F497108
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2859 | 1184 | 2031 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100108590|Ga0307409_1001085903 |
| Length | 350 |
| Sequence | MPAFPAWWILPPFDKPQKTSIDMVQVLIIGGAGMLGRKLAERLSADGQIGGKAISRLHLADMFTPTAPAGAPFEVTTTTGDFSEAGEAERLIADRPEIIFHLAAIVSGEAEADFDKGYRINLDGTRLLLDAIRAAGNYHPRLVFTSSIAVFGAPFPSEIPDEFHHTPLTSYGTQKAIGELLLSDYSRRGILDGVGIRLPTICVRPGKPNKAASGFFSGIIREPLNGMEAILPVPTDVRHWFASPRAAVQFMVHAATIDTAKVGPRRNLTMPGVAATVAEEIESLRRIAGEAAVKLIRHEPDATIMGIVKGWPQAFSPERALSLGFAADTDFDAIVRLYIEEELGGKIATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 7 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 11 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 12 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 16 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 17 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 20 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 21 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 22 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 26 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 29 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 30 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 31 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 32 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 33 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 34 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 35 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 36 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 37 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 38 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 39 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 40 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 41 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 42 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 43 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 44 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 45 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 46 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 47 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 48 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 49 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 50 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 51 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 52 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 53 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 54 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 55 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 56 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 57 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 58 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 59 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 60 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 61 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 62 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 63 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 64 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 65 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 66 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 67 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 68 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 69 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 70 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 71 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 72 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 73 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 74 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 75 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 76 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 77 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 78 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 79 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 80 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 81 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 82 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 83 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 84 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 85 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 86 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 87 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 88 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 89 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 90 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 91 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 92 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 93 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 94 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 95 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 96 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 97 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 98 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 99 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 100 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 101 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 102 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 103 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 104 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 105 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 106 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 107 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 108 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 109 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 110 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 111 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 112 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 113 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 114 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 115 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 116 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 117 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 118 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 119 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 120 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 121 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 122 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 123 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 124 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 125 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 126 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 127 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 128 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 129 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 130 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 131 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 132 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 133 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 134 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 135 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 136 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 137 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 138 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 139 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 140 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 141 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 142 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 143 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 144 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 145 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 146 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 147 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 148 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 149 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 150 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 151 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 152 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 153 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 154 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 155 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 156 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 157 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 158 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 159 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 160 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 161 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 162 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 163 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 164 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 165 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 166 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 167 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 168 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 169 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 170 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 171 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 172 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 173 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 174 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 175 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 176 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 177 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 178 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 179 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 180 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 181 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 182 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 183 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 184 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 185 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 186 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 187 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 188 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 189 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 190 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 191 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 192 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 193 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 194 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 195 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 196 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 197 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 198 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 199 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 200 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 201 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 202 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 203 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 204 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 205 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 206 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 207 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 208 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 209 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 210 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 211 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 212 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 213 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 214 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 215 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 216 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 217 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 218 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 219 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 220 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 221 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 222 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 223 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 224 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 225 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 226 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 227 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 228 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 229 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 230 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 231 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 232 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 233 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 234 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 235 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 236 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 237 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 238 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 239 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 240 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 241 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 242 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 243 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 244 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 245 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 246 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 247 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 248 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 249 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 250 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 251 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 252 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 253 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 254 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 255 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 256 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 257 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 258 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 259 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 260 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 261 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 262 