4787
1134 Ga0436360_1151605 3300039438 Unclassified 3911
1135 Ga0436361_0359473 3300039447 Bacteria 1646
1136 Ga0436361_0472526 3300039447 Bacteria 3708
1137 Ga0436361_0841184 3300039447 Bacteria 2152
1138 Ga0436363_0065264 3300039450 Bacteria 3683
1139 Ga0436363_0480840 3300039450 Bacteria 15596
1140 Ga0436363_0502334 3300039450 Bacteria 1545
1141 Ga0436363_1483637 3300039450 Bacteria 1389
1142 Ga0436362_0163701 3300039453 Bacteria 2023
1143 Ga0436362_0273395 3300039453 Bacteria 7027
1144 Ga0439453_0004011 3300041408 Bacteria 2162
1145 Ga0439441_000433 3300042001 Bacteria 4442
1146 Ga0439448_0029587 3300042005 Bacteria 1734
1147 Ga0439449_0006504 3300042007 Bacteria 4465
1148 Ga0439449_0082289 3300042007 Bacteria 1187
1149 Ga0439450_021898 3300042008 Bacteria 1376
1150 Ga0439463_029344 3300042016 Bacteria 1386
1151 Ga0450888_000640 3300042126 Bacteria 3333
1152 Ga0439435_0044619 3300042436 Bacteria 1250
1153 Ga0439444_0010606 3300042437 Bacteria 1475
1154 Ga0439459_0027578 3300042438 Bacteria 1135
1155 Ga0439464_0029077 3300042439 Bacteria 1543
1156 Ga0439460_0057258 3300042461 Bacteria 1182
1157 Ga0466963_0055803 3300044694 Bacteria 2628
1158 Ga0466963_0243349 3300044694 Bacteria 1262
1159 Ga0466964_0043964 3300044706 Bacteria 1813
1160 Ga0453684_0228680 3300044712 Bacteria 2149
1161 Ga0466971_0030184 3300044719 Bacteria 2426
1162 Ga0466970_0058045 3300044765 Bacteria 2071
1163 Ga0466970_0121864 3300044765 Bacteria 1429
1164 Ga0466957_0018581 3300044842 Bacteria 4083
1165 Ga0466957_0040720 3300044842 Bacteria 2807
1166 Ga0466960_0094443 3300044901 Bacteria 1530
1167 Ga0466959_0036483 3300045049 Bacteria 3633
1168 Ga0466959_0082126 3300045049 Bacteria 2322
1169 Ga0466959_0252367 3300045049 Bacteria 1216
1170 Ga0451576_0000220 3300045051 Bacteria 141261
1171 Ga0451576_0007851 3300045051 Bacteria 12646
1172 Ga0451576_0052322 3300045051 Bacteria 4279
1173 Ga0451576_0342508 3300045051 Bacteria 1565
1174 Ga0466967_0039921 3300045976 Bacteria 4038
1175 Ga0466967_0054386 3300045976 Bacteria 3522
1176 Ga0466967_0102676 3300045976 Bacteria 2616
1177 Ga0466967_0250502 3300045976 Bacteria 1692
1178 Ga0495592_0000422 3300046454 Bacteria 32126
1179 Ga0495592_0008218 3300046454 Bacteria 7837
1180 Ga0495603_0013575 3300046455 Bacteria 4928
1181 Ga0495603_0073805 3300046455 Bacteria 2004
1182 Ga0495629_0010732 3300046459 Bacteria 6663
1183 Ga0495629_0178950 3300046459 Bacteria 1470
1184 Ga0495638_0003388 3300046460 Bacteria 12561
1185 Ga0495638_0004884 3300046460 Bacteria 10085
1186 Ga0495638_0016499 3300046460 Bacteria 4945
1187 Ga0495638_0059109 3300046460 Bacteria 2375
1188 Ga0495641_0026188 3300046461 Bacteria 2849
1189 Ga0495651_0003394 3300046462 Bacteria 12218
1190 Ga0495651_0214779 3300046462 Bacteria 1336
1191 Ga0495653_0000032 3300046463 Bacteria 132763
1192 Ga0495653_0012696 3300046463 Bacteria 6881
1193 Ga0495650_0034472 3300046471 Bacteria 2240
1194 Ga0495580_0007921 3300046472 Bacteria 8498
1195 Ga0495582_0014056 3300046473 Bacteria 4407
1196 Ga0495582_0054498 3300046473 Bacteria 2205
1197 Ga0495582_0061613 3300046473 Bacteria 2072
1198 Ga0495605_0000998 3300046474 Bacteria 19122
1199 Ga0495639_0020303 3300046475 Bacteria 2903
1200 Ga0495639_0039292 3300046475 Bacteria 2128
1201 Ga0495662_0007582 3300046476 Bacteria 5356
1202 Ga0495662_0071800 3300046476 Bacteria 1678
1203 Ga0495662_0111810 3300046476 Bacteria 1339
1204 Ga0495664_0000010 3300046477 Bacteria 268381
1205 Ga0495664_0042324 3300046477 Bacteria 2697
1206 Ga0495584_0105914 3300046491 Bacteria 1422
1207 Ga0495585_0011596 3300046492 Bacteria 5212
1208 Ga0495585_0027859 3300046492 Bacteria 3224
1209 Ga0495594_0142096 3300046499 Bacteria 1362
1210 Ga0495607_0000153 3300046501 Bacteria 72099
1211 Ga0495607_0046587 3300046501 Bacteria 2545
1212 Ga0495583_0003578 3300046506 Bacteria 11679
1213 Ga0495583_0010063 3300046506 Bacteria 5569
1214 Ga0495606_0002805 3300046507 Bacteria 19397
1215 Ga0495606_0005629 3300046507 Bacteria 11889
1216 Ga0495606_0046520 3300046507 Bacteria 2867
1217 Ga0495606_0095951 3300046507 Bacteria 1815
1218 Ga0495606_0140452 3300046507 Bacteria 1427
1219 Ga0495608_0000008 3300046511 Bacteria 268629
1220 Ga0495608_0002249 3300046511 Bacteria 13939
1221 Ga0495608_0095522 3300046511 Bacteria 1920
1222 Ga0495610_0002088 3300046512 Bacteria 17067
1223 Ga0495610_0031912 3300046512 Bacteria 2743
1224 Ga0495610_0114606 3300046512 Bacteria 1190
1225 Ga0495616_0015211 3300046513 Bacteria 4281
1226 Ga0495618_0000002 3300046514 Bacteria 271353
1227 Ga0495618_0001172 3300046514 Bacteria 17756
1228 Ga0495618_0113401 3300046514 Bacteria 1736
1229 Ga0495620_0053665 3300046515 Bacteria 1706
1230 Ga0495620_0066403 3300046515 Bacteria 1486
1231 Ga0495628_0000009 3300046516 Bacteria 237611
1232 Ga0495628_0036636 3300046516 Bacteria 3935
1233 Ga0495630_0002397 3300046517 Bacteria 13021
1234 Ga0495630_0010749 3300046517 Bacteria 6610
1235 Ga0495630_0079890 3300046517 Bacteria 2467
1236 Ga0495630_0098248 3300046517 Bacteria 2215
1237 Ga0495630_0109284 3300046517 Bacteria 2095
1238 Ga0495631_0002952 3300046518 Bacteria 9418
1239 Ga0495632_0019934 3300046519 Bacteria 3643
1240 Ga0495632_0039034 3300046519 Bacteria 2400
1241 Ga0495637_0058673 3300046520 Bacteria 1586
1242 Ga0495643_0043383 3300046522 Bacteria 2448
1243 Ga0495643_0071616 3300046522 Bacteria 1819
1244 Ga0495643_0109687 3300046522 Bacteria 1404
1245 Ga0495666_0005885 3300046526 Bacteria 6177
1246 Ga0495666_0127107 3300046526 Bacteria 1192
1247 Ga0495652_0000011 3300046529 Bacteria 255329
1248 Ga0495652_0028155 3300046529 Bacteria 4948
1249 Ga0495652_0063179 3300046529 Bacteria 3118
1250 Ga0495652_0369195 3300046529 Bacteria 1023
1251 Ga0495654_0000258 3300046530 Bacteria 48532
1252 Ga0495640_0000094 3300046533 Bacteria 51238
1253 Ga0495640_0005042 3300046533 Bacteria 10490
1254 Ga0495640_0058151 3300046533 Bacteria 2637
1255 Ga0495640_0058737 3300046533 Bacteria 2622
1256 Ga0495640_0064896 3300046533 Bacteria 2467
1257 Ga0495640_0098706 3300046533 Bacteria 1919
1258 Ga0495640_0130390 3300046533 Bacteria 1628
1259 Ga0495586_0002047 3300046535 Bacteria 10948
1260 Ga0495586_0259900 3300046535 Bacteria 991
1261 Ga0495587_0000086 3300046536 Bacteria 72022
1262 Ga0495587_0009385 3300046536 Bacteria 6272
1263 Ga0495609_0024772 3300046538 Bacteria 2751
1264 Ga0495609_0059071 3300046538 Bacteria 1696
1265 Ga0495645_0000010 3300046543 Bacteria 238337
1266 Ga0495645_0102950 3300046543 Bacteria 2029
1267 Ga0495622_0005250 3300046557 Bacteria 6006
1268 Ga0495622_0050170 3300046557 Bacteria 1937
1269 Ga0495633_0068402 3300046558 Bacteria 1658
1270 Ga0495633_0092161 3300046558 Bacteria 1408
1271 Ga0495633_0165699 3300046558 Bacteria 1019
1272 Ga0495667_0000005 3300046559 Bacteria 268252
1273 Ga0495667_0014053 3300046559 Bacteria 5404
1274 Ga0495667_0019175 3300046559 Bacteria 4616
1275 Ga0495667_0113594 3300046559 Bacteria 1750
1276 Ga0495667_0130547 3300046559 Bacteria 1621
1277 Ga0495656_0009753 3300046615 Bacteria 3465
1278 Ga0495656_0052249 3300046615 Bacteria 1752
1279 Ga0495656_0104757 3300046615 Bacteria 1314
1280 Ga0495668_0016948 3300046616 Bacteria 4231
1281 Ga0495668_0019056 3300046616 Bacteria 3961
1282 Ga0495634_0000223 3300046642 Bacteria 53103
1283 Ga0495634_0006047 3300046642 Bacteria 9235
1284 Ga0495634_0119794 3300046642 Bacteria 1686
1285 Ga0495634_0205337 3300046642 Bacteria 1222
1286 Ga0495625_0006387 3300046660 Bacteria 10511
1287 Ga0495625_0089615 3300046660 Bacteria 2129
1288 Ga0495625_0092453 3300046660 Bacteria 2090
1289 Ga0495625_0115376 3300046660 Bacteria 1833
1290 Ga0495635_0000008 3300046663 Bacteria 268349
1291 Ga0495635_0178241 3300046663 Bacteria 1445
1292 Ga0495659_0049900 3300046664 Bacteria 1521
1293 Ga0495588_0000431 3300046674 Bacteria 22035
1294 Ga0495588_0116141 3300046674 Bacteria 1410
1295 Ga0495657_0000058 3300046675 Bacteria 97827
1296 Ga0495657_0035630 3300046675 Bacteria 3447
1297 Ga0495599_0000007 3300046678 Bacteria 236638
1298 Ga0495599_0005526 3300046678 Bacteria 7574
1299 Ga0495599_0079504 3300046678 Bacteria 2047
1300 Ga0495623_0000085 3300046679 Bacteria 55527
1301 Ga0495623_0003882 3300046679 Bacteria 9855
1302 Ga0495623_0030375 3300046679 Bacteria 3476
1303 Ga0495646_0000021 3300046680 Bacteria 115358
1304 Ga0495646_0019315 3300046680 Bacteria 4315
1305 Ga0495647_0013785 3300046681 Bacteria 2807
1306 Ga0495647_0108254 3300046681 Bacteria 1157
1307 Ga0495658_0004005 3300046683 Bacteria 7261
1308 Ga0495658_0012740 3300046683 Bacteria 4268
1309 Ga0495658_0078031 3300046683 Bacteria 1938
1310 Ga0495658_0232336 3300046683 Bacteria 1157
1311 Ga0495669_0080020 3300046684 Bacteria 1499
1312 Ga0495613_0020157 3300046689 Bacteria 4968
1313 Ga0495613_0233661 3300046689 Bacteria 1287
1314 Ga0495613_0280445 3300046689 Bacteria 1157
1315 Ga0495624_0023846 3300046690 Bacteria 4031
1316 Ga0495624_0037339 3300046690 Bacteria 3127
1317 Ga0495624_0042972 3300046690 Bacteria 2885
1318 Ga0495624_0064122 3300046690 Bacteria 2296
1319 Ga0495624_0189637 3300046690 Bacteria 1251
1320 Ga0495670_0063095 3300046691 Bacteria 1865
1321 Ga0495670_0063856 3300046691 Bacteria 1854
1322 Ga0495670_0091987 3300046691 Bacteria 1553
1323 Ga0495671_0029760 3300046692 Bacteria 2801
1324 Ga0495600_0000001 3300046809 Bacteria 214870
1325 Ga0495600_0001574 3300046809 Bacteria 12692
1326 Ga0495600_0121927 3300046809 Bacteria 1695
1327 Ga0495660_0007210 3300046810 Bacteria 6544
1328 Ga0495581_0028095 3300047315 Bacteria 3261
1329 Ga0495581_0049865 3300047315 Bacteria 2418
1330 Ga0495604_0000012 3300047317 Bacteria 268341
1331 Ga0495604_0000150 3300047317 Bacteria 60582
1332 Ga0495604_0003714 3300047317 Bacteria 12160
1333 Ga0495604_0040829 3300047317 Bacteria 3641
1334 Ga0495604_0048000 3300047317 Bacteria 3322
1335 Ga0495604_0085328 3300047317 Bacteria 2356
1336 Ga0495674_0000011 3300047319 Bacteria 270911
1337 Ga0495674_0040455 3300047319 Bacteria 4169
1338 Ga0495674_0044067 3300047319 Bacteria 3968
1339 Ga0495674_0058092 3300047319 Bacteria 3384
1340 Ga0495674_0061596 3300047319 Bacteria 3269
1341 Ga0495674_0342084 3300047319 Bacteria 1216
1342 Ga0495672_0130328 3300047320 Bacteria 1324
1343 Ga0495676_0048721 3300047321 Bacteria 3413
1344 Ga0495680_0000245 3300047322 Bacteria 59987
1345 Ga0495680_0000699 3300047322 Bacteria 37651
1346 Ga0495680_0287053 3300047322 Bacteria 1158
1347 Ga0495687_016135 3300047443 Bacteria 3767
1348 Ga0495675_0002083 3300047444 Bacteria 11942
1349 Ga0495681_0005448 3300047470 Bacteria 8512
1350 Ga0495684_0000084 3300047471 Bacteria 65600
1351 Ga0495684_0011394 3300047471 Bacteria 6866
1352 Ga0495686_0000422 3300047472 Bacteria 66571
1353 Ga0495686_0012523 3300047472 Bacteria 5930
1354 Ga0495686_0085933 3300047472 Bacteria 1915
1355 Ga0495686_0126838 3300047472 Bacteria 1517
1356 Ga0495593_0000733 3300047673 Bacteria 19034
1357 Ga0495593_0024774 3300047673 Bacteria 3322
1358 Ga0495593_0041197 3300047673 Bacteria 2484
1359 Ga0495602_0000073 3300048088 Bacteria 98745
1360 Ga0495602_0018808 3300048088 Bacteria 6881
1361 Ga0495602_0070373 3300048088 Bacteria 2994
1362 Ga0495626_0045815 3300048091 Bacteria 2040
1363 Ga0496100_0053486 3300048903 Bacteria 2629
1364 Ga0496100_0061223 3300048903 Bacteria 2480
1365 Ga0496100_0092105 3300048903 Bacteria 2071
1366 Ga0496100_0207717 3300048903 Bacteria 1431
1367 Ga0496100_0284529 3300048903 Bacteria 1233
1368 Ga0496101_0007599 3300048904 Bacteria 7038
1369 Ga0496101_0161732 3300048904 Bacteria 1717
1370 Ga0496101_0226311 3300048904 Bacteria 1453
1371 Ga0496101_0227971 3300048904 Bacteria 1447
1372 Ga0496101_0255239 3300048904 Bacteria 1367
1373 Ga0496101_0289863 3300048904 Bacteria 1280
1374 Ga0496101_0296054 3300048904 Bacteria 1267
1375 Ga0496102_0000742 3300048905 Bacteria 31941
1376 Ga0496102_0000871 3300048905 Bacteria 28857
1377 Ga0496102_0036824 3300048905 Bacteria 4409
1378 Ga0496102_0039482 3300048905 Bacteria 4266
1379 Ga0496102_0089273 3300048905 Bacteria 2851
1380 Ga0496102_0094089 3300048905 Bacteria 2776
1381 Ga0496102_0131352 3300048905 Bacteria 2344
1382 Ga0496102_0222394 3300048905 Bacteria 1780
1383 Ga0496102_0270142 3300048905 Bacteria 1603
1384 Ga0496103_0003369 3300048906 Bacteria 9767
1385 Ga0496103_0005846 3300048906 Bacteria 7346
1386 Ga0496103_0043886 3300048906 Bacteria 2754
1387 Ga0496103_0170466 3300048906 Bacteria 1398
1388 Ga0496104_0000317 3300048907 Bacteria 42918
1389 Ga0496104_0000445 3300048907 Bacteria 35921
1390 Ga0496104_0000530 3300048907 Bacteria 32802
1391 Ga0496104_0002241 3300048907 Bacteria 16685
1392 Ga0496104_0002378 3300048907 Bacteria 16215
1393 Ga0496104_0016654 3300048907 Bacteria 6680
1394 Ga0496104_0034739 3300048907 Bacteria 4702
1395 Ga0496104_0050423 3300048907 Bacteria 3927
1396 Ga0496104_0053959 3300048907 Bacteria 3798
1397 Ga0496104_0112248 3300048907 Bacteria 2614
1398 Ga0496104_0145895 3300048907 Bacteria 2272
1399 Ga0496104_0173119 3300048907 Bacteria 2069
1400 Ga0496104_0188496 3300048907 Bacteria 1973
1401 Ga0496104_0276801 3300048907 Bacteria 1591
1402 Ga0496104_0306548 3300048907 Bacteria 1500
1403 Ga0496104_0346180 3300048907 Bacteria 1399
1404 Ga0496105_0000485 3300048908 Bacteria 26121
1405 Ga0496105_0000514 3300048908 Bacteria 25562
1406 Ga0496105_0005876 3300048908 Bacteria 9357
1407 Ga0496105_0006690 3300048908 Bacteria 8873
1408 Ga0496105_0007602 3300048908 Bacteria 8402
1409 Ga0496105_0010080 3300048908 Bacteria 7417
1410 Ga0496105_0012574 3300048908 Bacteria 6706
1411 Ga0496105_0014128 3300048908 Bacteria 6353
1412 Ga0496105_0053871 3300048908 Bacteria 3322
1413 Ga0496105_0252534 3300048908 Bacteria 1428
1414 Ga0496106_0001604 3300048909 Bacteria 17003
1415 Ga0496106_0003648 3300048909 Bacteria 11477
1416 Ga0496106_0063690 3300048909 Bacteria 2803
1417 Ga0496106_0129156 3300048909 Bacteria 1981
1418 Ga0496106_0241648 3300048909 Bacteria 1443
1419 Ga0496107_0000769 3300048910 Bacteria 18509
1420 Ga0496107_0005678 3300048910 Bacteria 8538
1421 Ga0496107_0018433 3300048910 Bacteria 4915
1422 Ga0496107_0056732 3300048910 Bacteria 2830
1423 Ga0496107_0139352 3300048910 Bacteria 1793
1424 Ga0496107_0183310 3300048910 Bacteria 1555
1425 Ga0496107_0268179 3300048910 Bacteria 1271
1426 Ga0496108_0003421 3300048911 Bacteria 12733
1427 Ga0496108_0005811 3300048911 Bacteria 10000
1428 Ga0496108_0020092 3300048911 Bacteria 5488
1429 Ga0496108_0022495 3300048911 Bacteria 5184
1430 Ga0496108_0099532 3300048911 Bacteria 2478
1431 Ga0496108_0206057 3300048911 Bacteria 1707
1432 Ga0496108_0245343 3300048911 Bacteria 1558
1433 Ga0496109_0052258 3300048912 Bacteria 3724
1434 Ga0496109_0052763 3300048912 Bacteria 3707
1435 Ga0496109_0100189 3300048912 Bacteria 2687
1436 Ga0496109_0109831 3300048912 Bacteria 2564
1437 Ga0496109_0125347 3300048912 Bacteria 2394
1438 Ga0496109_0169939 3300048912 Bacteria 2045
1439 Ga0496109_0230438 3300048912 Bacteria 1742
1440 Ga0496109_0457617 3300048912 Bacteria 1205
1441 Ga0496109_0463250 3300048912 Bacteria 1197
1442 Ga0496110_0001191 3300048913 Bacteria 18527
1443 Ga0496110_0001539 3300048913 Bacteria 16772
1444 Ga0496110_0001886 3300048913 Bacteria 15483
1445 Ga0496110_0002034 3300048913 Bacteria 15073
1446 Ga0496110_0006680 3300048913 Bacteria 9168
1447 Ga0496110_0022057 3300048913 Bacteria 5401
1448 Ga0496110_0130702 3300048913 Bacteria 2267
1449 Ga0496110_0160498 3300048913 Bacteria 2038
1450 Ga0496110_0161733 3300048913 Bacteria 2030
1451 Ga0496110_0172954 3300048913 Bacteria 1960
1452 Ga0496110_0198313 3300048913 Bacteria 1823
1453 Ga0496110_0397212 3300048913 Bacteria 1257
1454 Ga0496111_0000072 3300048914 Bacteria 41891
1455 Ga0496111_0000641 3300048914 Bacteria 18442
1456 Ga0496111_0004377 3300048914 Bacteria 8918
1457 Ga0496111_0005434 3300048914 Bacteria 8164
1458 Ga0496111_0007231 3300048914 Bacteria 7261
1459 Ga0496111_0009427 3300048914 Bacteria 6515
1460 Ga0496111_0017287 3300048914 Bacteria 4985
1461 Ga0496111_0049553 3300048914 Bacteria 3029
1462 Ga0496111_0207264 3300048914 Bacteria 1457
1463 Ga0496112_0000112 3300048915 Bacteria 50370
1464 Ga0496112_0022204 3300048915 Bacteria 6048
1465 Ga0496112_0039797 3300048915 Bacteria 4594
1466 Ga0496112_0046586 3300048915 Bacteria 4253
1467 Ga0496112_0082097 3300048915 Bacteria 3188
1468 Ga0496112_0120503 3300048915 Bacteria 2593
1469 Ga0496112_0124913 3300048915 Bacteria 2544
1470 Ga0496112_0167656 3300048915 Bacteria 2162
1471 Ga0496112_0187003 3300048915 Bacteria 2034
1472 Ga0496112_0254516 3300048915 Bacteria 1706
1473 Ga0496112_0266507 3300048915 Bacteria 1662
1474 Ga0496112_0365346 3300048915 Bacteria 1385
1475 Ga0496113_0000058 3300048916 Bacteria 47947
1476 Ga0496113_0010750 3300048916 Bacteria 6068
1477 Ga0496113_0034796 3300048916 Bacteria 3679
1478 Ga0496113_0038211 3300048916 Bacteria 3529
1479 Ga0496113_0093805 3300048916 Bacteria 2318
1480 Ga0496113_0096795 3300048916 Bacteria 2282
1481 Ga0496113_0124169 3300048916 Bacteria 2021
1482 Ga0496113_0127165 3300048916 Bacteria 1996
1483 Ga0496113_0129897 3300048916 Bacteria 1976
1484 Ga0496113_0176816 3300048916 Bacteria 1691
1485 Ga0496113_0284026 3300048916 Bacteria 1324
1486 Ga0496114_0007803 3300048917 Bacteria 8465
1487 Ga0496114_0122586 3300048917 Bacteria 2237
1488 Ga0496114_0238531 3300048917 Bacteria 1598
1489 Ga0496114_0271651 3300048917 Bacteria 1494
1490 Ga0496115_0027599 3300048918 Bacteria 4443
1491 Ga0496115_0031287 3300048918 Bacteria 4192
1492 Ga0496115_0055864 3300048918 Bacteria 3172
1493 Ga0496115_0091711 3300048918 Bacteria 2483
1494 Ga0496115_0103261 3300048918 Bacteria 2338
1495 Ga0496115_0132373 3300048918 Bacteria 2055
1496 Ga0496115_0222208 3300048918 Bacteria 1559
1497 Ga0496115_0368499 3300048918 Bacteria 1169
1498 Ga0496116_0000057 3300048919 Bacteria 281652
1499 Ga0496116_0012408 3300048919 Bacteria 6966
1500 Ga0496116_0012509 3300048919 Bacteria 6928
1501 Ga0496116_0019060 3300048919 Bacteria 5268
1502 Ga0496116_0040535 3300048919 Bacteria 3206
1503 Ga0496117_0000031 3300048920 Bacteria 381048
1504 Ga0496117_0011023 3300048920 Bacteria 8139
1505 Ga0496117_0011870 3300048920 Bacteria 7751
1506 Ga0496117_0014595 3300048920 Bacteria 6759
1507 Ga0496117_0024058 3300048920 Bacteria 4830
1508 Ga0496117_0031515 3300048920 Bacteria 4045
1509 Ga0496117_0065649 3300048920 Bacteria 2466
1510 Ga0496118_0007166 3300048921 Bacteria 11925
1511 Ga0496118_0017115 3300048921 Bacteria 6617
1512 Ga0496118_0056878 3300048921 Bacteria 2936
1513 Ga0496118_0110647 3300048921 Bacteria 1824
1514 Ga0496118_0144860 3300048921 Bacteria 1498
1515 Ga0496119_0008094 3300048922 Bacteria 9317
1516 Ga0496119_0034851 3300048922 Bacteria 3305
1517 Ga0496119_0055006 3300048922 Bacteria 2420
1518 Ga0496119_0104261 3300048922 Bacteria 1587
1519 Ga0496119_0140261 3300048922 Bacteria 1306
1520 Ga0496120_0000337 3300048923 Bacteria 78140
1521 Ga0496120_0001370 3300048923 Bacteria 29844
1522 Ga0496120_0021465 3300048923 Bacteria 4081
1523 Ga0496120_0058289 3300048923 Bacteria 2170
1524 Ga0496120_0090646 3300048923 Bacteria 1634
1525 Ga0496120_0150688 3300048923 Bacteria 1169
1526 Ga0496121_0000034 3300048924 Bacteria 377095
1527 Ga0496121_0002534 3300048924 Bacteria 27692
1528 Ga0496121_0012777 3300048924 Bacteria 9096
1529 Ga0496121_0026378 3300048924 Bacteria 5478
1530 Ga0496121_0030244 3300048924 Bacteria 4977
1531 Ga0496121_0064178 3300048924 Bacteria 2995
1532 Ga0496121_0106282 3300048924 Bacteria 2152
1533 Ga0496121_0112075 3300048924 Bacteria 2079
1534 Ga0496121_0112864 3300048924 Bacteria 2069
1535 Ga0496121_0145201 3300048924 Bacteria 1754
1536 Ga0496121_0155265 3300048924 Bacteria 1680
1537 Ga0496121_0155763 3300048924 Bacteria 1676
1538 Ga0496122_0000023 3300048925 Bacteria 381035
1539 Ga0496122_0000137 3300048925 Bacteria 170016
1540 Ga0496122_0013243 3300048925 Bacteria 8087
1541 Ga0496122_0015622 3300048925 Bacteria 7243
1542 Ga0496122_0023847 3300048925 Bacteria 5374
1543 Ga0496122_0029495 3300048925 Bacteria 4625
1544 Ga0496122_0041958 3300048925 Bacteria 3607
1545 Ga0496122_0042708 3300048925 Bacteria 3563
1546 Ga0496122_0057097 3300048925 Bacteria 2903
1547 Ga0496122_0057689 3300048925 Bacteria 2880
1548 Ga0496122_0082611 3300048925 Bacteria 2230
1549 Ga0496122_0134606 3300048925 Bacteria 1561
1550 Ga0496122_0177611 3300048925 Bacteria 1274
1551 Ga0496122_0198344 3300048925 Bacteria 1176
1552 Ga0496123_0000022 3300048926 Bacteria 361832
1553 Ga0496123_0000027 3300048926 Bacteria 306773
1554 Ga0496123_0006417 3300048926 Bacteria 11402
1555 Ga0496123_0026974 3300048926 Bacteria 4289
1556 Ga0496123_0078386 3300048926 Bacteria 2024
1557 Ga0496123_0151012 3300048926 Bacteria 1253
1558 Ga0496123_0154375 3300048926 Bacteria 1233
1559 Ga0496123_0165177 3300048926 Bacteria 1175
1560 Ga0496124_0000174 3300048927 Bacteria 129228
1561 Ga0496124_0001771 3300048927 Bacteria 30049
1562 Ga0496124_0006219 3300048927 Bacteria 13078
1563 Ga0496124_0026047 3300048927 Bacteria 5280
1564 Ga0496124_0034417 3300048927 Bacteria 4446
1565 Ga0496124_0034422 3300048927 Bacteria 4446
1566 Ga0496124_0036141 3300048927 Bacteria 4313
1567 Ga0496124_0049497 3300048927 Bacteria 3585
1568 Ga0496124_0108721 3300048927 Bacteria 2236
1569 Ga0496124_0178713 3300048927 Bacteria 1635
1570 Ga0496125_0000030 3300048928 Bacteria 375023
1571 Ga0496125_0012335 3300048928 Bacteria 8491
1572 Ga0496125_0035505 3300048928 Bacteria 4371
1573 Ga0496125_0069923 3300048928 Bacteria 2751
1574 Ga0496125_0136186 3300048928 Bacteria 1717
1575 Ga0496125_0142009 3300048928 Bacteria 1668
1576 Ga0496125_0154175 3300048928 Bacteria 1572
1577 Ga0496126_0000115 3300048929 Bacteria 188546
1578 Ga0496126_0033060 3300048929 Bacteria 4868
1579 Ga0496126_0038419 3300048929 Bacteria 4455
1580 Ga0496126_0042064 3300048929 Bacteria 4223
1581 Ga0496126_0061969 3300048929 Bacteria 3358
1582 Ga0496126_0074572 3300048929 Bacteria 3013
1583 Ga0496126_0084838 3300048929 Bacteria 2793
1584 Ga0496126_0102611 3300048929 Bacteria 2500
1585 Ga0496126_0121485 3300048929 Bacteria 2264
1586 Ga0496126_0125683 3300048929 Unclassified 2220
1587 Ga0496126_0207275 3300048929 Bacteria 1652
1588 Ga0496126_0252274 3300048929 Bacteria 1470
1589 Ga0495678_012901 3300049459 Bacteria 3941
1590 Ga0501031_0000007 3300049568 Bacteria 166008
1591 Ga0501031_0005116 3300049568 Bacteria 8542
1592 Ga0501031_0012352 3300049568 Bacteria 5570
1593 Ga0501031_0090643 3300049568 Bacteria 1994
1594 Ga0501031_0228223 3300049568 Bacteria 1212
1595 Ga0501032_0000007 3300049569 Bacteria 253881
1596 Ga0501032_0001879 3300049569 Bacteria 16587
1597 Ga0501032_0016543 3300049569 Bacteria 5186
1598 Ga0501032_0048609 3300049569 Bacteria 2863
1599 Ga0501032_0198364 3300049569 Bacteria 1310
1600 Ga0501032_0215853 3300049569 Bacteria 1249
1601 Ga0501032_0238153 3300049569 Bacteria 1183
1602 Ga0501032_0359550 3300049569 Bacteria 937
1603 Ga0501033_0000040 3300049570 Bacteria 142586
1604 Ga0501033_0004368 3300049570 Bacteria 11331
1605 Ga0501033_0025128 3300049570 Bacteria 4487
1606 Ga0501033_0091662 3300049570 Bacteria 2223
1607 Ga0501033_0160838 3300049570 Bacteria 1617
1608 Ga0501033_0196653 3300049570 Bacteria 1441
1609 Ga0501033_0252776 3300049570 Bacteria 1249
1610 Ga0501034_0000029 3300049571 Bacteria 253881
1611 Ga0501034_0000162 3300049571 Bacteria 125834
1612 Ga0501034_0001131 3300049571 Bacteria 37119
1613 Ga0501034_0002653 3300049571 Bacteria 21171
1614 Ga0501034_0012919 3300049571 Bacteria 8611
1615 Ga0501034_0018360 3300049571 Bacteria 7173
1616 Ga0501034_0023629 3300049571 Bacteria 6262
1617 Ga0501034_0024938 3300049571 Bacteria 6083
1618 Ga0501034_0032448 3300049571 Bacteria 5303
1619 Ga0501034_0032682 3300049571 Bacteria 5284
1620 Ga0501034_0094910 3300049571 Bacteria 2979
1621 Ga0501034_0124971 3300049571 Bacteria 2558
1622 Ga0501034_0209902 3300049571 Bacteria 1903
1623 Ga0501034_0240878 3300049571 Bacteria 1755
1624 Ga0501034_0274978 3300049571 Bacteria 1624
1625 Ga0501034_0347697 3300049571 Bacteria 1411
1626 Ga0501034_0395900 3300049571 Bacteria 1304
1627 Ga0501036_0000004 3300049572 Bacteria 253881
1628 Ga0501036_0000559 3300049572 Bacteria 26726
1629 Ga0501036_0003243 3300049572 Bacteria 12966
1630 Ga0501036_0003303 3300049572 Bacteria 12872
1631 Ga0501036_0024551 3300049572 Bacteria 5082
1632 Ga0501036_0072485 3300049572 Bacteria 2911
1633 Ga0501036_0195620 3300049572 Bacteria 1701
1634 Ga0501036_0375031 3300049572 Bacteria 1187
1635 Ga0501036_0441372 3300049572 Bacteria 1085
1636 Ga0501037_0000004 3300049573 Bacteria 253989
1637 Ga0501037_0018226 3300049573 Bacteria 5172
1638 Ga0501037_0018455 3300049573 Bacteria 5143
1639 Ga0501037_0051520 3300049573 Bacteria 3011
1640 Ga0501037_0061394 3300049573 Bacteria 2740
1641 Ga0501037_0095581 3300049573 Bacteria 2148
1642 Ga0501037_0098608 3300049573 Bacteria 2110
1643 Ga0501037_0120734 3300049573 Bacteria 1884
1644 Ga0501037_0131113 3300049573 Bacteria 1797
1645 Ga0501037_0214723 3300049573 Bacteria 1355
1646 Ga0501037_0241800 3300049573 Bacteria 1265
1647 Ga0501037_0242343 3300049573 Bacteria 1263
1648 Ga0501037_0246140 3300049573 Bacteria 1252
1649 Ga0501038_0000005 3300049574 Bacteria 253881
1650 Ga0501038_0005084 3300049574 Bacteria 12226
1651 Ga0501038_0011772 3300049574 Bacteria 7982
1652 Ga0501038_0025190 3300049574 Bacteria 5303
1653 Ga0501038_0082991 3300049574 Bacteria 2698
1654 Ga0501038_0391569 3300049574 Bacteria 1076
1655 Ga0501039_0000009 3300049575 Bacteria 253881
1656 Ga0501039_0005792 3300049575 Bacteria 9359
1657 Ga0501039_0011081 3300049575 Bacteria 6870
1658 Ga0501039_0039986 3300049575 Bacteria 3621
1659 Ga0501039_0070455 3300049575 Bacteria 2716
1660 Ga0501039_0094286 3300049575 Bacteria 2333
1661 Ga0501039_0100506 3300049575 Bacteria 2257
1662 Ga0501040_0009812 3300049576 Bacteria 6250
1663 Ga0501040_0028962 3300049576 Bacteria 3735
1664 Ga0501040_0141790 3300049576 Bacteria 1693
1665 Ga0501040_0204409 3300049576 Bacteria 1403
1666 Ga0501042_0010639 3300049578 Bacteria 6180
1667 Ga0501042_0081362 3300049578 Bacteria 2321
1668 Ga0501042_0098549 3300049578 Bacteria 2102
1669 Ga0501043_0000736 3300049579 Bacteria 29004
1670 Ga0501043_0001227 3300049579 Bacteria 22604
1671 Ga0501043_0003174 3300049579 Bacteria 13596
1672 Ga0501043_0010595 3300049579 Bacteria 7218
1673 Ga0501043_0014872 3300049579 Bacteria 6091
1674 Ga0501043_0031243 3300049579 Bacteria 4187
1675 Ga0501043_0044063 3300049579 Bacteria 3507
1676 Ga0501043_0129343 3300049579 Bacteria 1979
1677 Ga0501043_0154261 3300049579 Bacteria 1796
1678 Ga0501043_0171778 3300049579 Bacteria 1691
1679 Ga0501043_0173770 3300049579 Bacteria 1680
1680 Ga0501043_0212217 3300049579 Bacteria 1500
1681 Ga0501043_0274914 3300049579 Bacteria 1292
1682 Ga0501046_0001837 3300049580 Bacteria 20235
1683 Ga0501046_0007945 3300049580 Bacteria 9282
1684 Ga0501046_0029996 3300049580 Bacteria 4418
1685 Ga0501046_0045435 3300049580 Bacteria 3489
1686 Ga0501046_0061840 3300049580 Bacteria 2926
1687 Ga0501046_0223548 3300049580 Bacteria 1393
1688 Ga0501047_0003137 3300049581 Bacteria 15685
1689 Ga0501047_0011635 3300049581 Bacteria 8322
1690 Ga0501047_0012748 3300049581 Bacteria 7964
1691 Ga0501047_0017683 3300049581 Bacteria 6831
1692 Ga0501047_0029724 3300049581 Bacteria 5267
1693 Ga0501047_0032514 3300049581 Bacteria 5036
1694 Ga0501047_0038887 3300049581 Bacteria 4602
1695 Ga0501047_0137136 3300049581 Bacteria 2327
1696 Ga0501047_0140640 3300049581 Bacteria 2292
1697 Ga0501047_0151851 3300049581 Bacteria 2192
1698 Ga0501047_0158778 3300049581 Bacteria 2133
1699 Ga0501047_0183852 3300049581 Bacteria 1956
1700 Ga0501047_0244202 3300049581 Bacteria 1645
1701 Ga0501047_0283845 3300049581 Bacteria 1500
1702 Ga0501047_0391781 3300049581 Bacteria 1222
1703 Ga0501048_0000151 3300049582 Bacteria 42561
1704 Ga0501048_0008611 3300049582 Bacteria 7703
1705 Ga0501048_0031194 3300049582 Bacteria 3856
1706 Ga0501048_0224232 3300049582 Bacteria 1334
1707 Ga0501048_0245865 3300049582 Bacteria 1270
1708 Ga0501048_0287435 3300049582 Bacteria 1169
1709 Ga0501067_0041815 3300049583 Bacteria 2545
1710 Ga0501067_0069865 3300049583 Bacteria 1945
1711 Ga0501068_0008727 3300049584 Bacteria 5652
1712 Ga0501068_0014566 3300049584 Bacteria 4499
1713 Ga0501068_0021116 3300049584 Bacteria 3800
1714 Ga0501068_0039568 3300049584 Bacteria 2827
1715 Ga0501068_0143092 3300049584 Bacteria 1499
1716 Ga0501068_0204433 3300049584 Bacteria 1253
1717 Ga0501068_0221066 3300049584 Bacteria 1204
1718 Ga0501069_0002411 3300049585 Bacteria 9502
1719 Ga0501069_0026629 3300049585 Bacteria 3167
1720 Ga0501069_0033702 3300049585 Bacteria 2821
1721 Ga0501069_0034085 3300049585 Bacteria 2804
1722 Ga0501070_0005227 3300049586 Bacteria 11067
1723 Ga0501070_0005894 3300049586 Bacteria 10451
1724 Ga0501070_0010861 3300049586 Bacteria 7692
1725 Ga0501070_0020723 3300049586 Bacteria 5515
1726 Ga0501070_0026632 3300049586 Bacteria 4851
1727 Ga0501070_0028069 3300049586 Bacteria 4719
1728 Ga0501070_0030737 3300049586 Bacteria 4498
1729 Ga0501070_0049766 3300049586 Bacteria 3479
1730 Ga0501070_0081113 3300049586 Bacteria 2684
1731 Ga0501070_0082113 3300049586 Bacteria 2667
1732 Ga0501070_0299565 3300049586 Bacteria 1310
1733 Ga0501070_0301677 3300049586 Bacteria 1305
1734 Ga0501071_0011715 3300049587 Bacteria 5918
1735 Ga0501071_0025628 3300049587 Bacteria 4133
1736 Ga0501071_0202093 3300049587 Bacteria 1493
1737 Ga0501071_0240335 3300049587 Bacteria 1365
1738 Ga0501072_0070380 3300049588 Bacteria 2763
1739 Ga0501072_0128970 3300049588 Bacteria 2015
1740 Ga0501072_0179329 3300049588 Bacteria 1690
1741 Ga0501073_0001201 3300049589 Bacteria 18879
1742 Ga0501073_0005720 3300049589 Bacteria 9301
1743 Ga0501073_0006498 3300049589 Bacteria 8696
1744 Ga0501073_0009708 3300049589 Bacteria 7090
1745 Ga0501073_0010790 3300049589 Bacteria 6689
1746 Ga0501073_0025551 3300049589 Bacteria 4233
1747 Ga0501073_0037567 3300049589 Bacteria 3437
1748 Ga0501073_0065647 3300049589 Bacteria 2530
1749 Ga0501073_0094938 3300049589 Bacteria 2071
1750 Ga0501073_0097070 3300049589 Bacteria 2047
1751 Ga0501073_0100648 3300049589 Bacteria 2007
1752 Ga0501073_0177116 3300049589 Bacteria 1476
1753 Ga0501073_0194279 3300049589 Bacteria 1404
1754 Ga0501073_0202869 3300049589 Bacteria 1371
1755 Ga0501073_0203106 3300049589 Bacteria 1370
1756 Ga0501073_0209012 3300049589 Bacteria 1349
1757 Ga0501074_0005855 3300049590 Bacteria 8869
1758 Ga0501074_0012718 3300049590 Bacteria 6119
1759 Ga0501074_0018996 3300049590 Bacteria 4993
1760 Ga0501074_0124494 3300049590 Bacteria 1843
1761 Ga0501074_0343333 3300049590 Bacteria 1060
1762 Ga0501075_0149379 3300049591 Bacteria 1781
1763 Ga0501075_0315670 3300049591 Bacteria 1191
1764 Ga0501076_0111203 3300049592 Bacteria 2214
1765 Ga0501076_0205327 3300049592 Bacteria 1609
1766 Ga0501076_0234740 3300049592 Bacteria 1500
1767 Ga0501076_0423612 3300049592 Bacteria 1095
1768 Ga0501077_0020579 3300049593 Bacteria 4177
1769 Ga0501077_0033219 3300049593 Bacteria 3284
1770 Ga0501077_0041605 3300049593 Bacteria 2924
1771 Ga0501077_0052209 3300049593 Bacteria 2597
1772 Ga0501077_0069047 3300049593 Bacteria 2240
1773 Ga0501079_0031480 3300049741 Bacteria 4078
1774 Ga0501079_0032061 3300049741 Bacteria 4039
1775 Ga0501079_0044969 3300049741 Bacteria 3408
1776 Ga0501079_0053474 3300049741 Bacteria 3115
1777 Ga0501079_0070652 3300049741 Bacteria 2696
1778 Ga0501079_0118501 3300049741 Bacteria 2058
1779 Ga0501079_0194645 3300049741 Bacteria 1583
1780 Ga0501080_0000130 3300049742 Bacteria 53465
1781 Ga0501080_0007728 3300049742 Bacteria 9722
1782 Ga0501080_0007746 3300049742 Bacteria 9710
1783 Ga0501080_0016485 3300049742 Bacteria 6824
1784 Ga0501080_0022690 3300049742 Bacteria 5815
1785 Ga0501080_0024231 3300049742 Bacteria 5626
1786 Ga0501080_0066799 3300049742 Bacteria 3344
1787 Ga0501080_0129552 3300049742 Bacteria 2335
1788 Ga0501080_0185972 3300049742 Bacteria 1910
1789 Ga0501080_0318785 3300049742 Bacteria 1408
1790 Ga0501080_0369493 3300049742 Bacteria 1293
1791 Ga0501080_0369927 3300049742 Bacteria 1292
1792 Ga0501080_0378711 3300049742 Bacteria 1275
1793 Ga0501081_0011150 3300049743 Bacteria 5878
1794 Ga0501081_0019570 3300049743 Bacteria 4508
1795 Ga0501081_0069515 3300049743 Bacteria 2453
1796 Ga0501081_0126740 3300049743 Bacteria 1822
1797 Ga0501081_0203385 3300049743 Bacteria 1437
1798 Ga0501083_0000480 3300049744 Bacteria 25565
1799 Ga0501083_0002243 3300049744 Bacteria 13202
1800 Ga0501083_0014715 3300049744 Bacteria 5469
1801 Ga0501083_0014948 3300049744 Bacteria 5432
1802 Ga0501083_0015468 3300049744 Bacteria 5344
1803 Ga0501083_0016876 3300049744 Bacteria 5100
1804 Ga0501083_0028904 3300049744 Bacteria 3819
1805 Ga0501083_0116923 3300049744 Bacteria 1750
1806 Ga0501083_0139768 3300049744 Bacteria 1586
1807 Ga0501083_0155240 3300049744 Bacteria 1498
1808 Ga0501280_006888 3300049776 Bacteria 1597
1809 Ga0501035_0000014 3300049822 Bacteria 253874
1810 Ga0501035_0000127 3300049822 Bacteria 92397
1811 Ga0501035_0002914 3300049822 Bacteria 16472
1812 Ga0501035_0004040 3300049822 Bacteria 13976
1813 Ga0501035_0026490 3300049822 Bacteria 5303
1814 Ga0501035_0093817 3300049822 Bacteria 2640
1815 Ga0501035_0114415 3300049822 Bacteria 2362
1816 Ga0501035_0150290 3300049822 Bacteria 2021
1817 Ga0501035_0155418 3300049822 Bacteria 1983
1818 Ga0501035_0191598 3300049822 Bacteria 1758
1819 Ga0501035_0219976 3300049822 Bacteria 1622
1820 Ga0501035_0241391 3300049822 Bacteria 1536
1821 Ga0501035_0349186 3300049822 Bacteria 1238
1822 Ga0501044_0000012 3300049823 Bacteria 253881
1823 Ga0501044_0000636 3300049823 Bacteria 42394
1824 Ga0501044_0004042 3300049823 Bacteria 16455
1825 Ga0501044_0013256 3300049823 Bacteria 8924
1826 Ga0501044_0034514 3300049823 Bacteria 5303
1827 Ga0501044_0034727 3300049823 Bacteria 5286
1828 Ga0501044_0036318 3300049823 Bacteria 5155
1829 Ga0501044_0089568 3300049823 Bacteria 3105
1830 Ga0501044_0126626 3300049823 Bacteria 2551
1831 Ga0501044_0132604 3300049823 Bacteria 2485
1832 Ga0501044_0172623 3300049823 Bacteria 2132
1833 Ga0501044_0272868 3300049823 Bacteria 1626
1834 Ga0501044_0327007 3300049823 Bacteria 1456
1835 Ga0501044_0357737 3300049823 Bacteria 1378
1836 Ga0501044_0378722 3300049823 Bacteria 1330
1837 Ga0501044_0382740 3300049823 Bacteria 1322
1838 Ga0501044_0417700 3300049823 Bacteria 1252
1839 Ga0501044_0472676 3300049823 Bacteria 1157
1840 Ga0501045_0011533 3300049824 Bacteria 6207
1841 Ga0501045_0204455 3300049824 Bacteria 1471
1842 Ga0501045_0240036 3300049824 Bacteria 1349
1843 nmdc:mga03683_23316_c1 3300050489 Bacteria 2410
1844 nmdc:mga03n38_2857_c1 3300050490 Bacteria 5436
1845 nmdc:mga00v17_100626_c1 3300050491 Bacteria 1824
1846 nmdc:mga00v17_150906_c1 3300050491 Bacteria 1493
1847 nmdc:mga00v17_15278_c1 3300050491 Bacteria 4307
1848 nmdc:mga00v17_183_c1 3300050491 Bacteria 37432
1849 nmdc:mga0yw44_180716_c1 3300050492 Bacteria 1388
1850 nmdc:mga0yw44_30581_c1 3300050492 Bacteria 3123
1851 nmdc:mga0yw44_35481_c1 3300050492 Bacteria 2931
1852 nmdc:mga0yw44_501_c1 3300050492 Bacteria 13990
1853 nmdc:mga0yw44_72364_c1 3300050492 Bacteria 2143
1854 nmdc:mga0yw44_751_c1 3300050492 Bacteria 12016
1855 nmdc:mga0k408_198452_c1 3300050493 Bacteria 1198
1856 nmdc:mga06z11_10620_c1 3300050494 Bacteria 3933
1857 nmdc:mga06z11_151928_c1 3300050494 Bacteria 1317
1858 nmdc:mga06z11_23381_c1 3300050494 Bacteria 2903
1859 nmdc:mga06z11_236801_c1 3300050494 Bacteria 1071
1860 nmdc:mga06z11_3201_c1 3300050494 Bacteria 6326
1861 nmdc:mga06z11_53691_c1 3300050494 Bacteria 2074
1862 nmdc:mga06z11_54516_c1 3300050494 Bacteria 2061
1863 nmdc:mga04h51_121517_c1 3300050495 Bacteria 973
1864 nmdc:mga04h51_3760_c1 3300050495 Bacteria 3720
1865 nmdc:mga04h51_43502_c1 3300050495 Bacteria 1478
1866 nmdc:mga04h51_788_c1 3300050495 Bacteria 7354
1867 nmdc:mga05p37_210744_c1 3300050507 Bacteria 2349
1868 nmdc:mga05p37_26679_c1 3300050507 Bacteria 7025
1869 nmdc:mga05p37_268_c1 3300050507 Bacteria 53897
1870 nmdc:mga05p37_334572_c1 3300050507 Bacteria 1787
1871 nmdc:mga05p37_38333_c1 3300050507 Bacteria 5878
1872 nmdc:mga05p37_39554_c1 3300050507 Bacteria 5790
1873 nmdc:mga05p37_452793_c1 3300050507 Bacteria 1485
1874 nmdc:mga05p37_513092_c1 3300050507 Bacteria 1373
1875 nmdc:mga09592_11852_c1 3300050508 Bacteria 7092
1876 nmdc:mga09592_12086_c1 3300050508 Bacteria 7026
1877 nmdc:mga09592_35342_c1 3300050508 Bacteria 4183
1878 nmdc:mga09592_37456_c1 3300050508 Bacteria 4069
1879 nmdc:mga09592_452739_c1 3300050508 Bacteria 1107
1880 nmdc:mga0qj67_14879_c1 3300050509 Bacteria 5885
1881 nmdc:mga0qj67_26592_c1 3300050509 Bacteria 4479
1882 nmdc:mga0qj67_38702_c1 3300050509 Bacteria 3742
1883 nmdc:mga0qj67_68904_c1 3300050509 Bacteria 2820
1884 nmdc:mga06r32_114999_c1 3300050510 Bacteria 2649
1885 nmdc:mga06r32_133_c1 3300050510 Bacteria 53973
1886 nmdc:mga06r32_137077_c1 3300050510 Bacteria 2422
1887 nmdc:mga06r32_183464_c1 3300050510 Bacteria 2079
1888 nmdc:mga06r32_29045_c1 3300050510 Bacteria 5178
1889 nmdc:mga06r32_339614_c1 3300050510 Bacteria 1487
1890 nmdc:mga06r32_51265_c1 3300050510 Bacteria 3949
1891 nmdc:mga06r32_641990_c1 3300050510 Bacteria 1030
1892 nmdc:mga06r32_83027_c1 3300050510 Bacteria 3122
1893 nmdc:mga08y16_386179_c1 3300050511 Bacteria 1435
1894 nmdc:mga08y16_433948_c1 3300050511 Bacteria 1342
1895 nmdc:mga08y16_459510_c1 3300050511 Bacteria 1298
1896 nmdc:mga08y16_604_c1 3300050511 Bacteria 33484
1897 nmdc:mga08y16_612482_c1 3300050511 Bacteria 1096
1898 nmdc:mga0n895_112572_c1 3300050512 Bacteria 2738
1899 nmdc:mga0n895_1134_c1 3300050512 Bacteria 19498
1900 nmdc:mga0n895_224463_c1 3300050512 Bacteria 1907
1901 nmdc:mga0n895_235723_c1 3300050512 Bacteria 1857
1902 nmdc:mga0n895_242670_c1 3300050512 Bacteria 1828
1903 nmdc:mga0n895_25390_c1 3300050512 Bacteria 5597
1904 nmdc:mga0n895_35109_c1 3300050512 Bacteria 4832
1905 nmdc:mga0n895_5394_c1 3300050512 Bacteria 10675
1906 nmdc:mga0n895_62149_c1 3300050512 Bacteria 3690
1907 nmdc:mga0n895_65341_c1 3300050512 Bacteria 3601
1908 nmdc:mga0n895_69727_c1 3300050512 Bacteria 3484
1909 nmdc:mga0rr50_118925_c1 3300050513 Bacteria 2100
1910 nmdc:mga0rr50_3559_c1 3300050513 Bacteria 8999
1911 nmdc:mga0rr50_4637_c1 3300050513 Bacteria 8098
1912 nmdc:mga08x19_1409_c1 3300050514 Bacteria 14868
1913 nmdc:mga08x19_289710_c1 3300050514 Bacteria 1136
1914 nmdc:mga0a205_269868_c1 3300050515 Bacteria 1578
1915 nmdc:mga0a205_292104_c1 3300050515 Bacteria 1504
1916 nmdc:mga0sz30_5131_c1 3300050516 Bacteria 4792
1917 nmdc:mga0sz30_80_c1 3300050516 Bacteria 36573
1918 Ga0495601_0000009 3300053077 Bacteria 270622
1919 Ga0495601_0019603 3300053077 Bacteria 4127
1920 Ga0495601_0077667 3300053077 Bacteria 2126
1921 Ga0495601_0080813 3300053077 Bacteria 2086
1922 Ga0495612_0000019 3300053078 Bacteria 137844
1923 Ga0495612_0003729 3300053078 Bacteria 6330
1924 Ga0495612_0007681 3300053078 Bacteria 4404
1925 Ga0500610_0024158 3300053079 Bacteria 3018
1926 Ga0500610_0046673 3300053079 Bacteria 2250
1927 Ga0495655_0003940 3300053083 Bacteria 2495
1928 Ga0495655_0004297 3300053083 Bacteria 2425
1929 Ga0495595_0000015 3300053084 Bacteria 144946
1930 Ga0495595_0000221 3300053084 Bacteria 22745
1931 Ga0495595_0018863 3300053084 Bacteria 2986
1932 Ga0495595_0033870 3300053084 Bacteria 2307
1933 Ga0495595_0035357 3300053084 Bacteria 2263
1934 Ga0495619_0000012 3300053085 Bacteria 268349
1935 Ga0495619_0001997 3300053085 Bacteria 13578
1936 Ga0495619_0008018 3300053085 Bacteria 6683
1937 Ga0495619_0033841 3300053085 Bacteria 3320
1938 Ga0495619_0040427 3300053085 Bacteria 3048
1939 Ga0500578_0038804 3300053086 Bacteria 3059
1940 Ga0500643_000008 3300053087 Bacteria 457931
1941 Ga0500644_0001056 3300053088 Bacteria 8189
1942 Ga0500644_0092833 3300053088 Bacteria 1133
1943 Ga0500646_0017598 3300053090 Bacteria 1875
1944 Ga0500647_0054562 3300053091 Bacteria 1923
1945 Ga0500651_0013102 3300053093 Bacteria 5041
1946 Ga0500566_0016698 3300053094 Bacteria 4308
1947 Ga0500566_0023437 3300053094 Bacteria 3624
1948 Ga0500566_0037748 3300053094 Bacteria 2798
1949 Ga0500641_0065847 3300053096 Bacteria 1516
1950 Ga0500557_000004 3300053105 Bacteria 202318
1951 Ga0500557_000228 3300053105 Bacteria 8621
1952 Ga0500560_049602 3300053107 Bacteria 1343
1953 Ga0500562_019931 3300053108 Bacteria 1739
1954 Ga0500569_003783 3300053109 Bacteria 3128
1955 Ga0500594_0006340 3300053118 Bacteria 2653
1956 Ga0500595_000010 3300053119 Bacteria 275806
1957 Ga0500595_000045 3300053119 Bacteria 90834
1958 Ga0500595_002270 3300053119 Bacteria 9692
1959 Ga0500595_004854 3300053119 Bacteria 5948
1960 Ga0500595_018777 3300053119 Bacteria 2522
1961 Ga0500595_036703 3300053119 Bacteria 1604
1962 Ga0500608_015411 3300053122 Bacteria 3435
1963 Ga0500608_125193 3300053122 Bacteria 1160
1964 Ga0500618_000045 3300053125 Bacteria 110042
1965 Ga0500642_0000133 3300053130 Bacteria 33202
1966 Ga0500642_0006925 3300053130 Bacteria 3774
1967 Ga0500652_093992 3300053131 Bacteria 1252
1968 Ga0500658_0011471 3300053134 Bacteria 3265
1969 Ga0500561_0000591 3300053137 Bacteria 5864
1970 Ga0500568_0000116 3300053139 Bacteria 71883
1971 Ga0500568_0001521 3300053139 Bacteria 14782
1972 Ga0500568_0004036 3300053139 Bacteria 7954
1973 Ga0500568_0034341 3300053139 Bacteria 2076
1974 Ga0500573_0000121 3300053140 Bacteria 30931
1975 Ga0500577_0018815 3300053142 Bacteria 2228
1976 Ga0500588_0015558 3300053146 Bacteria 1950
1977 Ga0500590_063879 3300053148 Bacteria 1844
1978 Ga0500604_0002220 3300053151 Bacteria 5326
1979 Ga0500604_0013376 3300053151 Bacteria 2223
1980 Ga0500616_0000001 3300053153 Bacteria 1986011
1981 Ga0500616_0000093 3300053153 Bacteria 183114
1982 Ga0500616_0000539 3300053153 Bacteria 47314
1983 Ga0500616_0001502 3300053153 Bacteria 22017
1984 Ga0500616_0142955 3300053153 Bacteria 1116
1985 Ga0500620_017284 3300053155 Bacteria 2078
1986 Ga0500622_0000486 3300053156 Bacteria 37244
1987 Ga0500622_0135580 3300053156 Bacteria 1179
1988 Ga0500624_000519 3300053157 Bacteria 11133
1989 Ga0500624_002151 3300053157 Bacteria 2735
1990 Ga0500627_0088520 3300053158 Bacteria 1385
1991 Ga0500634_0000005 3300053161 Bacteria 184092
1992 Ga0500634_0000507 3300053161 Bacteria 12661
1993 Ga0500634_0001341 3300053161 Bacteria 9450
1994 Ga0500634_0012475 3300053161 Bacteria 4426
1995 Ga0500639_093950 3300053163 Bacteria 1489
1996 Ga0500636_0048382 3300053177 Bacteria 2503
1997 Ga0500645_000051 3300053730 Bacteria 98521
1998 Ga0500645_028192 3300053730 Bacteria 1701
1999 Ga0500609_001805 3300053731 Bacteria 3106
2000 Ga0501084_0017572 3300054114 Bacteria 5948
2001 Ga0501084_0018707 3300054114 Bacteria 5768
2002 Ga0501084_0027038 3300054114 Bacteria 4793
2003 Ga0501084_0036290 3300054114 Bacteria 4118
2004 Ga0501084_0037753 3300054114 Bacteria 4037
2005 Ga0501084_0039088 3300054114 Bacteria 3969
2006 Ga0501084_0046623 3300054114 Bacteria 3631
2007 Ga0501084_0111778 3300054114 Bacteria 2296
2008 Ga0501084_0124646 3300054114 Bacteria 2167
2009 Ga0501084_0142028 3300054114 Bacteria 2022
2010 Ga0501084_0343064 3300054114 Bacteria 1262
2011 Ga0501084_0381536 3300054114 Bacteria 1191
2012 Ga0501084_0405285 3300054114 Bacteria 1152
2013 Ga0501084_0436349 3300054114 Bacteria 1107
2014 Ga0501082_0005230 3300060353 Bacteria 11281
2015 Ga0501082_0026891 3300060353 Bacteria 4957
2016 Ga0501082_0028918 3300060353 Bacteria 4775
2017 Ga0501082_0035666 3300060353 Bacteria 4286
2018 Ga0501082_0038785 3300060353 Bacteria 4109
2019 Ga0501082_0110103 3300060353 Bacteria 2384
2020 Ga0501082_0151312 3300060353 Bacteria 2016
2021 Ga0501082_0165803 3300060353 Bacteria 1920
2022 Ga0501082_0212025 3300060353 Bacteria 1685
2023 Ga0501082_0239897 3300060353 Bacteria 1577
2024 Ga0501082_0253222 3300060353 Bacteria 1532
2025 Ga0501082_0359360 3300060353 Bacteria 1270
2026 Ga0466962_0100198 3300061719 Bacteria 1391
2027 Ga0530510_0081230 3300061734 Bacteria 2360
2028 Ga0530510_0114488 3300061734 Bacteria 1977
2029 Ga0530510_0176347 3300061734 Bacteria 1584
2030 Ga0530510_0216307 3300061734 Bacteria 1424
2031 Ga0530510_0315916 3300061734 Bacteria 1170