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 263 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 264 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 265 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 266 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 267 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 268 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 269 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 270 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 271 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 272 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 273 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 274 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 275 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 276 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 277 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 278 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 279 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 280 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 281 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 282 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 283 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 284 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 285 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 286 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 287 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 288 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 289 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 290 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 291 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 292 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 293 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 294 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 295 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 296 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 297 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 298 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 299 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 300 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 301 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 302 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 303 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 304 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 305 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 306 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 307 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 308 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 309 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 310 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 311 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 312 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 313 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 314 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 315 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 316 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 317 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 318 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 319 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 320 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 321 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 322 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 323 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 324 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 325 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 326 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 327 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 328 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 329 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 330 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 331 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 332 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 333 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 334 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 335 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 336 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 337 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 338 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 339 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 340 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 341 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 342 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 343 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 344 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 345 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 346 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 347 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 348 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 349 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 350 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 351 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 352 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 353 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 354 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 355 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 356 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 357 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 358 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 359 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 360 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 361 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 362 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 363 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 364 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 365 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 366 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 367 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 368 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 369 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 370 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 371 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 372 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 373 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 374 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 375 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 376 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 377 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 378 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 379 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 380 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 381 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 382 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 383 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 384 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 385 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 386 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 387 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 388 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 389 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 390 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 391 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 392 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 393 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 394 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 395 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 396 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 397 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 398 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 399 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 400 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 401 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 402 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 403 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 404 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 405 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 406 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 407 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 408 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 409 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 410 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 411 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 412 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 413 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 414 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 415 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 416 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 417 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 418 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 419 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 420 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 421 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 422 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 423 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 424 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 425 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 426 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 427 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 428 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 429 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 430 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 431 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 432 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 433 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 434 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 435 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 436 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 437 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 438 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 439 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 440 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 441 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 442 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 443 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 444 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 445 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 446 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 447 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 448 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 449 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 450 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 451 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 452 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 453 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 454 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 455 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 456 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 457 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 458 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 459 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 460 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 461 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 462 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 463 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 464 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 465 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 466 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 467 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 468 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 469 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 470 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 471 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 472 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 473 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 474 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 475 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 476 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 477 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 478 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 479 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 480 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 481 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 482 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 483 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 484 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 485 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 486 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 487 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 488 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 489 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 490 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 491 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 492 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 493 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 494 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 495 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 496 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 497 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 498 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 499 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 500 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 501 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 502 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 503 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 504 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 505 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 506 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 507 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 508 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 509 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 510 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 511 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 512 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 513 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 514 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 515 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 516 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 517 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 518 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 519 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 520 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 521 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 522 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 523 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 524 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 525 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 526 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 527 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 528 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 529 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 530 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 531 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 532 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 533 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 534 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 535 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 536 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 537 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 538 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 539 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 540 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 541 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 542 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 543 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 544 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 545 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 546 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 547 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 548 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 549 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 550 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 551 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 552 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 553 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 554 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 555 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 556 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 557 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 558 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 559 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 560 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 561 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 562 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 563 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 564 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 565 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 566 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 567 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 568 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 569 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 570 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 571 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 572 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 573 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 574 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 575 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 576 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 577 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 578 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 579 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 580 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 581 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 582 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 583 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 584 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 585 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 586 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 587 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 588 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 589 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 590 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 591 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 592 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 593 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 594 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 595 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 596 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 597 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 598 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 599 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 600 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 601 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 602 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 603 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 604 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 605 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 606 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 607 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 608 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 609 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 610 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 611 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 612 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 613 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 614 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 615 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 616 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 617 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 618 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 619 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 620 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 621 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 622 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 623 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 624 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 625 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 626 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 627 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 628 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 629 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 630 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 631 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 632 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 633 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 634 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 635 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 636 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 637 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 638 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 639 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 640 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 641 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 642 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 643 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 644 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 645 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 646 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 647 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 648 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 649 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 650 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 651 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 652 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 653 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 654 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 655 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 656 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 657 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 658 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 659 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 660 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 661 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 662 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 663 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 664 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 665 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 666 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 667 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 668 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 669 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 670 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 671 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 672 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 673 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 674 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 675 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 676 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 677 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 678 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 679 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 680 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 681 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 682 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 683 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 684 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 685 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 686 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 687 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 688 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 689 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 690 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 691 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 693 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 694 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 695 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 696 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 697 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 698 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 699 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 700 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 702 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 703 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 704 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 705 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 706 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 707 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 708 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 709 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 710 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 711 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 712 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 713 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 714 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 715 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 716 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 717 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 718 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 719 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 720 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 721 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 722 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 723 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 724 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 725 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 726 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 727 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 728 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 729 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 730 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 731 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 732 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 733 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 734 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 735 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 736 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 737 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 738 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 739 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 740 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 741 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 742 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 743 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 744 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 745 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 746 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 747 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 748 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 749 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 750 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 751 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 752 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 753 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 754 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 755 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 756 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 757 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 758 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 759 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 760 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 761 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 762 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 763 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 764 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 765 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 766 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 