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0048000 Ga0495604_0048000_2476_3297 258
2 iso_pu_bacteria 2906378014 2906386458 261
3 3300031238 Ga0265332_10088275 Ga0265332_100882752 266
4 3300031241 Ga0265325_10000034 Ga0265325_1000003448 266
5 3300031595 Ga0265313_10025763 Ga0265313_100257632 266
6 3300050510 nmdc:mga06r32_339614_c1 nmdc:mga06r32_339614_c1_630_1442 270
7 3300035171 Ga0373946_0047267 Ga0373946_0047267_928_1752 274
8 3300035692 Ga0373935_0049269 Ga0373935_0049269_1804_2628 274
9 3300035121 Ga0373960_0035704 Ga0373960_0035704_563_1390 275
10 3300035241 Ga0373961_0098378 Ga0373961_0098378_78_908 276
11 3300044694 Ga0466963_0243349 Ga0466963_0243349_392_1222 276
12 3300046515 Ga0495620_0053665 Ga0495620_0053665_20_865 278
13 3300021441 Ga0213871_10051334 Ga0213871_100513342 279
14 3300039438 Ga0436360_0621837 Ga0436360_0621837_570_1412 279
15 3300048912 Ga0496109_0457617 Ga0496109_0457617_16_870 284
16 3300039438 Ga0436360_1151605 Ga0436360_1151605_2338_3201 285
17 3300005445 Ga0070708_100074256 Ga0070708_1000742562 286
18 iso_pu_bacteria 2513237156 2513985831 286
19 iso_pu_bacteria 2909399089 2909400515 286
20 iso_pu_bacteria 3004289098 3004296124 286
21 3300048913 Ga0496110_0002034 Ga0496110_0002034_14195_15058 287
22 3300048916 Ga0496113_0129897 Ga0496113_0129897_1092_1961 287
23 3300005434 Ga0070709_10028611 Ga0070709_100286112 288
24 3300005436 Ga0070713_100025577 Ga0070713_1000255773 288
25 3300005437 Ga0070710_10004764 Ga0070710_100047642 288
26 3300005439 Ga0070711_100036220 Ga0070711_1000362204 288
27 3300025906 Ga0207699_10026433 Ga0207699_100264332 288
28 3300025916 Ga0207663_10054062 Ga0207663_100540622 288
29 3300025928 Ga0207700_10065156 Ga0207700_100651562 288
30 3300032004 Ga0307414_10225659 Ga0307414_102256592 288
31 3300039062 Ga0400483_016265 Ga0400483_016265_462_1457 288
32 3300049569 Ga0501032_0359550 Ga0501032_0359550_10_879 288
33 3300046543 Ga0495645_0102950 Ga0495645_0102950_1149_2018 289
34 3300045049 Ga0466959_0252367 Ga0466959_0252367_316_1203 292
35 3300048929 Ga0496126_0252274 Ga0496126_0252274_42_926 294
36 3300010375 Ga0105239_10264833 Ga0105239_102648332 296
37 3300031247 Ga0265340_10005082 Ga0265340_100050827 297
38 3300039438 Ga0436360_1072416 Ga0436360_1072416_842_1828 297
39 3300039437 Ga0436365_1445989 Ga0436365_1445989_171_1154 299
40 3300042016 Ga0439463_029344 Ga0439463_029344_199_1206 299
41 3300006871 Ga0075434_100000211 Ga0075434_10000021112 301
42 3300006914 Ga0075436_100014215 Ga0075436_1000142152 301
43 3300007076 Ga0075435_100006459 Ga0075435_1000064598 301
44 3300049590 Ga0501074_0124494 Ga0501074_0124494_14_970 301
45 3300050512 nmdc:mga0n895_1134_c1 nmdc:mga0n895_1134_c1_9709_10638 301
46 3300050513 nmdc:mga0rr50_4637_c1 nmdc:mga0rr50_4637_c1_6641_7570 301
47 3300042436 Ga0439435_0044619 Ga0439435_0044619_326_1234 302
48 3300048913 Ga0496110_0161733 Ga0496110_0161733_524_1435 302
49 3300048915 Ga0496112_0365346 Ga0496112_0365346_67_978 302
50 3300048929 Ga0496126_0125683 Ga0496126_0125683_536_1534 302
51 3300005458 Ga0070681_10507171 Ga0070681_105071711 303
52 3300037312 Ga0395899_0089182 Ga0395899_0089182_1171_2145 303
53 3300037418 Ga0395900_0105149 Ga0395900_0105149_1780_2754 303
54 3300037466 Ga0395898_0029116 Ga0395898_0029116_2600_3574 303
55 3300037466 Ga0395898_0036536 Ga0395898_0036536_2551_3525 303
56 3300038443 Ga0395901_0019114 Ga0395901_0019114_1679_2653 303
57 3300048922 Ga0496119_0104261 Ga0496119_0104261_454_1365 303
58 3300049568 Ga0501031_0000007 Ga0501031_0000007_38549_39511 303
59 3300049569 Ga0501032_0000007 Ga0501032_0000007_126498_127460 303
60 3300049570 Ga0501033_0000040 Ga0501033_0000040_15127_16089 303
61 3300049571 Ga0501034_0000029 Ga0501034_0000029_126422_127384 303
62 3300049572 Ga0501036_0000004 Ga0501036_0000004_126422_127384 303
63 3300049573 Ga0501037_0000004 Ga0501037_0000004_126498_127460 303
64 3300049574 Ga0501038_0000005 Ga0501038_0000005_126422_127384 303
65 3300049575 Ga0501039_0000009 Ga0501039_0000009_126422_127384 303
66 3300049576 Ga0501040_0009812 Ga0501040_0009812_1041_2003 303
67 3300049579 Ga0501043_0001227 Ga0501043_0001227_15121_16083 303
68 3300049580 Ga0501046_0061840 Ga0501046_0061840_390_1352 303
69 3300049581 Ga0501047_0003137 Ga0501047_0003137_14391_15353 303
70 3300049586 Ga0501070_0030737 Ga0501070_0030737_206_1168 303
71 3300049822 Ga0501035_0000014 Ga0501035_0000014_126422_127384 303
72 3300049823 Ga0501044_0000012 Ga0501044_0000012_126498_127460 303
73 3300037466 Ga0395898_0466985 Ga0395898_0466985_13_987 304
74 3300038443 Ga0395901_0095982 Ga0395901_0095982_773_1747 304
75 3300005518 Ga0070699_100006683 Ga0070699_1000066836 305
76 3300006844 Ga0075428_100005911 Ga0075428_10000591111 305
77 3300006846 Ga0075430_100363525 Ga0075430_1003635251 305
78 3300006880 Ga0075429_100001213 Ga0075429_10000121310 305
79 3300025913 Ga0207695_10146155 Ga0207695_101461552 305
80 3300027907 Ga0207428_10000624 Ga0207428_1000062440 305
81 3300035172 Ga0373955_0062921 Ga0373955_0062921_167_1090 305
82 3300035724 Ga0373933_0052376 Ga0373933_0052376_1239_2162 305
83 3300036401 Ga0373937_0201561 Ga0373937_0201561_665_1588 305
84 3300037418 Ga0395900_0004702 Ga0395900_0004702_144_1118 305
85 3300037466 Ga0395898_0059206 Ga0395898_0059206_2701_3675 305
86 3300046559 Ga0495667_0113594 Ga0495667_0113594_411_1334 305
87 3300049581 Ga0501047_0151851 Ga0501047_0151851_173_1150 305
88 3300006846 Ga0075430_100086622 Ga0075430_1000866222 306
89 3300006846 Ga0075430_100129831 Ga0075430_1001298313 306
90 3300006871 Ga0075434_100006290 Ga0075434_1000062907 306
91 3300009147 Ga0114129_10107117 Ga0114129_101071172 306
92 3300025916 Ga0207663_10023281 Ga0207663_100232812 306
93 3300027682 Ga0209971_1005098 Ga0209971_10050984 306
94 3300032005 Ga0307411_10027540 Ga0307411_100275402 306
95 3300042001 Ga0439441_000433 Ga0439441_000433_408_1352 306
96 3300049578 Ga0501042_0098549 Ga0501042_0098549_396_1337 306
97 3300050507 nmdc:mga05p37_334572_c1 nmdc:mga05p37_334572_c1_380_1363 306
98 3300050507 nmdc:mga05p37_452793_c1 nmdc:mga05p37_452793_c1_104_1048 306
99 3300050508 nmdc:mga09592_12086_c1 nmdc:mga09592_12086_c1_719_1663 306
100 3300050509 nmdc:mga0qj67_38702_c1 nmdc:mga0qj67_38702_c1_260_1201 306
101 3300050512 nmdc:mga0n895_25390_c1 nmdc:mga0n895_25390_c1_1737_2690 306
102 3300009551 Ga0105238_10292662 Ga0105238_102926622 307
103 3300009551 Ga0105238_10512926 Ga0105238_105129262 307
104 3300009553 Ga0105249_10330206 Ga0105249_103302062 307
105 3300013102 Ga0157371_10123827 Ga0157371_101238272 307
106 3300013306 Ga0163162_10263359 Ga0163162_102633591 307
107 3300013307 Ga0157372_10232610 Ga0157372_102326101 307
108 3300013308 Ga0157375_10096756 Ga0157375_100967562 307
109 3300025918 Ga0207662_10176713 Ga0207662_101767132 307
110 3300025939 Ga0207665_10094554 Ga0207665_100945542 307
111 3300027378 Ga0209981_1007998 Ga0209981_10079982 307
112 3300048909 Ga0496106_0241648 Ga0496106_0241648_468_1391 307
113 3300048910 Ga0496107_0183310 Ga0496107_0183310_247_1170 307
114 3300049587 Ga0501071_0202093 Ga0501071_0202093_359_1303 307
115 3300049593 Ga0501077_0033219 Ga0501077_0033219_1096_2040 307
116 3300009094 Ga0111539_10024409 Ga0111539_100244096 308
117 3300027907 Ga0207428_10040791 Ga0207428_100407912 308
118 3300031235 Ga0265330_10039535 Ga0265330_100395352 308
119 3300031241 Ga0265325_10014336 Ga0265325_100143362 308
120 3300031247 Ga0265340_10009784 Ga0265340_100097842 308
121 3300031712 Ga0265342_10004092 Ga0265342_100040924 308
122 3300036647 Ga0316582_0222298 Ga0316582_0222298_41_1027 308
123 3300037068 Ga0373925_0125977 Ga0373925_0125977_896_1876 308
124 3300046517 Ga0495630_0010749 Ga0495630_0010749_2234_3193 308
125 3300046533 Ga0495640_0058737 Ga0495640_0058737_1595_2554 308
126 3300046690 Ga0495624_0037339 Ga0495624_0037339_926_1885 308
127 3300047315 Ga0495581_0028095 Ga0495581_0028095_776_1735 308
128 3300049573 Ga0501037_0098608 Ga0501037_0098608_702_1676 308
129 3300049579 Ga0501043_0154261 Ga0501043_0154261_696_1670 308
130 3300049586 Ga0501070_0049766 Ga0501070_0049766_2153_3127 308
131 3300049587 Ga0501071_0025628 Ga0501071_0025628_520_1494 308
132 3300049589 Ga0501073_0037567 Ga0501073_0037567_2001_2975 308
133 3300049744 Ga0501083_0155240 Ga0501083_0155240_494_1468 308
134 3300053077 Ga0495601_0080813 Ga0495601_0080813_928_1887 308
135 3300060353 Ga0501082_0239897 Ga0501082_0239897_290_1264 308
136 3300006914 Ga0075436_100003794 Ga0075436_1000037945 309
137 3300009147 Ga0114129_10160953 Ga0114129_101609532 309
138 3300025915 Ga0207693_10229138 Ga0207693_102291382 309
139 3300025949 Ga0207667_10007911 Ga0207667_100079119 309
140 3300048907 Ga0496104_0000317 Ga0496104_0000317_38016_38990 309
141 3300048908 Ga0496105_0000485 Ga0496105_0000485_20021_20995 309
142 3300049581 Ga0501047_0029724 Ga0501047_0029724_2987_3937 309
143 3300050507 nmdc:mga05p37_513092_c1 nmdc:mga05p37_513092_c1_382_1311 309
144 iso_pu_bacteria 2738543024 2739310542 309
145 3300005330 Ga0070690_100026997 Ga0070690_1000269972 310
146 3300005535 Ga0070684_100047934 Ga0070684_1000479343 310
147 3300006237 Ga0097621_100009027 Ga0097621_1000090276 310
148 3300006358 Ga0068871_100020899 Ga0068871_1000208992 310
149 3300014745 Ga0157377_10024575 Ga0157377_100245752 310
150 3300025918 Ga0207662_10047533 Ga0207662_100475332 310
151 3300028577 Ga0265318_10046624 Ga0265318_100466242 310
152 3300035170 Ga0373943_0113654 Ga0373943_0113654_486_1421 310
153 3300046535 Ga0495586_0259900 Ga0495586_0259900_10_975 310
154 3300049576 Ga0501040_0141790 Ga0501040_0141790_61_1017 310
155 3300049578 Ga0501042_0081362 Ga0501042_0081362_705_1661 310
156 3300049587 Ga0501071_0240335 Ga0501071_0240335_249_1205 310
157 3300049588 Ga0501072_0128970 Ga0501072_0128970_584_1540 310
158 3300049742 Ga0501080_0007746 Ga0501080_0007746_5273_6223 310
159 3300005345 Ga0070692_10041373 Ga0070692_100413732 311
160 3300005347 Ga0070668_100066458 Ga0070668_1000664582 311
161 3300005353 Ga0070669_100003300 Ga0070669_1000033009 311
162 3300005441 Ga0070700_100000733 Ga0070700_1000007339 311
163 3300005459 Ga0068867_100000417 Ga0068867_10000041721 311
164 3300005536 Ga0070697_100228438 Ga0070697_1002284382 311
165 3300005547 Ga0070693_100001007 Ga0070693_10000100710 311
166 3300005617 Ga0068859_100000332 Ga0068859_10000033241 311
167 3300005719 Ga0068861_100008854 Ga0068861_1000088542 311
168 3300005842 Ga0068858_100004862 Ga0068858_10000486210 311
169 3300006358 Ga0068871_100002899 Ga0068871_1000028992 311
170 3300006881 Ga0068865_100021004 Ga0068865_1000210042 311
171 3300006914 Ga0075436_100064857 Ga0075436_1000648573 311
172 3300006931 Ga0097620_100000332 Ga0097620_10000033212 311
173 3300007076 Ga0075435_100197824 Ga0075435_1001978242 311
174 3300009553 Ga0105249_10001691 Ga0105249_100016912 311
175 3300013306 Ga0163162_10099294 Ga0163162_100992942 311
176 3300014326 Ga0157380_10008288 Ga0157380_100082885 311
177 3300025899 Ga0207642_10162803 Ga0207642_101628032 311
178 3300025923 Ga0207681_10008264 Ga0207681_100082644 311
179 3300025935 Ga0207709_10000917 Ga0207709_1000091713 311
180 3300025935 Ga0207709_10005820 Ga0207709_100058204 311
181 3300025936 Ga0207670_10042605 Ga0207670_100426052 311
182 3300025938 Ga0207704_10005069 Ga0207704_100050695 311
183 3300025961 Ga0207712_10000763 Ga0207712_1000076324 311
184 3300025961 Ga0207712_10001549 Ga0207712_1000154910 311
185 3300026035 Ga0207703_10001682 Ga0207703_100016826 311
186 3300026041 Ga0207639_10011475 Ga0207639_100114756 311
187 3300026075 Ga0207708_10000114 Ga0207708_1000011458 311
188 3300028380 Ga0268265_10013313 Ga0268265_100133132 311
189 3300032002 Ga0307416_100248534 Ga0307416_1002485342 311
190 3300046517 Ga0495630_0109284 Ga0495630_0109284_1021_1959 311
191 3300046559 Ga0495667_0130547 Ga0495667_0130547_13_951 311
192 3300049571 Ga0501034_0012919 Ga0501034_0012919_5823_6800 311
193 3300049571 Ga0501034_0024938 Ga0501034_0024938_676_1662 311
194 3300049573 Ga0501037_0061394 Ga0501037_0061394_1611_2597 311
195 3300049581 Ga0501047_0244202 Ga0501047_0244202_226_1203 311
196 3300049589 Ga0501073_0010790 Ga0501073_0010790_4682_5668 311
197 3300054114 Ga0501084_0381536 Ga0501084_0381536_142_1128 311
198 iso_pu_bacteria 2773857925 2774871344 311
199 iso_pu_bacteria 2775506901 2776258896 311
200 3300005295 Ga0065707_10146168 Ga0065707_101461682 312
201 3300005354 Ga0070675_100021212 Ga0070675_1000212122 312
202 3300005441 Ga0070700_100129628 Ga0070700_1001296282 312
203 3300005459 Ga0068867_100169625 Ga0068867_1001696252 312
204 3300005617 Ga0068859_100586192 Ga0068859_1005861922 312
205 3300006931 Ga0097620_100586186 Ga0097620_1005861862 312
206 3300025972 Ga0207668_10053056 Ga0207668_100530563 312
207 3300027360 Ga0209969_1009492 Ga0209969_10094922 312
208 3300027364 Ga0209967_1001984 Ga0209967_10019843 312
209 3300027462 Ga0210000_1000744 Ga0210000_10007443 312
210 3300027471 Ga0209995_1004105 Ga0209995_10041052 312
211 3300027682 Ga0209971_1013510 Ga0209971_10135102 312
212 3300037068 Ga0373925_0330582 Ga0373925_0330582_157_1104 312
213 3300037418 Ga0395900_0120084 Ga0395900_0120084_1625_2569 312
214 3300046459 Ga0495629_0178950 Ga0495629_0178950_54_998 312
215 3300046642 Ga0495634_0205337 Ga0495634_0205337_255_1199 312
216 3300047320 Ga0495672_0130328 Ga0495672_0130328_16_960 312
217 3300048922 Ga0496119_0055006 Ga0496119_0055006_15_959 312
218 3300049571 Ga0501034_0347697 Ga0501034_0347697_382_1368 312
219 3300049571 Ga0501034_0395900 Ga0501034_0395900_51_1037 312
220 3300049575 Ga0501039_0070455 Ga0501039_0070455_365_1351 312
221 3300049579 Ga0501043_0010595 Ga0501043_0010595_1396_2382 312
222 3300049580 Ga0501046_0045435 Ga0501046_0045435_51_1037 312
223 3300049584 Ga0501068_0143092 Ga0501068_0143092_463_1449 312
224 3300049585 Ga0501069_0034085 Ga0501069_0034085_1402_2388 312
225 3300049741 Ga0501079_0070652 Ga0501079_0070652_1187_2173 312
226 3300049743 Ga0501081_0069515 Ga0501081_0069515_305_1291 312
227 3300049822 Ga0501035_0241391 Ga0501035_0241391_51_1037 312
228 3300054114 Ga0501084_0124646 Ga0501084_0124646_352_1338 312
229 iso_pu_bacteria 2915980308 2915983872 312
230 iso_pu_bacteria 2916061851 2916068477 312
231 iso_pu_bacteria 2921250672 2921256182 312
232 3300005330 Ga0070690_100176522 Ga0070690_1001765222 313
233 3300005615 Ga0070702_100107193 Ga0070702_1001071932 313
234 3300005618 Ga0068864_100489587 Ga0068864_1004895872 313
235 3300005981 Ga0081538_10024573 Ga0081538_100245735 313
236 3300021377 Ga0213874_10022715 Ga0213874_100227153 313
237 3300025918 Ga0207662_10091273 Ga0207662_100912732 313
238 3300025942 Ga0207689_10021922 Ga0207689_100219221 313
239 3300026023 Ga0207677_10579091 Ga0207677_105790911 313
240 3300026075 Ga0207708_10055868 Ga0207708_100558681 313
241 3300028381 Ga0268264_10092980 Ga0268264_100929801 313
242 3300028794 Ga0307515_10004497 Ga0307515_1000449713 313
243 3300031507 Ga0307509_10037843 Ga0307509_100378433 313
244 3300035692 Ga0373935_0121849 Ga0373935_0121849_616_1575 313
245 3300039450 Ga0436363_0480840 Ga0436363_0480840_9305_10282 313
246 3300039450 Ga0436363_1483637 Ga0436363_1483637_299_1282 313
247 3300049743 Ga0501081_0203385 Ga0501081_0203385_336_1295 313
248 3300031344 Ga0265316_10004461 Ga0265316_100044617 314
249 3300031595 Ga0265313_10053957 Ga0265313_100539572 314
250 3300035083 Ga0373926_0001015 Ga0373926_0001015_2020_3027 314
251 3300035113 Ga0373936_0008659 Ga0373936_0008659_864_1871 314
252 3300035725 Ga0373947_0099733 Ga0373947_0099733_170_1177 314
253 3300046472 Ga0495580_0007921 Ga0495580_0007921_6062_7069 314
254 3300046473 Ga0495582_0054498 Ga0495582_0054498_44_1051 314
255 3300046475 Ga0495639_0020303 Ga0495639_0020303_211_1218 314
256 3300046507 Ga0495606_0005629 Ga0495606_0005629_9929_10888 314
257 3300046526 Ga0495666_0005885 Ga0495666_0005885_1006_2013 314
258 3300046535 Ga0495586_0002047 Ga0495586_0002047_7407_8414 314
259 3300046681 Ga0495647_0013785 Ga0495647_0013785_1045_2052 314
260 3300046683 Ga0495658_0004005 Ga0495658_0004005_1684_2691 314
261 3300048924 Ga0496121_0012777 Ga0496121_0012777_1733_2692 314
262 3300049572 Ga0501036_0441372 Ga0501036_0441372_52_1014 314
263 3300053091 Ga0500647_0054562 Ga0500647_0054562_894_1850 314
264 3300054114 Ga0501084_0343064 Ga0501084_0343064_121_1083 314
265 iso_pu_bacteria 2874123672 2874124070 314
266 3300005295 Ga0065707_10134610 Ga0065707_101346101 315
267 3300005347 Ga0070668_100033602 Ga0070668_1000336023 315
268 3300005563 Ga0068855_100053304 Ga0068855_1000533043 315
269 3300005615 Ga0070702_100057852 Ga0070702_1000578522 315
270 3300005842 Ga0068858_100169232 Ga0068858_1001692322 315
271 3300005937 Ga0081455_10053792 Ga0081455_100537922 315
272 3300005937 Ga0081455_10054052 Ga0081455_100540523 315
273 3300006038 Ga0075365_10014030 Ga0075365_100140304 315
274 3300006844 Ga0075428_100203688 Ga0075428_1002036882 315
275 3300006847 Ga0075431_100350704 Ga0075431_1003507041 315
276 3300013105 Ga0157369_10421652 Ga0157369_104216523 315
277 3300013296 Ga0157374_10163290 Ga0157374_101632902 315
278 3300013306 Ga0163162_10045343 Ga0163162_100453432 315
279 3300014325 Ga0163163_10102773 Ga0163163_101027733 315
280 3300014968 Ga0157379_10187602 Ga0157379_101876021 315
281 3300026035 Ga0207703_10100954 Ga0207703_101009542 315
282 3300035118 Ga0373954_0000001 Ga0373954_0000001_89567_90535 315
283 3300035172 Ga0373955_0078198 Ga0373955_0078198_723_1691 315
284 3300035724 Ga0373933_0014895 Ga0373933_0014895_248_1216 315
285 3300036401 Ga0373937_0000524 Ga0373937_0000524_10210_11178 315
286 3300048904 Ga0496101_0226311 Ga0496101_0226311_135_1091 315
287 3300048905 Ga0496102_0094089 Ga0496102_0094089_88_1044 315
288 3300048907 Ga0496104_0053959 Ga0496104_0053959_931_1887 315
289 3300048908 Ga0496105_0014128 Ga0496105_0014128_4035_4991 315
290 3300048909 Ga0496106_0063690 Ga0496106_0063690_206_1162 315
291 3300048911 Ga0496108_0022495 Ga0496108_0022495_373_1329 315
292 3300048913 Ga0496110_0006680 Ga0496110_0006680_7346_8302 315
293 3300048915 Ga0496112_0046586 Ga0496112_0046586_654_1610 315
294 3300048916 Ga0496113_0038211 Ga0496113_0038211_1450_2406 315
295 3300049572 Ga0501036_0072485 Ga0501036_0072485_1767_2720 315
296 3300049575 Ga0501039_0039986 Ga0501039_0039986_1882_2853 315
297 3300049588 Ga0501072_0179329 Ga0501072_0179329_537_1490 315
298 3300049589 Ga0501073_0203106 Ga0501073_0203106_368_1321 315
299 3300049742 Ga0501080_0066799 Ga0501080_0066799_1983_2936 315
300 3300050492 nmdc:mga0yw44_501_c1 nmdc:mga0yw44_501_c1_5070_6053 315
301 3300050509 nmdc:mga0qj67_68904_c1 nmdc:mga0qj67_68904_c1_1748_2731 315
302 3300050510 nmdc:mga06r32_137077_c1 nmdc:mga06r32_137077_c1_1012_1995 315
303 iso_pu_bacteria 2513237351 2514587565 315
304 iso_pu_bacteria 2738541281 2738747453 315
305 iso_pu_bacteria 2738543032 2739356735 315
306 iso_pu_bacteria 2885318864 2885320794 315
307 iso_pu_bacteria 2888337043 2888338313 315
308 3300003775 Ga0055524_1000435 Ga0055524_100043510 316
309 3300003790 Ga0055528_1000033 Ga0055528_100003310 316
310 3300005440 Ga0070705_100109820 Ga0070705_1001098202 316
311 3300005545 Ga0070695_100091171 Ga0070695_1000911712 316
312 3300005548 Ga0070665_100026701 Ga0070665_1000267017 316
313 3300005719 Ga0068861_100364620 Ga0068861_1003646201 316
314 3300025273 Ga0209673_1000157 Ga0209673_100015710 316
315 3300025295 Ga0209564_1000237 Ga0209564_100023710 316
316 3300025299 Ga0209256_1000185 Ga0209256_100018510 316
317 3300026067 Ga0207678_10111326 Ga0207678_101113262 316
318 3300028379 Ga0268266_10090419 Ga0268266_100904192 316
319 3300031241 Ga0265325_10054261 Ga0265325_100542613 316
320 3300031711 Ga0265314_10042680 Ga0265314_100426803 316
321 3300046529 Ga0495652_0369195 Ga0495652_0369195_54_1004 316
322 3300050511 nmdc:mga08y16_612482_c1 nmdc:mga08y16_612482_c1_128_1081 316
323 3300050512 nmdc:mga0n895_224463_c1 nmdc:mga0n895_224463_c1_231_1214 316
324 iso_pu_bacteria 2713897090 2715500560 316
325 iso_pu_bacteria 2856314179 2856318173 316
326 iso_pu_bacteria 2906414383 2906418210 316
327 iso_pu_bacteria 2961170736 2961175841 316
328 iso_pu_bacteria 2970503327 2970508506 316
329 iso_pu_bacteria 2979808191 2979811845 316
330 3300005334 Ga0068869_100143106 Ga0068869_1001431063 317
331 3300005337 Ga0070682_100088567 Ga0070682_1000885673 317
332 3300005338 Ga0068868_100037635 Ga0068868_1000376353 317
333 3300005339 Ga0070660_100131859 Ga0070660_1001318591 317
334 3300005340 Ga0070689_100176001 Ga0070689_1001760013 317
335 3300005345 Ga0070692_10038866 Ga0070692_100388662 317
336 3300005356 Ga0070674_100048660 Ga0070674_1000486603 317
337 3300005364 Ga0070673_100044693 Ga0070673_1000446934 317
338 3300005438 Ga0070701_10162829 Ga0070701_101628292 317
339 3300005441 Ga0070700_100027128 Ga0070700_1000271284 317
340 3300005456 Ga0070678_100525533 Ga0070678_1005255331 317
341 3300005459 Ga0068867_100016190 Ga0068867_1000161903 317
342 3300005459 Ga0068867_100113901 Ga0068867_1001139013 317
343 3300005535 Ga0070684_100229585 Ga0070684_1002295852 317
344 3300005539 Ga0068853_100401731 Ga0068853_1004017311 317
345 3300005543 Ga0070672_100151621 Ga0070672_1001516211 317
346 3300005544 Ga0070686_100075392 Ga0070686_1000753923 317
347 3300005548 Ga0070665_100441668 Ga0070665_1004416681 317
348 3300005563 Ga0068855_100465137 Ga0068855_1004651373 317
349 3300005564 Ga0070664_100120215 Ga0070664_1001202152 317
350 3300005578 Ga0068854_100021398 Ga0068854_1000213982 317
351 3300005615 Ga0070702_100093894 Ga0070702_1000938942 317
352 3300005718 Ga0068866_10027915 Ga0068866_100279152 317
353 3300005719 Ga0068861_100189179 Ga0068861_1001891792 317
354 3300005840 Ga0068870_10018860 Ga0068870_100188602 317
355 3300005841 Ga0068863_100214375 Ga0068863_1002143752 317
356 3300005844 Ga0068862_100284438 Ga0068862_1002844381 317
357 3300006028 Ga0070717_10016310 Ga0070717_100163102 317
358 3300006163 Ga0070715_10001875 Ga0070715_100018751 317
359 3300006871 Ga0075434_100045576 Ga0075434_1000455763 317
360 3300009011 Ga0105251_10031021 Ga0105251_100310212 317
361 3300009094 Ga0111539_10148301 Ga0111539_101483011 317
362 3300009553 Ga0105249_10311215 Ga0105249_103112152 317
363 3300025321 Ga0207656_10032864 Ga0207656_100328641 317
364 3300025898 Ga0207692_10151304 Ga0207692_101513041 317
365 3300025901 Ga0207688_10002122 Ga0207688_100021229 317
366 3300025907 Ga0207645_10066685 Ga0207645_100666852 317
367 3300025908 Ga0207643_10045427 Ga0207643_100454272 317
368 3300025914 Ga0207671_10174406 Ga0207671_101744062 317
369 3300025915 Ga0207693_10021771 Ga0207693_100217712 317
370 3300025916 Ga0207663_10045565 Ga0207663_100455652 317
371 3300025919 Ga0207657_10030427 Ga0207657_100304272 317
372 3300025920 Ga0207649_10118222 Ga0207649_101182222 317
373 3300025926 Ga0207659_10038536 Ga0207659_100385363 317
374 3300025927 Ga0207687_10084687 Ga0207687_100846872 317
375 3300025928 Ga0207700_10111361 Ga0207700_101113612 317
376 3300025929 Ga0207664_10085522 Ga0207664_100855223 317
377 3300025931 Ga0207644_10350477 Ga0207644_103504771 317
378 3300025933 Ga0207706_10093359 Ga0207706_100933593 317
379 3300025935 Ga0207709_10005103 Ga0207709_100051033 317
380 3300025936 Ga0207670_10406824 Ga0207670_104068241 317
381 3300025939 Ga0207665_10018857 Ga0207665_100188573 317
382 3300025940 Ga0207691_10101354 Ga0207691_101013542 317
383 3300025960 Ga0207651_10181570 Ga0207651_101815702 317
384 3300025961 Ga0207712_10126412 Ga0207712_101264122 317
385 3300026075 Ga0207708_10005145 Ga0207708_100051458 317
386 3300026088 Ga0207641_10250705 Ga0207641_102507051 317
387 3300026089 Ga0207648_10001736 Ga0207648_1000173617 317
388 3300026089 Ga0207648_10216150 Ga0207648_102161502 317
389 3300026118 Ga0207675_100009348 Ga0207675_1000093483 317
390 3300026121 Ga0207683_10225670 Ga0207683_102256701 317
391 3300031711 Ga0265314_10084309 Ga0265314_100843091 317
392 3300039062 Ga0400483_150203 Ga0400483_150203_491_1462 317
393 3300039447 Ga0436361_0841184 Ga0436361_0841184_852_1805 317
394 3300042461 Ga0439460_0057258 Ga0439460_0057258_201_1154 317
395 3300046533 Ga0495640_0130390 Ga0495640_0130390_420_1385 317
396 3300048905 Ga0496102_0222394 Ga0496102_0222394_648_1631 317
397 3300048906 Ga0496103_0170466 Ga0496103_0170466_64_1047 317
398 3300048910 Ga0496107_0018433 Ga0496107_0018433_483_1466 317
399 3300048916 Ga0496113_0176816 Ga0496113_0176816_546_1499 317
400 3300048917 Ga0496114_0122586 Ga0496114_0122586_27_980 317
401 3300048918 Ga0496115_0222208 Ga0496115_0222208_424_1407 317
402 3300048923 Ga0496120_0058289 Ga0496120_0058289_910_1863 317
403 3300048925 Ga0496122_0198344 Ga0496122_0198344_202_1155 317
404 3300049586 Ga0501070_0299565 Ga0501070_0299565_90_1046 317
405 3300050495 nmdc:mga04h51_121517_c1 nmdc:mga04h51_121517_c1_10_963 317
406 3300050512 nmdc:mga0n895_235723_c1 nmdc:mga0n895_235723_c1_22_1005 317
407 3300050512 nmdc:mga0n895_69727_c1 nmdc:mga0n895_69727_c1_2370_3353 317
408 3300053086 Ga0500578_0038804 Ga0500578_0038804_117_1073 317
409 iso_pu_bacteria 2842694124 2842696667 317
410 iso_pu_bacteria 2958071322 2958073779 317
411 3300005436 Ga0070713_100376483 Ga0070713_1003764832 318
412 3300025944 Ga0207661_10176323 Ga0207661_101763232 318
413 3300046558 Ga0495633_0165699 Ga0495633_0165699_15_971 318
414 3300048910 Ga0496107_0268179 Ga0496107_0268179_178_1182 318
415 3300048929 Ga0496126_0033060 Ga0496126_0033060_2587_3630 318
416 3300049579 Ga0501043_0171778 Ga0501043_0171778_588_1547 318
417 3300050493 nmdc:mga0k408_198452_c1 nmdc:mga0k408_198452_c1_22_978 318
418 3300053146 Ga0500588_0015558 Ga0500588_0015558_506_1471 318
419 3300060353 Ga0501082_0035666 Ga0501082_0035666_2036_2995 318
420 iso_pu_bacteria 2513237090 2513608658 318
421 iso_pu_bacteria 2599185301 2599936414 318
422 iso_pu_bacteria 2643221551 2643774456 318
423 iso_pu_bacteria 2643221555 2643792901 318
424 iso_pu_bacteria 2693429783 2694628704 318
425 iso_pu_bacteria 2693429784 2694637382 318
426 iso_pu_bacteria 2847686936 2847691116 318
427 iso_pu_bacteria 2856314179 2856320747 318
428 iso_pu_bacteria 2856356410 2856356769 318
429 iso_pu_bacteria 2869285874 2869290327 318
430 iso_pu_bacteria 2871429161 2871432611 318
431 iso_pu_bacteria 2871444079 2871444628 318
432 iso_pu_bacteria 2874102143 2874109133 318
433 iso_pu_bacteria 2874146452 2874152578 318
434 iso_pu_bacteria 2874155637 2874159978 318
435 iso_pu_bacteria 2876369609 2876375749 318
436 iso_pu_bacteria 2876377896 2876385901 318
437 iso_pu_bacteria 2876392853 2876398014 318
438 iso_pu_bacteria 2876413966 2876418494 318
439 iso_pu_bacteria 2878035449 2878035919 318
440 iso_pu_bacteria 2878745973 2878750225 318
441 iso_pu_bacteria 2881147464 2881149912 318
442 iso_pu_bacteria 2881161766 2881166793 318
443 iso_pu_bacteria 2885305155 2885308309 318
444 iso_pu_bacteria 2885326080 2885330834 318
445 iso_pu_bacteria 2885334103 2885342483 318
446 iso_pu_bacteria 2888350351 2888355150 318
447 iso_pu_bacteria 2889010040 2889010129 318
448 iso_pu_bacteria 2903492973 2903504443 318
449 iso_pu_bacteria 2904659560 2904664665 318
450 iso_pu_bacteria 2906308376 2906312583 318
451 iso_pu_bacteria 2906321335 2906325292 318
452 iso_pu_bacteria 2906328253 2906330690 318
453 iso_pu_bacteria 2906354277 2906362971 318
454 iso_pu_bacteria 2906414383 2906419804 318
455 iso_pu_bacteria 2922130491 2922134244 318
456 iso_pu_bacteria 2922158528 2922158899 318
457 iso_pu_bacteria 2924726620 2924731695 318
458 iso_pu_bacteria 2937813078 2937819272 318
459 iso_pu_bacteria 2937848649 2937852010 318
460 iso_pu_bacteria 2937891427 2937895244 318
461 iso_pu_bacteria 2958041894 2958044485 318
462 iso_pu_bacteria 2958115193 2958115506 318
463 iso_pu_bacteria 2958130278 2958134715 318
464 iso_pu_bacteria 2958179912 2958186530 318
465 iso_pu_bacteria 2961077736 2961085029 318
466 iso_pu_bacteria 2961114664 2961119663 318
467 iso_pu_bacteria 2965062239 2965069187 318