767 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 768 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 769 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 770 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 772 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 774 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 775 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 779 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 780 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 781 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 782 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 783 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 784 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 785 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 786 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 787 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 788 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 789 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 790 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 791 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 792 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 793 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 794 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 795 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 796 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 797 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 798 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 799 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 800 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 801 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 802 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 803 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 804 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 805 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 806 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 807 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 808 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 809 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 810 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 811 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 812 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 813 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 814 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 815 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 816 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 817 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 818 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 819 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 820 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 821 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 822 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 823 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 824 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 825 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 826 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 827 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 828 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 829 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 830 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 831 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 832 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 833 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 834 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 835 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 836 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 837 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 838 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 839 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 840 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 841 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 842 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 843 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 844 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 845 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 846 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 847 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 848 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 849 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 850 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 851 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 852 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 853 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 854 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 855 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 856 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 857 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 858 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 859 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 860 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 861 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 862 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 863 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 864 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 865 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 866 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 867 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 868 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 869 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 870 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 871 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 872 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 873 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 874 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 875 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 876 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 877 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 878 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 879 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 880 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 881 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 882 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 883 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 884 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 885 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 886 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 887 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 888 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 889 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 890 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 891 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 892 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 893 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 894 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 895 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 896 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 897 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 898 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 899 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 900 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 901 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 902 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 903 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 904 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 905 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 906 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 907 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 908 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 909 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 910 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 911 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 912 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 913 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 914 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 915 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 916 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 917 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 918 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 919 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 920 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 921 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 922 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 923 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 924 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 925 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 926 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 927 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 928 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 929 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 930 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 931 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 932 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 933 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 934 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 935 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 936 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 937 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 938 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 939 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 940 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 941 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 942 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 943 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 944 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 945 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 946 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 947 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 948 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 949 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 950 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 951 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 952 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 953 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 954 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 955 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 956 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 957 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 958 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 959 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 960 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 961 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 962 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 963 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 964 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 965 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 966 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 967 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 968 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 969 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 970 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 971 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 972 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 973 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 974 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 975 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 976 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 977 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 978 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 979 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 980 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 981 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 982 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 983 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 984 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 985 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 986 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 987 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 988 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 989 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 990 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 991 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 992 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 993 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 994 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 995 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 996 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 997 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 998 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 999 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1000 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1001 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1002 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 1003 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 1004 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1005 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 1006 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1007 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1008 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1009 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1010 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1011 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1012 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 1013 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1014 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1015 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1016 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1017 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1018 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1019 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1020 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1021 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1022 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1023 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1024 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1025 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1026 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1027 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1028 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1029 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1030 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1031 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1032 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1033 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1034 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1035 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1036 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1037 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1038 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1039 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1040 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1041 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1042 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1043 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1044 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1045 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1046 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1047 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1048 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1049 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1050 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1051 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1052 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1053 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1054 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1055 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1056 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1057 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1058 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1059 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1060 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1061 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1062 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1063 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1064 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1065 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1066 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1067 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1068 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1069 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1070 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1071 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1072 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1073 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1074 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1075 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1076 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1077 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1078 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1079 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1080 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1081 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1082 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1083 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1084 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1085 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1086 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1087 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1088 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1089 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1090 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1091 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1092 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1093 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1094 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1095 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1096 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1097 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1098 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1099 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1100 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1101 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1102 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1103 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1104 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1105 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1106 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1107 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 1108 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1111 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1112 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 1113 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 1114 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 1115 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1116 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1117 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1118 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1119 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1120 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1121 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1122 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1123 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1124 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1125 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1126 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1127 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 1128 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1129 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1130 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1131 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1132 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1133 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 1134 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1135 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1136 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1137 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1138 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1139 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1140 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1141 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1142 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 1143 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1144 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1145 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 1146 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1147 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1148 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 1149 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1150 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1151 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1152 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1153 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1154 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1155 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1156 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1157 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1158 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1159 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1160 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1161 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1162 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1163 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1164 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1165 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1166 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1167 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1168 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1169 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1170 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1171 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1172 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1173 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1174 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1175 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1176 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 1177 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 1178 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1179 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1180 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1181 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1182 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1183 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1184 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71 |
| Metatranscriptomes | 0.21 |
| Isolates | 28.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 7.56 |
| Nodule | 23.4 |
| Rhizoplane | 5.04 |
| Rhizosphere | 54.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10021610 | 3300001979 | Bacteria | 2228 |
| 2 | JGI24740J21852_10050296 | 3300001979 | Bacteria | 1199 |
| 3 | JGI24751J29686_10002245 | 3300002459 | Bacteria | 3911 |
| 4 | JGI24751J29686_10007661 | 3300002459 | Bacteria | 2207 |
| 5 | JGI25156J39149_1004301 | 3300002705 | Bacteria | 4376 |
| 6 | JGI25157J39369_1002383 | 3300002741 | Bacteria | 4776 |
| 7 | JGI25152J39213_1000531 | 3300002773 | Bacteria | 21074 |
| 8 | JGI25152J39213_1002315 | 3300002773 | Bacteria | 7348 |
| 9 | JGI25150J39212_1000024 | 3300002774 | Bacteria | 129646 |
| 10 | JGI25159J45721_1001556 | 3300002987 | Bacteria | 9403 |
| 11 | JGI25151J46595_10000027 | 3300003187 | Bacteria | 208739 |
| 12 | JGI25151J46595_10000069 | 3300003187 | Bacteria | 139420 |
| 13 | JGI25406J46586_10013043 | 3300003203 | Bacteria | 3587 |
| 14 | JGI25165J46597_1000042 | 3300003214 | Bacteria | 271606 |
| 15 | JGI25165J46597_1006314 | 3300003214 | Bacteria | 2114 |
| 16 | JGI25165J46597_1007664 | 3300003214 | Bacteria | 1768 |
| 17 | JGI25153J46596_10000012 | 3300003215 | Bacteria | 308056 |
| 18 | JGI25153J46596_10000517 | 3300003215 | Bacteria | 24352 |
| 19 | JGI25153J46596_10002078 | 3300003215 | Bacteria | 11772 |
| 20 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 21 | JGI25161J50226_1000047 | 3300003374 | Bacteria | 113472 |
| 22 | Ga0055542_1000761 | 3300003762 | Bacteria | 24456 |
| 23 | Ga0055529_1001880 | 3300003763 | Bacteria | 4878 |
| 24 | Ga0055526_1000017 | 3300003771 | Bacteria | 210613 |
| 25 | Ga0055526_1013167 | 3300003771 | Bacteria | 3526 |
| 26 | Ga0055526_1017984 | 3300003771 | Bacteria | 2665 |
| 27 | Ga0055524_1000435 | 3300003775 | Bacteria | 34955 |
| 28 | Ga0055524_1003714 | 3300003775 | Bacteria | 7299 |
| 29 | Ga0055524_1013029 | 3300003775 | Bacteria | 3160 |
| 30 | Ga0055536_1004308 | 3300003781 | Bacteria | 7321 |
| 31 | Ga0055528_1000033 | 3300003790 | Bacteria | 119662 |
| 32 | Ga0055528_1001182 | 3300003790 | Bacteria | 16852 |
| 33 | Ga0055528_1011971 | 3300003790 | Bacteria | 3400 |
| 34 | Ga0055528_1035106 | 3300003790 | Bacteria | 1223 |
| 35 | Ga0055540_1000925 | 3300003792 | Bacteria | 19166 |
| 36 | Ga0055531_10000685 | 3300003794 | Bacteria | 28855 |
| 37 | Ga0055531_10013033 | 3300003794 | Bacteria | 3861 |
| 38 | Ga0058692_1001178 | 3300003856 | Bacteria | 10036 |
| 39 | Ga0058692_1001422 | 3300003856 | Bacteria | 8814 |
| 40 | Ga0058692_1001511 | 3300003856 | Bacteria | 8500 |
| 41 | Ga0055543_1000007 | 3300004625 | Bacteria | 204042 |
| 42 | Ga0055543_1013268 | 3300004625 | Bacteria | 1633 |
| 43 | Ga0065165_1000231 | 3300005262 | Bacteria | 97237 |
| 44 | Ga0065165_1000313 | 3300005262 | Bacteria | 79494 |
| 45 | Ga0065165_1000357 | 3300005262 | Bacteria | 75030 |
| 46 | Ga0065165_1008048 | 3300005262 | Bacteria | 5035 |
| 47 | Ga0065165_1008460 | 3300005262 | Bacteria | 4807 |
| 48 | Ga0065707_10134610 | 3300005295 | Bacteria | 1862 |
| 49 | Ga0065707_10146168 | 3300005295 | Bacteria | 1711 |
| 50 | Ga0070658_10000595 | 3300005327 | Bacteria | 31313 |
| 51 | Ga0070658_10040997 | 3300005327 | Bacteria | 3735 |
| 52 | Ga0070658_10322566 | 3300005327 | Bacteria | 1319 |
| 53 | Ga0070676_10071503 | 3300005328 | Bacteria | 2084 |
| 54 | Ga0070683_100105930 | 3300005329 | Bacteria | 2651 |
| 55 | Ga0070683_100133616 | 3300005329 | Bacteria | 2349 |
| 56 | Ga0070690_100000472 | 3300005330 | Bacteria | 20208 |
| 57 | Ga0070690_100020090 | 3300005330 | Bacteria | 4066 |
| 58 | Ga0070690_100026997 | 3300005330 | Bacteria | 3546 |
| 59 | Ga0070690_100176522 | 3300005330 | Bacteria | 1474 |
| 60 | Ga0070670_100011566 | 3300005331 | Bacteria | 7545 |
| 61 | Ga0070670_100079159 | 3300005331 | Bacteria | 2824 |
| 62 | Ga0070670_100130783 | 3300005331 | Bacteria | 2168 |
| 63 | Ga0070670_100459691 | 3300005331 | Bacteria | 1129 |
| 64 | Ga0068869_100010254 | 3300005334 | Bacteria | 6104 |
| 65 | Ga0068869_100021520 | 3300005334 | Bacteria | 4438 |
| 66 | Ga0068869_100143106 | 3300005334 | Bacteria | 1848 |
| 67 | Ga0068869_100151919 | 3300005334 | Bacteria | 1797 |
| 68 | Ga0070666_10030238 | 3300005335 | Bacteria | 3567 |
| 69 | Ga0070666_10210667 | 3300005335 | Bacteria | 1369 |
| 70 | Ga0070666_10229508 | 3300005335 | Bacteria | 1311 |
| 71 | Ga0070680_100006080 | 3300005336 | Bacteria | 9144 |
| 72 | Ga0070680_100020436 | 3300005336 | Bacteria | 5256 |
| 73 | Ga0070680_100020901 | 3300005336 | Bacteria | 5197 |
| 74 | Ga0070680_100063360 | 3300005336 | Bacteria | 3028 |
| 75 | Ga0070682_100003001 | 3300005337 | Bacteria | 9366 |
| 76 | Ga0070682_100088567 | 3300005337 | Bacteria | 2020 |
| 77 | Ga0068868_100000209 | 3300005338 | Bacteria | 39624 |
| 78 | Ga0068868_100037635 | 3300005338 | Bacteria | 3752 |
| 79 | Ga0068868_100064476 | 3300005338 | Bacteria | 2908 |
| 80 | Ga0068868_100110568 | 3300005338 | Bacteria | 2232 |
| 81 | Ga0070660_100015769 | 3300005339 | Bacteria | 5466 |
| 82 | Ga0070660_100131859 | 3300005339 | Bacteria | 2000 |
| 83 | Ga0070689_100000614 | 3300005340 | Bacteria | 21600 |
| 84 | Ga0070689_100006652 | 3300005340 | Bacteria | 8027 |