468 iso_pu_bacteria 2968091066 2968094764 318
469 iso_pu_bacteria 2968097103 2968099325 318
470 iso_pu_bacteria 2968110612 2968115918 318
471 iso_pu_bacteria 2968128360 2968133666 318
472 iso_pu_bacteria 2977843712 2977848371 318
473 iso_pu_bacteria 2977858184 2977863332 318
474 iso_pu_bacteria 2977922695 2977922975 318
475 iso_pu_bacteria 2977942078 2977944743 318
476 iso_pu_bacteria 2977971508 2977976047 318
477 iso_pu_bacteria 2977986579 2977990132 318
478 iso_pu_bacteria 2979742915 2979750661 318
479 iso_pu_bacteria 2979779861 2979785313 318
480 iso_pu_bacteria 2996341866 2996344260 318
481 iso_pu_bacteria 3000135777 3000139620 318
482 iso_pu_bacteria 3004167301 3004167649 318
483 iso_pu_bacteria 8004387939 8004392533 318
484 iso_pu_bacteria 8004445564 8004446520 318
485 iso_pu_bacteria 8004640170 8004645135 318
486 iso_pu_bacteria 8004703790 8004712062 318
487 iso_pu_bacteria 8004714634 8004718842 318
488 3300003187 JGI25151J46595_10000069 JGI25151J46595_100000697 319
489 3300005330 Ga0070690_100000472 Ga0070690_10000047218 319
490 3300005338 Ga0068868_100000209 Ga0068868_10000020918 319
491 3300005343 Ga0070687_100000190 Ga0070687_10000019010 319
492 3300005456 Ga0070678_100230417 Ga0070678_1002304172 319
493 3300005530 Ga0070679_100002529 Ga0070679_10000252911 319
494 3300005544 Ga0070686_100000825 Ga0070686_1000008259 319
495 3300005545 Ga0070695_100000457 Ga0070695_10000045711 319
496 3300009098 Ga0105245_10000115 Ga0105245_1000011523 319
497 3300009177 Ga0105248_10243132 Ga0105248_102431322 319
498 3300010375 Ga0105239_10163319 Ga0105239_101633192 319
499 3300011119 Ga0105246_10316084 Ga0105246_103160841 319
500 3300013297 Ga0157378_10001030 Ga0157378_1000103014 319
501 3300013306 Ga0163162_10112611 Ga0163162_101126113 319
502 3300014968 Ga0157379_10098205 Ga0157379_100982052 319
503 3300014969 Ga0157376_10002960 Ga0157376_100029603 319
504 3300025294 Ga0209025_1000008 Ga0209025_100000871 319
505 3300025929 Ga0207664_10125164 Ga0207664_101251642 319
506 3300035410 Ga0373924_0031279 Ga0373924_0031279_45_1052 319
507 3300035695 Ga0373927_0021393 Ga0373927_0021393_3021_4028 319
508 3300039437 Ga0436365_0536235 Ga0436365_0536235_1896_2858 319
509 3300044706 Ga0466964_0043964 Ga0466964_0043964_411_1379 319
510 3300045976 Ga0466967_0039921 Ga0466967_0039921_2565_3533 319
511 3300046615 Ga0495656_0009753 Ga0495656_0009753_322_1311 319
512 3300046674 Ga0495588_0116141 Ga0495588_0116141_217_1224 319
513 3300048928 Ga0496125_0142009 Ga0496125_0142009_413_1396 319
514 3300048929 Ga0496126_0084838 Ga0496126_0084838_119_1102 319
515 3300049571 Ga0501034_0240878 Ga0501034_0240878_489_1454 319
516 3300049579 Ga0501043_0274914 Ga0501043_0274914_110_1093 319
517 3300049593 Ga0501077_0052209 Ga0501077_0052209_548_1516 319
518 3300049822 Ga0501035_0150290 Ga0501035_0150290_186_1151 319
519 3300049823 Ga0501044_0126626 Ga0501044_0126626_449_1414 319
520 3300050514 nmdc:mga08x19_1409_c1 nmdc:mga08x19_1409_c1_10325_11317 319
521 3300060353 Ga0501082_0151312 Ga0501082_0151312_133_1140 319
522 iso_pu_bacteria 2503198000 2503199986 319
523 iso_pu_bacteria 2508501123 2509118500 319
524 iso_pu_bacteria 2508501127 2509142564 319
525 iso_pu_bacteria 2509276018 2509369549 319
526 iso_pu_bacteria 2510065059 2510319279 319
527 iso_pu_bacteria 2512875016 2512932546 319
528 iso_pu_bacteria 2512875024 2512960563 319
529 iso_pu_bacteria 2513237164 2514036347 319
530 iso_pu_bacteria 2513237305 2514416472 319
531 iso_pu_bacteria 2588253730 2588518621 319
532 iso_pu_bacteria 2597489875 2597812152 319
533 iso_pu_bacteria 2643221595 2643984853 319
534 iso_pu_bacteria 2643221627 2644153183 319
535 iso_pu_bacteria 2687453392 2688597232 319
536 iso_pu_bacteria 2721755686 2723574437 319
537 iso_pu_bacteria 2756170246 2756671523 319
538 iso_pu_bacteria 2791355123 2792747980 319
539 iso_pu_bacteria 2828305725 2828308520 319
540 iso_pu_bacteria 2841734538 2841738145 319
541 iso_pu_bacteria 2844002411 2844008566 319
542 iso_pu_bacteria 2844009547 2844012613 319
543 iso_pu_bacteria 2856320880 2856323093 319
544 iso_pu_bacteria 2856328259 2856334853 319
545 iso_pu_bacteria 2856334872 2856341596 319
546 iso_pu_bacteria 2856342000 2856347362 319
547 iso_pu_bacteria 2857367948 2857373943 319
548 iso_pu_bacteria 2869234852 2869237041 319
549 iso_pu_bacteria 2869249662 2869251573 319
550 iso_pu_bacteria 2869256925 2869260108 319
551 iso_pu_bacteria 2869264136 2869271081 319
552 iso_pu_bacteria 2869271264 2869277761 319
553 iso_pu_bacteria 2869278585 2869282644 319
554 iso_pu_bacteria 2871451962 2871453796 319
555 iso_pu_bacteria 2871459585 2871461229 319
556 iso_pu_bacteria 2871466892 2871469077 319
557 iso_pu_bacteria 2871474448 2871480148 319
558 iso_pu_bacteria 2871488783 2871493229 319
559 iso_pu_bacteria 2874109183 2874116408 319
560 iso_pu_bacteria 2874116593 2874122777 319
561 iso_pu_bacteria 2874139085 2874142301 319
562 iso_pu_bacteria 2874162495 2874167969 319
563 iso_pu_bacteria 2874168670 2874174796 319
564 iso_pu_bacteria 2876363079 2876365202 319
565 iso_pu_bacteria 2876386047 2876387917 319
566 iso_pu_bacteria 2876399893 2876402848 319
567 iso_pu_bacteria 2876406927 2876410514 319
568 iso_pu_bacteria 2876420981 2876422967 319
569 iso_pu_bacteria 2878738818 2878744516 319
570 iso_pu_bacteria 2878753008 2878757274 319
571 iso_pu_bacteria 2878774303 2878774958 319
572 iso_pu_bacteria 2881845957 2881849434 319
573 iso_pu_bacteria 2881861095 2881866324 319
574 iso_pu_bacteria 2882632389 2882632553 319
575 iso_pu_bacteria 2882912400 2882916294 319
576 iso_pu_bacteria 2885312484 2885312898 319
577 iso_pu_bacteria 2885318864 2885320518 319
578 iso_pu_bacteria 2888343758 2888345919 319
579 iso_pu_bacteria 2889016732 2889018200 319
580 iso_pu_bacteria 2903448605 2903450202 319
581 iso_pu_bacteria 2903492973 2903501001 319
582 iso_pu_bacteria 2903521522 2903522063 319
583 iso_pu_bacteria 2903528002 2903528441 319
584 iso_pu_bacteria 2906363423 2906367031 319
585 iso_pu_bacteria 2906370794 2906376949 319
586 iso_pu_bacteria 2906386501 2906388706 319
587 iso_pu_bacteria 2906393657 2906398172 319
588 iso_pu_bacteria 2906401398 2906403230 319
589 iso_pu_bacteria 2906408224 2906411344 319
590 iso_pu_bacteria 2922151315 2922155915 319
591 iso_pu_bacteria 2922172374 2922177612 319
592 iso_pu_bacteria 2924733363 2924737885 319
593 iso_pu_bacteria 2924741084 2924744877 319
594 iso_pu_bacteria 2924748358 2924749718 319
595 iso_pu_bacteria 2924754689 2924756982 319
596 iso_pu_bacteria 2924776078 2924782546 319
597 iso_pu_bacteria 2924784321 2924786579 319
598 iso_pu_bacteria 2937836603 2937842623 319
599 iso_pu_bacteria 2937861824 2937862670 319
600 iso_pu_bacteria 2937868953 2937869622 319
601 iso_pu_bacteria 2937877337 2937881188 319
602 iso_pu_bacteria 2937972304 2937977279 319
603 iso_pu_bacteria 2937980651 2937985520 319
604 iso_pu_bacteria 2958034702 2958039427 319
605 iso_pu_bacteria 2958041894 2958052944 319
606 iso_pu_bacteria 2958064165 2958064935 319
607 iso_pu_bacteria 2958084443 2958088255 319
608 iso_pu_bacteria 2958092219 2958095206 319
609 iso_pu_bacteria 2958100919 2958102161 319
610 iso_pu_bacteria 2958108152 2958109801 319
611 iso_pu_bacteria 2958122699 2958129811 319
612 iso_pu_bacteria 2958137437 2958141420 319
613 iso_pu_bacteria 2958144490 2958147691 319
614 iso_pu_bacteria 2958158011 2958158860 319
615 iso_pu_bacteria 2958172287 2958175241 319
616 iso_pu_bacteria 2961136820 2961139807 319
617 iso_pu_bacteria 2961170736 2961175397 319
618 iso_pu_bacteria 2961183825 2961184379 319
619 iso_pu_bacteria 2963644680 2963646657 319
620 iso_pu_bacteria 2965025482 2965027608 319
621 iso_pu_bacteria 2965040258 2965043317 319
622 iso_pu_bacteria 2965089291 2965093491 319
623 iso_pu_bacteria 2965119406 2965126589 319
624 iso_pu_bacteria 2967996073 2967999601 319
625 iso_pu_bacteria 2968003550 2968007959 319
626 iso_pu_bacteria 2968016561 2968020754 319
627 iso_pu_bacteria 2968083720 2968090550 319
628 iso_pu_bacteria 2968138860 2968146538 319
629 iso_pu_bacteria 2970469710 2970474051 319
630 iso_pu_bacteria 2970489779 2970490691 319
631 iso_pu_bacteria 2970503327 2970507985 319
632 iso_pu_bacteria 2970510686 2970515310 319
633 iso_pu_bacteria 2970524798 2970527371 319
634 iso_pu_bacteria 2970532167 2970534296 319
635 iso_pu_bacteria 2970540015 2970543926 319
636 iso_pu_bacteria 2970547951 2970552309 319
637 iso_pu_bacteria 2970593180 2970597253 319
638 iso_pu_bacteria 2970627176 2970632719 319
639 iso_pu_bacteria 2977821940 2977826433 319
640 iso_pu_bacteria 2977851361 2977855583 319
641 iso_pu_bacteria 2977872689 2977880125 319
642 iso_pu_bacteria 2977935797 2977940318 319
643 iso_pu_bacteria 2979764755 2979766351 319
644 iso_pu_bacteria 2979808191 2979813169 319
645 iso_pu_bacteria 2987645492 2987647975 319
646 iso_pu_bacteria 2987673487 2987675409 319
647 iso_pu_bacteria 2996348954 2996352629 319
648 iso_pu_bacteria 2996386984 2996390017 319
649 iso_pu_bacteria 3004195979 3004199814 319
650 iso_pu_bacteria 3004211236 3004218052 319
651 iso_pu_bacteria 3004218560 3004220901 319
652 iso_pu_bacteria 3004232784 3004235697 319
653 iso_pu_bacteria 3004248173 3004253825 319
654 iso_pu_bacteria 3004268573 3004273909 319
655 iso_pu_bacteria 3004275668 3004279311 319
656 iso_pu_bacteria 637000159 637075640 319
657 iso_pu_bacteria 649633066 649871786 319
658 iso_pu_bacteria 8004312739 8004321187 319
659 iso_pu_bacteria 8004361976 8004363741 319
660 iso_pu_bacteria 8004374579 8004378849 319
661 iso_pu_bacteria 8004395343 8004397991 319
662 iso_pu_bacteria 8004695233 8004700437 319
663 iso_pu_bacteria 8004727605 8004729761 319
664 iso_pu_bacteria 8055617313 8055619465 319
665 3300003762 Ga0055542_1000761 Ga0055542_10007618 320
666 3300003763 Ga0055529_1001880 Ga0055529_10018805 320
667 3300006038 Ga0075365_10090389 Ga0075365_100903891 320
668 3300006038 Ga0075365_10289032 Ga0075365_102890321 320
669 3300025254 Ga0209148_1000080 Ga0209148_1000080123 320
670 3300025272 Ga0209455_1000171 Ga0209455_100017132 320
671 3300025913 Ga0207695_10051716 Ga0207695_100517162 320
672 3300028379 Ga0268266_10002242 Ga0268266_100022425 320
673 3300035113 Ga0373936_0004827 Ga0373936_0004827_3617_4612 320
674 3300035118 Ga0373954_0001191 Ga0373954_0001191_788_1783 320
675 3300035120 Ga0373957_0014910 Ga0373957_0014910_950_1945 320
676 3300035171 Ga0373946_0007686 Ga0373946_0007686_2870_3865 320
677 3300035172 Ga0373955_0000211 Ga0373955_0000211_1210_2205 320
678 3300035410 Ga0373924_0005832 Ga0373924_0005832_2901_3896 320
679 3300035695 Ga0373927_0011842 Ga0373927_0011842_1169_2164 320
680 3300035724 Ga0373933_0004328 Ga0373933_0004328_5940_6935 320
681 3300036401 Ga0373937_0000009 Ga0373937_0000009_46639_47634 320
682 3300037068 Ga0373925_0000194 Ga0373925_0000194_64564_65559 320
683 3300039438 Ga0436360_0436684 Ga0436360_0436684_59_1039 320
684 3300039447 Ga0436361_0472526 Ga0436361_0472526_2318_3298 320
685 3300044712 Ga0453684_0228680 Ga0453684_0228680_309_1304 320
686 3300045051 Ga0451576_0000220 Ga0451576_0000220_17150_18145 320
687 3300046454 Ga0495592_0000422 Ga0495592_0000422_15420_16415 320
688 3300046463 Ga0495653_0000032 Ga0495653_0000032_15840_16835 320
689 3300046477 Ga0495664_0000010 Ga0495664_0000010_220877_221872 320
690 3300046507 Ga0495606_0046520 Ga0495606_0046520_343_1329 320
691 3300046511 Ga0495608_0000008 Ga0495608_0000008_46777_47772 320
692 3300046514 Ga0495618_0000002 Ga0495618_0000002_223150_224145 320
693 3300046516 Ga0495628_0000009 Ga0495628_0000009_220905_221900 320
694 3300046517 Ga0495630_0002397 Ga0495630_0002397_7141_8136 320
695 3300046529 Ga0495652_0000011 Ga0495652_0000011_46467_47462 320
696 3300046533 Ga0495640_0000094 Ga0495640_0000094_46467_47462 320
697 3300046536 Ga0495587_0000086 Ga0495587_0000086_24568_25563 320
698 3300046543 Ga0495645_0000010 Ga0495645_0000010_15840_16835 320
699 3300046559 Ga0495667_0000005 Ga0495667_0000005_220905_221900 320
700 3300046642 Ga0495634_0000223 Ga0495634_0000223_2109_3104 320
701 3300046663 Ga0495635_0000008 Ga0495635_0000008_46450_47445 320
702 3300046675 Ga0495657_0000058 Ga0495657_0000058_1203_2198 320
703 3300046678 Ga0495599_0000007 Ga0495599_0000007_46467_47462 320
704 3300046679 Ga0495623_0000085 Ga0495623_0000085_41977_42972 320
705 3300046680 Ga0495646_0000021 Ga0495646_0000021_46422_47417 320
706 3300046689 Ga0495613_0020157 Ga0495613_0020157_2050_3045 320
707 3300046690 Ga0495624_0023846 Ga0495624_0023846_2428_3423 320
708 3300046809 Ga0495600_0000001 Ga0495600_0000001_46467_47462 320
709 3300047317 Ga0495604_0000012 Ga0495604_0000012_220892_221887 320
710 3300047319 Ga0495674_0000011 Ga0495674_0000011_223178_224173 320
711 3300047322 Ga0495680_0000245 Ga0495680_0000245_24596_25591 320
712 3300047444 Ga0495675_0002083 Ga0495675_0002083_4897_5892 320
713 3300047471 Ga0495684_0000084 Ga0495684_0000084_48766_49761 320
714 3300047673 Ga0495593_0000733 Ga0495593_0000733_2065_3060 320
715 3300048088 Ga0495602_0000073 Ga0495602_0000073_46450_47445 320
716 3300048908 Ga0496105_0010080 Ga0496105_0010080_1070_2074 320
717 3300053077 Ga0495601_0000009 Ga0495601_0000009_46450_47445 320
718 3300053078 Ga0495612_0000019 Ga0495612_0000019_90383_91378 320
719 3300053084 Ga0495595_0000015 Ga0495595_0000015_27705_28700 320
720 3300053085 Ga0495619_0000012 Ga0495619_0000012_46450_47445 320
721 3300053119 Ga0500595_018777 Ga0500595_018777_815_1789 320
722 3300053156 Ga0500622_0135580 Ga0500622_0135580_138_1136 320
723 iso_pu_bacteria 2509276022 2509394898 320
724 iso_pu_bacteria 2643221734 2644737110 320
725 iso_pu_bacteria 2818991467 2819720012 320
726 iso_pu_bacteria 2869162929 2869163814 320
727 iso_pu_bacteria 2924762789 2924768133 320
728 iso_pu_bacteria 2937822353 2937827824 320
729 iso_pu_bacteria 2987666974 2987671445 320
730 iso_pu_bacteria 3004334049 3004335746 320
731 3300002459 JGI24751J29686_10007661 JGI24751J29686_100076613 321
732 3300005327 Ga0070658_10040997 Ga0070658_100409973 321
733 3300005328 Ga0070676_10071503 Ga0070676_100715033 321
734 3300005331 Ga0070670_100079159 Ga0070670_1000791593 321
735 3300005334 Ga0068869_100010254 Ga0068869_1000102543 321
736 3300005335 Ga0070666_10210667 Ga0070666_102106671 321
737 3300005336 Ga0070680_100006080 Ga0070680_1000060802 321
738 3300005336 Ga0070680_100020901 Ga0070680_1000209012 321
739 3300005337 Ga0070682_100003001 Ga0070682_1000030012 321
740 3300005338 Ga0068868_100110568 Ga0068868_1001105682 321
741 3300005340 Ga0070689_100000614 Ga0070689_10000061417 321
742 3300005341 Ga0070691_10035309 Ga0070691_100353093 321
743 3300005343 Ga0070687_100099886 Ga0070687_1000998862 321
744 3300005344 Ga0070661_100054046 Ga0070661_1000540464 321
745 3300005345 Ga0070692_10006738 Ga0070692_100067389 321
746 3300005354 Ga0070675_100002866 Ga0070675_10000286610 321
747 3300005355 Ga0070671_100094543 Ga0070671_1000945433 321
748 3300005365 Ga0070688_100168955 Ga0070688_1001689551 321
749 3300005366 Ga0070659_100119241 Ga0070659_1001192412 321
750 3300005440 Ga0070705_100000320 Ga0070705_10000032012 321
751 3300005441 Ga0070700_100000571 Ga0070700_10000057110 321
752 3300005455 Ga0070663_100010835 Ga0070663_1000108353 321
753 3300005456 Ga0070678_100003166 Ga0070678_1000031664 321
754 3300005459 Ga0068867_100080280 Ga0068867_1000802802 321
755 3300005466 Ga0070685_10067945 Ga0070685_100679453 321
756 3300005530 Ga0070679_100103918 Ga0070679_1001039184 321
757 3300005539 Ga0068853_100160368 Ga0068853_1001603683 321
758 3300005543 Ga0070672_100049162 Ga0070672_1000491623 321
759 3300005546 Ga0070696_100005170 Ga0070696_1000051705 321
760 3300005547 Ga0070693_100060331 Ga0070693_1000603312 321
761 3300005549 Ga0070704_100008897 Ga0070704_1000088973 321
762 3300005563 Ga0068855_100629172 Ga0068855_1006291721 321
763 3300005578 Ga0068854_100069934 Ga0068854_1000699342 321
764 3300005614 Ga0068856_100386344 Ga0068856_1003863442 321
765 3300005615 Ga0070702_100000050 Ga0070702_10000005012 321
766 3300005615 Ga0070702_100003946 Ga0070702_1000039464 321
767 3300005616 Ga0068852_100016572 Ga0068852_1000165722 321
768 3300005618 Ga0068864_100038504 Ga0068864_1000385048 321
769 3300005719 Ga0068861_100148020 Ga0068861_1001480202 321
770 3300005834 Ga0068851_10006256 Ga0068851_100062563 321
771 3300005840 Ga0068870_10040967 Ga0068870_100409673 321
772 3300005841 Ga0068863_100040400 Ga0068863_1000404004 321
773 3300005842 Ga0068858_100031069 Ga0068858_10003106910 321
774 3300005843 Ga0068860_100088103 Ga0068860_1000881032 321
775 3300006237 Ga0097621_100113558 Ga0097621_1001135584 321
776 3300006844 Ga0075428_100159870 Ga0075428_1001598703 321
777 3300006871 Ga0075434_100001777 Ga0075434_10000177710 321
778 3300007076 Ga0075435_100008023 Ga0075435_1000080234 321
779 3300009011 Ga0105251_10065134 Ga0105251_100651342 321
780 3300009093 Ga0105240_10059935 Ga0105240_100599352 321
781 3300009093 Ga0105240_10259473 Ga0105240_102594732 321
782 3300009094 Ga0111539_10077044 Ga0111539_100770444 321
783 3300009098 Ga0105245_10007590 Ga0105245_100075904 321
784 3300009101 Ga0105247_10028530 Ga0105247_100285305 321
785 3300009148 Ga0105243_10001566 Ga0105243_1000156615 321
786 3300009174 Ga0105241_10033070 Ga0105241_100330701 321
787 3300009174 Ga0105241_10182951 Ga0105241_101829512 321
788 3300009177 Ga0105248_10047992 Ga0105248_100479923 321
789 3300009545 Ga0105237_10132128 Ga0105237_101321281 321
790 3300009545 Ga0105237_10199693 Ga0105237_101996932 321
791 3300009551 Ga0105238_10013423 Ga0105238_100134234 321
792 3300009551 Ga0105238_10088560 Ga0105238_100885602 321
793 3300009553 Ga0105249_10001995 Ga0105249_100019958 321
794 3300009553 Ga0105249_10548771 Ga0105249_105487711 321
795 3300010375 Ga0105239_10260239 Ga0105239_102602391 321
796 3300011119 Ga0105246_10003706 Ga0105246_1000370610 321
797 3300013102 Ga0157371_10274742 Ga0157371_102747421 321
798 3300013104 Ga0157370_10026364 Ga0157370_100263646 321
799 3300013104 Ga0157370_10216944 Ga0157370_102169441 321
800 3300013296 Ga0157374_10006468 Ga0157374_100064684 321
801 3300013307 Ga0157372_10171317 Ga0157372_101713172 321
802 3300013308 Ga0157375_10011994 Ga0157375_100119948 321
803 3300014745 Ga0157377_10008042 Ga0157377_100080424 321
804 3300014969 Ga0157376_10381377 Ga0157376_103813771 321
805 3300020070 Ga0206356_10632670 Ga0206356_106326701 321
806 3300020081 Ga0206354_10039477 Ga0206354_100394771 321
807 3300020082 Ga0206353_10339595 Ga0206353_103395952 321
808 3300020082 Ga0206353_10593657 Ga0206353_105936571 321
809 3300021384 Ga0213876_10000260 Ga0213876_1000026030 321
810 3300025321 Ga0207656_10014795 Ga0207656_100147953 321
811 3300025900 Ga0207710_10051552 Ga0207710_100515521 321
812 3300025901 Ga0207688_10000213 Ga0207688_1000021324 321
813 3300025904 Ga0207647_10086211 Ga0207647_100862111 321
814 3300025908 Ga0207643_10000218 Ga0207643_1000021817 321
815 3300025909 Ga0207705_10021988 Ga0207705_100219883 321
816 3300025912 Ga0207707_10069552 Ga0207707_100695524 321
817 3300025913 Ga0207695_10067364 Ga0207695_100673642 321
818 3300025916 Ga0207663_10072744 Ga0207663_100727442 321
819 3300025917 Ga0207660_10194260 Ga0207660_101942602 321
820 3300025918 Ga0207662_10140258 Ga0207662_101402582 321
821 3300025919 Ga0207657_10034378 Ga0207657_100343784 321
822 3300025920 Ga0207649_10007165 Ga0207649_1000716510 321
823 3300025921 Ga0207652_10029701 Ga0207652_100297017 321
824 3300025925 Ga0207650_10096013 Ga0207650_100960133 321
825 3300025926 Ga0207659_10083561 Ga0207659_100835614 321
826 3300025927 Ga0207687_10068045 Ga0207687_100680451 321
827 3300025931 Ga0207644_10020710 Ga0207644_100207103 321
828 3300025932 Ga0207690_10296031 Ga0207690_102960311 321
829 3300025940 Ga0207691_10035136 Ga0207691_100351363 321
830 3300025941 Ga0207711_10116460 Ga0207711_101164602 321
831 3300025942 Ga0207689_10000762 Ga0207689_1000076210 321
832 3300025945 Ga0207679_10005378 Ga0207679_100053781 321
833 3300025960 Ga0207651_10341819 Ga0207651_103418191 321
834 3300025981 Ga0207640_10225598 Ga0207640_102255982 321
835 3300025986 Ga0207658_10217649 Ga0207658_102176492 321
836 3300026023 Ga0207677_10004998 Ga0207677_100049983 321
837 3300026035 Ga0207703_10112645 Ga0207703_101126452 321
838 3300026067 Ga0207678_10000245 Ga0207678_1000024510 321
839 3300026078 Ga0207702_10006836 Ga0207702_100068365 321
840 3300026088 Ga0207641_10008353 Ga0207641_100083539 321
841 3300026118 Ga0207675_100206359 Ga0207675_1002063592 321
842 3300026121 Ga0207683_10000454 Ga0207683_1000045436 321
843 3300027907 Ga0207428_10007115 Ga0207428_100071155 321
844 3300028379 Ga0268266_10116611 Ga0268266_101166111 321
845 3300028381 Ga0268264_10054830 Ga0268264_100548306 321
846 3300035113 Ga0373936_0002485 Ga0373936_0002485_181_1173 321
847 3300035691 Ga0373931_0033418 Ga0373931_0033418_1461_2459 321
848 3300035691 Ga0373931_0084866 Ga0373931_0084866_717_1715 321
849 3300037312 Ga0395899_0033298 Ga0395899_0033298_30_1007 321
850 3300038443 Ga0395901_0316458 Ga0395901_0316458_634_1599 321
851 3300039437 Ga0436365_0836133 Ga0436365_0836133_26241_27212 321
852 3300042005 Ga0439448_0029587 Ga0439448_0029587_718_1683 321
853 3300042008 Ga0439450_021898 Ga0439450_021898_350_1315 321
854 3300042438 Ga0439459_0027578 Ga0439459_0027578_39_1004 321
855 3300045049 Ga0466959_0082126 Ga0466959_0082126_1290_2282 321
856 3300048903 Ga0496100_0061223 Ga0496100_0061223_1074_2039 321
857 3300048907 Ga0496104_0050423 Ga0496104_0050423_995_1960 321
858 3300048909 Ga0496106_0003648 Ga0496106_0003648_819_1784 321
859 3300048914 Ga0496111_0004377 Ga0496111_0004377_3610_4575 321
860 3300048916 Ga0496113_0127165 Ga0496113_0127165_36_1001 321
861 3300048917 Ga0496114_0271651 Ga0496114_0271651_312_1277 321
862 3300049582 Ga0501048_0224232 Ga0501048_0224232_82_1101 321
863 3300050511 nmdc:mga08y16_433948_c1 nmdc:mga08y16_433948_c1_141_1106 321
864 3300050512 nmdc:mga0n895_62149_c1 nmdc:mga0n895_62149_c1_350_1315 321
865 3300050513 nmdc:mga0rr50_3559_c1 nmdc:mga0rr50_3559_c1_4018_4983 321
866 3300050514 nmdc:mga08x19_289710_c1 nmdc:mga08x19_289710_c1_64_1029 321
867 3300053163 Ga0500639_093950 Ga0500639_093950_260_1252 321
868 3300060353 Ga0501082_0165803 Ga0501082_0165803_640_1638 321
869 iso_pu_bacteria 2507262055 2507508308 321
870 iso_pu_bacteria 2595698237 2596374991 321
871 iso_pu_bacteria 2643221547 2643758846 321
872 iso_pu_bacteria 2643221736 2644746177 321
873 iso_pu_bacteria 2841760612 2841766125 321
874 iso_pu_bacteria 2841911363 2841911480 321
875 iso_pu_bacteria 2841917233 2841917943 321
876 iso_pu_bacteria 2844104063 2844105891 321
877 iso_pu_bacteria 2848992105 2848998287 321
878 iso_pu_bacteria 2851182111 2851186390 321
879 iso_pu_bacteria 2851246043 2851246247 321
880 iso_pu_bacteria 2882456835 2882460273 321
881 iso_pu_bacteria 2889306138 2889311892 321
882 iso_pu_bacteria 2902330777 2902335036 321
883 iso_pu_bacteria 2902405164 2902411380 321
884 iso_pu_bacteria 2928125067 2928129914 321
885 iso_pu_bacteria 2932401849 2932402074 321
886 iso_pu_bacteria 2935769743 2935771781 321
887 iso_pu_bacteria 2935777560 2935778780 321
888 iso_pu_bacteria 8016603502 8016610231 321
889 iso_pu_bacteria 8016613128 8016614701 321
890 iso_pu_bacteria 8019538911 8019545142 321
891 iso_pu_bacteria 8019547302 8019553381 321
892 iso_pu_bacteria 8057529695 8057531527 321
893 3300001979 JGI24740J21852_10050296 JGI24740J21852_100502962 322
894 3300002705 JGI25156J39149_1004301 JGI25156J39149_10043013 322
895 3300002741 JGI25157J39369_1002383 JGI25157J39369_10023834 322
896 3300003214 JGI25165J46597_1000042 JGI25165J46597_1000042156 322
897 3300005336 Ga0070680_100020436 Ga0070680_1000204364 322
898 3300005341 Ga0070691_10073615 Ga0070691_100736152 322
899 3300005347 Ga0070668_100099546 Ga0070668_1000995463 322
900 3300005347 Ga0070668_100190190 Ga0070668_1001901902 322
901 3300005347 Ga0070668_100329184 Ga0070668_1003291842 322
902 3300005365 Ga0070688_100104138 Ga0070688_1001041381 322
903 3300005440 Ga0070705_100000101 Ga0070705_10000010123 322
904 3300005441 Ga0070700_100134966 Ga0070700_1001349662 322
905 3300005444 Ga0070694_100000321 Ga0070694_10000032124 322
906 3300005444 Ga0070694_100081356 Ga0070694_1000813562 322
907 3300005455 Ga0070663_100243504 Ga0070663_1002435042 322
908 3300005458 Ga0070681_10016232 Ga0070681_100162323 322
909 3300005468 Ga0070707_100234729 Ga0070707_1002347292 322
910 3300005518 Ga0070699_100000281 Ga0070699_10000028129 322
911 3300005530 Ga0070679_100215188 Ga0070679_1002151882 322
912 3300005536 Ga0070697_100003354 Ga0070697_1000033543 322
913 3300005539 Ga0068853_100014287 Ga0068853_1000142877 322
914 3300005545 Ga0070695_100000120 Ga0070695_10000012014 322
915 3300005546 Ga0070696_100000478 Ga0070696_10000047818 322
916 3300005547 Ga0070693_100064052 Ga0070693_1000640522 322
917 3300005548 Ga0070665_100491879 Ga0070665_1004918792 322
918 3300005549 Ga0070704_100002732 Ga0070704_1000027328 322
919 3300005577 Ga0068857_100006107 Ga0068857_1000061073 322
920 3300005577 Ga0068857_100092451 Ga0068857_1000924513 322
921 3300005617 Ga0068859_100006827 Ga0068859_1000068275 322
922 3300005719 Ga0068861_100112174 Ga0068861_1001121742 322
923 3300005842 Ga0068858_100105377 Ga0068858_1001053773 322
924 3300005843 Ga0068860_100000900 Ga0068860_10000090012 322
925 3300005844 Ga0068862_100001691 Ga0068862_10000169119 322
926 3300005844 Ga0068862_100062409 Ga0068862_1000624093 322
927 3300005937 Ga0081455_10000160 Ga0081455_1000016032 322
928 3300005983 Ga0081540_1000032 Ga0081540_100003288 322
929 3300006038 Ga0075365_10007299 Ga0075365_100072992 322
930 3300006038 Ga0075365_10027063 Ga0075365_100270632 322
931 3300006042 Ga0075368_10068508 Ga0075368_100685083 322
932 3300006051 Ga0075364_10014940 Ga0075364_100149404 322
933 3300006051 Ga0075364_10035025 Ga0075364_100350254 322
934 3300006178 Ga0075367_10022341 Ga0075367_100223414 322
935 3300006186 Ga0075369_10014037 Ga0075369_100140373 322
936 3300006844 Ga0075428_100020360 Ga0075428_1000203607 322
937 3300006844 Ga0075428_100227622 Ga0075428_1002276222 322
938 3300006844 Ga0075428_100259450 Ga0075428_1002594503 322
939 3300006846 Ga0075430_100001639 Ga0075430_10000163916 322
940 3300006846 Ga0075430_100087775 Ga0075430_1000877751 322
941 3300006846 Ga0075430_100312493 Ga0075430_1003124932 322
942 3300006847 Ga0075431_100003545 Ga0075431_10000354514 322
943 3300006847 Ga0075431_100005435 Ga0075431_1000054352 322
944 3300006847 Ga0075431_100064679 Ga0075431_1000646792 322
945 3300006847 Ga0075431_100084861 Ga0075431_1000848612 322
946 3300006847 Ga0075431_100092037 Ga0075431_1000920372 322
947 3300006847 Ga0075431_100146448 Ga0075431_1001464482 322
948 3300006871 Ga0075434_100000371 Ga0075434_10000037120 322
949 3300006871 Ga0075434_100023631 Ga0075434_1000236314 322
950 3300006880 Ga0075429_100053625 Ga0075429_1000536253 322
951 3300006914 Ga0075436_100168696 Ga0075436_1001686962 322
952 3300006931 Ga0097620_100006827 Ga0097620_1000068275 322
953 3300007076 Ga0075435_100130816 Ga0075435_1001308161 322
954 3300009092 Ga0105250_10058295 Ga0105250_100582952 322
955 3300009093 Ga0105240_10016012 Ga0105240_100160128 322
956 3300009093 Ga0105240_10211647 Ga0105240_102116473 322
957 3300009094 Ga0111539_10001777 Ga0111539_1000177715 322
958 3300009094 Ga0111539_10081452 Ga0111539_100814523 322
959 3300009147 Ga0114129_10028829 Ga0114129_100288296 322
960 3300009147 Ga0114129_10039454 Ga0114129_100394546 322
961 3300009147 Ga0114129_10295577 Ga0114129_102955773 322
962 3300009147 Ga0114129_10387854 Ga0114129_103878541 322
963 3300009148 Ga0105243_10058123 Ga0105243_100581232 322
964 3300009551 Ga0105238_10012662 Ga0105238_100126625 322
965 3300009551 Ga0105238_10309527 Ga0105238_103095272 322
966 3300009553 Ga0105249_10008449 Ga0105249_100084496 322
967 3300010375 Ga0105239_10157282 Ga0105239_101572822 322
968 3300010375 Ga0105239_10206328 Ga0105239_102063283 322
969 3300011119 Ga0105246_10024155 Ga0105246_100241553 322
970 3300013105 Ga0157369_10117120 Ga0157369_101171202 322
971 3300013308 Ga0157375_10125566 Ga0157375_101255664 322
972 3300014497 Ga0182008_10042480 Ga0182008_100424802 322
973 3300015261 Ga0182006_1014659 Ga0182006_10146593 322
974 3300025250 Ga0209026_1000029 Ga0209026_1000029180 322
975 3300025256 Ga0209759_1000040 Ga0209759_100004034 322
976 3300025261 Ga0209233_1000028 Ga0209233_1000028448 322
977 3300025297 Ga0209758_1020840 Ga0209758_10208403 322
978 3300025904 Ga0207647_10015916 Ga0207647_100159163 322
979 3300025912 Ga0207707_10065174 Ga0207707_100651743 322
980 3300025913 Ga0207695_10123834 Ga0207695_101238343 322
981 3300025913 Ga0207695_10428145 Ga0207695_104281451 322
982 3300025914 Ga0207671_10017102 Ga0207671_100171023 322
983 3300025917 Ga0207660_10001765 Ga0207660_100017656 322
984 3300025921 Ga0207652_10196331 Ga0207652_101963312 322
985 3300025922 Ga0207646_10245445 Ga0207646_102454451 322
986 3300025923 Ga0207681_10144849 Ga0207681_101448491 322
987 3300025936 Ga0207670_10279153 Ga0207670_102791532 322
988 3300025961 Ga0207712_10080583 Ga0207712_100805832 322
989 3300025972 Ga0207668_10059474 Ga0207668_100594743 322
990 3300026041 Ga0207639_10076759 Ga0207639_100767592 322
991 3300026067 Ga0207678_10133405 Ga0207678_101334052 322
992 3300026067 Ga0207678_10338031 Ga0207678_103380311 322
993 3300026075 Ga0207708_10177349 Ga0207708_101773492 322
994 3300026095 Ga0207676_10036284 Ga0207676_100362843 322
995 3300026116 Ga0207674_10001070 Ga0207674_1000107023 322
996 3300026116 Ga0207674_10022820 Ga0207674_100228205 322
997 3300026118 Ga0207675_100062369 Ga0207675_1000623692 322
998 3300026118 Ga0207675_100373408 Ga0207675_1003734081 322
999 3300027866 Ga0209813_10005127 Ga0209813_100051273 322
1000 3300027866 Ga0209813_10056536 Ga0209813_100565362 322
1001 3300027907 Ga0207428_10025045 Ga0207428_100250456 322
1002 3300027907 Ga0207428_10111880 Ga0207428_101118801 322
1003 3300028380 Ga0268265_10010310 Ga0268265_100103108 322
1004 3300028380 Ga0268265_10173588 Ga0268265_101735882 322
1005 3300028381 Ga0268264_10002112 Ga0268264_100021126 322
1006 3300035084 Ga0373928_0024966 Ga0373928_0024966_33_1007 322
1007 3300035091 Ga0373951_0005963 Ga0373951_0005963_463_1437 322
1008 3300035092 Ga0373952_0006162 Ga0373952_0006162_439_1413 322
1009 3300035112 Ga0373932_0013433 Ga0373932_0013433_389_1363 322
1010 3300035207 Ga0373942_0004211 Ga0373942_0004211_1830_2804 322
1011 3300035207 Ga0373942_0048976 Ga0373942_0048976_153_1127 322
1012 3300035241 Ga0373961_0002900 Ga0373961_0002900_3174_4148 322
1013 3300035242 Ga0373962_0005517 Ga0373962_0005517_320_1294 322
1014 3300035242 Ga0373962_0015800 Ga0373962_0015800_937_1911 322
1015 3300035691 Ga0373931_0000263 Ga0373931_0000263_12355_13329 322
1016 3300035691 Ga0373931_0005290 Ga0373931_0005290_4133_5107 322
1017 3300035695 Ga0373927_0000307 Ga0373927_0000307_8362_9339 322
1018 3300037068 Ga0373925_0003316 Ga0373925_0003316_6057_7034 322
1019 3300037471 Ga0395905_0072572 Ga0395905_0072572_541_1515 322
1020 3300038443 Ga0395901_0056175 Ga0395901_0056175_1049_2023 322
1021 3300038443 Ga0395901_0074592 Ga0395901_0074592_1112_2086 322
1022 3300045976 Ga0466967_0250502 Ga0466967_0250502_436_1410 322
1023 3300046462 Ga0495651_0214779 Ga0495651_0214779_192_1217 322
1024 3300046499 Ga0495594_0142096 Ga0495594_0142096_239_1213 322
1025 3300046616 Ga0495668_0019056 Ga0495668_0019056_1442_2416 322
1026 3300046664 Ga0495659_0049900 Ga0495659_0049900_355_1332 322
1027 3300046809 Ga0495600_0121927 Ga0495600_0121927_14_1039 322
1028 3300047319 Ga0495674_0342084 Ga0495674_0342084_162_1136 322
1029 3300048903 Ga0496100_0053486 Ga0496100_0053486_1618_2592 322
1030 3300048904 Ga0496101_0255239 Ga0496101_0255239_299_1273 322
1031 3300048905 Ga0496102_0000742 Ga0496102_0000742_5719_6693 322
1032 3300048906 Ga0496103_0043886 Ga0496103_0043886_171_1145 322
1033 3300048907 Ga0496104_0000530 Ga0496104_0000530_14941_15915 322
1034 3300048907 Ga0496104_0002241 Ga0496104_0002241_15608_16582 322
1035 3300048908 Ga0496105_0007602 Ga0496105_0007602_221_1195 322
1036 3300048909 Ga0496106_0001604 Ga0496106_0001604_7512_8486 322
1037 3300048910 Ga0496107_0005678 Ga0496107_0005678_5649_6623 322
1038 3300048911 Ga0496108_0020092 Ga0496108_0020092_3523_4497 322
1039 3300048911 Ga0496108_0099532 Ga0496108_0099532_1167_2141 322
1040 3300048912 Ga0496109_0109831 Ga0496109_0109831_912_1886 322
1041 3300048912 Ga0496109_0125347 Ga0496109_0125347_63_1037 322
1042 3300048913 Ga0496110_0001191 Ga0496110_0001191_582_1556 322
1043 3300048914 Ga0496111_0005434 Ga0496111_0005434_881_1855 322
1044 3300048915 Ga0496112_0167656 Ga0496112_0167656_438_1412 322
1045 3300048915 Ga0496112_0254516 Ga0496112_0254516_178_1152 322
1046 3300048916 Ga0496113_0096795 Ga0496113_0096795_935_1909 322
1047 3300048916 Ga0496113_0124169 Ga0496113_0124169_168_1142 322
1048 3300048918 Ga0496115_0031287 Ga0496115_0031287_149_1123 322
1049 3300048923 Ga0496120_0001370 Ga0496120_0001370_21574_22548 322
1050 3300048924 Ga0496121_0106282 Ga0496121_0106282_599_1573 322
1051 3300048929 Ga0496126_0038419 Ga0496126_0038419_2282_3256 322
1052 3300049570 Ga0501033_0252776 Ga0501033_0252776_203_1171 322
1053 3300049573 Ga0501037_0241800 Ga0501037_0241800_71_1039 322
1054 3300049575 Ga0501039_0094286 Ga0501039_0094286_1061_2047 322
1055 3300049582 Ga0501048_0245865 Ga0501048_0245865_50_1024 322
1056 3300049588 Ga0501072_0070380 Ga0501072_0070380_107_1081 322
1057 3300049589 Ga0501073_0097070 Ga0501073_0097070_227_1201 322
1058 3300049589 Ga0501073_0177116 Ga0501073_0177116_207_1175 322
1059 3300049591 Ga0501075_0149379 Ga0501075_0149379_772_1758 322
1060 3300049592 Ga0501076_0205327 Ga0501076_0205327_108_1094 322
1061 3300049592 Ga0501076_0234740 Ga0501076_0234740_318_1292 322
1062 3300049593 Ga0501077_0020579 Ga0501077_0020579_1407_2393 322
1063 3300049593 Ga0501077_0041605 Ga0501077_0041605_1923_2897 322
1064 3300049741 Ga0501079_0031480 Ga0501079_0031480_705_1691 322
1065 3300049741 Ga0501079_0044969 Ga0501079_0044969_1561_2535 322
1066 3300049741 Ga0501079_0053474 Ga0501079_0053474_1217_2191 322
1067 3300049742 Ga0501080_0185972 Ga0501080_0185972_30_1040 322
1068 3300049742 Ga0501080_0369493 Ga0501080_0369493_139_1107 322
1069 3300049743 Ga0501081_0011150 Ga0501081_0011150_3951_4925 322
1070 3300049743 Ga0501081_0019570 Ga0501081_0019570_805_1791 322
1071 3300049743 Ga0501081_0126740 Ga0501081_0126740_56_1030 322
1072 3300049744 Ga0501083_0139768 Ga0501083_0139768_383_1351 322
1073 3300049822 Ga0501035_0191598 Ga0501035_0191598_452_1426 322
1074 3300049823 Ga0501044_0357737 Ga0501044_0357737_228_1196 322
1075 3300050494 nmdc:mga06z11_10620_c1 nmdc:mga06z11_10620_c1_447_1421 322
1076 3300050494 nmdc:mga06z11_3201_c1 nmdc:mga06z11_3201_c1_1857_2831 322
1077 3300050495 nmdc:mga04h51_43502_c1 nmdc:mga04h51_43502_c1_185_1159 322
1078 3300050495 nmdc:mga04h51_788_c1 nmdc:mga04h51_788_c1_532_1506 322
1079 3300050507 nmdc:mga05p37_38333_c1 nmdc:mga05p37_38333_c1_2293_3267 322
1080 3300050507 nmdc:mga05p37_39554_c1 nmdc:mga05p37_39554_c1_4680_5654 322
1081 3300050508 nmdc:mga09592_35342_c1 nmdc:mga09592_35342_c1_2724_3698 322
1082 3300050508 nmdc:mga09592_37456_c1 nmdc:mga09592_37456_c1_2919_3893 322
1083 3300050508 nmdc:mga09592_452739_c1 nmdc:mga09592_452739_c1_82_1056 322
1084 3300050509 nmdc:mga0qj67_14879_c1 nmdc:mga0qj67_14879_c1_2551_3525 322
1085 3300050510 nmdc:mga06r32_183464_c1 nmdc:mga06r32_183464_c1_56_1030 322
1086 3300050510 nmdc:mga06r32_83027_c1 nmdc:mga06r32_83027_c1_1757_2731 322
1087 3300050511 nmdc:mga08y16_386179_c1 nmdc:mga08y16_386179_c1_63_1037 322
1088 3300050511 nmdc:mga08y16_459510_c1 nmdc:mga08y16_459510_c1_147_1157 322
1089 3300050512 nmdc:mga0n895_242670_c1 nmdc:mga0n895_242670_c1_756_1730 322
1090 3300050512 nmdc:mga0n895_5394_c1 nmdc:mga0n895_5394_c1_5578_6552 322
1091 3300050512 nmdc:mga0n895_65341_c1 nmdc:mga0n895_65341_c1_2050_3024 322
1092 3300050513 nmdc:mga0rr50_118925_c1 nmdc:mga0rr50_118925_c1_69_1043 322
1093 3300050515 nmdc:mga0a205_269868_c1 nmdc:mga0a205_269868_c1_82_1056 322
1094 3300050515 nmdc:mga0a205_292104_c1 nmdc:mga0a205_292104_c1_180_1154 322
1095 3300053119 Ga0500595_036703 Ga0500595_036703_315_1289 322
1096 3300053151 Ga0500604_0013376 Ga0500604_0013376_285_1259 322
1097 3300053155 Ga0500620_017284 Ga0500620_017284_526_1500 322
1098 3300053161 Ga0500634_0012475 Ga0500634_0012475_634_1653 322
1099 3300054114 Ga0501084_0018707 Ga0501084_0018707_4758_5756 322
1100 3300054114 Ga0501084_0039088 Ga0501084_0039088_2216_3202 322
1101 3300054114 Ga0501084_0046623 Ga0501084_0046623_13_987 322
1102 3300060353 Ga0501082_0038785 Ga0501082_0038785_1707_2681 322
1103 3300060353 Ga0501082_0253222 Ga0501082_0253222_413_1387 322
1104 3300060353 Ga0501082_0359360 Ga0501082_0359360_13_987 322
1105 3300061734 Ga0530510_0081230 Ga0530510_0081230_128_1102 322
1106 3300061734 Ga0530510_0176347 Ga0530510_0176347_108_1094 322
1107 3300061734 Ga0530510_0315916 Ga0530510_0315916_123_1097 322
1108 iso_pu_bacteria 2511231052 2511497567 322
1109 iso_pu_bacteria 2512047086 2512530009 322
1110 iso_pu_bacteria 2512875026 2512969748 322
1111 iso_pu_bacteria 2513237086 2513581830 322
1112 iso_pu_bacteria 2513237089 2513603096 322
1113 iso_pu_bacteria 2513237091 2513619286 322
1114 iso_pu_bacteria 2513237140 2513887190 322
1115 iso_pu_bacteria 2513237159 2513999346 322
1116 iso_pu_bacteria 2513237160 2514004533 322
1117 iso_pu_bacteria 2515154107 2515609856 322
1118 iso_pu_bacteria 2516143018 2516207744 322
1119 iso_pu_bacteria 2517487022 2517565373 322
1120 iso_pu_bacteria 2524023207 2524451439 322
1121 iso_pu_bacteria 2551306084 2551677229 322
1122 iso_pu_bacteria 2551306085 2551688381 322
1123 iso_pu_bacteria 2551306086 2551697038 322
1124 iso_pu_bacteria 2551306090 2551723128 322
1125 iso_pu_bacteria 2551306091 2551728089 322
1126 iso_pu_bacteria 2551306092 2551732558 322
1127 iso_pu_bacteria 2551306093 2551744798 322
1128 iso_pu_bacteria 2582581306 2585268513 322
1129 iso_pu_bacteria 2582581866 2585394053 322
1130 iso_pu_bacteria 2690316117 2692319277 322
1131 iso_pu_bacteria 2751185821 2753458950 322
1132 iso_pu_bacteria 2758568016 2758637820 322
1133 iso_pu_bacteria 2775506902 2776269284 322
1134 iso_pu_bacteria 2775506904 2776283577 322
1135 iso_pu_bacteria 2791355082 2792584698 322
1136 iso_pu_bacteria 2791355091 2792621513 322
1137 iso_pu_bacteria 2791355092 2792627799 322
1138 iso_pu_bacteria 2791355094 2792640231 322
1139 iso_pu_bacteria 2802428858 2802716174 322
1140 iso_pu_bacteria 2802428859 2802722788 322
1141 iso_pu_bacteria 2802428860 2802729067 322
1142 iso_pu_bacteria 2802428861 2802735461 322
1143 iso_pu_bacteria 2802428862 2802741963 322
1144 iso_pu_bacteria 2802428863 2802748413 322
1145 iso_pu_bacteria 2842521101 2842525138 322
1146 iso_pu_bacteria 2847417321 2847422214 322
1147 iso_pu_bacteria 2855825444 2855828399 322
1148 iso_pu_bacteria 2855839649 2855843511 322
1149 iso_pu_bacteria 2855872281 2855875657 322
1150 iso_pu_bacteria 2858800743 2858807227 322
1151 iso_pu_bacteria 2894652903 2894653438 322
1152 iso_pu_bacteria 2915986958 2915988994 322
1153 iso_pu_bacteria 2915993759 2916000139 322
1154 iso_pu_bacteria 2916000859 2916004801 322
1155 iso_pu_bacteria 2916007675 2916013131 322
1156 iso_pu_bacteria 2916014648 2916020232 322
1157 iso_pu_bacteria 2916021584 2916027052 322
1158 iso_pu_bacteria 2916028427 2916029960 322
1159 iso_pu_bacteria 2916035215 2916041103 322
1160 iso_pu_bacteria 2916041962 2916048581 322
1161 iso_pu_bacteria 2916055098 2916058731 322
1162 iso_pu_bacteria 2916068649 2916075417 322
1163 iso_pu_bacteria 2921201388 2921206922 322
1164 iso_pu_bacteria 2921244191 2921247674 322
1165 iso_pu_bacteria 2921263974 2921265381 322
1166 iso_pu_bacteria 2921282425 2921283172 322
1167 iso_pu_bacteria 2921289301 2921296026 322
1168 iso_pu_bacteria 2921296804 2921302011 322
1169 iso_pu_bacteria 2924144063 2924148971 322
1170 iso_pu_bacteria 2924150972 2924155387 322
1171 iso_pu_bacteria 2924158325 2924158639 322
1172 iso_pu_bacteria 2924172951 2924175838 322
1173 iso_pu_bacteria 2924179722 2924183889 322
1174 iso_pu_bacteria 2924186466 2924193443 322
1175 iso_pu_bacteria 2924193448 2924198816 322
1176 iso_pu_bacteria 2924200457 2924204690 322
1177 iso_pu_bacteria 2924207177 2924212266 322
1178 iso_pu_bacteria 2924214083 2924218484 322
1179 iso_pu_bacteria 2924221636 2924222441 322
1180 iso_pu_bacteria 2924228884 2924232552 322
1181 iso_pu_bacteria 2936996657 2936996677 322
1182 iso_pu_bacteria 2937002841 2937008416 322
1183 iso_pu_bacteria 2937029754 2937032369 322
1184 iso_pu_bacteria 2937036028 2937038355 322
1185 iso_pu_bacteria 2937042894 2937043468 322
1186 iso_pu_bacteria 2937049772 2937050476 322
1187 iso_pu_bacteria 2937056579 2937057129 322
1188 iso_pu_bacteria 2937063883 2937069047 322
1189 iso_pu_bacteria 2937071275 2937076748 322
1190 iso_pu_bacteria 2937078374 2937081832 322
1191 iso_pu_bacteria 2937084907 2937090306 322
1192 iso_pu_bacteria 2937091812 2937094936 322
1193 iso_pu_bacteria 2937098957 2937099159 322
1194 iso_pu_bacteria 2937106411 2937106763 322
1195 iso_pu_bacteria 2937113482 2937116903 322
1196 iso_pu_bacteria 2937126314 2937131844 322
1197 iso_pu_bacteria 2957375807 2957381045 322
1198 iso_pu_bacteria 2957388812 2957394318 322
1199 iso_pu_bacteria 2957415311 2957417882 322
1200 iso_pu_bacteria 2957422303 2957424865 322
1201 iso_pu_bacteria 2957430029 2957437058 322
1202 iso_pu_bacteria 2957437181 2957442765 322
1203 iso_pu_bacteria 2957443900 2957444077 322
1204 iso_pu_bacteria 2957450854 2957455011 322
1205 iso_pu_bacteria 2957457609 2957460764 322
1206 iso_pu_bacteria 2957464669 2957470742 322
1207 iso_pu_bacteria 2957471148 2957472812 322
1208 iso_pu_bacteria 2957478035 2957479280 322
1209 iso_pu_bacteria 2957484790 2957487220 322
1210 iso_pu_bacteria 2957491536 2957497404 322
1211 iso_pu_bacteria 2957498199 2957505435 322
1212 iso_pu_bacteria 2957505466 2957506370 322
1213 iso_pu_bacteria 2960584000 2960589899 322
1214 iso_pu_bacteria 2960591022 2960596663 322
1215 iso_pu_bacteria 2960597568 2960603233 322
1216 iso_pu_bacteria 2960603979 2960607537 322
1217 iso_pu_bacteria 2960617483 2960619243 322
1218 iso_pu_bacteria 2960624210 2960624702 322
1219 iso_pu_bacteria 2960631154 2960634559 322
1220 iso_pu_bacteria 2960637947 2960642938 322
1221 iso_pu_bacteria 2960645483 2960645959 322
1222 iso_pu_bacteria 2960652885 2960653489 322
1223 iso_pu_bacteria 2960660292 2960662602 322
1224 iso_pu_bacteria 2960667422 2960673012 322
1225 iso_pu_bacteria 2960674078 2960678368 322
1226 iso_pu_bacteria 2960680706 2960685754 322
1227 iso_pu_bacteria 2960693952 2960694981 322
1228 iso_pu_bacteria 2964607997 2964608269 322
1229 iso_pu_bacteria 2964621998 2964622291 322
1230 iso_pu_bacteria 2964628898 2964632209 322
1231 iso_pu_bacteria 2964636051 2964639383 322
1232 iso_pu_bacteria 2964643177 2964644892 322
1233 iso_pu_bacteria 2964643177 2964647658 322
1234 iso_pu_bacteria 2964649959 2964653465 322
1235 iso_pu_bacteria 2964656573 2964658568 322
1236 iso_pu_bacteria 2964663802 2964670479 322
1237 iso_pu_bacteria 2964678106 2964681504 322
1238 iso_pu_bacteria 2964685014 2964685566 322
1239 iso_pu_bacteria 2964691889 2964692311 322
1240 iso_pu_bacteria 2964698721 2964699246 322
1241 iso_pu_bacteria 2964705432 2964708819 322
1242 iso_pu_bacteria 2964712639 2964714525 322
1243 iso_pu_bacteria 2964719344 2964720166 322
1244 iso_pu_bacteria 2967664464 2967666370 322
1245 iso_pu_bacteria 2967671571 2967674233 322
1246 iso_pu_bacteria 2967678726 2967679625 322
1247 iso_pu_bacteria 2967686174 2967692661 322
1248 iso_pu_bacteria 2967693043 2967696541 322
1249 iso_pu_bacteria 2967699805 2967704537 322
1250 iso_pu_bacteria 2967706974 2967707748 322
1251 iso_pu_bacteria 2967714385 2967717109 322
1252 iso_pu_bacteria 2967721400 2967728519 322
1253 iso_pu_bacteria 2967728569 2967731776 322
1254 iso_pu_bacteria 2967735183 2967741643 322
1255 iso_pu_bacteria 2967748971 2967753953 322
1256 iso_pu_bacteria 2967762386 2967764269 322
1257 iso_pu_bacteria 2967769361 2967771862 322
1258 iso_pu_bacteria 2967775926 2967779495 322
1259 iso_pu_bacteria 2970019648 2970023850 322
1260 iso_pu_bacteria 2970026789 2970028491 322
1261 iso_pu_bacteria 2970033650 2970040773 322
1262 iso_pu_bacteria 2970040964 2970047526 322
1263 iso_pu_bacteria 2970047711 2970054126 322
1264 iso_pu_bacteria 2970054988 2970055268 322
1265 iso_pu_bacteria 2970061556 2970064179 322
1266 iso_pu_bacteria 2970068827 2970075942 322
1267 iso_pu_bacteria 2970076120 2970081912 322
1268 iso_pu_bacteria 2970082768 2970085826 322
1269 iso_pu_bacteria 2970088815 2970092334 322
1270 iso_pu_bacteria 2970095765 2970096227 322
1271 iso_pu_bacteria 2970109326 2970109639 322
1272 iso_pu_bacteria 2970116247 2970122226 322
1273 iso_pu_bacteria 2970122695 2970124994 322
1274 iso_pu_bacteria 2970129317 2970132525 322
1275 iso_pu_bacteria 2970136068 2970136899 322
1276 iso_pu_bacteria 2970143518 2970147091 322
1277 iso_pu_bacteria 2970149975 2970156072 322
1278 iso_pu_bacteria 2970156795 2970157611 322
1279 iso_pu_bacteria 2970164137 2970169435 322
1280 iso_pu_bacteria 2970184632 2970188966 322
1281 iso_pu_bacteria 2970191845 2970198616 322
1282 iso_pu_bacteria 2977530762 2977533165 322
1283 iso_pu_bacteria 2977537788 2977538336 322
1284 iso_pu_bacteria 2977544691 2977546237 322
1285 iso_pu_bacteria 2977551784 2977555674 322
1286 iso_pu_bacteria 2977558990 2977562914 322
1287 iso_pu_bacteria 2977565890 2977569638 322
1288 iso_pu_bacteria 2977572785 2977572950 322
1289 iso_pu_bacteria 2977579622 2977583111 322
1290 iso_pu_bacteria 3002141150 3002141966 322
1291 iso_pu_bacteria 3003665799 3003669458 322
1292 iso_pu_bacteria 3003930520 3003935853 322
1293 iso_pu_bacteria 3005445848 3005446592 322
1294 iso_pu_bacteria 643692032 643823880 322
1295 iso_pu_bacteria 648276728 648740337 322
1296 iso_pu_bacteria 8003992118 8003996090 322
1297 iso_pu_bacteria 8003999396 8004003855 322
1298 iso_pu_bacteria 8049293176 8049296782 322
1299 3300003203 JGI25406J46586_10013043 JGI25406J46586_100130434 323
1300 3300005327 Ga0070658_10322566 Ga0070658_103225661 323
1301 3300005539 Ga0068853_100204447 Ga0068853_1002044473 323
1302 3300005616 Ga0068852_100235654 Ga0068852_1002356541 323
1303 3300005937 Ga0081455_10264540 Ga0081455_102645402 323
1304 3300005983 Ga0081540_1012683 Ga0081540_10126835 323
1305 3300005985 Ga0081539_10000856 Ga0081539_1000085665 323
1306 3300006038 Ga0075365_10036306 Ga0075365_100363062 323
1307 3300006038 Ga0075365_10144556 Ga0075365_101445563 323
1308 3300006042 Ga0075368_10056250 Ga0075368_100562502 323
1309 3300006048 Ga0075363_100034177 Ga0075363_1000341774 323
1310 3300006051 Ga0075364_10097233 Ga0075364_100972331 323
1311 3300006178 Ga0075367_10071339 Ga0075367_100713393 323
1312 3300009093 Ga0105240_10194622 Ga0105240_101946223 323
1313 3300010375 Ga0105239_10148418 Ga0105239_101484182 323
1314 3300010375 Ga0105239_10200602 Ga0105239_102006023 323
1315 3300013104 Ga0157370_10224216 Ga0157370_102242161 323
1316 3300013105 Ga0157369_10273617 Ga0157369_102736173 323
1317 3300013306 Ga0163162_10092574 Ga0163162_100925742 323
1318 3300014325 Ga0163163_10000150 Ga0163163_1000015060 323
1319 3300014325 Ga0163163_10119349 Ga0163163_101193492 323
1320 3300014968 Ga0157379_10010439 Ga0157379_100104393 323
1321 3300021388 Ga0213875_10013299 Ga0213875_100132995 323
1322 3300025261 Ga0209233_1003389 Ga0209233_10033892 323
1323 3300025911 Ga0207654_10239484 Ga0207654_102394842 323
1324 3300026095 Ga0207676_10233222 Ga0207676_102332221 323
1325 3300026142 Ga0207698_10144721 Ga0207698_101447212 323
1326 3300035090 Ga0373949_0000224 Ga0373949_0000224_3294_4334 323
1327 3300035119 Ga0373956_0048977 Ga0373956_0048977_606_1583 323
1328 3300037853 Ga0436364_0115455 Ga0436364_0115455_4934_5911 323
1329 3300037853 Ga0436364_0976983 Ga0436364_0976983_210_1187 323
1330 3300039437 Ga0436365_0582386 Ga0436365_0582386_21332_22309 323
1331 3300039437 Ga0436365_1093511 Ga0436365_1093511_10773_11750 323
1332 3300039450 Ga0436363_0065264 Ga0436363_0065264_273_1250 323
1333 3300039453 Ga0436362_0273395 Ga0436362_0273395_5288_6265 323
1334 3300042007 Ga0439449_0082289 Ga0439449_0082289_168_1142 323
1335 3300046520 Ga0495637_0058673 Ga0495637_0058673_147_1118 323
1336 3300046557 Ga0495622_0050170 Ga0495622_0050170_949_1926 323
1337 3300048929 Ga0496126_0042064 Ga0496126_0042064_746_1723 323
1338 3300048929 Ga0496126_0061969 Ga0496126_0061969_823_1800 323
1339 3300049568 Ga0501031_0005116 Ga0501031_0005116_1706_2683 323
1340 3300049569 Ga0501032_0048609 Ga0501032_0048609_1194_2171 323
1341 3300049570 Ga0501033_0025128 Ga0501033_0025128_378_1355 323
1342 3300049571 Ga0501034_0002653 Ga0501034_0002653_16501_17475 323
1343 3300049571 Ga0501034_0032448 Ga0501034_0032448_3133_4110 323
1344 3300049572 Ga0501036_0003243 Ga0501036_0003243_10982_11956 323
1345 3300049572 Ga0501036_0024551 Ga0501036_0024551_3133_4110 323
1346 3300049573 Ga0501037_0018226 Ga0501037_0018226_3133_4110 323
1347 3300049574 Ga0501038_0025190 Ga0501038_0025190_1194_2171 323
1348 3300049575 Ga0501039_0011081 Ga0501039_0011081_2733_3710 323
1349 3300049575 Ga0501039_0100506 Ga0501039_0100506_982_1956 323
1350 3300049576 Ga0501040_0028962 Ga0501040_0028962_1477_2454 323
1351 3300049578 Ga0501042_0010639 Ga0501042_0010639_1058_2035 323
1352 3300049579 Ga0501043_0000736 Ga0501043_0000736_26540_27514 323
1353 3300049579 Ga0501043_0014872 Ga0501043_0014872_3133_4110 323
1354 3300049580 Ga0501046_0007945 Ga0501046_0007945_2608_3585 323
1355 3300049580 Ga0501046_0029996 Ga0501046_0029996_3222_4196 323
1356 3300049581 Ga0501047_0012748 Ga0501047_0012748_973_1950 323
1357 3300049582 Ga0501048_0000151 Ga0501048_0000151_37181_38155 323
1358 3300049582 Ga0501048_0008611 Ga0501048_0008611_2236_3213 323
1359 3300049583 Ga0501067_0041815 Ga0501067_0041815_1464_2441 323
1360 3300049584 Ga0501068_0008727 Ga0501068_0008727_3424_4401 323
1361 3300049586 Ga0501070_0005227 Ga0501070_0005227_4950_5924 323
1362 3300049586 Ga0501070_0010861 Ga0501070_0010861_4488_5465 323
1363 3300049586 Ga0501070_0081113 Ga0501070_0081113_49_1023 323
1364 3300049587 Ga0501071_0011715 Ga0501071_0011715_3969_4946 323
1365 3300049589 Ga0501073_0009708 Ga0501073_0009708_2651_3628 323
1366 3300049589 Ga0501073_0025551 Ga0501073_0025551_1869_2849 323
1367 3300049589 Ga0501073_0094938 Ga0501073_0094938_1066_2040 323
1368 3300049590 Ga0501074_0012718 Ga0501074_0012718_3633_4610 323
1369 3300049590 Ga0501074_0018996 Ga0501074_0018996_3394_4368 323
1370 3300049590 Ga0501074_0343333 Ga0501074_0343333_39_1010 323
1371 3300049592 Ga0501076_0111203 Ga0501076_0111203_405_1385 323
1372 3300049742 Ga0501080_0000130 Ga0501080_0000130_25881_26855 323
1373 3300049742 Ga0501080_0024231 Ga0501080_0024231_1202_2179 323
1374 3300049744 Ga0501083_0000480 Ga0501083_0000480_3808_4782 323
1375 3300049744 Ga0501083_0028904 Ga0501083_0028904_2719_3696 323
1376 3300049822 Ga0501035_0026490 Ga0501035_0026490_3133_4110 323
1377 3300049823 Ga0501044_0000636 Ga0501044_0000636_37209_38183 323
1378 3300049823 Ga0501044_0034514 Ga0501044_0034514_1194_2171 323
1379 3300049823 Ga0501044_0327007 Ga0501044_0327007_151_1125 323
1380 3300049823 Ga0501044_0382740 Ga0501044_0382740_249_1226 323
1381 3300049824 Ga0501045_0011533 Ga0501045_0011533_1301_2278 323
1382 3300049824 Ga0501045_0240036 Ga0501045_0240036_324_1298 323
1383 3300050491 nmdc:mga00v17_100626_c1 nmdc:mga00v17_100626_c1_168_1145 323
1384 3300050494 nmdc:mga06z11_236801_c1 nmdc:mga06z11_236801_c1_36_1013 323
1385 3300053153 Ga0500616_0142955 Ga0500616_0142955_67_1044 323
1386 3300053161 Ga0500634_0000507 Ga0500634_0000507_5788_6762 323
1387 3300054114 Ga0501084_0027038 Ga0501084_0027038_1243_2223 323
1388 3300054114 Ga0501084_0436349 Ga0501084_0436349_69_1046 323
1389 3300060353 Ga0501082_0028918 Ga0501082_0028918_2827_3801 323
1390 iso_pu_bacteria 2510065057 2510305552 323
1391 iso_pu_bacteria 2510461069 2510840344 323
1392 iso_pu_bacteria 2510917026 2511171931 323
1393 iso_pu_bacteria 2511231052 2511503592 323
1394 iso_pu_bacteria 2512047086 2512530271 323
1395 iso_pu_bacteria 2512875026 2512970220 323
1396 iso_pu_bacteria 2513237086 2513583932 323
1397 iso_pu_bacteria 2513237088 2513600999 323
1398 iso_pu_bacteria 2513237089 2513601284 323
1399 iso_pu_bacteria 2513237091 2513615894 323
1400 iso_pu_bacteria 2513237140 2513883551 323
1401 iso_pu_bacteria 2513237143 2513903604 323
1402 iso_pu_bacteria 2513237156 2513986662 323
1403 iso_pu_bacteria 2513237160 2514003269 323
1404 iso_pu_bacteria 2515154107 2515610013 323
1405 iso_pu_bacteria 2516653046 2516898199 323
1406 iso_pu_bacteria 2517487022 2517570742 323
1407 iso_pu_bacteria 2524023207 2524451724 323
1408 iso_pu_bacteria 2534681796 2535517316 323
1409 iso_pu_bacteria 2551306084 2551677322 323
1410 iso_pu_bacteria 2551306085 2551684923 323
1411 iso_pu_bacteria 2551306086 2551693210 323
1412 iso_pu_bacteria 2551306089 2551708604 323
1413 iso_pu_bacteria 2551306090 2551716860 323
1414 iso_pu_bacteria 2551306091 2551728792 323
1415 iso_pu_bacteria 2551306092 2551735705 323
1416 iso_pu_bacteria 2551306092 2551737452 323
1417 iso_pu_bacteria 2551306093 2551742001 323
1418 iso_pu_bacteria 2582581283 2585169153 323
1419 iso_pu_bacteria 2582581294 2585204591 323
1420 iso_pu_bacteria 2582581299 2585230759 323
1421 iso_pu_bacteria 2585427633 2585992830 323
1422 iso_pu_bacteria 2585427634 2586003540 323
1423 iso_pu_bacteria 2599185156 2599335866 323
1424 iso_pu_bacteria 2599185236 2599719825 323
1425 iso_pu_bacteria 2600254933 2600377102 323
1426 iso_pu_bacteria 2643221558 2643814636 323
1427 iso_pu_bacteria 2643221599 2644003001 323
1428 iso_pu_bacteria 2643221634 2644196744 323
1429 iso_pu_bacteria 2643221653 2644300515 323
1430 iso_pu_bacteria 2643221719 2644658856 323
1431 iso_pu_bacteria 2643221734 2644737111 323
1432 iso_pu_bacteria 2738541317 2738946848 323
1433 iso_pu_bacteria 2758568016 2758638842 323
1434 iso_pu_bacteria 2802428858 2802716575 323
1435 iso_pu_bacteria 2802428859 2802725388 323
1436 iso_pu_bacteria 2802428860 2802730520 323
1437 iso_pu_bacteria 2802428861 2802737507 323
1438 iso_pu_bacteria 2802428862 2802743103 323
1439 iso_pu_bacteria 2802428863 2802750526 323
1440 iso_pu_bacteria 2818991272 2819243487 323
1441 iso_pu_bacteria 2818991461 2819682968 323
1442 iso_pu_bacteria 2821123053 2821126401 323
1443 iso_pu_bacteria 2838074704 2838076068 323
1444 iso_pu_bacteria 2838736955 2838737124 323
1445 iso_pu_bacteria 2841840854 2841842507 323
1446 iso_pu_bacteria 2842140634 2842142287 323
1447 iso_pu_bacteria 2842922631 2842926982 323
1448 iso_pu_bacteria 2854896431 2854899753 323
1449 iso_pu_bacteria 2854911287 2854916425 323
1450 iso_pu_bacteria 2854916844 2854921022 323
1451 iso_pu_bacteria 2855825444 2855829762 323
1452 iso_pu_bacteria 2855839649 2855846042 323
1453 iso_pu_bacteria 2857531043 2857532962 323
1454 iso_pu_bacteria 2858800743 2858804224 323
1455 iso_pu_bacteria 2899803654 2899804069 323
1456 iso_pu_bacteria 2913308742 2913311792 323
1457 iso_pu_bacteria 2915650412 2915652684 323
1458 iso_pu_bacteria 2915980308 2915981286 323
1459 iso_pu_bacteria 2915986958 2915992653 323
1460 iso_pu_bacteria 2915993759 2915997341 323
1461 iso_pu_bacteria 2916000859 2916004201 323
1462 iso_pu_bacteria 2916007675 2916011816 323
1463 iso_pu_bacteria 2916014648 2916017441 323
1464 iso_pu_bacteria 2916021584 2916023643 323
1465 iso_pu_bacteria 2916028427 2916028689 323
1466 iso_pu_bacteria 2916035215 2916035646 323
1467 iso_pu_bacteria 2916041962 2916043504 323
1468 iso_pu_bacteria 2916048683 2916049781 323
1469 iso_pu_bacteria 2916055098 2916056079 323
1470 iso_pu_bacteria 2916061851 2916062147 323