| 85 | Ga0070689_100007446 | 3300005340 | Bacteria | 7654 |
| 86 | Ga0070689_100176001 | 3300005340 | Bacteria | 1735 |
| 87 | Ga0070691_10035309 | 3300005341 | Bacteria | 2354 |
| 88 | Ga0070691_10073615 | 3300005341 | Bacteria | 1661 |
| 89 | Ga0070687_100000190 | 3300005343 | Bacteria | 21399 |
| 90 | Ga0070687_100025536 | 3300005343 | Bacteria | 2836 |
| 91 | Ga0070687_100099886 | 3300005343 | Bacteria | 1623 |
| 92 | Ga0070661_100046657 | 3300005344 | Bacteria | 3170 |
| 93 | Ga0070661_100054046 | 3300005344 | Bacteria | 2941 |
| 94 | Ga0070692_10006738 | 3300005345 | Bacteria | 5006 |
| 95 | Ga0070692_10038866 | 3300005345 | Bacteria | 2428 |
| 96 | Ga0070692_10041373 | 3300005345 | Bacteria | 2360 |
| 97 | Ga0070668_100033602 | 3300005347 | Bacteria | 3907 |
| 98 | Ga0070668_100066458 | 3300005347 | Bacteria | 2798 |
| 99 | Ga0070668_100098437 | 3300005347 | Bacteria | 2314 |
| 100 | Ga0070668_100099546 | 3300005347 | Bacteria | 2302 |
| 101 | Ga0070668_100156759 | 3300005347 | Bacteria | 1845 |
| 102 | Ga0070668_100190190 | 3300005347 | Bacteria | 1681 |
| 103 | Ga0070668_100308329 | 3300005347 | Bacteria | 1329 |
| 104 | Ga0070668_100329184 | 3300005347 | Bacteria | 1288 |
| 105 | Ga0070669_100003300 | 3300005353 | Bacteria | 11600 |
| 106 | Ga0070669_100124486 | 3300005353 | Bacteria | 1971 |
| 107 | Ga0070675_100002866 | 3300005354 | Bacteria | 12996 |
| 108 | Ga0070675_100021212 | 3300005354 | Bacteria | 5189 |
| 109 | Ga0070675_100154306 | 3300005354 | Bacteria | 1971 |
| 110 | Ga0070671_100009666 | 3300005355 | Bacteria | 7748 |
| 111 | Ga0070671_100078678 | 3300005355 | Bacteria | 2756 |
| 112 | Ga0070671_100094543 | 3300005355 | Bacteria | 2505 |
| 113 | Ga0070674_100025155 | 3300005356 | Bacteria | 3872 |
| 114 | Ga0070674_100048660 | 3300005356 | Bacteria | 2910 |
| 115 | Ga0070673_100044693 | 3300005364 | Bacteria | 3431 |
| 116 | Ga0070688_100012599 | 3300005365 | Bacteria | 4740 |
| 117 | Ga0070688_100018867 | 3300005365 | Bacteria | 3988 |
| 118 | Ga0070688_100104138 | 3300005365 | Bacteria | 1876 |
| 119 | Ga0070688_100168955 | 3300005365 | Bacteria | 1508 |
| 120 | Ga0070659_100119241 | 3300005366 | Bacteria | 2135 |
| 121 | Ga0070659_100129972 | 3300005366 | Bacteria | 2045 |
| 122 | Ga0070667_100005456 | 3300005367 | Bacteria | 10623 |
| 123 | Ga0070709_10005929 | 3300005434 | Bacteria | 6630 |
| 124 | Ga0070709_10028611 | 3300005434 | Bacteria | 3325 |
| 125 | Ga0070709_10034343 | 3300005434 | Bacteria | 3074 |
| 126 | Ga0070709_10152872 | 3300005434 | Bacteria | 1597 |
| 127 | Ga0070714_100016855 | 3300005435 | Bacteria | 5909 |
| 128 | Ga0070714_100022579 | 3300005435 | Bacteria | 5159 |
| 129 | Ga0070714_100037888 | 3300005435 | Bacteria | 4054 |
| 130 | Ga0070714_100167505 | 3300005435 | Bacteria | 1992 |
| 131 | Ga0070714_100560028 | 3300005435 | Bacteria | 1095 |
| 132 | Ga0070713_100025577 | 3300005436 | Bacteria | 4617 |
| 133 | Ga0070713_100025962 | 3300005436 | Bacteria | 4590 |
| 134 | Ga0070713_100074693 | 3300005436 | Bacteria | 2873 |
| 135 | Ga0070713_100104650 | 3300005436 | Bacteria | 2457 |
| 136 | Ga0070713_100376483 | 3300005436 | Bacteria | 1322 |
| 137 | Ga0070710_10004764 | 3300005437 | Bacteria | 6420 |
| 138 | Ga0070710_10022918 | 3300005437 | Bacteria | 3274 |
| 139 | Ga0070710_10141687 | 3300005437 | Bacteria | 1475 |
| 140 | Ga0070701_10162829 | 3300005438 | Bacteria | 1294 |
| 141 | Ga0070711_100000801 | 3300005439 | Bacteria | 16448 |
| 142 | Ga0070711_100036220 | 3300005439 | Bacteria | 3305 |
| 143 | Ga0070711_100076598 | 3300005439 | Bacteria | 2372 |
| 144 | Ga0070711_100124150 | 3300005439 | Bacteria | 1914 |
| 145 | Ga0070711_100191666 | 3300005439 | Bacteria | 1572 |
| 146 | Ga0070711_100250879 | 3300005439 | Bacteria | 1388 |
| 147 | Ga0070711_100350158 | 3300005439 | Bacteria | 1187 |
| 148 | Ga0070705_100000101 | 3300005440 | Bacteria | 48577 |
| 149 | Ga0070705_100000320 | 3300005440 | Bacteria | 28430 |
| 150 | Ga0070705_100109820 | 3300005440 | Bacteria | 1760 |
| 151 | Ga0070700_100000571 | 3300005441 | Bacteria | 18444 |
| 152 | Ga0070700_100000733 | 3300005441 | Bacteria | 16216 |
| 153 | Ga0070700_100027128 | 3300005441 | Bacteria | 3393 |
| 154 | Ga0070700_100129628 | 3300005441 | Bacteria | 1700 |
| 155 | Ga0070700_100134966 | 3300005441 | Bacteria | 1670 |
| 156 | Ga0070694_100000321 | 3300005444 | Bacteria | 25869 |
| 157 | Ga0070694_100081356 | 3300005444 | Bacteria | 2253 |
| 158 | Ga0070708_100074256 | 3300005445 | Bacteria | 3067 |
| 159 | Ga0070663_100010835 | 3300005455 | Bacteria | 5696 |
| 160 | Ga0070663_100025745 | 3300005455 | Bacteria | 3975 |
| 161 | Ga0070663_100027751 | 3300005455 | Bacteria | 3848 |
| 162 | Ga0070663_100141408 | 3300005455 | Bacteria | 1838 |
| 163 | Ga0070663_100199670 | 3300005455 | Bacteria | 1560 |
| 164 | Ga0070663_100243504 | 3300005455 | Bacteria | 1420 |
| 165 | Ga0070678_100003166 | 3300005456 | Bacteria | 9114 |
| 166 | Ga0070678_100011827 | 3300005456 | Bacteria | 5399 |
| 167 | Ga0070678_100043922 | 3300005456 | Bacteria | 3187 |
| 168 | Ga0070678_100230417 | 3300005456 | Bacteria | 1544 |
| 169 | Ga0070678_100525533 | 3300005456 | Bacteria | 1047 |
| 170 | Ga0070681_10016232 | 3300005458 | Bacteria | 7428 |
| 171 | Ga0070681_10120549 | 3300005458 | Bacteria | 2558 |
| 172 | Ga0070681_10130087 | 3300005458 | Bacteria | 2449 |
| 173 | Ga0070681_10158097 | 3300005458 | Bacteria | 2190 |
| 174 | Ga0070681_10507171 | 3300005458 | Bacteria | 1120 |
| 175 | Ga0068867_100000417 | 3300005459 | Bacteria | 28383 |
| 176 | Ga0068867_100016190 | 3300005459 | Bacteria | 5295 |
| 177 | Ga0068867_100080280 | 3300005459 | Bacteria | 2456 |
| 178 | Ga0068867_100113901 | 3300005459 | Bacteria | 2081 |
| 179 | Ga0068867_100169625 | 3300005459 | Bacteria | 1727 |
| 180 | Ga0068867_100355548 | 3300005459 | Bacteria | 1223 |
| 181 | Ga0070685_10067945 | 3300005466 | Bacteria | 2104 |
| 182 | Ga0070706_100182407 | 3300005467 | Bacteria | 1960 |
| 183 | Ga0070707_100039104 | 3300005468 | Bacteria | 4534 |
| 184 | Ga0070707_100232121 | 3300005468 | Bacteria | 1796 |
| 185 | Ga0070707_100234729 | 3300005468 | Bacteria | 1785 |
| 186 | Ga0070698_100319420 | 3300005471 | Bacteria | 1483 |
| 187 | Ga0070699_100000281 | 3300005518 | Bacteria | 48573 |
| 188 | Ga0070699_100006683 | 3300005518 | Bacteria | 10030 |
| 189 | Ga0070699_100021616 | 3300005518 | Bacteria | 5549 |
| 190 | Ga0070699_100272384 | 3300005518 | Bacteria | 1515 |
| 191 | Ga0070699_100296574 | 3300005518 | Bacteria | 1450 |
| 192 | Ga0070679_100002529 | 3300005530 | Bacteria | 16578 |
| 193 | Ga0070679_100006164 | 3300005530 | Bacteria | 11159 |
| 194 | Ga0070679_100103918 | 3300005530 | Bacteria | 2827 |
| 195 | Ga0070679_100215188 | 3300005530 | Bacteria | 1884 |
| 196 | Ga0070679_100532617 | 3300005530 | Bacteria | 1118 |
| 197 | Ga0070684_100047934 | 3300005535 | Bacteria | 3705 |
| 198 | Ga0070684_100155473 | 3300005535 | Bacteria | 2074 |
| 199 | Ga0070684_100229585 | 3300005535 | Bacteria | 1694 |
| 200 | Ga0070697_100003354 | 3300005536 | Bacteria | 12307 |
| 201 | Ga0070697_100228438 | 3300005536 | Bacteria | 1587 |
| 202 | Ga0068853_100014287 | 3300005539 | Bacteria | 6498 |
| 203 | Ga0068853_100160368 | 3300005539 | Bacteria | 2029 |
| 204 | Ga0068853_100204447 | 3300005539 | Bacteria | 1798 |
| 205 | Ga0068853_100401731 | 3300005539 | Bacteria | 1282 |
| 206 | Ga0070672_100049162 | 3300005543 | Bacteria | 3279 |
| 207 | Ga0070672_100151621 | 3300005543 | Bacteria | 1918 |
| 208 | Ga0070686_100000825 | 3300005544 | Bacteria | 17899 |
| 209 | Ga0070686_100075392 | 3300005544 | Bacteria | 2219 |
| 210 | Ga0070686_100262069 | 3300005544 | Bacteria | 1267 |
| 211 | Ga0070695_100000120 | 3300005545 | Bacteria | 35206 |
| 212 | Ga0070695_100000457 | 3300005545 | Bacteria | 21293 |
| 213 | Ga0070695_100091171 | 3300005545 | Bacteria | 2035 |
| 214 | Ga0070696_100000478 | 3300005546 | Bacteria | 25109 |
| 215 | Ga0070696_100003819 | 3300005546 | Bacteria | 10057 |
| 216 | Ga0070696_100005170 | 3300005546 | Bacteria | 8723 |
| 217 | Ga0070693_100001007 | 3300005547 | Bacteria | 12571 |
| 218 | Ga0070693_100060331 | 3300005547 | Bacteria | 2201 |
| 219 | Ga0070693_100064052 | 3300005547 | Bacteria | 2145 |
| 220 | Ga0070665_100000961 | 3300005548 | Bacteria | 36670 |
| 221 | Ga0070665_100012792 | 3300005548 | Bacteria | 8455 |
| 222 | Ga0070665_100026701 | 3300005548 | Bacteria | 5815 |
| 223 | Ga0070665_100075185 | 3300005548 | Bacteria | 3385 |
| 224 | Ga0070665_100076161 | 3300005548 | Bacteria | 3362 |
| 225 | Ga0070665_100441668 | 3300005548 | Bacteria | 1310 |
| 226 | Ga0070665_100491879 | 3300005548 | Bacteria | 1238 |
| 227 | Ga0070704_100002732 | 3300005549 | Bacteria | 9977 |
| 228 | Ga0070704_100008897 | 3300005549 | Bacteria | 6045 |
| 229 | Ga0068855_100013001 | 3300005563 | Bacteria | 10045 |
| 230 | Ga0068855_100053304 | 3300005563 | Bacteria | 4759 |
| 231 | Ga0068855_100099355 | 3300005563 | Bacteria | 3352 |
| 232 | Ga0068855_100236476 | 3300005563 | Bacteria | 2043 |
| 233 | Ga0068855_100465137 | 3300005563 | Bacteria | 1378 |
| 234 | Ga0068855_100629172 | 3300005563 | Bacteria | 1155 |
| 235 | Ga0070664_100120215 | 3300005564 | Bacteria | 2299 |
| 236 | Ga0070664_100338396 | 3300005564 | Bacteria | 1366 |
| 237 | Ga0068857_100006107 | 3300005577 | Bacteria | 10289 |
| 238 | Ga0068857_100092451 | 3300005577 | Bacteria | 2709 |
| 239 | Ga0068857_100443489 | 3300005577 | Bacteria | 1213 |
| 240 | Ga0068854_100021398 | 3300005578 | Bacteria | 4388 |
| 241 | Ga0068854_100069934 | 3300005578 | Bacteria | 2564 |
| 242 | Ga0068854_100107749 | 3300005578 | Bacteria | 2098 |
| 243 | Ga0068856_100006239 | 3300005614 | Bacteria | 11699 |
| 244 | Ga0068856_100386344 | 3300005614 | Bacteria | 1419 |
| 245 | Ga0070702_100000050 | 3300005615 | Bacteria | 32860 |
| 246 | Ga0070702_100003946 | 3300005615 | Bacteria | 6729 |
| 247 | Ga0070702_100057852 | 3300005615 | Bacteria | 2243 |
| 248 | Ga0070702_100093894 | 3300005615 | Bacteria | 1825 |
| 249 | Ga0070702_100107193 | 3300005615 | Bacteria | 1725 |
| 250 | Ga0068852_100009087 | 3300005616 | Bacteria | 7358 |
| 251 | Ga0068852_100016572 | 3300005616 | Bacteria | 5753 |
| 252 | Ga0068852_100064598 | 3300005616 | Bacteria | 3191 |
| 253 | Ga0068852_100096341 | 3300005616 | Bacteria | 2659 |
| 254 | Ga0068852_100235654 | 3300005616 | Bacteria | 1747 |
| 255 | Ga0068852_100366447 | 3300005616 | Bacteria | 1410 |
| 256 | Ga0068859_100000332 | 3300005617 | Bacteria | 47130 |
| 257 | Ga0068859_100006827 | 3300005617 | Bacteria | 11597 |
| 258 | Ga0068859_100024736 | 3300005617 | Bacteria | 6026 |
| 259 | Ga0068859_100586192 | 3300005617 | Bacteria | 1208 |
| 260 | Ga0068864_100012375 | 3300005618 | Bacteria | 7054 |
| 261 | Ga0068864_100038504 | 3300005618 | Bacteria | 4084 |
| 262 | Ga0068864_100489587 | 3300005618 | Bacteria | 1182 |
| 263 | Ga0068866_10027915 | 3300005718 | Bacteria | 2684 |
| 264 | Ga0068861_100007871 | 3300005719 | Bacteria | 7333 |
| 265 | Ga0068861_100008854 | 3300005719 | Bacteria | 6937 |
| 266 | Ga0068861_100112174 | 3300005719 | Bacteria | 2186 |
| 267 | Ga0068861_100148020 | 3300005719 | Bacteria | 1924 |
| 268 | Ga0068861_100189179 | 3300005719 | Bacteria | 1719 |
| 269 | Ga0068861_100364620 | 3300005719 | Bacteria | 1272 |
| 270 | Ga0068851_10006256 | 3300005834 | Bacteria | 5432 |
| 271 | Ga0068870_10001906 | 3300005840 | Bacteria | 8609 |
| 272 | Ga0068870_10018860 | 3300005840 | Bacteria | 3338 |
| 273 | Ga0068870_10040967 | 3300005840 | Bacteria | 2404 |
| 274 | Ga0068870_10124167 | 3300005840 | Bacteria | 1491 |
| 275 | Ga0068863_100009237 | 3300005841 | Bacteria | 9620 |
| 276 | Ga0068863_100040400 | 3300005841 | Bacteria | 4435 |
| 277 | Ga0068863_100108817 | 3300005841 | Bacteria | 2638 |
| 278 | Ga0068863_100209174 | 3300005841 | Bacteria | 1878 |
| 279 | Ga0068863_100214375 | 3300005841 | Bacteria | 1854 |
| 280 | Ga0068858_100004862 | 3300005842 | Bacteria | 13176 |
| 281 | Ga0068858_100019146 | 3300005842 | Bacteria | 6404 |
| 282 | Ga0068858_100031069 | 3300005842 | Bacteria | 4960 |
| 283 | Ga0068858_100105377 | 3300005842 | Bacteria | 2631 |
| 284 | Ga0068858_100169232 | 3300005842 | Bacteria | 2060 |
| 285 | Ga0068860_100000900 | 3300005843 | Bacteria | 32980 |
| 286 | Ga0068860_100079823 | 3300005843 | Bacteria | 3111 |
| 287 | Ga0068860_100088103 | 3300005843 | Bacteria | 2955 |
| 288 | Ga0068860_100388544 | 3300005843 | Bacteria | 1378 |
| 289 | Ga0068862_100001691 | 3300005844 | Bacteria | 19990 |
| 290 | Ga0068862_100010969 | 3300005844 | Bacteria | 7483 |
| 291 | Ga0068862_100062409 | 3300005844 | Bacteria | 3205 |
| 292 | Ga0068862_100172162 | 3300005844 | Bacteria | 1939 |
| 293 | Ga0068862_100284438 | 3300005844 | Bacteria | 1516 |
| 294 | Ga0081455_10000160 | 3300005937 | Bacteria | 82166 |
| 295 | Ga0081455_10003542 | 3300005937 | Bacteria | 17909 |
| 296 | Ga0081455_10053792 | 3300005937 | Bacteria | 3437 |
| 297 | Ga0081455_10054052 | 3300005937 | Bacteria | 3426 |
| 298 | Ga0081455_10264540 | 3300005937 | Bacteria | 1251 |
| 299 | Ga0081538_10024573 | 3300005981 | Bacteria | 4288 |
| 300 | Ga0081540_1000032 | 3300005983 | Bacteria | 144522 |
| 301 | Ga0081540_1002311 | 3300005983 | Bacteria | 15633 |
| 302 | Ga0081540_1012683 | 3300005983 | Bacteria | 5529 |
| 303 | Ga0081539_10000856 | 3300005985 | Bacteria | 58246 |
| 304 | Ga0081539_10013687 | 3300005985 | Bacteria | 6092 |
| 305 | Ga0070717_10016310 | 3300006028 | Bacteria | 5757 |
| 306 | Ga0070717_10048238 | 3300006028 | Bacteria | 3492 |
| 307 | Ga0075365_10007299 | 3300006038 | Bacteria | 6179 |
| 308 | Ga0075365_10014030 | 3300006038 | Bacteria | 4811 |
| 309 | Ga0075365_10027063 | 3300006038 | Bacteria | 3645 |
| 310 | Ga0075365_10036306 | 3300006038 | Bacteria | 3192 |
| 311 | Ga0075365_10041629 | 3300006038 | Bacteria | 3002 |
| 312 | Ga0075365_10090389 | 3300006038 | Bacteria | 2085 |
| 313 | Ga0075365_10121269 | 3300006038 | Bacteria | 1804 |
| 314 | Ga0075365_10144556 | 3300006038 | Bacteria | 1652 |
| 315 | Ga0075365_10289032 | 3300006038 | Bacteria | 1153 |
| 316 | Ga0075368_10006600 | 3300006042 | Bacteria | 4064 |
| 317 | Ga0075368_10034380 | 3300006042 | Bacteria | 1975 |
| 318 | Ga0075368_10050834 | 3300006042 | Bacteria | 1647 |
| 319 | Ga0075368_10056250 | 3300006042 | Bacteria | 1569 |
| 320 | Ga0075368_10068508 | 3300006042 | Bacteria | 1430 |
| 321 | Ga0075363_100008322 | 3300006048 | Bacteria | 4824 |
| 322 | Ga0075363_100034177 | 3300006048 | Bacteria | 2653 |
| 323 | Ga0075364_10014940 | 3300006051 | Bacteria | 4806 |