1471 iso_pu_bacteria 2916068649 2916070826 323
1472 iso_pu_bacteria 2916076590 2916080345 323
1473 iso_pu_bacteria 2917699015 2917703990 323
1474 iso_pu_bacteria 2919171160 2919176038 323
1475 iso_pu_bacteria 2920760137 2920764804 323
1476 iso_pu_bacteria 2920822456 2920827195 323
1477 iso_pu_bacteria 2921201388 2921203804 323
1478 iso_pu_bacteria 2921208531 2921210564 323
1479 iso_pu_bacteria 2921237296 2921240183 323
1480 iso_pu_bacteria 2921244191 2921247942 323
1481 iso_pu_bacteria 2921250672 2921251792 323
1482 iso_pu_bacteria 2921257292 2921258150 323
1483 iso_pu_bacteria 2921263974 2921264313 323
1484 iso_pu_bacteria 2921282425 2921286093 323
1485 iso_pu_bacteria 2921289301 2921296443 323
1486 iso_pu_bacteria 2921296804 2921301851 323
1487 iso_pu_bacteria 2924144063 2924150001 323
1488 iso_pu_bacteria 2924150972 2924153641 323
1489 iso_pu_bacteria 2924158325 2924162869 323
1490 iso_pu_bacteria 2924165586 2924170470 323
1491 iso_pu_bacteria 2924172951 2924179446 323
1492 iso_pu_bacteria 2924179722 2924182879 323
1493 iso_pu_bacteria 2924186466 2924191318 323
1494 iso_pu_bacteria 2924193448 2924199876 323
1495 iso_pu_bacteria 2924200457 2924201125 323
1496 iso_pu_bacteria 2924207177 2924210877 323
1497 iso_pu_bacteria 2924214083 2924221104 323
1498 iso_pu_bacteria 2924221636 2924221702 323
1499 iso_pu_bacteria 2924228884 2924234466 323
1500 iso_pu_bacteria 2929138655 2929141908 323
1501 iso_pu_bacteria 2936996657 2936997294 323
1502 iso_pu_bacteria 2937002841 2937006425 323
1503 iso_pu_bacteria 2937009748 2937016239 323
1504 iso_pu_bacteria 2937016420 2937021096 323
1505 iso_pu_bacteria 2937023124 2937024878 323
1506 iso_pu_bacteria 2937029754 2937035774 323
1507 iso_pu_bacteria 2937036028 2937041595 323
1508 iso_pu_bacteria 2937042894 2937044690 323
1509 iso_pu_bacteria 2937049772 2937055386 323
1510 iso_pu_bacteria 2937056579 2937056602 323
1511 iso_pu_bacteria 2937063883 2937070961 323
1512 iso_pu_bacteria 2937071275 2937075878 323
1513 iso_pu_bacteria 2937078374 2937080836 323
1514 iso_pu_bacteria 2937091812 2937091980 323
1515 iso_pu_bacteria 2937098957 2937106168 323
1516 iso_pu_bacteria 2937106411 2937106587 323
1517 iso_pu_bacteria 2937113482 2937113662 323
1518 iso_pu_bacteria 2937119839 2937123463 323
1519 iso_pu_bacteria 2937126314 2937126559 323
1520 iso_pu_bacteria 2957375807 2957379484 323
1521 iso_pu_bacteria 2957382221 2957383499 323
1522 iso_pu_bacteria 2957388812 2957390819 323
1523 iso_pu_bacteria 2957395598 2957397654 323
1524 iso_pu_bacteria 2957402308 2957408699 323
1525 iso_pu_bacteria 2957408893 2957413212 323
1526 iso_pu_bacteria 2957415311 2957418592 323
1527 iso_pu_bacteria 2957422303 2957428686 323
1528 iso_pu_bacteria 2957430029 2957432247 323
1529 iso_pu_bacteria 2957437181 2957441798 323
1530 iso_pu_bacteria 2957443900 2957448015 323
1531 iso_pu_bacteria 2957450854 2957454021 323
1532 iso_pu_bacteria 2957457609 2957457941 323
1533 iso_pu_bacteria 2957464669 2957470082 323
1534 iso_pu_bacteria 2957471148 2957474318 323
1535 iso_pu_bacteria 2957478035 2957478232 323
1536 iso_pu_bacteria 2957484790 2957487793 323
1537 iso_pu_bacteria 2957491536 2957494230 323
1538 iso_pu_bacteria 2957498199 2957498388 323
1539 iso_pu_bacteria 2957505466 2957511221 323
1540 iso_pu_bacteria 2960584000 2960589020 323
1541 iso_pu_bacteria 2960591022 2960591949 323
1542 iso_pu_bacteria 2960597568 2960597768 323
1543 iso_pu_bacteria 2960603979 2960607156 323
1544 iso_pu_bacteria 2960610863 2960613430 323
1545 iso_pu_bacteria 2960617483 2960620789 323
1546 iso_pu_bacteria 2960624210 2960624758 323
1547 iso_pu_bacteria 2960631154 2960633971 323
1548 iso_pu_bacteria 2960637947 2960640629 323
1549 iso_pu_bacteria 2960645483 2960649898 323
1550 iso_pu_bacteria 2960652885 2960653463 323
1551 iso_pu_bacteria 2960660292 2960661110 323
1552 iso_pu_bacteria 2960667422 2960669457 323
1553 iso_pu_bacteria 2960674078 2960675999 323
1554 iso_pu_bacteria 2960680706 2960684859 323
1555 iso_pu_bacteria 2960687367 2960689781 323
1556 iso_pu_bacteria 2960693952 2960698324 323
1557 iso_pu_bacteria 2964607997 2964615076 323
1558 iso_pu_bacteria 2964615318 2964615604 323
1559 iso_pu_bacteria 2964621998 2964622062 323
1560 iso_pu_bacteria 2964628898 2964633049 323
1561 iso_pu_bacteria 2964636051 2964638581 323
1562 iso_pu_bacteria 2964649959 2964654532 323
1563 iso_pu_bacteria 2964656573 2964662510 323
1564 iso_pu_bacteria 2964663802 2964667342 323
1565 iso_pu_bacteria 2964670856 2964675575 323
1566 iso_pu_bacteria 2964678106 2964681134 323
1567 iso_pu_bacteria 2964685014 2964689700 323
1568 iso_pu_bacteria 2964691889 2964691990 323
1569 iso_pu_bacteria 2964698721 2964701435 323
1570 iso_pu_bacteria 2964705432 2964706842 323
1571 iso_pu_bacteria 2964712639 2964715243 323
1572 iso_pu_bacteria 2964719344 2964719413 323
1573 iso_pu_bacteria 2967671571 2967676410 323
1574 iso_pu_bacteria 2967678726 2967679327 323
1575 iso_pu_bacteria 2967686174 2967690642 323
1576 iso_pu_bacteria 2967693043 2967694438 323
1577 iso_pu_bacteria 2967699805 2967702101 323
1578 iso_pu_bacteria 2967706974 2967710709 323
1579 iso_pu_bacteria 2967714385 2967715142 323
1580 iso_pu_bacteria 2967721400 2967728246 323
1581 iso_pu_bacteria 2967728569 2967731064 323
1582 iso_pu_bacteria 2967735183 2967737723 323
1583 iso_pu_bacteria 2967742019 2967745950 323
1584 iso_pu_bacteria 2967748971 2967749744 323
1585 iso_pu_bacteria 2967755722 2967758129 323
1586 iso_pu_bacteria 2967762386 2967763289 323
1587 iso_pu_bacteria 2967769361 2967769678 323
1588 iso_pu_bacteria 2967775926 2967780383 323
1589 iso_pu_bacteria 2970019648 2970020290 323
1590 iso_pu_bacteria 2970026789 2970032823 323
1591 iso_pu_bacteria 2970033650 2970037531 323
1592 iso_pu_bacteria 2970040964 2970044810 323
1593 iso_pu_bacteria 2970047711 2970047794 323
1594 iso_pu_bacteria 2970054988 2970057621 323
1595 iso_pu_bacteria 2970061556 2970061746 323
1596 iso_pu_bacteria 2970068827 2970070592 323
1597 iso_pu_bacteria 2970076120 2970077911 323
1598 iso_pu_bacteria 2970082768 2970085376 323
1599 iso_pu_bacteria 2970088815 2970089003 323
1600 iso_pu_bacteria 2970095765 2970099810 323
1601 iso_pu_bacteria 2970102677 2970105522 323
1602 iso_pu_bacteria 2970109326 2970113177 323
1603 iso_pu_bacteria 2970116247 2970121710 323
1604 iso_pu_bacteria 2970122695 2970123483 323
1605 iso_pu_bacteria 2970129317 2970131083 323
1606 iso_pu_bacteria 2970136068 2970138694 323
1607 iso_pu_bacteria 2970143518 2970144870 323
1608 iso_pu_bacteria 2970149975 2970152979 323
1609 iso_pu_bacteria 2970156795 2970156946 323
1610 iso_pu_bacteria 2970164137 2970164379 323
1611 iso_pu_bacteria 2970170962 2970173029 323
1612 iso_pu_bacteria 2970177841 2970183155 323
1613 iso_pu_bacteria 2970184632 2970190072 323
1614 iso_pu_bacteria 2970191845 2970192422 323
1615 iso_pu_bacteria 2977516862 2977522751 323
1616 iso_pu_bacteria 2977523885 2977526110 323
1617 iso_pu_bacteria 2977530762 2977534407 323
1618 iso_pu_bacteria 2977537788 2977543135 323
1619 iso_pu_bacteria 2977544691 2977546523 323
1620 iso_pu_bacteria 2977551784 2977555012 323
1621 iso_pu_bacteria 2977558990 2977561450 323
1622 iso_pu_bacteria 2977565890 2977572542 323
1623 iso_pu_bacteria 2977572785 2977575916 323
1624 iso_pu_bacteria 2977579622 2977580027 323
1625 iso_pu_bacteria 2989776772 2989781071 323
1626 iso_pu_bacteria 2996336353 2996341249 323
1627 iso_pu_bacteria 2996887358 2996892615 323
1628 iso_pu_bacteria 3000017691 3000020498 323
1629 iso_pu_bacteria 3005452660 3005455140 323
1630 iso_pu_bacteria 648276728 648736140 323
1631 iso_pu_bacteria 8003992118 8003998497 323
1632 iso_pu_bacteria 8003999396 8004002280 323
1633 iso_pu_bacteria 8005246636 8005251441 323
1634 iso_pu_bacteria 8005258706 8005264758 323
1635 iso_pu_bacteria 8005321885 8005327142 323
1636 iso_pu_bacteria 8005542996 8005546140 323
1637 iso_pu_bacteria 8005658619 8005661982 323
1638 iso_pu_bacteria 8054460903 8054464669 323
1639 3300005434 Ga0070709_10005929 Ga0070709_100059292 324
1640 3300005434 Ga0070709_10034343 Ga0070709_100343434 324
1641 3300005435 Ga0070714_100016855 Ga0070714_1000168553 324
1642 3300005435 Ga0070714_100037888 Ga0070714_1000378885 324
1643 3300005435 Ga0070714_100560028 Ga0070714_1005600281 324
1644 3300005436 Ga0070713_100025962 Ga0070713_1000259626 324
1645 3300005436 Ga0070713_100074693 Ga0070713_1000746932 324
1646 3300005436 Ga0070713_100104650 Ga0070713_1001046501 324
1647 3300005437 Ga0070710_10022918 Ga0070710_100229183 324
1648 3300005439 Ga0070711_100000801 Ga0070711_10000080111 324
1649 3300005439 Ga0070711_100124150 Ga0070711_1001241503 324
1650 3300005455 Ga0070663_100027751 Ga0070663_1000277512 324
1651 3300005548 Ga0070665_100076161 Ga0070665_1000761613 324
1652 3300005614 Ga0068856_100006239 Ga0068856_1000062397 324
1653 3300005841 Ga0068863_100108817 Ga0068863_1001088173 324
1654 3300006175 Ga0070712_100171482 Ga0070712_1001714822 324
1655 3300009545 Ga0105237_10262249 Ga0105237_102622492 324
1656 3300010159 Ga0099796_10058848 Ga0099796_100588481 324
1657 3300021358 Ga0213873_10004680 Ga0213873_100046802 324
1658 3300025898 Ga0207692_10000504 Ga0207692_100005043 324
1659 3300025906 Ga0207699_10000508 Ga0207699_1000050811 324
1660 3300025915 Ga0207693_10160234 Ga0207693_101602342 324
1661 3300025916 Ga0207663_10000732 Ga0207663_100007325 324
1662 3300025916 Ga0207663_10034225 Ga0207663_100342253 324
1663 3300025928 Ga0207700_10056062 Ga0207700_100560621 324
1664 3300025928 Ga0207700_10074501 Ga0207700_100745012 324
1665 3300025929 Ga0207664_10018977 Ga0207664_100189772 324
1666 3300025929 Ga0207664_10131642 Ga0207664_101316421 324
1667 3300026067 Ga0207678_10079912 Ga0207678_100799122 324
1668 3300026078 Ga0207702_10008706 Ga0207702_100087066 324
1669 3300028379 Ga0268266_10277140 Ga0268266_102771402 324
1670 3300031456 Ga0307513_10175906 Ga0307513_101759063 324
1671 3300035725 Ga0373947_0032636 Ga0373947_0032636_1932_2906 324
1672 3300037068 Ga0373925_0022002 Ga0373925_0022002_1439_2413 324
1673 3300039437 Ga0436365_1332159 Ga0436365_1332159_9185_10168 324
1674 3300039450 Ga0436363_0502334 Ga0436363_0502334_280_1266 324
1675 3300039453 Ga0436362_0163701 Ga0436362_0163701_336_1319 324
1676 3300045051 Ga0451576_0007851 Ga0451576_0007851_7021_8031 324
1677 3300046491 Ga0495584_0105914 Ga0495584_0105914_344_1327 324
1678 3300046512 Ga0495610_0114606 Ga0495610_0114606_43_1026 324
1679 3300046517 Ga0495630_0098248 Ga0495630_0098248_843_1817 324
1680 3300046533 Ga0495640_0058151 Ga0495640_0058151_1432_2406 324
1681 3300048091 Ga0495626_0045815 Ga0495626_0045815_107_1090 324
1682 3300048912 Ga0496109_0169939 Ga0496109_0169939_927_1925 324
1683 3300048916 Ga0496113_0284026 Ga0496113_0284026_213_1193 324
1684 3300048920 Ga0496117_0011870 Ga0496117_0011870_5119_6099 324
1685 3300048920 Ga0496117_0065649 Ga0496117_0065649_940_1920 324
1686 3300048923 Ga0496120_0090646 Ga0496120_0090646_15_995 324
1687 3300048925 Ga0496122_0177611 Ga0496122_0177611_280_1260 324
1688 3300048926 Ga0496123_0078386 Ga0496123_0078386_472_1452 324
1689 3300049569 Ga0501032_0198364 Ga0501032_0198364_41_1045 324
1690 3300049570 Ga0501033_0196653 Ga0501033_0196653_109_1089 324
1691 3300049573 Ga0501037_0242343 Ga0501037_0242343_21_1001 324
1692 3300049593 Ga0501077_0069047 Ga0501077_0069047_695_1678 324
1693 3300049744 Ga0501083_0002243 Ga0501083_0002243_6786_7769 324
1694 3300053079 Ga0500610_0046673 Ga0500610_0046673_368_1351 324
1695 3300053096 Ga0500641_0065847 Ga0500641_0065847_443_1429 324
1696 3300060353 Ga0501082_0026891 Ga0501082_0026891_3120_4103 324
1697 iso_pu_bacteria 2510917022 2511137334 324
1698 iso_pu_bacteria 2511231027 2511392108 324
1699 iso_pu_bacteria 2524023209 2524459100 324
1700 iso_pu_bacteria 2537561587 2537873019 324
1701 iso_pu_bacteria 2537561587 2537873641 324
1702 iso_pu_bacteria 2554235003 2554248900 324
1703 iso_pu_bacteria 2558860242 2559295988 324
1704 iso_pu_bacteria 2582581294 2585205754 324
1705 iso_pu_bacteria 2582581304 2585259283 324
1706 iso_pu_bacteria 2582581307 2585274067 324
1707 iso_pu_bacteria 2582581865 2585389302 324
1708 iso_pu_bacteria 2585427531 2585560517 324
1709 iso_pu_bacteria 2585427594 2585847505 324
1710 iso_pu_bacteria 2585427609 2585903701 324
1711 iso_pu_bacteria 2585428125 2587981180 324
1712 iso_pu_bacteria 2599185210 2599603219 324
1713 iso_pu_bacteria 2600255279 2601610876 324
1714 iso_pu_bacteria 2600255308 2601747650 324
1715 iso_pu_bacteria 2643221568 2643854920 324
1716 iso_pu_bacteria 2643221582 2643916789 324
1717 iso_pu_bacteria 2643221582 2643921512 324
1718 iso_pu_bacteria 2643221618 2644104959 324
1719 iso_pu_bacteria 2643221636 2644203132 324
1720 iso_pu_bacteria 2643221655 2644307501 324
1721 iso_pu_bacteria 2643221659 2644333971 324
1722 iso_pu_bacteria 2643221688 2644496569 324
1723 iso_pu_bacteria 2643221693 2644521566 324
1724 iso_pu_bacteria 2643221712 2644613585 324
1725 iso_pu_bacteria 2738541293 2738803285 324
1726 iso_pu_bacteria 2765235802 2765465970 324
1727 iso_pu_bacteria 2767802442 2770196606 324
1728 iso_pu_bacteria 2808606387 2808988186 324
1729 iso_pu_bacteria 2818991439 2819560998 324
1730 iso_pu_bacteria 2838675328 2838678394 324
1731 iso_pu_bacteria 2838675328 2838678634 324
1732 iso_pu_bacteria 2838714209 2838716698 324
1733 iso_pu_bacteria 2838714209 2838718278 324
1734 iso_pu_bacteria 2838719591 2838722690 324
1735 iso_pu_bacteria 2838719591 2838722930 324
1736 iso_pu_bacteria 2838724970 2838727449 324
1737 iso_pu_bacteria 2838724970 2838728344 324
1738 iso_pu_bacteria 2839993093 2839993603 324
1739 iso_pu_bacteria 2840764183 2840766624 324
1740 iso_pu_bacteria 2841846520 2841849079 324
1741 iso_pu_bacteria 2841846520 2841850486 324
1742 iso_pu_bacteria 2841859092 2841861898 324
1743 iso_pu_bacteria 2841859092 2841863262 324
1744 iso_pu_bacteria 2842124991 2842128172 324
1745 iso_pu_bacteria 2842124991 2842129004 324
1746 iso_pu_bacteria 2842130223 2842133287 324
1747 iso_pu_bacteria 2842130223 2842133526 324
1748 iso_pu_bacteria 2842152218 2842155280 324
1749 iso_pu_bacteria 2842152218 2842155562 324
1750 iso_pu_bacteria 2842170452 2842173780 324
1751 iso_pu_bacteria 2842170452 2842174480 324
1752 iso_pu_bacteria 2842175837 2842178901 324
1753 iso_pu_bacteria 2842175837 2842179140 324
1754 iso_pu_bacteria 2842187318 2842189806 324
1755 iso_pu_bacteria 2842187318 2842190702 324
1756 iso_pu_bacteria 2842211629 2842214120 324
1757 iso_pu_bacteria 2842211629 2842214974 324
1758 iso_pu_bacteria 2842224351 2842226840 324
1759 iso_pu_bacteria 2842224351 2842227695 324
1760 iso_pu_bacteria 2842298080 2842298453 324
1761 iso_pu_bacteria 2842333319 2842336912 324
1762 iso_pu_bacteria 2842357229 2842360465 324
1763 iso_pu_bacteria 2842509118 2842510482 324
1764 iso_pu_bacteria 2842515876 2842517836 324
1765 iso_pu_bacteria 2842515876 2842520001 324
1766 iso_pu_bacteria 2842871566 2842874917 324
1767 iso_pu_bacteria 2852387548 2852390906 324
1768 iso_pu_bacteria 2857576091 2857578694 324
1769 iso_pu_bacteria 2899792073 2899792985 324
1770 iso_pu_bacteria 2899792073 2899795359 324
1771 iso_pu_bacteria 2899845264 2899849338 324
1772 iso_pu_bacteria 2904578770 2904579699 324
1773 iso_pu_bacteria 2919114240 2919116915 324
1774 iso_pu_bacteria 2919114240 2919118464 324
1775 iso_pu_bacteria 2919119836 2919120634 324
1776 iso_pu_bacteria 2919166419 2919170551 324
1777 iso_pu_bacteria 2926754445 2926754994 324
1778 iso_pu_bacteria 2926754445 2926758428 324
1779 iso_pu_bacteria 2926760298 2926762157 324
1780 iso_pu_bacteria 2928521798 2928522498 324
1781 iso_pu_bacteria 2933006813 2933009341 324
1782 iso_pu_bacteria 2933006813 2933010589 324
1783 iso_pu_bacteria 2933011516 2933013465 324
1784 iso_pu_bacteria 2933011516 2933015739 324
1785 iso_pu_bacteria 2933594066 2933597523 324
1786 iso_pu_bacteria 2939669807 2939672003 324
1787 iso_pu_bacteria 2954011201 2954014106 324
1788 iso_pu_bacteria 2978969890 2978972646 324
1789 iso_pu_bacteria 2979089926 2979092573 324
1790 iso_pu_bacteria 2979095461 2979100036 324
1791 iso_pu_bacteria 2979100975 2979104545 324
1792 iso_pu_bacteria 2984509177 2984513660 324
1793 iso_pu_bacteria 2984518228 2984522760 324
1794 iso_pu_bacteria 2984537506 2984542067 324
1795 iso_pu_bacteria 2984587000 2984590898 324
1796 iso_pu_bacteria 2984601300 2984601497 324
1797 iso_pu_bacteria 650716007 650741203 324
1798 iso_pu_bacteria 8003570095 8003573125 324
1799 iso_pu_bacteria 8003570095 8003573735 324
1800 iso_pu_bacteria 8046767195 8046772547 324
1801 iso_pu_bacteria 8056875544 8056879741 324
1802 3300003214 JGI25165J46597_1006314 JGI25165J46597_10063142 325
1803 3300003214 JGI25165J46597_1007664 JGI25165J46597_10076642 325
1804 3300003215 JGI25153J46596_10002078 JGI25153J46596_100020785 325
1805 3300003771 Ga0055526_1000017 Ga0055526_100001738 325
1806 3300004625 Ga0055543_1013268 Ga0055543_10132682 325
1807 3300005262 Ga0065165_1000231 Ga0065165_10002315 325
1808 3300005262 Ga0065165_1000313 Ga0065165_100031350 325
1809 3300005327 Ga0070658_10000595 Ga0070658_1000059511 325
1810 3300005329 Ga0070683_100105930 Ga0070683_1001059302 325
1811 3300005331 Ga0070670_100459691 Ga0070670_1004596911 325
1812 3300005334 Ga0068869_100021520 Ga0068869_1000215203 325
1813 3300005335 Ga0070666_10030238 Ga0070666_100302382 325
1814 3300005434 Ga0070709_10152872 Ga0070709_101528722 325
1815 3300005435 Ga0070714_100167505 Ga0070714_1001675052 325
1816 3300005439 Ga0070711_100191666 Ga0070711_1001916662 325
1817 3300005455 Ga0070663_100199670 Ga0070663_1001996702 325
1818 3300005458 Ga0070681_10120549 Ga0070681_101205492 325
1819 3300005458 Ga0070681_10130087 Ga0070681_101300872 325
1820 3300005468 Ga0070707_100232121 Ga0070707_1002321211 325
1821 3300005530 Ga0070679_100006164 Ga0070679_1000061644 325
1822 3300005548 Ga0070665_100012792 Ga0070665_1000127927 325
1823 3300005563 Ga0068855_100099355 Ga0068855_1000993554 325
1824 3300005840 Ga0068870_10124167 Ga0068870_101241672 325
1825 3300005841 Ga0068863_100209174 Ga0068863_1002091741 325
1826 3300005844 Ga0068862_100172162 Ga0068862_1001721622 325
1827 3300005985 Ga0081539_10013687 Ga0081539_100136874 325
1828 3300006042 Ga0075368_10034380 Ga0075368_100343802 325
1829 3300006847 Ga0075431_100020612 Ga0075431_1000206123 325
1830 3300009093 Ga0105240_10087081 Ga0105240_100870812 325
1831 3300009093 Ga0105240_10161270 Ga0105240_101612702 325
1832 3300009093 Ga0105240_10357390 Ga0105240_103573902 325
1833 3300009174 Ga0105241_10159157 Ga0105241_101591572 325
1834 3300009545 Ga0105237_10056057 Ga0105237_100560572 325
1835 3300009551 Ga0105238_10038211 Ga0105238_100382113 325
1836 3300009551 Ga0105238_10124082 Ga0105238_101240823 325
1837 3300009551 Ga0105238_10569175 Ga0105238_105691752 325
1838 3300009553 Ga0105249_10081287 Ga0105249_100812872 325
1839 3300010375 Ga0105239_10177443 Ga0105239_101774432 325
1840 3300013105 Ga0157369_10195153 Ga0157369_101951532 325
1841 3300013297 Ga0157378_10111532 Ga0157378_101115322 325
1842 3300014325 Ga0163163_10662111 Ga0163163_106621112 325
1843 3300014326 Ga0157380_10030596 Ga0157380_100305963 325
1844 3300021384 Ga0213876_10074564 Ga0213876_100745642 325
1845 3300021384 Ga0213876_10181579 Ga0213876_101815791 325
1846 3300025261 Ga0209233_1000613 Ga0209233_100061314 325
1847 3300025284 Ga0209130_1000209 Ga0209130_100020923 325
1848 3300025294 Ga0209025_1010153 Ga0209025_10101536 325
1849 3300025294 Ga0209025_1014934 Ga0209025_10149341 325
1850 3300025909 Ga0207705_10001941 Ga0207705_100019415 325
1851 3300025912 Ga0207707_10133884 Ga0207707_101338843 325
1852 3300025912 Ga0207707_10456026 Ga0207707_104560261 325
1853 3300025913 Ga0207695_10023254 Ga0207695_100232542 325
1854 3300025913 Ga0207695_10127350 Ga0207695_101273502 325
1855 3300025913 Ga0207695_10406203 Ga0207695_104062031 325
1856 3300025913 Ga0207695_10435917 Ga0207695_104359171 325
1857 3300025914 Ga0207671_10144931 Ga0207671_101449312 325
1858 3300025916 Ga0207663_10163460 Ga0207663_101634602 325
1859 3300025917 Ga0207660_10002161 Ga0207660_100021614 325
1860 3300025919 Ga0207657_10024387 Ga0207657_100243872 325
1861 3300025924 Ga0207694_10144217 Ga0207694_101442172 325
1862 3300025942 Ga0207689_10058267 Ga0207689_100582672 325
1863 3300025949 Ga0207667_10127690 Ga0207667_101276903 325
1864 3300026078 Ga0207702_10054191 Ga0207702_100541912 325
1865 3300027666 Ga0209282_1015395 Ga0209282_10153953 325
1866 3300028379 Ga0268266_10000594 Ga0268266_1000059413 325
1867 3300028379 Ga0268266_10113076 Ga0268266_101130762 325
1868 3300028379 Ga0268266_10251918 Ga0268266_102519181 325
1869 3300028379 Ga0268266_10280692 Ga0268266_102806922 325
1870 3300028800 Ga0265338_10001544 Ga0265338_1000154432 325
1871 3300031238 Ga0265332_10027782 Ga0265332_100277821 325
1872 3300031238 Ga0265332_10028322 Ga0265332_100283222 325
1873 3300031241 Ga0265325_10021210 Ga0265325_100212102 325
1874 3300031247 Ga0265340_10016580 Ga0265340_100165804 325
1875 3300031247 Ga0265340_10022812 Ga0265340_100228123 325
1876 3300031250 Ga0265331_10016364 Ga0265331_100163641 325
1877 3300031344 Ga0265316_10163938 Ga0265316_101639382 325
1878 3300031595 Ga0265313_10009374 Ga0265313_100093747 325
1879 3300031711 Ga0265314_10038822 Ga0265314_100388221 325
1880 3300031712 Ga0265342_10015115 Ga0265342_100151153 325
1881 3300031712 Ga0265342_10027918 Ga0265342_100279182 325
1882 3300031995 Ga0307409_100108590 Ga0307409_1001085903 325
1883 3300033180 Ga0307510_10137701 Ga0307510_101377012 325
1884 3300035724 Ga0373933_0229299 Ga0373933_0229299_123_1109 325
1885 3300037853 Ga0436364_1147744 Ga0436364_1147744_1423_2403 325
1886 3300039437 Ga0436365_0017591 Ga0436365_0017591_737_1717 325
1887 3300039437 Ga0436365_0920082 Ga0436365_0920082_7253_8233 325
1888 3300044765 Ga0466970_0121864 Ga0466970_0121864_76_1062 325
1889 3300044901 Ga0466960_0094443 Ga0466960_0094443_425_1402 325
1890 3300045976 Ga0466967_0102676 Ga0466967_0102676_482_1525 325
1891 3300046460 Ga0495638_0016499 Ga0495638_0016499_1218_2195 325
1892 3300046492 Ga0495585_0027859 Ga0495585_0027859_1195_2172 325
1893 3300046515 Ga0495620_0066403 Ga0495620_0066403_422_1405 325
1894 3300046690 Ga0495624_0189637 Ga0495624_0189637_241_1221 325
1895 3300046691 Ga0495670_0091987 Ga0495670_0091987_516_1493 325
1896 3300047319 Ga0495674_0044067 Ga0495674_0044067_1208_2188 325
1897 3300048905 Ga0496102_0039482 Ga0496102_0039482_13_993 325
1898 3300048907 Ga0496104_0276801 Ga0496104_0276801_114_1094 325
1899 3300048908 Ga0496105_0252534 Ga0496105_0252534_384_1364 325
1900 3300048912 Ga0496109_0463250 Ga0496109_0463250_114_1094 325
1901 3300048913 Ga0496110_0172954 Ga0496110_0172954_458_1450 325
1902 3300048914 Ga0496111_0207264 Ga0496111_0207264_440_1432 325
1903 3300048915 Ga0496112_0082097 Ga0496112_0082097_787_1767 325
1904 3300048918 Ga0496115_0368499 Ga0496115_0368499_72_1058 325
1905 3300048921 Ga0496118_0144860 Ga0496118_0144860_213_1199 325
1906 3300048922 Ga0496119_0140261 Ga0496119_0140261_237_1223 325
1907 3300048925 Ga0496122_0057097 Ga0496122_0057097_1487_2470 325
1908 3300048929 Ga0496126_0102611 Ga0496126_0102611_854_1840 325
1909 3300049569 Ga0501032_0238153 Ga0501032_0238153_180_1166 325
1910 3300049571 Ga0501034_0018360 Ga0501034_0018360_3227_4213 325
1911 3300049571 Ga0501034_0023629 Ga0501034_0023629_5034_6011 325
1912 3300049571 Ga0501034_0209902 Ga0501034_0209902_235_1212 325
1913 3300049573 Ga0501037_0131113 Ga0501037_0131113_632_1615 325
1914 3300049574 Ga0501038_0391569 Ga0501038_0391569_48_1031 325
1915 3300049579 Ga0501043_0129343 Ga0501043_0129343_622_1605 325
1916 3300049579 Ga0501043_0173770 Ga0501043_0173770_470_1447 325
1917 3300049581 Ga0501047_0011635 Ga0501047_0011635_2401_3378 325
1918 3300049581 Ga0501047_0137136 Ga0501047_0137136_223_1200 325
1919 3300049581 Ga0501047_0140640 Ga0501047_0140640_964_1947 325
1920 3300049581 Ga0501047_0158778 Ga0501047_0158778_520_1512 325
1921 3300049581 Ga0501047_0183852 Ga0501047_0183852_169_1146 325
1922 3300049581 Ga0501047_0391781 Ga0501047_0391781_113_1096 325
1923 3300049586 Ga0501070_0020723 Ga0501070_0020723_2685_3662 325
1924 3300049591 Ga0501075_0315670 Ga0501075_0315670_101_1081 325
1925 3300049742 Ga0501080_0129552 Ga0501080_0129552_995_1978 325
1926 3300049822 Ga0501035_0093817 Ga0501035_0093817_981_1964 325
1927 3300049823 Ga0501044_0034727 Ga0501044_0034727_835_1812 325
1928 3300049823 Ga0501044_0417700 Ga0501044_0417700_192_1169 325
1929 3300053077 Ga0495601_0019603 Ga0495601_0019603_930_1910 325
1930 3300053084 Ga0495595_0033870 Ga0495595_0033870_1095_2075 325
1931 3300053085 Ga0495619_0033841 Ga0495619_0033841_691_1668 325
1932 3300053087 Ga0500643_000008 Ga0500643_000008_323419_324411 325
1933 3300053094 Ga0500566_0016698 Ga0500566_0016698_475_1461 325
1934 3300053105 Ga0500557_000004 Ga0500557_000004_73974_74960 325
1935 3300053119 Ga0500595_002270 Ga0500595_002270_3945_4931 325
1936 3300053119 Ga0500595_004854 Ga0500595_004854_3483_4460 325
1937 3300053130 Ga0500642_0000133 Ga0500642_0000133_29474_30460 325
1938 3300053139 Ga0500568_0034341 Ga0500568_0034341_841_1833 325
1939 3300053140 Ga0500573_0000121 Ga0500573_0000121_19502_20479 325
1940 3300053156 Ga0500622_0000486 Ga0500622_0000486_25183_26160 325
1941 3300053177 Ga0500636_0048382 Ga0500636_0048382_1241_2227 325
1942 3300053730 Ga0500645_028192 Ga0500645_028192_135_1112 325
1943 3300060353 Ga0501082_0212025 Ga0501082_0212025_417_1400 325
1944 iso_pu_bacteria 2643221643 2644242136 325
1945 iso_pu_bacteria 2643221736 2644746178 325
1946 iso_pu_bacteria 2841760612 2841766126 325
1947 iso_pu_bacteria 2844104063 2844105892 325
1948 iso_pu_bacteria 2851182111 2851186391 325
1949 iso_pu_bacteria 2851246043 2851246248 325
1950 iso_pu_bacteria 8057529695 8057531526 325
1951 3300005329 Ga0070683_100133616 Ga0070683_1001336162 326
1952 3300005336 Ga0070680_100063360 Ga0070680_1000633601 326
1953 3300005339 Ga0070660_100015769 Ga0070660_1000157695 326
1954 3300005344 Ga0070661_100046657 Ga0070661_1000466573 326
1955 3300005435 Ga0070714_100022579 Ga0070714_1000225795 326
1956 3300005458 Ga0070681_10158097 Ga0070681_101580972 326
1957 3300005546 Ga0070696_100003819 Ga0070696_1000038197 326
1958 3300005563 Ga0068855_100236476 Ga0068855_1002364762 326
1959 3300005616 Ga0068852_100096341 Ga0068852_1000963412 326
1960 3300005616 Ga0068852_100366447 Ga0068852_1003664472 326
1961 3300006175 Ga0070712_100339038 Ga0070712_1003390382 326
1962 3300006946 Ga0079104_1009774 Ga0079104_10097744 326
1963 3300006948 Ga0099826_10079759 Ga0099826_100797592 326
1964 3300007265 Ga0099794_10087406 Ga0099794_100874062 326
1965 3300007788 Ga0099795_10006137 Ga0099795_100061372 326
1966 3300021384 Ga0213876_10018209 Ga0213876_100182094 326
1967 3300021388 Ga0213875_10000046 Ga0213875_10000046102 326
1968 3300022739 Ga0228711_1000045 Ga0228711_10000456 326
1969 3300022740 Ga0228710_1000036 Ga0228710_100003696 326
1970 3300025245 Ga0207425_1002206 Ga0207425_10022062 326
1971 3300025258 Ga0209129_1002679 Ga0209129_10026798 326
1972 3300025294 Ga0209025_1022482 Ga0209025_10224823 326
1973 3300025294 Ga0209025_1032144 Ga0209025_10321442 326
1974 3300025297 Ga0209758_1012600 Ga0209758_10126002 326
1975 3300025297 Ga0209758_1012869 Ga0209758_10128692 326
1976 3300025912 Ga0207707_10298046 Ga0207707_102980462 326
1977 3300025917 Ga0207660_10024327 Ga0207660_100243273 326
1978 3300025919 Ga0207657_10011619 Ga0207657_100116195 326
1979 3300025920 Ga0207649_10108977 Ga0207649_101089771 326
1980 3300025921 Ga0207652_10280474 Ga0207652_102804741 326
1981 3300025921 Ga0207652_10401741 Ga0207652_104017411 326
1982 3300025929 Ga0207664_10350825 Ga0207664_103508252 326
1983 3300025944 Ga0207661_10135602 Ga0207661_101356022 326
1984 3300025949 Ga0207667_10157624 Ga0207667_101576242 326
1985 3300025949 Ga0207667_10308230 Ga0207667_103082301 326
1986 3300026142 Ga0207698_10266057 Ga0207698_102660572 326
1987 3300027111 Ga0209281_1000178 Ga0209281_100017823 326
1988 3300027111 Ga0209281_1000417 Ga0209281_100041767 326
1989 3300027666 Ga0209282_1000023 Ga0209282_100002349 326
1990 3300028556 Ga0265337_1027756 Ga0265337_10277561 326
1991 3300031241 Ga0265325_10015145 Ga0265325_100151454 326
1992 3300031247 Ga0265340_10036542 Ga0265340_100365422 326
1993 3300031456 Ga0307513_10008284 Ga0307513_1000828415 326
1994 3300031548 Ga0307408_100033455 Ga0307408_1000334552 326
1995 3300031711 Ga0265314_10001108 Ga0265314_1000110831 326
1996 3300031712 Ga0265342_10000203 Ga0265342_1000020310 326
1997 3300031967 Ga0315914_1000016 Ga0315914_10000166 326
1998 3300033430 Ga0315913_1000027 Ga0315913_100002788 326
1999 3300033464 Ga0315915_1000007 Ga0315915_100000784 326
2000 3300035118 Ga0373954_0019863 Ga0373954_0019863_1124_2104 326
2001 3300035119 Ga0373956_0017449 Ga0373956_0017449_469_1449 326
2002 3300035172 Ga0373955_0004010 Ga0373955_0004010_809_1789 326
2003 3300035695 Ga0373927_0060671 Ga0373927_0060671_1122_2102 326
2004 3300035724 Ga0373933_0023829 Ga0373933_0023829_2269_3249 326
2005 3300035724 Ga0373933_0050166 Ga0373933_0050166_1421_2401 326
2006 3300036401 Ga0373937_0088397 Ga0373937_0088397_154_1134 326
2007 3300037418 Ga0395900_0162899 Ga0395900_0162899_719_1702 326
2008 3300037853 Ga0436364_0990934 Ga0436364_0990934_11596_12576 326
2009 3300044694 Ga0466963_0055803 Ga0466963_0055803_883_1863 326
2010 3300044719 Ga0466971_0030184 Ga0466971_0030184_1308_2288 326
2011 3300044842 Ga0466957_0018581 Ga0466957_0018581_750_1730 326
2012 3300045049 Ga0466959_0036483 Ga0466959_0036483_2510_3490 326
2013 3300045051 Ga0451576_0052322 Ga0451576_0052322_1523_2503 326
2014 3300045051 Ga0451576_0342508 Ga0451576_0342508_115_1095 326
2015 3300045976 Ga0466967_0054386 Ga0466967_0054386_1907_2887 326
2016 3300046476 Ga0495662_0007582 Ga0495662_0007582_1396_2433 326
2017 3300046514 Ga0495618_0113401 Ga0495618_0113401_717_1697 326
2018 3300046557 Ga0495622_0005250 Ga0495622_0005250_3420_4457 326
2019 3300046559 Ga0495667_0019175 Ga0495667_0019175_3039_4019 326
2020 3300046642 Ga0495634_0119794 Ga0495634_0119794_444_1481 326
2021 3300046683 Ga0495658_0078031 Ga0495658_0078031_65_1102 326
2022 3300047317 Ga0495604_0003714 Ga0495604_0003714_3328_4365 326
2023 3300047317 Ga0495604_0040829 Ga0495604_0040829_1678_2658 326
2024 3300048913 Ga0496110_0160498 Ga0496110_0160498_240_1226 326
2025 3300049571 Ga0501034_0124971 Ga0501034_0124971_1074_2060 326
2026 3300049573 Ga0501037_0051520 Ga0501037_0051520_982_1962 326
2027 3300049574 Ga0501038_0082991 Ga0501038_0082991_218_1201 326
2028 3300049579 Ga0501043_0031243 Ga0501043_0031243_1485_2468 326
2029 3300049581 Ga0501047_0032514 Ga0501047_0032514_823_1803 326
2030 3300049581 Ga0501047_0283845 Ga0501047_0283845_148_1131 326
2031 3300049584 Ga0501068_0221066 Ga0501068_0221066_119_1108 326
2032 3300049586 Ga0501070_0026632 Ga0501070_0026632_1044_2027 326
2033 3300049589 Ga0501073_0194279 Ga0501073_0194279_145_1128 326
2034 3300049741 Ga0501079_0032061 Ga0501079_0032061_822_1811 326
2035 3300049776 Ga0501280_006888 Ga0501280_006888_248_1228 326
2036 3300049822 Ga0501035_0219976 Ga0501035_0219976_379_1365 326
2037 3300049822 Ga0501035_0349186 Ga0501035_0349186_29_1009 326
2038 3300049823 Ga0501044_0013256 Ga0501044_0013256_2826_3809 326
2039 3300049823 Ga0501044_0132604 Ga0501044_0132604_585_1565 326
2040 3300049824 Ga0501045_0204455 Ga0501045_0204455_248_1237 326
2041 3300053077 Ga0495601_0077667 Ga0495601_0077667_163_1143 326
2042 3300053078 Ga0495612_0007681 Ga0495612_0007681_2501_3481 326
2043 3300053084 Ga0495595_0018863 Ga0495595_0018863_959_1939 326
2044 3300053084 Ga0495595_0035357 Ga0495595_0035357_986_1966 326
2045 3300053085 Ga0495619_0040427 Ga0495619_0040427_426_1406 326
2046 3300053122 Ga0500608_015411 Ga0500608_015411_1489_2469 326
2047 3300053139 Ga0500568_0000116 Ga0500568_0000116_27096_28076 326
2048 3300053148 Ga0500590_063879 Ga0500590_063879_317_1354 326
2049 3300053157 Ga0500624_002151 Ga0500624_002151_688_1698 326
2050 3300053161 Ga0500634_0000005 Ga0500634_0000005_142895_143875 326
2051 3300060353 Ga0501082_0110103 Ga0501082_0110103_394_1374 326
2052 3300061719 Ga0466962_0100198 Ga0466962_0100198_332_1312 326
2053 3300061734 Ga0530510_0216307 Ga0530510_0216307_338_1327 326
2054 iso_pu_bacteria 2919679072 2919680441 326
2055 iso_pu_bacteria 8024486573 8024488524 326
2056 3300002459 JGI24751J29686_10002245 JGI24751J29686_100022452 327
2057 3300003771 Ga0055526_1013167 Ga0055526_10131673 327
2058 3300003775 Ga0055524_1003714 Ga0055524_10037148 327
2059 3300003781 Ga0055536_1004308 Ga0055536_10043082 327
2060 3300003790 Ga0055528_1011971 Ga0055528_10119711 327
2061 3300003790 Ga0055528_1035106 Ga0055528_10351061 327
2062 3300003792 Ga0055540_1000925 Ga0055540_100092510 327
2063 3300003794 Ga0055531_10000685 Ga0055531_1000068516 327
2064 3300005262 Ga0065165_1008460 Ga0065165_10084604 327
2065 3300005330 Ga0070690_100020090 Ga0070690_1000200901 327
2066 3300005331 Ga0070670_100130783 Ga0070670_1001307833 327
2067 3300005334 Ga0068869_100151919 Ga0068869_1001519192 327
2068 3300005338 Ga0068868_100064476 Ga0068868_1000644762 327
2069 3300005340 Ga0070689_100006652 Ga0070689_1000066523 327
2070 3300005340 Ga0070689_100007446 Ga0070689_1000074467 327
2071 3300005343 Ga0070687_100025536 Ga0070687_1000255364 327
2072 3300005347 Ga0070668_100098437 Ga0070668_1000984373 327
2073 3300005347 Ga0070668_100156759 Ga0070668_1001567592 327
2074 3300005347 Ga0070668_100308329 Ga0070668_1003083291 327
2075 3300005355 Ga0070671_100078678 Ga0070671_1000786782 327
2076 3300005356 Ga0070674_100025155 Ga0070674_1000251552 327
2077 3300005365 Ga0070688_100012599 Ga0070688_1000125992 327
2078 3300005365 Ga0070688_100018867 Ga0070688_1000188674 327
2079 3300005367 Ga0070667_100005456 Ga0070667_1000054563 327
2080 3300005437 Ga0070710_10141687 Ga0070710_101416872 327
2081 3300005439 Ga0070711_100076598 Ga0070711_1000765982 327
2082 3300005439 Ga0070711_100350158 Ga0070711_1003501581 327
2083 3300005455 Ga0070663_100025745 Ga0070663_1000257453 327
2084 3300005455 Ga0070663_100141408 Ga0070663_1001414082 327
2085 3300005456 Ga0070678_100011827 Ga0070678_1000118275 327
2086 3300005456 Ga0070678_100043922 Ga0070678_1000439222 327
2087 3300005459 Ga0068867_100355548 Ga0068867_1003555481 327
2088 3300005468 Ga0070707_100039104 Ga0070707_1000391042 327
2089 3300005518 Ga0070699_100021616 Ga0070699_1000216162 327
2090 3300005518 Ga0070699_100272384 Ga0070699_1002723842 327
2091 3300005530 Ga0070679_100532617 Ga0070679_1005326171 327
2092 3300005544 Ga0070686_100262069 Ga0070686_1002620691 327
2093 3300005563 Ga0068855_100013001 Ga0068855_1000130013 327
2094 3300005564 Ga0070664_100338396 Ga0070664_1003383961 327
2095 3300005578 Ga0068854_100107749 Ga0068854_1001077492 327
2096 3300005616 Ga0068852_100009087 Ga0068852_1000090874 327
2097 3300005617 Ga0068859_100024736 Ga0068859_1000247362 327
2098 3300005618 Ga0068864_100012375 Ga0068864_1000123756 327
2099 3300005719 Ga0068861_100007871 Ga0068861_1000078716 327
2100 3300005840 Ga0068870_10001906 Ga0068870_100019063 327
2101 3300005841 Ga0068863_100009237 Ga0068863_1000092375 327
2102 3300005842 Ga0068858_100019146 Ga0068858_1000191466 327
2103 3300005843 Ga0068860_100079823 Ga0068860_1000798231 327
2104 3300005843 Ga0068860_100388544 Ga0068860_1003885442 327
2105 3300005937 Ga0081455_10003542 Ga0081455_100035425 327
2106 3300005983 Ga0081540_1002311 Ga0081540_10023118 327
2107 3300006038 Ga0075365_10041629 Ga0075365_100416293 327
2108 3300006042 Ga0075368_10050834 Ga0075368_100508342 327
2109 3300006175 Ga0070712_100002508 Ga0070712_1000025082 327
2110 3300006175 Ga0070712_100004561 Ga0070712_1000045612 327
2111 3300006175 Ga0070712_100136445 Ga0070712_1001364451 327
2112 3300006178 Ga0075367_10002480 Ga0075367_100024804 327
2113 3300006178 Ga0075367_10039443 Ga0075367_100394432 327
2114 3300006178 Ga0075367_10164023 Ga0075367_101640231 327
2115 3300006186 Ga0075369_10009394 Ga0075369_100093945 327
2116 3300006237 Ga0097621_100051087 Ga0097621_1000510874 327
2117 3300006358 Ga0068871_100005378 Ga0068871_1000053782 327
2118 3300006844 Ga0075428_100001220 Ga0075428_10000122021 327
2119 3300006844 Ga0075428_100053554 Ga0075428_1000535545 327
2120 3300006844 Ga0075428_100159065 Ga0075428_1001590651 327
2121 3300006846 Ga0075430_100002472 Ga0075430_10000247210 327
2122 3300006847 Ga0075431_100000109 Ga0075431_10000010939 327
2123 3300006880 Ga0075429_100022955 Ga0075429_1000229555 327
2124 3300006880 Ga0075429_100090593 Ga0075429_1000905932 327
2125 3300006881 Ga0068865_100038875 Ga0068865_1000388754 327
2126 3300006931 Ga0097620_100024736 Ga0097620_1000247362 327
2127 3300006946 Ga0079104_1000063 Ga0079104_1000063150 327
2128 3300006946 Ga0079104_1007401 Ga0079104_10074012 327
2129 3300007265 Ga0099794_10018011 Ga0099794_100180113 327
2130 3300009036 Ga0105244_10078544 Ga0105244_100785442 327
2131 3300009092 Ga0105250_10026489 Ga0105250_100264892 327
2132 3300009093 Ga0105240_10044678 Ga0105240_100446784 327
2133 3300009093 Ga0105240_10305535 Ga0105240_103055352 327
2134 3300009094 Ga0111539_10061693 Ga0111539_100616933 327
2135 3300009098 Ga0105245_10137928 Ga0105245_101379282 327
2136 3300009101 Ga0105247_10011005 Ga0105247_100110052 327
2137 3300009147 Ga0114129_10000425 Ga0114129_1000042535 327
2138 3300009147 Ga0114129_10089914 Ga0114129_100899143 327
2139 3300009147 Ga0114129_10157237 Ga0114129_101572372 327
2140 3300009147 Ga0114129_10281742 Ga0114129_102817422 327
2141 3300009147 Ga0114129_10341581 Ga0114129_103415812 327
2142 3300009148 Ga0105243_10128637 Ga0105243_101286372 327
2143 3300009176 Ga0105242_10127953 Ga0105242_101279532 327
2144 3300009177 Ga0105248_10002392 Ga0105248_1000239213 327
2145 3300009177 Ga0105248_10098637 Ga0105248_100986374 327
2146 3300009177 Ga0105248_10339674 Ga0105248_103396742 327
2147 3300009551 Ga0105238_10246639 Ga0105238_102466391 327
2148 3300009553 Ga0105249_10134656 Ga0105249_101346562 327
2149 3300010375 Ga0105239_10326482 Ga0105239_103264822 327
2150 3300011119 Ga0105246_10008619 Ga0105246_100086193 327
2151 3300011119 Ga0105246_10066455 Ga0105246_100664552 327
2152 3300013100 Ga0157373_10071974 Ga0157373_100719741 327
2153 3300013100 Ga0157373_10261002 Ga0157373_102610021 327
2154 3300013102 Ga0157371_10069114 Ga0157371_100691142 327
2155 3300013104 Ga0157370_10306328 Ga0157370_103063281 327
2156 3300013105 Ga0157369_10202001 Ga0157369_102020012 327
2157 3300013250 Ga0171462_1008 Ga0171462_1008337 327
2158 3300013296 Ga0157374_10006671 Ga0157374_100066713 327
2159 3300013296 Ga0157374_10073552 Ga0157374_100735523 327
2160 3300013297 Ga0157378_10035361 Ga0157378_100353611 327
2161 3300013307 Ga0157372_10587039 Ga0157372_105870391 327
2162 3300013308 Ga0157375_10035164 Ga0157375_100351643 327
2163 3300013308 Ga0157375_10163308 Ga0157375_101633082 327
2164 3300014325 Ga0163163_10010637 Ga0163163_100106378 327
2165 3300014326 Ga0157380_10080263 Ga0157380_100802632 327
2166 3300014745 Ga0157377_10004065 Ga0157377_100040652 327
2167 3300014968 Ga0157379_10474868 Ga0157379_104748682 327
2168 3300017792 Ga0163161_10057076 Ga0163161_100570762 327
2169 3300020070 Ga0206356_10305157 Ga0206356_103051572 327
2170 3300020082 Ga0206353_11216187 Ga0206353_112161871 327
2171 3300022739 Ga0228711_1000184 Ga0228711_100018412 327
2172 3300022740 Ga0228710_1000177 Ga0228710_100017713 327
2173 3300025254 Ga0209148_1001606 Ga0209148_10016065 327
2174 3300025258 Ga0209129_1001403 Ga0209129_10014035 327
2175 3300025272 Ga0209455_1001291 Ga0209455_10012914 327
2176 3300025273 Ga0209673_1014457 Ga0209673_10144572 327
2177 3300025273 Ga0209673_1028115 Ga0209673_10281152 327
2178 3300025294 Ga0209025_1014358 Ga0209025_10143582 327
2179 3300025295 Ga0209564_1003161 Ga0209564_10031612 327
2180 3300025297 Ga0209758_1000130 Ga0209758_100013099 327
2181 3300025297 Ga0209758_1028720 Ga0209758_10287202 327
2182 3300025299 Ga0209256_1008788 Ga0209256_10087887 327
2183 3300025299 Ga0209256_1013348 Ga0209256_10133482 327
2184 3300025302 Ga0207426_1006212 Ga0207426_10062124 327
2185 3300025303 Ga0209051_1004806 Ga0209051_10048066 327
2186 3300025303 Ga0209051_1005181 Ga0209051_10051816 327
2187 3300025304 Ga0209257_1003615 Ga0209257_10036156 327
2188 3300025315 Ga0207697_10026362 Ga0207697_100263622 327
2189 3300025899 Ga0207642_10056938 Ga0207642_100569382 327
2190 3300025900 Ga0207710_10004939 Ga0207710_100049392 327
2191 3300025901 Ga0207688_10000344 Ga0207688_100003445 327
2192 3300025901 Ga0207688_10238146 Ga0207688_102381461 327
2193 3300025903 Ga0207680_10038874 Ga0207680_100388742 327
2194 3300025904 Ga0207647_10030957 Ga0207647_100309572 327
2195 3300025906 Ga0207699_10096390 Ga0207699_100963902 327
2196 3300025907 Ga0207645_10007988 Ga0207645_100079885 327
2197 3300025907 Ga0207645_10013416 Ga0207645_100134163 327
2198 3300025908 Ga0207643_10008419 Ga0207643_100084194 327
2199 3300025910 Ga0207684_10203617 Ga0207684_102036172 327
2200 3300025911 Ga0207654_10122151 Ga0207654_101221512 327
2201 3300025914 Ga0207671_10210293 Ga0207671_102102931 327
2202 3300025915 Ga0207693_10004810 Ga0207693_1000481010 327
2203 3300025915 Ga0207693_10009374 Ga0207693_100093743 327
2204 3300025915 Ga0207693_10012513 Ga0207693_100125136 327
2205 3300025915 Ga0207693_10100901 Ga0207693_101009013 327
2206 3300025915 Ga0207693_10127360 Ga0207693_101273602 327
2207 3300025918 Ga0207662_10005862 Ga0207662_100058625 327
2208 3300025922 Ga0207646_10007326 Ga0207646_1000732611 327
2209 3300025922 Ga0207646_10103953 Ga0207646_101039532 327
2210 3300025923 Ga0207681_10028104 Ga0207681_100281043 327
2211 3300025923 Ga0207681_10041178 Ga0207681_100411781 327
2212 3300025926 Ga0207659_10019408 Ga0207659_100194082 327
2213 3300025928 Ga0207700_10286364 Ga0207700_102863641 327
2214 3300025931 Ga0207644_10007463 Ga0207644_100074632 327
2215 3300025931 Ga0207644_10053055 Ga0207644_100530552 327
2216 3300025933 Ga0207706_10003979 Ga0207706_100039798 327
2217 3300025933 Ga0207706_10377048 Ga0207706_103770481 327
2218 3300025934 Ga0207686_10023021 Ga0207686_100230212 327
2219 3300025935 Ga0207709_10013217 Ga0207709_100132172 327
2220 3300025936 Ga0207670_10004303 Ga0207670_100043033 327
2221 3300025936 Ga0207670_10010975 Ga0207670_100109754 327
2222 3300025936 Ga0207670_10107671 Ga0207670_101076712 327
2223 3300025937 Ga0207669_10145014 Ga0207669_101450141 327
2224 3300025938 Ga0207704_10010576 Ga0207704_100105762 327
2225 3300025938 Ga0207704_10123145 Ga0207704_101231452 327
2226 3300025939 Ga0207665_10217331 Ga0207665_102173312 327
2227 3300025940 Ga0207691_10005727 Ga0207691_100057277 327
2228 3300025940 Ga0207691_10080795 Ga0207691_100807953 327
2229 3300025941 Ga0207711_10257644 Ga0207711_102576442 327
2230 3300025942 Ga0207689_10023847 Ga0207689_100238474 327
2231 3300025960 Ga0207651_10045102 Ga0207651_100451023 327
2232 3300025961 Ga0207712_10013285 Ga0207712_100132854 327
2233 3300025972 Ga0207668_10137408 Ga0207668_101374082 327
2234 3300025986 Ga0207658_10155695 Ga0207658_101556951 327
2235 3300025986 Ga0207658_10433128 Ga0207658_104331281 327
2236 3300026035 Ga0207703_10011007 Ga0207703_100110076 327
2237 3300026041 Ga0207639_10087124 Ga0207639_100871241 327
2238 3300026067 Ga0207678_10010214 Ga0207678_100102142 327
2239 3300026067 Ga0207678_10535513 Ga0207678_105355131 327
2240 3300026075 Ga0207708_10003612 Ga0207708_100036126 327
2241 3300026075 Ga0207708_10229961 Ga0207708_102299612 327
2242 3300026078 Ga0207702_10029050 Ga0207702_100290503 327
2243 3300026088 Ga0207641_10010010 Ga0207641_100100105 327
2244 3300026095 Ga0207676_10001967 Ga0207676_100019679 327
2245 3300026116 Ga0207674_10181948 Ga0207674_101819482 327
2246 3300026118 Ga0207675_100012148 Ga0207675_1000121488 327
2247 3300026121 Ga0207683_10008437 Ga0207683_100084376 327
2248 3300026142 Ga0207698_10011789 Ga0207698_100117896 327
2249 3300027111 Ga0209281_1000082 Ga0209281_1000082246 327
2250 3300027111 Ga0209281_1000110 Ga0209281_1000110147 327
2251 3300027111 Ga0209281_1000459 Ga0209281_100045920 327
2252 3300027666 Ga0209282_1000006 Ga0209282_1000006268 327
2253 3300027671 Ga0209588_1031076 Ga0209588_10310762 327
2254 3300027907 Ga0207428_10006066 Ga0207428_100060664 327
2255 3300028381 Ga0268264_10008605 Ga0268264_100086056 327
2256 3300028794 Ga0307515_10012438 Ga0307515_100124383 327
2257 3300028794 Ga0307515_10138425 Ga0307515_101384252 327
2258 3300028794 Ga0307515_10300625 Ga0307515_103006251 327
2259 3300030522 Ga0307512_10145519 Ga0307512_101455192 327
2260 3300031241 Ga0265325_10001708 Ga0265325_1000170813 327
2261 3300031241 Ga0265325_10004418 Ga0265325_100044184 327
2262 3300031247 Ga0265340_10000573 Ga0265340_1000057318 327
2263 3300031247 Ga0265340_10009717 Ga0265340_100097175 327
2264 3300031249 Ga0265339_10001994 Ga0265339_100019947 327
2265 3300031456 Ga0307513_10065459 Ga0307513_100654592 327
2266 3300031595 Ga0265313_10000176 Ga0265313_100001768 327
2267 3300031595 Ga0265313_10006492 Ga0265313_100064927 327
2268 3300031665 Ga0316575_10023815 Ga0316575_100238153 327
2269 3300031712 Ga0265342_10000175 Ga0265342_1000017523 327
2270 3300031730 Ga0307516_10149293 Ga0307516_101492932 327
2271 3300031731 Ga0307405_10091050 Ga0307405_100910501 327
2272 3300031967 Ga0315914_1000003 Ga0315914_1000003323 327
2273 3300033430 Ga0315913_1000001 Ga0315913_1000001274 327
2274 3300033464 Ga0315915_1000008 Ga0315915_100000813 327
2275 3300034817 Ga0373948_0011197 Ga0373948_0011197_446_1429 327
2276 3300035089 Ga0373944_0008316 Ga0373944_0008316_313_1296 327
2277 3300035113 Ga0373936_0006776 Ga0373936_0006776_354_1337 327
2278 3300035116 Ga0373945_0011091 Ga0373945_0011091_972_1955 327
2279 3300035116 Ga0373945_0105284 Ga0373945_0105284_17_1000 327
2280 3300035117 Ga0373953_0003117 Ga0373953_0003117_2388_3371 327
2281 3300035118 Ga0373954_0006503 Ga0373954_0006503_854_1837 327
2282 3300035119 Ga0373956_0001924 Ga0373956_0001924_185_1168 327
2283 3300035120 Ga0373957_0093016 Ga0373957_0093016_164_1147 327
2284 3300035121 Ga0373960_0003540 Ga0373960_0003540_1403_2386 327
2285 3300035170 Ga0373943_0072402 Ga0373943_0072402_453_1436 327
2286 3300035171 Ga0373946_0024197 Ga0373946_0024197_914_1897 327
2287 3300035172 Ga0373955_0159577 Ga0373955_0159577_191_1174 327
2288 3300035691 Ga0373931_0015912 Ga0373931_0015912_1734_2717 327
2289 3300035691 Ga0373931_0025006 Ga0373931_0025006_1510_2493 327
2290 3300035692 Ga0373935_0205609 Ga0373935_0205609_45_1028 327
2291 3300035695 Ga0373927_0007289 Ga0373927_0007289_4612_5595 327
2292 3300035695 Ga0373927_0095942 Ga0373927_0095942_276_1259 327
2293 3300035724 Ga0373933_0002515 Ga0373933_0002515_8005_8988 327
2294 3300035725 Ga0373947_0025815 Ga0373947_0025815_990_1973 327
2295 3300035725 Ga0373947_0052934 Ga0373947_0052934_767_1750 327
2296 3300035725 Ga0373947_0084848 Ga0373947_0084848_706_1689 327
2297 3300035725 Ga0373947_0126297 Ga0373947_0126297_549_1532 327
2298 3300036401 Ga0373937_0001146 Ga0373937_0001146_16695_17678 327
2299 3300036401 Ga0373937_0318568 Ga0373937_0318568_188_1171 327
2300 3300037068 Ga0373925_0027273 Ga0373925_0027273_2039_3022 327
2301 3300037418 Ga0395900_0185454 Ga0395900_0185454_518_1501 327
2302 3300037471 Ga0395905_0087942 Ga0395905_0087942_334_1317 327
2303 3300038443 Ga0395901_0153653 Ga0395901_0153653_886_1869 327
2304 3300039437 Ga0436365_1673482 Ga0436365_1673482_278_1264 327
2305 3300039447 Ga0436361_0359473 Ga0436361_0359473_525_1556 327
2306 3300041408 Ga0439453_0004011 Ga0439453_0004011_1040_2023 327
2307 3300042007 Ga0439449_0006504 Ga0439449_0006504_1697_2680 327
2308 3300042126 Ga0450888_000640 Ga0450888_000640_113_1096 327
2309 3300042437 Ga0439444_0010606 Ga0439444_0010606_161_1144 327
2310 3300042439 Ga0439464_0029077 Ga0439464_0029077_419_1423 327
2311 3300044765 Ga0466970_0058045 Ga0466970_0058045_198_1214 327
2312 3300044842 Ga0466957_0040720 Ga0466957_0040720_987_1970 327
2313 3300046454 Ga0495592_0008218 Ga0495592_0008218_1401_2384 327
2314 3300046455 Ga0495603_0013575 Ga0495603_0013575_1279_2262 327
2315 3300046455 Ga0495603_0073805 Ga0495603_0073805_381_1364 327
2316 3300046459 Ga0495629_0010732 Ga0495629_0010732_3991_4974 327
2317 3300046460 Ga0495638_0003388 Ga0495638_0003388_8171_9154 327
2318 3300046460 Ga0495638_0004884 Ga0495638_0004884_2348_3331 327
2319 3300046460 Ga0495638_0059109 Ga0495638_0059109_713_1696 327
2320 3300046461 Ga0495641_0026188 Ga0495641_0026188_659_1642 327
2321 3300046462 Ga0495651_0003394 Ga0495651_0003394_8104_9087 327
2322 3300046463 Ga0495653_0012696 Ga0495653_0012696_4012_4995 327
2323 3300046471 Ga0495650_0034472 Ga0495650_0034472_285_1268 327
2324 3300046473 Ga0495582_0014056 Ga0495582_0014056_642_1625 327
2325 3300046474 Ga0495605_0000998 Ga0495605_0000998_12482_13465 327
2326 3300046475 Ga0495639_0039292 Ga0495639_0039292_170_1153 327
2327 3300046476 Ga0495662_0071800 Ga0495662_0071800_124_1107 327
2328 3300046476 Ga0495662_0111810 Ga0495662_0111810_137_1120 327
2329 3300046477 Ga0495664_0042324 Ga0495664_0042324_1242_2225 327
2330 3300046492 Ga0495585_0011596 Ga0495585_0011596_541_1524 327
2331 3300046501 Ga0495607_0046587 Ga0495607_0046587_501_1484 327
2332 3300046506 Ga0495583_0003578 Ga0495583_0003578_3032_4015 327
2333 3300046506 Ga0495583_0010063 Ga0495583_0010063_3674_4657 327
2334 3300046507 Ga0495606_0095951 Ga0495606_0095951_621_1604 327
2335 3300046511 Ga0495608_0002249 Ga0495608_0002249_4125_5108 327
2336 3300046512 Ga0495610_0002088 Ga0495610_0002088_11481_12464 327
2337 3300046512 Ga0495610_0031912 Ga0495610_0031912_1563_2549 327
2338 3300046513 Ga0495616_0015211 Ga0495616_0015211_2824_3807 327
2339 3300046514 Ga0495618_0001172 Ga0495618_0001172_3732_4715 327
2340 3300046516 Ga0495628_0036636 Ga0495628_0036636_1486_2469 327
2341 3300046517 Ga0495630_0079890 Ga0495630_0079890_498_1481 327
2342 3300046518 Ga0495631_0002952 Ga0495631_0002952_282_1265 327
2343 3300046519 Ga0495632_0019934 Ga0495632_0019934_2506_3489 327
2344 3300046519 Ga0495632_0039034 Ga0495632_0039034_556_1539 327
2345 3300046522 Ga0495643_0043383 Ga0495643_0043383_672_1655 327
2346 3300046522 Ga0495643_0109687 Ga0495643_0109687_335_1318 327
2347 3300046529 Ga0495652_0028155 Ga0495652_0028155_1150_2133 327
2348 3300046529 Ga0495652_0063179 Ga0495652_0063179_1291_2283 327
2349 3300046530 Ga0495654_0000258 Ga0495654_0000258_43114_44109 327
2350 3300046533 Ga0495640_0005042 Ga0495640_0005042_5697_6680 327
2351 3300046533 Ga0495640_0064896 Ga0495640_0064896_1088_2071 327
2352 3300046533 Ga0495640_0098706 Ga0495640_0098706_176_1168 327
2353 3300046536 Ga0495587_0009385 Ga0495587_0009385_2054_3037 327
2354 3300046538 Ga0495609_0024772 Ga0495609_0024772_1095_2078 327
2355 3300046538 Ga0495609_0059071 Ga0495609_0059071_242_1225 327
2356 3300046558 Ga0495633_0068402 Ga0495633_0068402_255_1238 327
2357 3300046559 Ga0495667_0014053 Ga0495667_0014053_477_1460 327
2358 3300046615 Ga0495656_0052249 Ga0495656_0052249_296_1279 327
2359 3300046615 Ga0495656_0104757 Ga0495656_0104757_134_1117 327
2360 3300046616 Ga0495668_0016948 Ga0495668_0016948_1298_2281 327
2361 3300046642 Ga0495634_0006047 Ga0495634_0006047_4896_5879 327
2362 3300046660 Ga0495625_0006387 Ga0495625_0006387_7329_8312 327
2363 3300046660 Ga0495625_0092453 Ga0495625_0092453_814_1797 327
2364 3300046663 Ga0495635_0178241 Ga0495635_0178241_308_1291 327
2365 3300046675 Ga0495657_0035630 Ga0495657_0035630_572_1555 327
2366 3300046678 Ga0495599_0005526 Ga0495599_0005526_1742_2725 327
2367 3300046678 Ga0495599_0079504 Ga0495599_0079504_931_1923 327
2368 3300046679 Ga0495623_0003882 Ga0495623_0003882_4191_5174 327
2369 3300046680 Ga0495646_0019315 Ga0495646_0019315_1827_2810 327
2370 3300046681 Ga0495647_0108254 Ga0495647_0108254_116_1099 327
2371 3300046683 Ga0495658_0012740 Ga0495658_0012740_583_1566 327
2372 3300046683 Ga0495658_0232336 Ga0495658_0232336_131_1114 327
2373 3300046684 Ga0495669_0080020 Ga0495669_0080020_473_1456 327
2374 3300046689 Ga0495613_0233661 Ga0495613_0233661_272_1255 327
2375 3300046689 Ga0495613_0280445 Ga0495613_0280445_37_1020 327
2376 3300046690 Ga0495624_0064122 Ga0495624_0064122_930_1913 327
2377 3300046691 Ga0495670_0063095 Ga0495670_0063095_302_1285 327
2378 3300046691 Ga0495670_0063856 Ga0495670_0063856_13_996 327
2379 3300046809 Ga0495600_0001574 Ga0495600_0001574_6978_7961 327
2380 3300046810 Ga0495660_0007210 Ga0495660_0007210_4582_5565 327
2381 3300047315 Ga0495581_0049865 Ga0495581_0049865_1179_2162 327
2382 3300047317 Ga0495604_0000150 Ga0495604_0000150_50855_51838 327
2383 3300047319 Ga0495674_0040455 Ga0495674_0040455_2894_3877 327
2384 3300047319 Ga0495674_0058092 Ga0495674_0058092_2012_2995 327
2385 3300047321 Ga0495676_0048721 Ga0495676_0048721_2030_3013 327
2386 3300047322 Ga0495680_0000699 Ga0495680_0000699_28786_29769 327
2387 3300047443 Ga0495687_016135 Ga0495687_016135_2060_3043 327
2388 3300047471 Ga0495684_0011394 Ga0495684_0011394_4047_5030 327
2389 3300047472 Ga0495686_0012523 Ga0495686_0012523_4429_5412 327
2390 3300047472 Ga0495686_0085933 Ga0495686_0085933_45_1040 327
2391 3300047472 Ga0495686_0126838 Ga0495686_0126838_245_1231 327
2392 3300047673 Ga0495593_0024774 Ga0495593_0024774_43_1026 327
2393 3300047673 Ga0495593_0041197 Ga0495593_0041197_1067_2050 327
2394 3300048088 Ga0495602_0018808 Ga0495602_0018808_1979_2962 327
2395 3300048903 Ga0496100_0092105 Ga0496100_0092105_1067_2050 327
2396 3300048903 Ga0496100_0284529 Ga0496100_0284529_231_1214 327
2397 3300048904 Ga0496101_0007599 Ga0496101_0007599_2337_3320 327
2398 3300048904 Ga0496101_0161732 Ga0496101_0161732_714_1697 327
2399 3300048904 Ga0496101_0227971 Ga0496101_0227971_14_997 327
2400 3300048904 Ga0496101_0296054 Ga0496101_0296054_52_1035 327
2401 3300048905 Ga0496102_0000871 Ga0496102_0000871_19667_20650 327
2402 3300048905 Ga0496102_0036824 Ga0496102_0036824_231_1214 327
2403 3300048905 Ga0496102_0089273 Ga0496102_0089273_1389_2399 327
2404 3300048905 Ga0496102_0131352 Ga0496102_0131352_578_1561 327
2405 3300048905 Ga0496102_0270142 Ga0496102_0270142_39_1022 327
2406 3300048906 Ga0496103_0003369 Ga0496103_0003369_7654_8637 327
2407 3300048906 Ga0496103_0005846 Ga0496103_0005846_123_1106 327
2408 3300048907 Ga0496104_0000445 Ga0496104_0000445_3593_4576 327
2409 3300048907 Ga0496104_0002378 Ga0496104_0002378_15056_16039 327
2410 3300048907 Ga0496104_0016654 Ga0496104_0016654_3355_4338 327
2411 3300048907 Ga0496104_0034739 Ga0496104_0034739_3142_4125 327
2412 3300048907 Ga0496104_0112248 Ga0496104_0112248_765_1748 327
2413 3300048907 Ga0496104_0145895 Ga0496104_0145895_124_1107 327
2414 3300048907 Ga0496104_0173119 Ga0496104_0173119_363_1373 327
2415 3300048907 Ga0496104_0188496 Ga0496104_0188496_359_1342 327
2416 3300048907 Ga0496104_0306548 Ga0496104_0306548_193_1176 327
2417 3300048907 Ga0496104_0346180 Ga0496104_0346180_285_1268 327
2418 3300048908 Ga0496105_0000514 Ga0496105_0000514_13742_14725 327
2419 3300048908 Ga0496105_0005876 Ga0496105_0005876_231_1214 327
2420 3300048908 Ga0496105_0006690 Ga0496105_0006690_4854_5837 327
2421 3300048908 Ga0496105_0012574 Ga0496105_0012574_3612_4595 327
2422 3300048908 Ga0496105_0053871 Ga0496105_0053871_1937_2920 327
2423 3300048909 Ga0496106_0129156 Ga0496106_0129156_322_1305 327
2424 3300048910 Ga0496107_0000769 Ga0496107_0000769_14323_15306 327
2425 3300048910 Ga0496107_0056732 Ga0496107_0056732_701_1684 327
2426 3300048910 Ga0496107_0139352 Ga0496107_0139352_83_1066 327
2427 3300048911 Ga0496108_0003421 Ga0496108_0003421_7387_8370 327
2428 3300048911 Ga0496108_0005811 Ga0496108_0005811_7343_8353 327
2429 3300048911 Ga0496108_0206057 Ga0496108_0206057_211_1194 327
2430 3300048911 Ga0496108_0245343 Ga0496108_0245343_281_1264 327
2431 3300048912 Ga0496109_0052258 Ga0496109_0052258_861_1871 327