| 324 | Ga0075364_10035025 | 3300006051 | Bacteria | 3243 |
| 325 | Ga0075364_10097233 | 3300006051 | Bacteria | 1958 |
| 326 | Ga0075364_10159130 | 3300006051 | Bacteria | 1524 |
| 327 | Ga0070715_10001875 | 3300006163 | Bacteria | 6301 |
| 328 | Ga0070716_100020794 | 3300006173 | Bacteria | 3450 |
| 329 | Ga0070712_100002508 | 3300006175 | Bacteria | 11319 |
| 330 | Ga0070712_100004561 | 3300006175 | Bacteria | 8553 |
| 331 | Ga0070712_100136445 | 3300006175 | Bacteria | 1866 |
| 332 | Ga0070712_100171482 | 3300006175 | Bacteria | 1684 |
| 333 | Ga0070712_100339038 | 3300006175 | Bacteria | 1227 |
| 334 | Ga0075362_10020700 | 3300006177 | Bacteria | 2751 |
| 335 | Ga0075367_10002480 | 3300006178 | Bacteria | 8449 |
| 336 | Ga0075367_10022341 | 3300006178 | Bacteria | 3547 |
| 337 | Ga0075367_10039443 | 3300006178 | Bacteria | 2754 |
| 338 | Ga0075367_10071339 | 3300006178 | Bacteria | 2089 |
| 339 | Ga0075367_10164023 | 3300006178 | Bacteria | 1382 |
| 340 | Ga0075369_10009394 | 3300006186 | Bacteria | 3797 |
| 341 | Ga0075369_10014037 | 3300006186 | Bacteria | 3193 |
| 342 | Ga0075369_10020387 | 3300006186 | Bacteria | 2715 |
| 343 | Ga0075369_10033295 | 3300006186 | Bacteria | 2184 |
| 344 | Ga0097621_100009027 | 3300006237 | Bacteria | 7220 |
| 345 | Ga0097621_100051087 | 3300006237 | Bacteria | 3363 |
| 346 | Ga0097621_100113558 | 3300006237 | Bacteria | 2291 |
| 347 | Ga0068871_100002899 | 3300006358 | Bacteria | 11767 |
| 348 | Ga0068871_100005378 | 3300006358 | Bacteria | 8971 |
| 349 | Ga0068871_100020899 | 3300006358 | Bacteria | 5021 |
| 350 | Ga0075428_100001220 | 3300006844 | Bacteria | 27537 |
| 351 | Ga0075428_100005911 | 3300006844 | Bacteria | 13598 |
| 352 | Ga0075428_100020360 | 3300006844 | Bacteria | 7347 |
| 353 | Ga0075428_100053554 | 3300006844 | Bacteria | 4422 |
| 354 | Ga0075428_100159065 | 3300006844 | Bacteria | 2452 |
| 355 | Ga0075428_100159870 | 3300006844 | Bacteria | 2445 |
| 356 | Ga0075428_100203688 | 3300006844 | Bacteria | 2139 |
| 357 | Ga0075428_100227622 | 3300006844 | Bacteria | 2012 |
| 358 | Ga0075428_100259450 | 3300006844 | Bacteria | 1872 |
| 359 | Ga0075430_100001639 | 3300006846 | Bacteria | 18299 |
| 360 | Ga0075430_100002472 | 3300006846 | Bacteria | 15389 |
| 361 | Ga0075430_100082381 | 3300006846 | Bacteria | 2696 |
| 362 | Ga0075430_100086622 | 3300006846 | Bacteria | 2622 |
| 363 | Ga0075430_100087775 | 3300006846 | Bacteria | 2603 |
| 364 | Ga0075430_100129831 | 3300006846 | Bacteria | 2100 |
| 365 | Ga0075430_100312493 | 3300006846 | Bacteria | 1299 |
| 366 | Ga0075430_100363525 | 3300006846 | Bacteria | 1195 |
| 367 | Ga0075431_100000109 | 3300006847 | Bacteria | 52399 |
| 368 | Ga0075431_100003545 | 3300006847 | Bacteria | 15109 |
| 369 | Ga0075431_100005435 | 3300006847 | Bacteria | 12587 |
| 370 | Ga0075431_100020612 | 3300006847 | Bacteria | 6737 |
| 371 | Ga0075431_100064679 | 3300006847 | Bacteria | 3777 |
| 372 | Ga0075431_100084861 | 3300006847 | Bacteria | 3269 |
| 373 | Ga0075431_100092037 | 3300006847 | Bacteria | 3129 |
| 374 | Ga0075431_100146448 | 3300006847 | Bacteria | 2434 |
| 375 | Ga0075431_100337982 | 3300006847 | Bacteria | 1516 |
| 376 | Ga0075431_100350704 | 3300006847 | Bacteria | 1484 |
| 377 | Ga0075434_100000211 | 3300006871 | Bacteria | 39638 |
| 378 | Ga0075434_100000371 | 3300006871 | Bacteria | 32625 |
| 379 | Ga0075434_100001777 | 3300006871 | Bacteria | 18583 |
| 380 | Ga0075434_100006290 | 3300006871 | Bacteria | 10880 |
| 381 | Ga0075434_100023631 | 3300006871 | Bacteria | 5994 |
| 382 | Ga0075434_100045576 | 3300006871 | Bacteria | 4350 |
| 383 | Ga0075429_100001213 | 3300006880 | Bacteria | 20918 |
| 384 | Ga0075429_100022955 | 3300006880 | Bacteria | 5409 |
| 385 | Ga0075429_100053625 | 3300006880 | Bacteria | 3508 |
| 386 | Ga0075429_100090593 | 3300006880 | Bacteria | 2667 |
| 387 | Ga0068865_100021004 | 3300006881 | Bacteria | 4243 |
| 388 | Ga0068865_100038875 | 3300006881 | Bacteria | 3223 |
| 389 | Ga0075436_100003794 | 3300006914 | Bacteria | 10365 |
| 390 | Ga0075436_100014215 | 3300006914 | Bacteria | 5450 |
| 391 | Ga0075436_100064857 | 3300006914 | Bacteria | 2525 |
| 392 | Ga0075436_100168696 | 3300006914 | Bacteria | 1545 |
| 393 | Ga0097620_100000332 | 3300006931 | Bacteria | 47130 |
| 394 | Ga0097620_100006827 | 3300006931 | Bacteria | 11597 |
| 395 | Ga0097620_100024736 | 3300006931 | Bacteria | 6026 |
| 396 | Ga0097620_100586186 | 3300006931 | Bacteria | 1208 |
| 397 | Ga0079104_1000063 | 3300006946 | Bacteria | 159519 |
| 398 | Ga0079104_1007401 | 3300006946 | Bacteria | 3989 |
| 399 | Ga0079104_1009774 | 3300006946 | Bacteria | 3221 |
| 400 | Ga0099826_10000120 | 3300006948 | Bacteria | 35923 |
| 401 | Ga0099826_10010203 | 3300006948 | Bacteria | 7033 |
| 402 | Ga0099826_10079759 | 3300006948 | Bacteria | 2044 |
| 403 | Ga0075435_100006459 | 3300007076 | Bacteria | 8292 |
| 404 | Ga0075435_100008023 | 3300007076 | Bacteria | 7557 |
| 405 | Ga0075435_100130816 | 3300007076 | Bacteria | 2100 |
| 406 | Ga0075435_100197824 | 3300007076 | Bacteria | 1702 |
| 407 | Ga0099794_10018011 | 3300007265 | Bacteria | 3159 |
| 408 | Ga0099794_10087406 | 3300007265 | Bacteria | 1544 |
| 409 | Ga0099795_10006137 | 3300007788 | Bacteria | 3255 |
| 410 | Ga0105251_10031021 | 3300009011 | Bacteria | 2678 |
| 411 | Ga0105251_10065134 | 3300009011 | Bacteria | 1706 |
| 412 | Ga0105244_10078544 | 3300009036 | Bacteria | 1636 |
| 413 | Ga0105250_10026489 | 3300009092 | Bacteria | 2335 |
| 414 | Ga0105250_10058295 | 3300009092 | Bacteria | 1550 |
| 415 | Ga0105240_10016012 | 3300009093 | Bacteria | 10165 |
| 416 | Ga0105240_10044678 | 3300009093 | Bacteria | 5626 |
| 417 | Ga0105240_10059935 | 3300009093 | Bacteria | 4747 |
| 418 | Ga0105240_10087081 | 3300009093 | Bacteria | 3825 |
| 419 | Ga0105240_10161270 | 3300009093 | Bacteria | 2663 |
| 420 | Ga0105240_10194622 | 3300009093 | Bacteria | 2382 |
| 421 | Ga0105240_10211647 | 3300009093 | Bacteria | 2265 |
| 422 | Ga0105240_10259473 | 3300009093 | Bacteria | 2005 |
| 423 | Ga0105240_10305535 | 3300009093 | Bacteria | 1818 |
| 424 | Ga0105240_10357390 | 3300009093 | Bacteria | 1656 |
| 425 | Ga0111539_10001777 | 3300009094 | Bacteria | 28667 |
| 426 | Ga0111539_10024409 | 3300009094 | Bacteria | 7420 |
| 427 | Ga0111539_10061693 | 3300009094 | Bacteria | 4441 |
| 428 | Ga0111539_10077044 | 3300009094 | Bacteria | 3925 |
| 429 | Ga0111539_10081452 | 3300009094 | Bacteria | 3807 |
| 430 | Ga0111539_10148301 | 3300009094 | Bacteria | 2746 |
| 431 | Ga0105245_10000115 | 3300009098 | Bacteria | 77632 |
| 432 | Ga0105245_10007590 | 3300009098 | Bacteria | 9496 |
| 433 | Ga0105245_10137928 | 3300009098 | Bacteria | 2294 |
| 434 | Ga0105247_10011005 | 3300009101 | Bacteria | 5460 |
| 435 | Ga0105247_10028530 | 3300009101 | Bacteria | 3378 |
| 436 | Ga0114129_10000425 | 3300009147 | Bacteria | 50146 |
| 437 | Ga0114129_10028829 | 3300009147 | Bacteria | 7865 |
| 438 | Ga0114129_10039454 | 3300009147 | Bacteria | 6657 |
| 439 | Ga0114129_10089914 | 3300009147 | Bacteria | 4256 |
| 440 | Ga0114129_10107117 | 3300009147 | Bacteria | 3861 |
| 441 | Ga0114129_10157237 | 3300009147 | Bacteria | 3107 |
| 442 | Ga0114129_10160953 | 3300009147 | Bacteria | 3066 |
| 443 | Ga0114129_10281742 | 3300009147 | Bacteria | 2221 |
| 444 | Ga0114129_10295577 | 3300009147 | Bacteria | 2160 |
| 445 | Ga0114129_10341581 | 3300009147 | Bacteria | 1986 |
| 446 | Ga0114129_10387854 | 3300009147 | Bacteria | 1843 |
| 447 | Ga0105243_10001566 | 3300009148 | Bacteria | 19983 |
| 448 | Ga0105243_10002537 | 3300009148 | Bacteria | 15248 |
| 449 | Ga0105243_10058123 | 3300009148 | Bacteria | 3081 |
| 450 | Ga0105243_10128637 | 3300009148 | Bacteria | 2146 |
| 451 | Ga0105241_10033070 | 3300009174 | Bacteria | 3881 |
| 452 | Ga0105241_10159157 | 3300009174 | Bacteria | 1855 |
| 453 | Ga0105241_10182951 | 3300009174 | Bacteria | 1740 |
| 454 | Ga0105242_10127953 | 3300009176 | Bacteria | 2188 |
| 455 | Ga0105248_10002392 | 3300009177 | Bacteria | 20840 |
| 456 | Ga0105248_10047992 | 3300009177 | Bacteria | 4789 |
| 457 | Ga0105248_10098637 | 3300009177 | Bacteria | 3292 |
| 458 | Ga0105248_10243132 | 3300009177 | Bacteria | 2026 |
| 459 | Ga0105248_10339674 | 3300009177 | Bacteria | 1691 |
| 460 | Ga0105237_10056057 | 3300009545 | Bacteria | 3946 |
| 461 | Ga0105237_10132128 | 3300009545 | Bacteria | 2490 |
| 462 | Ga0105237_10199693 | 3300009545 | Bacteria | 1999 |
| 463 | Ga0105237_10262249 | 3300009545 | Bacteria | 1730 |
| 464 | Ga0105238_10012662 | 3300009551 | Bacteria | 8513 |
| 465 | Ga0105238_10013423 | 3300009551 | Bacteria | 8270 |
| 466 | Ga0105238_10038211 | 3300009551 | Bacteria | 4875 |
| 467 | Ga0105238_10088560 | 3300009551 | Bacteria | 3082 |
| 468 | Ga0105238_10124082 | 3300009551 | Bacteria | 2562 |
| 469 | Ga0105238_10246639 | 3300009551 | Bacteria | 1764 |
| 470 | Ga0105238_10292662 | 3300009551 | Bacteria | 1611 |
| 471 | Ga0105238_10309527 | 3300009551 | Bacteria | 1564 |
| 472 | Ga0105238_10512926 | 3300009551 | Bacteria | 1201 |
| 473 | Ga0105238_10569175 | 3300009551 | Bacteria | 1138 |
| 474 | Ga0105249_10001691 | 3300009553 | Bacteria | 19321 |
| 475 | Ga0105249_10001995 | 3300009553 | Bacteria | 17726 |
| 476 | Ga0105249_10008449 | 3300009553 | Bacteria | 8970 |
| 477 | Ga0105249_10081287 | 3300009553 | Bacteria | 3012 |
| 478 | Ga0105249_10134656 | 3300009553 | Bacteria | 2363 |
| 479 | Ga0105249_10311215 | 3300009553 | Bacteria | 1583 |
| 480 | Ga0105249_10330206 | 3300009553 | Bacteria | 1539 |
| 481 | Ga0105249_10548771 | 3300009553 | Bacteria | 1206 |
| 482 | Ga0099796_10058848 | 3300010159 | Bacteria | 1356 |
| 483 | Ga0105239_10103610 | 3300010375 | Bacteria | 3149 |
| 484 | Ga0105239_10148418 | 3300010375 | Bacteria | 2616 |
| 485 | Ga0105239_10157282 | 3300010375 | Bacteria | 2539 |
| 486 | Ga0105239_10163319 | 3300010375 | Bacteria | 2489 |
| 487 | Ga0105239_10177443 | 3300010375 | Bacteria | 2383 |
| 488 | Ga0105239_10200602 | 3300010375 | Bacteria | 2235 |
| 489 | Ga0105239_10206328 | 3300010375 | Bacteria | 2202 |
| 490 | Ga0105239_10248504 | 3300010375 | Bacteria | 1998 |
| 491 | Ga0105239_10260239 | 3300010375 | Bacteria | 1950 |
| 492 | Ga0105239_10264833 | 3300010375 | Bacteria | 1932 |
| 493 | Ga0105239_10326482 | 3300010375 | Bacteria | 1731 |
| 494 | Ga0105246_10003706 | 3300011119 | Bacteria | 9251 |
| 495 | Ga0105246_10008619 | 3300011119 | Bacteria | 6272 |
| 496 | Ga0105246_10024155 | 3300011119 | Bacteria | 3945 |
| 497 | Ga0105246_10066455 | 3300011119 | Bacteria | 2525 |
| 498 | Ga0105246_10211931 | 3300011119 | Bacteria | 1513 |
| 499 | Ga0105246_10213339 | 3300011119 | Bacteria | 1508 |
| 500 | Ga0105246_10316084 | 3300011119 | Bacteria | 1267 |
| 501 | Ga0157373_10049569 | 3300013100 | Bacteria | 2992 |
| 502 | Ga0157373_10071974 | 3300013100 | Bacteria | 2441 |
| 503 | Ga0157373_10261002 | 3300013100 | Bacteria | 1226 |
| 504 | Ga0157371_10069114 | 3300013102 | Bacteria | 2501 |
| 505 | Ga0157371_10111413 | 3300013102 | Bacteria | 1942 |
| 506 | Ga0157371_10123827 | 3300013102 | Bacteria | 1839 |
| 507 | Ga0157371_10274742 | 3300013102 | Bacteria | 1216 |
| 508 | Ga0157370_10000324 | 3300013104 | Bacteria | 59791 |
| 509 | Ga0157370_10026364 | 3300013104 | Bacteria | 5740 |
| 510 | Ga0157370_10216944 | 3300013104 | Bacteria | 1773 |
| 511 | Ga0157370_10224216 | 3300013104 | Bacteria | 1740 |
| 512 | Ga0157370_10306328 | 3300013104 | Bacteria | 1466 |
| 513 | Ga0157369_10005525 | 3300013105 | Bacteria | 14679 |
| 514 | Ga0157369_10117120 | 3300013105 | Bacteria | 2828 |
| 515 | Ga0157369_10195153 | 3300013105 | Bacteria | 2126 |
| 516 | Ga0157369_10202001 | 3300013105 | Bacteria | 2086 |
| 517 | Ga0157369_10273617 | 3300013105 | Bacteria | 1759 |
| 518 | Ga0157369_10421652 | 3300013105 | Bacteria | 1383 |
| 519 | Ga0171462_1008 | 3300013250 | Bacteria | 384318 |
| 520 | Ga0157374_10006468 | 3300013296 | Bacteria | 9945 |
| 521 | Ga0157374_10006671 | 3300013296 | Bacteria | 9807 |
| 522 | Ga0157374_10073552 | 3300013296 | Bacteria | 3226 |
| 523 | Ga0157374_10163290 | 3300013296 | Bacteria | 2170 |
| 524 | Ga0157378_10001030 | 3300013297 | Bacteria | 25495 |
| 525 | Ga0157378_10035361 | 3300013297 | Bacteria | 4418 |
| 526 | Ga0157378_10111532 | 3300013297 | Bacteria | 2508 |
| 527 | Ga0163162_10045343 | 3300013306 | Bacteria | 4405 |
| 528 | Ga0163162_10092574 | 3300013306 | Bacteria | 3107 |
| 529 | Ga0163162_10099294 | 3300013306 | Bacteria | 3002 |
| 530 | Ga0163162_10112611 | 3300013306 | Bacteria | 2820 |
| 531 | Ga0163162_10263359 | 3300013306 | Bacteria | 1855 |
| 532 | Ga0157372_10096778 | 3300013307 | Bacteria | 3365 |
| 533 | Ga0157372_10171317 | 3300013307 | Bacteria | 2511 |
| 534 | Ga0157372_10232610 | 3300013307 | Bacteria | 2137 |
| 535 | Ga0157372_10587039 | 3300013307 | Bacteria | 1299 |
| 536 | Ga0157375_10011994 | 3300013308 | Bacteria | 7674 |
| 537 | Ga0157375_10035164 | 3300013308 | Bacteria | 4780 |
| 538 | Ga0157375_10096756 | 3300013308 | Bacteria | 3025 |
| 539 | Ga0157375_10125566 | 3300013308 | Bacteria | 2680 |
| 540 | Ga0157375_10163308 | 3300013308 | Bacteria | 2371 |
| 541 | Ga0163163_10000150 | 3300014325 | Bacteria | 72638 |
| 542 | Ga0163163_10010637 | 3300014325 | Bacteria | 8290 |
| 543 | Ga0163163_10102773 | 3300014325 | Bacteria | 2882 |
| 544 | Ga0163163_10104374 | 3300014325 | Bacteria | 2859 |
| 545 | Ga0163163_10119349 | 3300014325 | Bacteria | 2670 |
| 546 | Ga0163163_10662111 | 3300014325 | Bacteria | 1108 |
| 547 | Ga0157380_10008288 | 3300014326 | Bacteria | 7406 |
| 548 | Ga0157380_10030596 | 3300014326 | Bacteria | 4125 |
| 549 | Ga0157380_10080263 | 3300014326 | Bacteria | 2666 |
| 550 | Ga0182008_10042480 | 3300014497 | Bacteria | 2264 |
| 551 | Ga0157377_10004065 | 3300014745 | Bacteria | 6675 |
| 552 | Ga0157377_10008042 | 3300014745 | Bacteria | 5127 |
| 553 | Ga0157377_10024575 | 3300014745 | Bacteria | 3204 |
| 554 | Ga0157379_10010439 | 3300014968 | Bacteria | 8094 |
| 555 | Ga0157379_10098205 | 3300014968 | Bacteria | 2629 |
| 556 | Ga0157379_10187602 | 3300014968 | Bacteria | 1869 |
| 557 | Ga0157379_10474868 | 3300014968 | Bacteria | 1157 |
| 558 | Ga0157376_10002960 | 3300014969 | Bacteria | 11654 |
| 559 | Ga0157376_10381377 | 3300014969 | Bacteria | 1358 |
| 560 | Ga0182006_1014659 | 3300015261 | Bacteria | 3374 |
| 561 | Ga0182005_1029798 | 3300015265 | Bacteria | 1488 |
| 562 | Ga0163161_10057076 | 3300017792 | Bacteria | 2837 |
| 563 | Ga0206356_10305157 | 3300020070 | Bacteria | 1604 |
| 564 | Ga0206356_10632670 | 3300020070 | Bacteria | 2430 |
| 565 | Ga0206354_10039477 | 3300020081 | Bacteria | 1390 |