2432 3300048912 Ga0496109_0052763 Ga0496109_0052763_2094_3077 327
2433 3300048912 Ga0496109_0100189 Ga0496109_0100189_1201_2184 327
2434 3300048912 Ga0496109_0230438 Ga0496109_0230438_582_1565 327
2435 3300048913 Ga0496110_0001539 Ga0496110_0001539_2243_3226 327
2436 3300048913 Ga0496110_0001886 Ga0496110_0001886_9445_10455 327
2437 3300048913 Ga0496110_0022057 Ga0496110_0022057_1177_2187 327
2438 3300048913 Ga0496110_0130702 Ga0496110_0130702_1197_2180 327
2439 3300048913 Ga0496110_0198313 Ga0496110_0198313_58_1041 327
2440 3300048913 Ga0496110_0397212 Ga0496110_0397212_24_1007 327
2441 3300048914 Ga0496111_0000072 Ga0496111_0000072_21691_22674 327
2442 3300048914 Ga0496111_0000641 Ga0496111_0000641_14616_15599 327
2443 3300048914 Ga0496111_0007231 Ga0496111_0007231_616_1626 327
2444 3300048914 Ga0496111_0009427 Ga0496111_0009427_2129_3112 327
2445 3300048914 Ga0496111_0017287 Ga0496111_0017287_215_1198 327
2446 3300048914 Ga0496111_0049553 Ga0496111_0049553_1875_2858 327
2447 3300048915 Ga0496112_0000112 Ga0496112_0000112_19188_20171 327
2448 3300048915 Ga0496112_0022204 Ga0496112_0022204_1143_2153 327
2449 3300048915 Ga0496112_0039797 Ga0496112_0039797_3592_4575 327
2450 3300048915 Ga0496112_0187003 Ga0496112_0187003_944_1927 327
2451 3300048915 Ga0496112_0266507 Ga0496112_0266507_48_1031 327
2452 3300048916 Ga0496113_0000058 Ga0496113_0000058_21725_22708 327
2453 3300048916 Ga0496113_0010750 Ga0496113_0010750_4373_5383 327
2454 3300048916 Ga0496113_0034796 Ga0496113_0034796_2420_3403 327
2455 3300048916 Ga0496113_0093805 Ga0496113_0093805_1285_2268 327
2456 3300048917 Ga0496114_0007803 Ga0496114_0007803_5277_6260 327
2457 3300048917 Ga0496114_0238531 Ga0496114_0238531_565_1548 327
2458 3300048918 Ga0496115_0027599 Ga0496115_0027599_3229_4212 327
2459 3300048918 Ga0496115_0055864 Ga0496115_0055864_709_1692 327
2460 3300048918 Ga0496115_0091711 Ga0496115_0091711_781_1764 327
2461 3300048918 Ga0496115_0103261 Ga0496115_0103261_1060_2055 327
2462 3300048918 Ga0496115_0132373 Ga0496115_0132373_447_1430 327
2463 3300048920 Ga0496117_0024058 Ga0496117_0024058_397_1380 327
2464 3300048922 Ga0496119_0034851 Ga0496119_0034851_566_1549 327
2465 3300048923 Ga0496120_0150688 Ga0496120_0150688_22_1005 327
2466 3300048924 Ga0496121_0000034 Ga0496121_0000034_175807_176790 327
2467 3300048924 Ga0496121_0155265 Ga0496121_0155265_481_1464 327
2468 3300048924 Ga0496121_0155763 Ga0496121_0155763_526_1509 327
2469 3300048925 Ga0496122_0000137 Ga0496122_0000137_22429_23412 327
2470 3300048925 Ga0496122_0023847 Ga0496122_0023847_593_1576 327
2471 3300048925 Ga0496122_0029495 Ga0496122_0029495_1069_2052 327
2472 3300048925 Ga0496122_0057097 Ga0496122_0057097_461_1447 327
2473 3300048925 Ga0496122_0057689 Ga0496122_0057689_1413_2396 327
2474 3300048926 Ga0496123_0000022 Ga0496123_0000022_145128_146111 327
2475 3300048926 Ga0496123_0154375 Ga0496123_0154375_75_1058 327
2476 3300048927 Ga0496124_0034417 Ga0496124_0034417_2016_2999 327
2477 3300048927 Ga0496124_0034422 Ga0496124_0034422_2687_3670 327
2478 3300048927 Ga0496124_0036141 Ga0496124_0036141_1396_2379 327
2479 3300048927 Ga0496124_0049497 Ga0496124_0049497_957_1940 327
2480 3300048927 Ga0496124_0108721 Ga0496124_0108721_711_1709 327
2481 3300048928 Ga0496125_0000030 Ga0496125_0000030_197713_198696 327
2482 3300048928 Ga0496125_0136186 Ga0496125_0136186_650_1633 327
2483 3300048929 Ga0496126_0084838 Ga0496126_0084838_1138_2124 327
2484 3300049459 Ga0495678_012901 Ga0495678_012901_2204_3187 327
2485 3300049568 Ga0501031_0012352 Ga0501031_0012352_459_1442 327
2486 3300049568 Ga0501031_0228223 Ga0501031_0228223_54_1040 327
2487 3300049569 Ga0501032_0016543 Ga0501032_0016543_1322_2308 327
2488 3300049569 Ga0501032_0215853 Ga0501032_0215853_135_1118 327
2489 3300049571 Ga0501034_0001131 Ga0501034_0001131_34884_35870 327
2490 3300049571 Ga0501034_0032682 Ga0501034_0032682_2090_3076 327
2491 3300049571 Ga0501034_0094910 Ga0501034_0094910_1071_2054 327
2492 3300049571 Ga0501034_0274978 Ga0501034_0274978_334_1317 327
2493 3300049572 Ga0501036_0000559 Ga0501036_0000559_2906_3889 327
2494 3300049572 Ga0501036_0003303 Ga0501036_0003303_4211_5197 327
2495 3300049572 Ga0501036_0375031 Ga0501036_0375031_54_1037 327
2496 3300049573 Ga0501037_0018455 Ga0501037_0018455_3772_4758 327
2497 3300049573 Ga0501037_0214723 Ga0501037_0214723_192_1175 327
2498 3300049573 Ga0501037_0246140 Ga0501037_0246140_156_1184 327
2499 3300049576 Ga0501040_0204409 Ga0501040_0204409_53_1036 327
2500 3300049579 Ga0501043_0044063 Ga0501043_0044063_741_1727 327
2501 3300049579 Ga0501043_0212217 Ga0501043_0212217_456_1439 327
2502 3300049581 Ga0501047_0017683 Ga0501047_0017683_4177_5163 327
2503 3300049582 Ga0501048_0287435 Ga0501048_0287435_132_1118 327
2504 3300049583 Ga0501067_0069865 Ga0501067_0069865_637_1623 327
2505 3300049584 Ga0501068_0021116 Ga0501068_0021116_1493_2479 327
2506 3300049584 Ga0501068_0204433 Ga0501068_0204433_232_1218 327
2507 3300049585 Ga0501069_0026629 Ga0501069_0026629_399_1385 327
2508 3300049585 Ga0501069_0033702 Ga0501069_0033702_244_1230 327
2509 3300049586 Ga0501070_0005894 Ga0501070_0005894_4693_5679 327
2510 3300049586 Ga0501070_0301677 Ga0501070_0301677_110_1093 327
2511 3300049589 Ga0501073_0065647 Ga0501073_0065647_652_1638 327
2512 3300049589 Ga0501073_0100648 Ga0501073_0100648_987_1970 327
2513 3300049589 Ga0501073_0209012 Ga0501073_0209012_152_1138 327
2514 3300049741 Ga0501079_0118501 Ga0501079_0118501_364_1350 327
2515 3300049741 Ga0501079_0194645 Ga0501079_0194645_208_1194 327
2516 3300049742 Ga0501080_0022690 Ga0501080_0022690_4211_5197 327
2517 3300049742 Ga0501080_0378711 Ga0501080_0378711_79_1065 327
2518 3300049744 Ga0501083_0014948 Ga0501083_0014948_4100_5086 327
2519 3300049744 Ga0501083_0116923 Ga0501083_0116923_474_1457 327
2520 3300049822 Ga0501035_0000127 Ga0501035_0000127_86769_87755 327
2521 3300049822 Ga0501035_0004040 Ga0501035_0004040_3958_4944 327
2522 3300049823 Ga0501044_0036318 Ga0501044_0036318_2721_3704 327
2523 3300049823 Ga0501044_0089568 Ga0501044_0089568_525_1508 327
2524 3300049823 Ga0501044_0172623 Ga0501044_0172623_919_1905 327
2525 3300049823 Ga0501044_0472676 Ga0501044_0472676_21_1007 327
2526 3300050491 nmdc:mga00v17_15278_c1 nmdc:mga00v17_15278_c1_2089_3072 327
2527 3300050492 nmdc:mga0yw44_180716_c1 nmdc:mga0yw44_180716_c1_16_999 327
2528 3300050492 nmdc:mga0yw44_30581_c1 nmdc:mga0yw44_30581_c1_1572_2555 327
2529 3300050492 nmdc:mga0yw44_35481_c1 nmdc:mga0yw44_35481_c1_228_1211 327
2530 3300050492 nmdc:mga0yw44_72364_c1 nmdc:mga0yw44_72364_c1_118_1101 327
2531 3300050494 nmdc:mga06z11_151928_c1 nmdc:mga06z11_151928_c1_147_1130 327
2532 3300050494 nmdc:mga06z11_23381_c1 nmdc:mga06z11_23381_c1_1142_2125 327
2533 3300050495 nmdc:mga04h51_3760_c1 nmdc:mga04h51_3760_c1_1932_2915 327
2534 3300050507 nmdc:mga05p37_210744_c1 nmdc:mga05p37_210744_c1_536_1519 327
2535 3300050507 nmdc:mga05p37_26679_c1 nmdc:mga05p37_26679_c1_4714_5697 327
2536 3300050507 nmdc:mga05p37_268_c1 nmdc:mga05p37_268_c1_37062_38066 327
2537 3300050508 nmdc:mga09592_11852_c1 nmdc:mga09592_11852_c1_1650_2654 327
2538 3300050509 nmdc:mga0qj67_26592_c1 nmdc:mga0qj67_26592_c1_2654_3637 327
2539 3300050510 nmdc:mga06r32_133_c1 nmdc:mga06r32_133_c1_14139_15143 327
2540 3300050510 nmdc:mga06r32_29045_c1 nmdc:mga06r32_29045_c1_4013_4996 327
2541 3300050510 nmdc:mga06r32_51265_c1 nmdc:mga06r32_51265_c1_604_1587 327
2542 3300050510 nmdc:mga06r32_641990_c1 nmdc:mga06r32_641990_c1_32_1015 327
2543 3300050511 nmdc:mga08y16_604_c1 nmdc:mga08y16_604_c1_3731_4735 327
2544 3300050512 nmdc:mga0n895_112572_c1 nmdc:mga0n895_112572_c1_191_1174 327
2545 3300050512 nmdc:mga0n895_35109_c1 nmdc:mga0n895_35109_c1_3009_3992 327
2546 3300053078 Ga0495612_0003729 Ga0495612_0003729_3663_4646 327
2547 3300053079 Ga0500610_0024158 Ga0500610_0024158_1268_2251 327
2548 3300053083 Ga0495655_0003940 Ga0495655_0003940_799_1782 327
2549 3300053083 Ga0495655_0004297 Ga0495655_0004297_1394_2377 327
2550 3300053084 Ga0495595_0000221 Ga0495595_0000221_18813_19796 327
2551 3300053085 Ga0495619_0001997 Ga0495619_0001997_7550_8533 327
2552 3300053085 Ga0495619_0008018 Ga0495619_0008018_3502_4485 327
2553 3300053088 Ga0500644_0001056 Ga0500644_0001056_2400_3383 327
2554 3300053088 Ga0500644_0092833 Ga0500644_0092833_57_1043 327
2555 3300053093 Ga0500651_0013102 Ga0500651_0013102_2441_3424 327
2556 3300053094 Ga0500566_0023437 Ga0500566_0023437_1624_2610 327
2557 3300053094 Ga0500566_0037748 Ga0500566_0037748_1438_2421 327
2558 3300053105 Ga0500557_000228 Ga0500557_000228_1620_2603 327
2559 3300053108 Ga0500562_019931 Ga0500562_019931_273_1256 327
2560 3300053109 Ga0500569_003783 Ga0500569_003783_1699_2682 327
2561 3300053118 Ga0500594_0006340 Ga0500594_0006340_1199_2182 327
2562 3300053119 Ga0500595_000010 Ga0500595_000010_112030_113013 327
2563 3300053119 Ga0500595_000045 Ga0500595_000045_71678_72664 327
2564 3300053125 Ga0500618_000045 Ga0500618_000045_81668_82663 327
2565 3300053131 Ga0500652_093992 Ga0500652_093992_259_1242 327
2566 3300053134 Ga0500658_0011471 Ga0500658_0011471_823_1809 327
2567 3300053139 Ga0500568_0004036 Ga0500568_0004036_2206_3189 327
2568 3300053142 Ga0500577_0018815 Ga0500577_0018815_816_1802 327
2569 3300053153 Ga0500616_0000001 Ga0500616_0000001_710251_711234 327
2570 3300053153 Ga0500616_0000093 Ga0500616_0000093_52164_53159 327
2571 3300053153 Ga0500616_0001502 Ga0500616_0001502_18267_19250 327
2572 3300053161 Ga0500634_0001341 Ga0500634_0001341_144_1127 327
2573 3300053730 Ga0500645_000051 Ga0500645_000051_42504_43487 327
2574 3300054114 Ga0501084_0036290 Ga0501084_0036290_1539_2522 327
2575 3300054114 Ga0501084_0037753 Ga0501084_0037753_1256_2239 327
2576 3300054114 Ga0501084_0111778 Ga0501084_0111778_181_1164 327
2577 3300054114 Ga0501084_0142028 Ga0501084_0142028_171_1157 327
2578 3300061734 Ga0530510_0114488 Ga0530510_0114488_216_1199 327
2579 3300002773 JGI25152J39213_1000531 JGI25152J39213_10005313 328
2580 3300002773 JGI25152J39213_1002315 JGI25152J39213_10023153 328
2581 3300002774 JGI25150J39212_1000024 JGI25150J39212_100002449 328
2582 3300002987 JGI25159J45721_1001556 JGI25159J45721_10015567 328
2583 3300003187 JGI25151J46595_10000027 JGI25151J46595_10000027114 328
2584 3300003215 JGI25153J46596_10000012 JGI25153J46596_10000012265 328
2585 3300003215 JGI25153J46596_10000517 JGI25153J46596_100005175 328
2586 3300003354 JGI25160J50197_1000001 JGI25160J50197_100000180 328
2587 3300003374 JGI25161J50226_1000047 JGI25161J50226_100004724 328
2588 3300003771 Ga0055526_1017984 Ga0055526_10179842 328
2589 3300003775 Ga0055524_1013029 Ga0055524_10130292 328
2590 3300003790 Ga0055528_1001182 Ga0055528_10011825 328
2591 3300003794 Ga0055531_10013033 Ga0055531_100130332 328
2592 3300003856 Ga0058692_1001178 Ga0058692_10011782 328
2593 3300003856 Ga0058692_1001422 Ga0058692_10014226 328
2594 3300003856 Ga0058692_1001511 Ga0058692_10015117 328
2595 3300004625 Ga0055543_1000007 Ga0055543_1000007115 328
2596 3300005262 Ga0065165_1000357 Ga0065165_100035723 328
2597 3300005262 Ga0065165_1008048 Ga0065165_10080483 328
2598 3300005331 Ga0070670_100011566 Ga0070670_1000115664 328
2599 3300005335 Ga0070666_10229508 Ga0070666_102295082 328
2600 3300005353 Ga0070669_100124486 Ga0070669_1001244861 328
2601 3300005354 Ga0070675_100154306 Ga0070675_1001543062 328
2602 3300005355 Ga0070671_100009666 Ga0070671_1000096666 328
2603 3300005366 Ga0070659_100129972 Ga0070659_1001299722 328
2604 3300005467 Ga0070706_100182407 Ga0070706_1001824074 328
2605 3300005471 Ga0070698_100319420 Ga0070698_1003194201 328
2606 3300005518 Ga0070699_100296574 Ga0070699_1002965741 328
2607 3300005535 Ga0070684_100155473 Ga0070684_1001554731 328
2608 3300005548 Ga0070665_100000961 Ga0070665_1000009614 328
2609 3300005548 Ga0070665_100075185 Ga0070665_1000751853 328
2610 3300005577 Ga0068857_100443489 Ga0068857_1004434892 328
2611 3300005844 Ga0068862_100010969 Ga0068862_1000109695 328
2612 3300006028 Ga0070717_10048238 Ga0070717_100482383 328
2613 3300006038 Ga0075365_10121269 Ga0075365_101212691 328
2614 3300006042 Ga0075368_10006600 Ga0075368_100066003 328
2615 3300006048 Ga0075363_100008322 Ga0075363_1000083224 328
2616 3300006051 Ga0075364_10159130 Ga0075364_101591302 328
2617 3300006173 Ga0070716_100020794 Ga0070716_1000207944 328
2618 3300006177 Ga0075362_10020700 Ga0075362_100207002 328
2619 3300006186 Ga0075369_10033295 Ga0075369_100332952 328
2620 3300006948 Ga0099826_10000120 Ga0099826_1000012021 328
2621 3300006948 Ga0099826_10010203 Ga0099826_100102034 328
2622 3300009148 Ga0105243_10002537 Ga0105243_100025378 328
2623 3300010375 Ga0105239_10248504 Ga0105239_102485042 328
2624 3300011119 Ga0105246_10211931 Ga0105246_102119312 328
2625 3300011119 Ga0105246_10213339 Ga0105246_102133392 328
2626 3300013100 Ga0157373_10049569 Ga0157373_100495692 328
2627 3300013102 Ga0157371_10111413 Ga0157371_101114132 328
2628 3300013104 Ga0157370_10000324 Ga0157370_1000032442 328
2629 3300014325 Ga0163163_10104374 Ga0163163_101043742 328
2630 3300015265 Ga0182005_1029798 Ga0182005_10297981 328
2631 3300021388 Ga0213875_10014809 Ga0213875_100148092 328
2632 3300025245 Ga0207425_1000043 Ga0207425_1000043112 328
2633 3300025258 Ga0209129_1000072 Ga0209129_100007282 328
2634 3300025258 Ga0209129_1000226 Ga0209129_100022617 328
2635 3300025273 Ga0209673_1000239 Ga0209673_100023985 328
2636 3300025284 Ga0209130_1000145 Ga0209130_100014580 328
2637 3300025284 Ga0209130_1015990 Ga0209130_10159902 328
2638 3300025294 Ga0209025_1000120 Ga0209025_100012082 328
2639 3300025294 Ga0209025_1001416 Ga0209025_100141624 328
2640 3300025294 Ga0209025_1001755 Ga0209025_10017553 328
2641 3300025295 Ga0209564_1014218 Ga0209564_10142183 328
2642 3300025297 Ga0209758_1000059 Ga0209758_100005922 328
2643 3300025297 Ga0209758_1000111 Ga0209758_100011182 328
2644 3300025297 Ga0209758_1022623 Ga0209758_10226232 328
2645 3300025298 Ga0209050_1004722 Ga0209050_100472210 328
2646 3300025299 Ga0209256_1000619 Ga0209256_100061935 328
2647 3300025302 Ga0207426_1000011 Ga0207426_100001180 328
2648 3300025303 Ga0209051_1008002 Ga0209051_10080022 328
2649 3300025303 Ga0209051_1027204 Ga0209051_10272041 328
2650 3300025304 Ga0209257_1000997 Ga0209257_100099716 328
2651 3300025903 Ga0207680_10292765 Ga0207680_102927651 328
2652 3300025910 Ga0207684_10193153 Ga0207684_101931533 328
2653 3300025925 Ga0207650_10022208 Ga0207650_100222083 328
2654 3300025929 Ga0207664_10082568 Ga0207664_100825683 328
2655 3300025929 Ga0207664_10281055 Ga0207664_102810551 328
2656 3300025931 Ga0207644_10008328 Ga0207644_100083288 328
2657 3300025933 Ga0207706_10078106 Ga0207706_100781062 328
2658 3300025939 Ga0207665_10148182 Ga0207665_101481822 328
2659 3300025960 Ga0207651_10067158 Ga0207651_100671582 328
2660 3300026116 Ga0207674_10176613 Ga0207674_101766132 328
2661 3300026121 Ga0207683_10287481 Ga0207683_102874811 328
2662 3300027312 Ga0209371_1000037 Ga0209371_1000037179 328
2663 3300027312 Ga0209371_1000534 Ga0209371_10005345 328
2664 3300027312 Ga0209371_1000686 Ga0209371_10006862 328
2665 3300027312 Ga0209371_1006547 Ga0209371_10065474 328
2666 3300027666 Ga0209282_1003316 Ga0209282_10033166 328
2667 3300027866 Ga0209813_10003330 Ga0209813_100033303 328
2668 3300028379 Ga0268266_10001956 Ga0268266_100019563 328
2669 3300028794 Ga0307515_10001890 Ga0307515_1000189019 328
2670 3300028794 Ga0307515_10048889 Ga0307515_100488897 328
2671 3300030500 Ga0268256_1000039 Ga0268256_1000039129 328
2672 3300030500 Ga0268256_1001706 Ga0268256_100170611 328
2673 3300030500 Ga0268256_1004290 Ga0268256_10042903 328
2674 3300030500 Ga0268256_1005810 Ga0268256_10058104 328
2675 3300030744 Ga0316181_1049652 Ga0316181_10496524 328
2676 3300031456 Ga0307513_10327763 Ga0307513_103277632 328
2677 3300031727 Ga0316576_10025908 Ga0316576_100259085 328
2678 3300031728 Ga0316578_10019852 Ga0316578_100198523 328
2679 3300031731 Ga0307405_10021829 Ga0307405_100218293 328
2680 3300031901 Ga0307406_10208623 Ga0307406_102086232 328
2681 3300031911 Ga0307412_10004632 Ga0307412_100046323 328
2682 3300031995 Ga0307409_100037634 Ga0307409_1000376343 328
2683 3300032004 Ga0307414_10037748 Ga0307414_100377483 328
2684 3300032004 Ga0307414_10150389 Ga0307414_101503892 328
2685 3300035170 Ga0373943_0120506 Ga0373943_0120506_23_1018 328
2686 3300035172 Ga0373955_0146999 Ga0373955_0146999_23_1018 328
2687 3300035398 Ga0316574_0166237 Ga0316574_0166237_351_1352 328
2688 3300035410 Ga0373924_0066750 Ga0373924_0066750_368_1363 328
2689 3300035691 Ga0373931_0216702 Ga0373931_0216702_61_1050 328
2690 3300035724 Ga0373933_0124702 Ga0373933_0124702_192_1187 328
2691 3300035725 Ga0373947_0287859 Ga0373947_0287859_58_1053 328
2692 3300036401 Ga0373937_0052053 Ga0373937_0052053_1427_2422 328
2693 3300037068 Ga0373925_0113013 Ga0373925_0113013_317_1312 328
2694 3300037312 Ga0395899_0169900 Ga0395899_0169900_279_1274 328
2695 3300037418 Ga0395900_0452707 Ga0395900_0452707_132_1127 328
2696 3300037471 Ga0395905_0108653 Ga0395905_0108653_688_1674 328
2697 3300037471 Ga0395905_0109022 Ga0395905_0109022_1562_2548 328
2698 3300037853 Ga0436364_0774424 Ga0436364_0774424_64_1059 328
2699 3300038443 Ga0395901_0200004 Ga0395901_0200004_483_1478 328
2700 3300038443 Ga0395901_0581085 Ga0395901_0581085_34_1023 328
2701 3300039437 Ga0436365_1644321 Ga0436365_1644321_1536_2531 328
2702 3300046473 Ga0495582_0061613 Ga0495582_0061613_102_1097 328
2703 3300046501 Ga0495607_0000153 Ga0495607_0000153_17657_18649 328
2704 3300046507 Ga0495606_0002805 Ga0495606_0002805_3129_4115 328
2705 3300046507 Ga0495606_0140452 Ga0495606_0140452_397_1383 328
2706 3300046511 Ga0495608_0095522 Ga0495608_0095522_55_1050 328
2707 3300046522 Ga0495643_0071616 Ga0495643_0071616_453_1463 328
2708 3300046526 Ga0495666_0127107 Ga0495666_0127107_68_1063 328
2709 3300046558 Ga0495633_0092161 Ga0495633_0092161_249_1235 328
2710 3300046660 Ga0495625_0089615 Ga0495625_0089615_1051_2040 328
2711 3300046660 Ga0495625_0115376 Ga0495625_0115376_448_1434 328
2712 3300046674 Ga0495588_0000431 Ga0495588_0000431_7521_8558 328
2713 3300046679 Ga0495623_0030375 Ga0495623_0030375_516_1511 328
2714 3300046690 Ga0495624_0042972 Ga0495624_0042972_447_1442 328
2715 3300046692 Ga0495671_0029760 Ga0495671_0029760_709_1746 328
2716 3300047317 Ga0495604_0085328 Ga0495604_0085328_1039_2034 328
2717 3300047319 Ga0495674_0061596 Ga0495674_0061596_845_1840 328
2718 3300047322 Ga0495680_0287053 Ga0495680_0287053_112_1107 328
2719 3300047470 Ga0495681_0005448 Ga0495681_0005448_7511_8497 328
2720 3300047472 Ga0495686_0000422 Ga0495686_0000422_47144_48130 328
2721 3300048088 Ga0495602_0070373 Ga0495602_0070373_322_1317 328
2722 3300048903 Ga0496100_0207717 Ga0496100_0207717_293_1279 328
2723 3300048904 Ga0496101_0289863 Ga0496101_0289863_251_1237 328
2724 3300048915 Ga0496112_0120503 Ga0496112_0120503_977_1972 328
2725 3300048915 Ga0496112_0124913 Ga0496112_0124913_995_1990 328
2726 3300048919 Ga0496116_0000057 Ga0496116_0000057_179649_180635 328
2727 3300048919 Ga0496116_0012408 Ga0496116_0012408_2733_3770 328
2728 3300048919 Ga0496116_0012509 Ga0496116_0012509_5188_6174 328
2729 3300048919 Ga0496116_0019060 Ga0496116_0019060_780_1766 328
2730 3300048919 Ga0496116_0040535 Ga0496116_0040535_1465_2451 328
2731 3300048920 Ga0496117_0000031 Ga0496117_0000031_216943_217980 328
2732 3300048920 Ga0496117_0011023 Ga0496117_0011023_6165_7151 328
2733 3300048920 Ga0496117_0014595 Ga0496117_0014595_4559_5545 328
2734 3300048920 Ga0496117_0031515 Ga0496117_0031515_342_1328 328
2735 3300048921 Ga0496118_0007166 Ga0496118_0007166_3979_5016 328
2736 3300048921 Ga0496118_0017115 Ga0496118_0017115_535_1521 328
2737 3300048921 Ga0496118_0056878 Ga0496118_0056878_775_1761 328
2738 3300048921 Ga0496118_0110647 Ga0496118_0110647_30_1016 328
2739 3300048922 Ga0496119_0008094 Ga0496119_0008094_5060_6046 328
2740 3300048923 Ga0496120_0000337 Ga0496120_0000337_66144_67181 328
2741 3300048923 Ga0496120_0021465 Ga0496120_0021465_1890_2876 328
2742 3300048924 Ga0496121_0002534 Ga0496121_0002534_2907_3893 328
2743 3300048924 Ga0496121_0026378 Ga0496121_0026378_4476_5462 328
2744 3300048924 Ga0496121_0030244 Ga0496121_0030244_2775_3761 328
2745 3300048924 Ga0496121_0064178 Ga0496121_0064178_1797_2807 328
2746 3300048924 Ga0496121_0112075 Ga0496121_0112075_54_1040 328
2747 3300048924 Ga0496121_0112864 Ga0496121_0112864_807_1793 328
2748 3300048924 Ga0496121_0145201 Ga0496121_0145201_434_1420 328
2749 3300048925 Ga0496122_0000023 Ga0496122_0000023_216931_217968 328
2750 3300048925 Ga0496122_0013243 Ga0496122_0013243_1066_2052 328
2751 3300048925 Ga0496122_0015622 Ga0496122_0015622_5482_6468 328
2752 3300048925 Ga0496122_0041958 Ga0496122_0041958_2353_3363 328
2753 3300048925 Ga0496122_0042708 Ga0496122_0042708_1595_2584 328
2754 3300048925 Ga0496122_0082611 Ga0496122_0082611_179_1165 328
2755 3300048925 Ga0496122_0134606 Ga0496122_0134606_445_1431 328
2756 3300048926 Ga0496123_0000027 Ga0496123_0000027_163068_164105 328
2757 3300048926 Ga0496123_0006417 Ga0496123_0006417_917_1903 328
2758 3300048926 Ga0496123_0026974 Ga0496123_0026974_1170_2156 328
2759 3300048926 Ga0496123_0151012 Ga0496123_0151012_85_1071 328
2760 3300048926 Ga0496123_0165177 Ga0496123_0165177_149_1135 328
2761 3300048927 Ga0496124_0000174 Ga0496124_0000174_65736_66743 328
2762 3300048927 Ga0496124_0001771 Ga0496124_0001771_15976_16962 328
2763 3300048927 Ga0496124_0006219 Ga0496124_0006219_5696_6682 328
2764 3300048927 Ga0496124_0026047 Ga0496124_0026047_3379_4365 328
2765 3300048927 Ga0496124_0178713 Ga0496124_0178713_368_1378 328
2766 3300048928 Ga0496125_0012335 Ga0496125_0012335_3697_4683 328
2767 3300048928 Ga0496125_0035505 Ga0496125_0035505_221_1213 328
2768 3300048928 Ga0496125_0069923 Ga0496125_0069923_1066_2052 328
2769 3300048928 Ga0496125_0154175 Ga0496125_0154175_258_1244 328
2770 3300048929 Ga0496126_0000115 Ga0496126_0000115_179590_180576 328
2771 3300048929 Ga0496126_0074572 Ga0496126_0074572_1661_2647 328
2772 3300048929 Ga0496126_0121485 Ga0496126_0121485_728_1714 328
2773 3300049568 Ga0501031_0090643 Ga0501031_0090643_581_1570 328
2774 3300049569 Ga0501032_0001879 Ga0501032_0001879_9133_10122 328
2775 3300049570 Ga0501033_0004368 Ga0501033_0004368_3751_4740 328
2776 3300049570 Ga0501033_0091662 Ga0501033_0091662_934_1923 328
2777 3300049570 Ga0501033_0160838 Ga0501033_0160838_486_1475 328
2778 3300049571 Ga0501034_0000162 Ga0501034_0000162_50112_51098 328
2779 3300049572 Ga0501036_0195620 Ga0501036_0195620_88_1077 328
2780 3300049573 Ga0501037_0095581 Ga0501037_0095581_300_1289 328
2781 3300049573 Ga0501037_0120734 Ga0501037_0120734_727_1716 328
2782 3300049574 Ga0501038_0005084 Ga0501038_0005084_962_1951 328
2783 3300049574 Ga0501038_0011772 Ga0501038_0011772_6576_7565 328
2784 3300049575 Ga0501039_0005792 Ga0501039_0005792_3302_4291 328
2785 3300049579 Ga0501043_0003174 Ga0501043_0003174_359_1348 328
2786 3300049580 Ga0501046_0001837 Ga0501046_0001837_10219_11208 328
2787 3300049580 Ga0501046_0223548 Ga0501046_0223548_143_1132 328
2788 3300049581 Ga0501047_0038887 Ga0501047_0038887_3138_4127 328
2789 3300049582 Ga0501048_0031194 Ga0501048_0031194_1541_2530 328
2790 3300049584 Ga0501068_0014566 Ga0501068_0014566_2925_3914 328
2791 3300049584 Ga0501068_0039568 Ga0501068_0039568_368_1357 328
2792 3300049585 Ga0501069_0002411 Ga0501069_0002411_3038_4027 328
2793 3300049586 Ga0501070_0028069 Ga0501070_0028069_213_1202 328
2794 3300049586 Ga0501070_0082113 Ga0501070_0082113_513_1664 328
2795 3300049589 Ga0501073_0001201 Ga0501073_0001201_6661_7650 328
2796 3300049589 Ga0501073_0005720 Ga0501073_0005720_7228_8217 328
2797 3300049589 Ga0501073_0006498 Ga0501073_0006498_2033_3184 328
2798 3300049589 Ga0501073_0202869 Ga0501073_0202869_274_1305 328
2799 3300049590 Ga0501074_0005855 Ga0501074_0005855_380_1369 328
2800 3300049742 Ga0501080_0007728 Ga0501080_0007728_8546_9535 328
2801 3300049742 Ga0501080_0016485 Ga0501080_0016485_1654_2805 328
2802 3300049742 Ga0501080_0318785 Ga0501080_0318785_188_1177 328
2803 3300049742 Ga0501080_0369927 Ga0501080_0369927_144_1175 328
2804 3300049744 Ga0501083_0014715 Ga0501083_0014715_963_1952 328
2805 3300049744 Ga0501083_0015468 Ga0501083_0015468_500_1489 328
2806 3300049744 Ga0501083_0016876 Ga0501083_0016876_400_1551 328
2807 3300049822 Ga0501035_0002914 Ga0501035_0002914_8845_9834 328
2808 3300049822 Ga0501035_0114415 Ga0501035_0114415_667_1656 328
2809 3300049822 Ga0501035_0155418 Ga0501035_0155418_631_1632 328
2810 3300049823 Ga0501044_0004042 Ga0501044_0004042_12984_13973 328
2811 3300049823 Ga0501044_0272868 Ga0501044_0272868_500_1489 328
2812 3300049823 Ga0501044_0378722 Ga0501044_0378722_74_1063 328
2813 3300050489 nmdc:mga03683_23316_c1 nmdc:mga03683_23316_c1_221_1258 328
2814 3300050490 nmdc:mga03n38_2857_c1 nmdc:mga03n38_2857_c1_3366_4403 328
2815 3300050491 nmdc:mga00v17_150906_c1 nmdc:mga00v17_150906_c1_240_1229 328
2816 3300050491 nmdc:mga00v17_183_c1 nmdc:mga00v17_183_c1_13136_14173 328
2817 3300050492 nmdc:mga0yw44_751_c1 nmdc:mga0yw44_751_c1_7794_8831 328
2818 3300050494 nmdc:mga06z11_53691_c1 nmdc:mga06z11_53691_c1_688_1725 328
2819 3300050494 nmdc:mga06z11_54516_c1 nmdc:mga06z11_54516_c1_177_1214 328
2820 3300050516 nmdc:mga0sz30_80_c1 nmdc:mga0sz30_80_c1_974_2011 328
2821 3300053090 Ga0500646_0017598 Ga0500646_0017598_434_1423 328
2822 3300053107 Ga0500560_049602 Ga0500560_049602_254_1291 328
2823 3300053130 Ga0500642_0006925 Ga0500642_0006925_1329_2318 328
2824 3300053137 Ga0500561_0000591 Ga0500561_0000591_1650_2687 328
2825 3300053139 Ga0500568_0001521 Ga0500568_0001521_12055_13044 328
2826 3300053151 Ga0500604_0002220 Ga0500604_0002220_905_1894 328
2827 3300053153 Ga0500616_0000539 Ga0500616_0000539_1038_2027 328
2828 3300053157 Ga0500624_000519 Ga0500624_000519_10003_10989 328
2829 3300053158 Ga0500627_0088520 Ga0500627_0088520_59_1045 328
2830 3300053731 Ga0500609_001805 Ga0500609_001805_1290_2279 328
2831 3300054114 Ga0501084_0017572 Ga0501084_0017572_3574_4563 328
2832 3300054114 Ga0501084_0405285 Ga0501084_0405285_26_1015 328
2833 3300060353 Ga0501082_0005230 Ga0501082_0005230_3919_4908 328
2834 iso_pu_bacteria 2643221698 2644541540 328
2835 3300005262 Ga0065165_1000313 Ga0065165_100031349 329
2836 3300005439 Ga0070711_100250879 Ga0070711_1002508791 329
2837 3300005616 Ga0068852_100064598 Ga0068852_1000645983 329
2838 3300006846 Ga0075430_100082381 Ga0075430_1000823813 329
2839 3300006847 Ga0075431_100337982 Ga0075431_1003379822 329
2840 3300010375 Ga0105239_10103610 Ga0105239_101036102 329
2841 3300013105 Ga0157369_10005525 Ga0157369_100055255 329
2842 3300013307 Ga0157372_10096778 Ga0157372_100967785 329
2843 3300025284 Ga0209130_1000209 Ga0209130_100020924 329
2844 3300025294 Ga0209025_1014934 Ga0209025_10149342 329
2845 3300025302 Ga0207426_1009460 Ga0207426_10094605 329
2846 3300026078 Ga0207702_10120775 Ga0207702_101207751 329
2847 3300031995 Ga0307409_100540779 Ga0307409_1005407791 329
2848 3300037471 Ga0395905_0000247 Ga0395905_0000247_3906_4898 329
2849 3300049592 Ga0501076_0423612 Ga0501076_0423612_49_1056 329
2850 3300050510 nmdc:mga06r32_114999_c1 nmdc:mga06r32_114999_c1_342_1349 329
2851 iso_pu_bacteria 2909042592 2909046450 330
2852 3300048929 Ga0496126_0207275 Ga0496126_0207275_163_1167 332
2853 3300053122 Ga0500608_125193 Ga0500608_125193_93_1097 332
2854 3300021388 Ga0213875_10156609 Ga0213875_101566091 333
2855 3300037853 Ga0436364_0031070 Ga0436364_0031070_1059_2060 333
2856 3300037853 Ga0436364_0155142 Ga0436364_0155142_176_1177 333
2857 3300001979 JGI24740J21852_10021610 JGI24740J21852_100216102 334
2858 3300006186 Ga0075369_10020387 Ga0075369_100203872 334
2859 3300050516 nmdc:mga0sz30_5131_c1 nmdc:mga0sz30_5131_c1_3192_4196 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

24

191

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

264

0.86

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

27

198

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

27

208

0.8

PF07993

NAD_binding_4

Male sterility protein

74

227

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hrz-assembly1.cif.gz_A-2 the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens 0.9721 1 332
2hrz-assembly1.cif.gz_A-2 the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens 0.9521 1 332
7cgv-assembly1.cif.gz_C-2 full consensus l-threonine 3-dehydrogenase, fctdh-iiym (nad+ bound form) 0.8895 1 325
7cgv-assembly1.cif.gz_D-2 full consensus l-threonine 3-dehydrogenase, fctdh-iiym (nad+ bound form) 0.8861 1 325
7epr-assembly2.cif.gz_C partial consensus l-threonine 3-dehydrogenase (c-change) 0.8856 2 333
ID Description Score Start End Superfamily
2hrzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 1 310 3.40.50.720
2hrzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 1 310 3.40.50.720
2hrzA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9412 183 332 3.90.25.10
2hrzA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9319 183 332 3.90.25.10
3a4vB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8781 3 324 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0A1PP05-F1-model_v4 UDP-glucose 4-epimerase 0.9844 1 330 GO:0016491
AF-A0A7X3Z7P9-F1-model_v4 NAD-dependent epimerase 0.9842 163 326
AF-A0A159Z7H1-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9823 1 328 GO:0016491
AF-A0A530CEN0-F1-model_v4 NAD-dependent epimerase 0.9811 200 333
AF-A0A3S2A8I2-F1-model_v4 NAD-dependent epimerase 0.981 136 333

Feature Viewer

pLDDT pTM Quality
95.41 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map