| 566 | Ga0206353_10339595 | 3300020082 | Bacteria | 1855 |
| 567 | Ga0206353_10593657 | 3300020082 | Bacteria | 1511 |
| 568 | Ga0206353_11216187 | 3300020082 | Bacteria | 1260 |
| 569 | Ga0213873_10004680 | 3300021358 | Bacteria | 2573 |
| 570 | Ga0213874_10022715 | 3300021377 | Bacteria | 1743 |
| 571 | Ga0213876_10000260 | 3300021384 | Bacteria | 48782 |
| 572 | Ga0213876_10018209 | 3300021384 | Bacteria | 3707 |
| 573 | Ga0213876_10074564 | 3300021384 | Bacteria | 1792 |
| 574 | Ga0213876_10181579 | 3300021384 | Bacteria | 1119 |
| 575 | Ga0213875_10000046 | 3300021388 | Bacteria | 149850 |
| 576 | Ga0213875_10013299 | 3300021388 | Bacteria | 4045 |
| 577 | Ga0213875_10014809 | 3300021388 | Bacteria | 3800 |
| 578 | Ga0213875_10156609 | 3300021388 | Bacteria | 1068 |
| 579 | Ga0213871_10051334 | 3300021441 | Bacteria | 1131 |
| 580 | Ga0228711_1000045 | 3300022739 | Bacteria | 85435 |
| 581 | Ga0228711_1000184 | 3300022739 | Bacteria | 62108 |
| 582 | Ga0228710_1000036 | 3300022740 | Bacteria | 91904 |
| 583 | Ga0228710_1000177 | 3300022740 | Bacteria | 62984 |
| 584 | Ga0207425_1000043 | 3300025245 | Bacteria | 208791 |
| 585 | Ga0207425_1002206 | 3300025245 | Bacteria | 7076 |
| 586 | Ga0209026_1000029 | 3300025250 | Bacteria | 337109 |
| 587 | Ga0209148_1000080 | 3300025254 | Bacteria | 277806 |
| 588 | Ga0209148_1001606 | 3300025254 | Bacteria | 10541 |
| 589 | Ga0209759_1000040 | 3300025256 | Bacteria | 254501 |
| 590 | Ga0209129_1000072 | 3300025258 | Bacteria | 208805 |
| 591 | Ga0209129_1000226 | 3300025258 | Bacteria | 63537 |
| 592 | Ga0209129_1001403 | 3300025258 | Bacteria | 13475 |
| 593 | Ga0209129_1002679 | 3300025258 | Bacteria | 8410 |
| 594 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 595 | Ga0209233_1000613 | 3300025261 | Bacteria | 18219 |
| 596 | Ga0209233_1003389 | 3300025261 | Bacteria | 5620 |
| 597 | Ga0209455_1000171 | 3300025272 | Bacteria | 109696 |
| 598 | Ga0209455_1001291 | 3300025272 | Bacteria | 11697 |
| 599 | Ga0209673_1000157 | 3300025273 | Bacteria | 144747 |
| 600 | Ga0209673_1000239 | 3300025273 | Bacteria | 105502 |
| 601 | Ga0209673_1014457 | 3300025273 | Bacteria | 3052 |
| 602 | Ga0209673_1028115 | 3300025273 | Bacteria | 1817 |
| 603 | Ga0209130_1000145 | 3300025284 | Bacteria | 113201 |
| 604 | Ga0209130_1000209 | 3300025284 | Bacteria | 78300 |
| 605 | Ga0209130_1015990 | 3300025284 | Bacteria | 1831 |
| 606 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 607 | Ga0209025_1000120 | 3300025294 | Bacteria | 208791 |
| 608 | Ga0209025_1001416 | 3300025294 | Bacteria | 31774 |
| 609 | Ga0209025_1001755 | 3300025294 | Bacteria | 25992 |
| 610 | Ga0209025_1010153 | 3300025294 | Bacteria | 6423 |
| 611 | Ga0209025_1014358 | 3300025294 | Bacteria | 4879 |
| 612 | Ga0209025_1014934 | 3300025294 | Bacteria | 4729 |
| 613 | Ga0209025_1022482 | 3300025294 | Bacteria | 3340 |
| 614 | Ga0209025_1032144 | 3300025294 | Bacteria | 2462 |
| 615 | Ga0209564_1000237 | 3300025295 | Bacteria | 120540 |
| 616 | Ga0209564_1003161 | 3300025295 | Bacteria | 11595 |
| 617 | Ga0209564_1014218 | 3300025295 | Bacteria | 3326 |
| 618 | Ga0209758_1000059 | 3300025297 | Bacteria | 328458 |
| 619 | Ga0209758_1000111 | 3300025297 | Bacteria | 208790 |
| 620 | Ga0209758_1000130 | 3300025297 | Bacteria | 184456 |
| 621 | Ga0209758_1012600 | 3300025297 | Bacteria | 4712 |
| 622 | Ga0209758_1012869 | 3300025297 | Bacteria | 4633 |
| 623 | Ga0209758_1020840 | 3300025297 | Bacteria | 3081 |
| 624 | Ga0209758_1022623 | 3300025297 | Bacteria | 2872 |
| 625 | Ga0209758_1028720 | 3300025297 | Bacteria | 2344 |
| 626 | Ga0209050_1004722 | 3300025298 | Bacteria | 9025 |
| 627 | Ga0209256_1000185 | 3300025299 | Bacteria | 120265 |
| 628 | Ga0209256_1000619 | 3300025299 | Bacteria | 49078 |
| 629 | Ga0209256_1008788 | 3300025299 | Bacteria | 4594 |
| 630 | Ga0209256_1013348 | 3300025299 | Bacteria | 3052 |
| 631 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 632 | Ga0207426_1006212 | 3300025302 | Bacteria | 5246 |
| 633 | Ga0207426_1009460 | 3300025302 | Bacteria | 3855 |
| 634 | Ga0209051_1004806 | 3300025303 | Bacteria | 8147 |
| 635 | Ga0209051_1005181 | 3300025303 | Bacteria | 7720 |
| 636 | Ga0209051_1008002 | 3300025303 | Bacteria | 5673 |
| 637 | Ga0209051_1027204 | 3300025303 | Bacteria | 2284 |
| 638 | Ga0209257_1000997 | 3300025304 | Bacteria | 38352 |
| 639 | Ga0209257_1003615 | 3300025304 | Bacteria | 13025 |
| 640 | Ga0207697_10026362 | 3300025315 | Bacteria | 2376 |
| 641 | Ga0207656_10014795 | 3300025321 | Bacteria | 3014 |
| 642 | Ga0207656_10032864 | 3300025321 | Bacteria | 2157 |
| 643 | Ga0207692_10000504 | 3300025898 | Bacteria | 13779 |
| 644 | Ga0207692_10151304 | 3300025898 | Bacteria | 1329 |
| 645 | Ga0207642_10056938 | 3300025899 | Bacteria | 1795 |
| 646 | Ga0207642_10162803 | 3300025899 | Bacteria | 1200 |
| 647 | Ga0207710_10004939 | 3300025900 | Bacteria | 5778 |
| 648 | Ga0207710_10051552 | 3300025900 | Bacteria | 1848 |
| 649 | Ga0207688_10000213 | 3300025901 | Bacteria | 25981 |
| 650 | Ga0207688_10000344 | 3300025901 | Bacteria | 21559 |
| 651 | Ga0207688_10002122 | 3300025901 | Bacteria | 10654 |
| 652 | Ga0207688_10238146 | 3300025901 | Bacteria | 1100 |
| 653 | Ga0207680_10038874 | 3300025903 | Bacteria | 2757 |
| 654 | Ga0207680_10292765 | 3300025903 | Bacteria | 1133 |
| 655 | Ga0207647_10015916 | 3300025904 | Bacteria | 5146 |
| 656 | Ga0207647_10030957 | 3300025904 | Bacteria | 3448 |
| 657 | Ga0207647_10086211 | 3300025904 | Bacteria | 1877 |
| 658 | Ga0207699_10000508 | 3300025906 | Bacteria | 19334 |
| 659 | Ga0207699_10026433 | 3300025906 | Bacteria | 3200 |
| 660 | Ga0207699_10096390 | 3300025906 | Bacteria | 1867 |
| 661 | Ga0207645_10007988 | 3300025907 | Bacteria | 7422 |
| 662 | Ga0207645_10013416 | 3300025907 | Bacteria | 5521 |
| 663 | Ga0207645_10066685 | 3300025907 | Bacteria | 2301 |
| 664 | Ga0207643_10000218 | 3300025908 | Bacteria | 40287 |
| 665 | Ga0207643_10008419 | 3300025908 | Bacteria | 5535 |
| 666 | Ga0207643_10045427 | 3300025908 | Bacteria | 2481 |
| 667 | Ga0207705_10001941 | 3300025909 | Bacteria | 16155 |
| 668 | Ga0207705_10021988 | 3300025909 | Bacteria | 4551 |
| 669 | Ga0207684_10193153 | 3300025910 | Bacteria | 1756 |
| 670 | Ga0207684_10203617 | 3300025910 | Bacteria | 1707 |
| 671 | Ga0207654_10122151 | 3300025911 | Bacteria | 1637 |
| 672 | Ga0207654_10239484 | 3300025911 | Bacteria | 1212 |
| 673 | Ga0207707_10065174 | 3300025912 | Bacteria | 3173 |
| 674 | Ga0207707_10069552 | 3300025912 | Bacteria | 3068 |
| 675 | Ga0207707_10133884 | 3300025912 | Bacteria | 2167 |
| 676 | Ga0207707_10298046 | 3300025912 | Bacteria | 1394 |
| 677 | Ga0207707_10456026 | 3300025912 | Bacteria | 1094 |
| 678 | Ga0207695_10023254 | 3300025913 | Bacteria | 7010 |
| 679 | Ga0207695_10051716 | 3300025913 | Bacteria | 4311 |
| 680 | Ga0207695_10067364 | 3300025913 | Bacteria | 3673 |
| 681 | Ga0207695_10123834 | 3300025913 | Bacteria | 2550 |
| 682 | Ga0207695_10127350 | 3300025913 | Bacteria | 2507 |
| 683 | Ga0207695_10146155 | 3300025913 | Bacteria | 2308 |
| 684 | Ga0207695_10406203 | 3300025913 | Bacteria | 1246 |
| 685 | Ga0207695_10428145 | 3300025913 | Bacteria | 1207 |
| 686 | Ga0207695_10435917 | 3300025913 | Bacteria | 1194 |
| 687 | Ga0207671_10017102 | 3300025914 | Bacteria | 5606 |
| 688 | Ga0207671_10144931 | 3300025914 | Bacteria | 1832 |
| 689 | Ga0207671_10174406 | 3300025914 | Bacteria | 1671 |
| 690 | Ga0207671_10210293 | 3300025914 | Bacteria | 1521 |
| 691 | Ga0207693_10004810 | 3300025915 | Bacteria | 11361 |
| 692 | Ga0207693_10009374 | 3300025915 | Bacteria | 7984 |
| 693 | Ga0207693_10012513 | 3300025915 | Bacteria | 6854 |
| 694 | Ga0207693_10021771 | 3300025915 | Bacteria | 5097 |
| 695 | Ga0207693_10100901 | 3300025915 | Bacteria | 2263 |
| 696 | Ga0207693_10127360 | 3300025915 | Bacteria | 2001 |
| 697 | Ga0207693_10160234 | 3300025915 | Bacteria | 1770 |
| 698 | Ga0207693_10229138 | 3300025915 | Unclassified | 1459 |
| 699 | Ga0207663_10000732 | 3300025916 | Bacteria | 14686 |
| 700 | Ga0207663_10023281 | 3300025916 | Bacteria | 3552 |
| 701 | Ga0207663_10034225 | 3300025916 | Bacteria | 3036 |
| 702 | Ga0207663_10045565 | 3300025916 | Bacteria | 2698 |
| 703 | Ga0207663_10054062 | 3300025916 | Bacteria | 2512 |
| 704 | Ga0207663_10072744 | 3300025916 | Bacteria | 2223 |
| 705 | Ga0207663_10163460 | 3300025916 | Bacteria | 1574 |
| 706 | Ga0207660_10001765 | 3300025917 | Bacteria | 14471 |
| 707 | Ga0207660_10002161 | 3300025917 | Bacteria | 13042 |
| 708 | Ga0207660_10024327 | 3300025917 | Bacteria | 4100 |
| 709 | Ga0207660_10194260 | 3300025917 | Bacteria | 1582 |
| 710 | Ga0207662_10005862 | 3300025918 | Bacteria | 6590 |
| 711 | Ga0207662_10047533 | 3300025918 | Bacteria | 2542 |
| 712 | Ga0207662_10091273 | 3300025918 | Bacteria | 1874 |
| 713 | Ga0207662_10140258 | 3300025918 | Bacteria | 1531 |
| 714 | Ga0207662_10176713 | 3300025918 | Bacteria | 1372 |
| 715 | Ga0207657_10011619 | 3300025919 | Bacteria | 8731 |
| 716 | Ga0207657_10024387 | 3300025919 | Bacteria | 5603 |
| 717 | Ga0207657_10030427 | 3300025919 | Bacteria | 4900 |
| 718 | Ga0207657_10034378 | 3300025919 | Bacteria | 4558 |
| 719 | Ga0207649_10007165 | 3300025920 | Bacteria | 6061 |
| 720 | Ga0207649_10108977 | 3300025920 | Bacteria | 1847 |
| 721 | Ga0207649_10118222 | 3300025920 | Bacteria | 1783 |
| 722 | Ga0207652_10029701 | 3300025921 | Bacteria | 4573 |
| 723 | Ga0207652_10196331 | 3300025921 | Bacteria | 1816 |
| 724 | Ga0207652_10280474 | 3300025921 | Bacteria | 1503 |
| 725 | Ga0207652_10401741 | 3300025921 | Bacteria | 1236 |
| 726 | Ga0207646_10007326 | 3300025922 | Bacteria | 11239 |
| 727 | Ga0207646_10103953 | 3300025922 | Bacteria | 2547 |
| 728 | Ga0207646_10245445 | 3300025922 | Bacteria | 1617 |
| 729 | Ga0207681_10008264 | 3300025923 | Bacteria | 6363 |
| 730 | Ga0207681_10028104 | 3300025923 | Bacteria | 3642 |
| 731 | Ga0207681_10041178 | 3300025923 | Bacteria | 3079 |
| 732 | Ga0207681_10144849 | 3300025923 | Bacteria | 1774 |
| 733 | Ga0207694_10144217 | 3300025924 | Bacteria | 1916 |
| 734 | Ga0207650_10022208 | 3300025925 | Bacteria | 4491 |
| 735 | Ga0207650_10096013 | 3300025925 | Bacteria | 2273 |
| 736 | Ga0207659_10019408 | 3300025926 | Bacteria | 4475 |
| 737 | Ga0207659_10038536 | 3300025926 | Bacteria | 3326 |
| 738 | Ga0207659_10083561 | 3300025926 | Bacteria | 2367 |
| 739 | Ga0207687_10068045 | 3300025927 | Bacteria | 2536 |
| 740 | Ga0207687_10084687 | 3300025927 | Bacteria | 2298 |
| 741 | Ga0207700_10056062 | 3300025928 | Bacteria | 2965 |
| 742 | Ga0207700_10065156 | 3300025928 | Bacteria | 2779 |
| 743 | Ga0207700_10074501 | 3300025928 | Bacteria | 2626 |
| 744 | Ga0207700_10111361 | 3300025928 | Bacteria | 2203 |
| 745 | Ga0207700_10286364 | 3300025928 | Bacteria | 1419 |
| 746 | Ga0207664_10018977 | 3300025929 | Bacteria | 5074 |
| 747 | Ga0207664_10082568 | 3300025929 | Bacteria | 2618 |
| 748 | Ga0207664_10085522 | 3300025929 | Bacteria | 2574 |
| 749 | Ga0207664_10125164 | 3300025929 | Bacteria | 2157 |
| 750 | Ga0207664_10131642 | 3300025929 | Bacteria | 2106 |
| 751 | Ga0207664_10281055 | 3300025929 | Bacteria | 1460 |
| 752 | Ga0207664_10350825 | 3300025929 | Bacteria | 1306 |
| 753 | Ga0207644_10007463 | 3300025931 | Bacteria | 7130 |
| 754 | Ga0207644_10008328 | 3300025931 | Bacteria | 6795 |
| 755 | Ga0207644_10020710 | 3300025931 | Bacteria | 4474 |
| 756 | Ga0207644_10053055 | 3300025931 | Bacteria | 2917 |
| 757 | Ga0207644_10350477 | 3300025931 | Bacteria | 1199 |
| 758 | Ga0207690_10296031 | 3300025932 | Bacteria | 1265 |
| 759 | Ga0207706_10003979 | 3300025933 | Bacteria | 14003 |
| 760 | Ga0207706_10078106 | 3300025933 | Bacteria | 2911 |
| 761 | Ga0207706_10093359 | 3300025933 | Bacteria | 2646 |
| 762 | Ga0207706_10377048 | 3300025933 | Bacteria | 1231 |
| 763 | Ga0207686_10023021 | 3300025934 | Bacteria | 3594 |
| 764 | Ga0207709_10000917 | 3300025935 | Bacteria | 22229 |
| 765 | Ga0207709_10005103 | 3300025935 | Bacteria | 7495 |
| 766 | Ga0207709_10005820 | 3300025935 | Bacteria | 6967 |
| 767 | Ga0207709_10013217 | 3300025935 | Bacteria | 4554 |
| 768 | Ga0207670_10004303 | 3300025936 | Bacteria | 7645 |
| 769 | Ga0207670_10010975 | 3300025936 | Bacteria | 5236 |
| 770 | Ga0207670_10042605 | 3300025936 | Bacteria | 2992 |
| 771 | Ga0207670_10107671 | 3300025936 | Bacteria | 2002 |
| 772 | Ga0207670_10279153 | 3300025936 | Bacteria | 1301 |
| 773 | Ga0207670_10406824 | 3300025936 | Bacteria | 1089 |
| 774 | Ga0207669_10145014 | 3300025937 | Bacteria | 1654 |
| 775 | Ga0207704_10005069 | 3300025938 | Bacteria | 6061 |
| 776 | Ga0207704_10010576 | 3300025938 | Bacteria | 4507 |
| 777 | Ga0207704_10123145 | 3300025938 | Bacteria | 1779 |
| 778 | Ga0207665_10018857 | 3300025939 | Bacteria | 4534 |
| 779 | Ga0207665_10094554 | 3300025939 | Bacteria | 2076 |
| 780 | Ga0207665_10148182 | 3300025939 | Bacteria | 1679 |
| 781 | Ga0207665_10217331 | 3300025939 | Bacteria | 1399 |
| 782 | Ga0207691_10005727 | 3300025940 | Bacteria | 12016 |
| 783 | Ga0207691_10035136 | 3300025940 | Bacteria | 4656 |
| 784 | Ga0207691_10080795 | 3300025940 | Bacteria | 2923 |
| 785 | Ga0207691_10101354 | 3300025940 | Bacteria | 2569 |
| 786 | Ga0207711_10116460 | 3300025941 | Bacteria | 2382 |
| 787 | Ga0207711_10257644 | 3300025941 | Bacteria | 1603 |
| 788 | Ga0207689_10000762 | 3300025942 | Bacteria | 30912 |
| 789 | Ga0207689_10021922 | 3300025942 | Bacteria | 5372 |
| 790 | Ga0207689_10023847 | 3300025942 | Bacteria | 5133 |
| 791 | Ga0207689_10058267 | 3300025942 | Bacteria | 3177 |
| 792 | Ga0207661_10135602 | 3300025944 | Bacteria | 2114 |
| 793 | Ga0207661_10176323 | 3300025944 | Unclassified | 1864 |
| 794 | Ga0207679_10005378 | 3300025945 | Bacteria | 8026 |
| 795 | Ga0207667_10007911 | 3300025949 | Bacteria | 12694 |
| 796 | Ga0207667_10127690 | 3300025949 | Bacteria | 2619 |
| 797 | Ga0207667_10157624 | 3300025949 | Bacteria | 2336 |
| 798 | Ga0207667_10308230 | 3300025949 | Bacteria | 1617 |
| 799 | Ga0207651_10045102 | 3300025960 | Bacteria | 2955 |
| 800 | Ga0207651_10067158 | 3300025960 | Bacteria | 2522 |
| 801 | Ga0207651_10181570 | 3300025960 | Bacteria | 1670 |
| 802 | Ga0207651_10341819 | 3300025960 | Bacteria | 1257 |
| 803 | Ga0207712_10000763 | 3300025961 | Bacteria | 24183 |
| 804 | Ga0207712_10001549 | 3300025961 | Bacteria | 15507 |
| 805 | Ga0207712_10013285 | 3300025961 | Bacteria | 5279 |
| 806 | Ga0207712_10080583 | 3300025961 | Bacteria | 2368 |
| 807 | Ga0207712_10126412 | 3300025961 | Bacteria | 1942 |
| 808 | Ga0207668_10053056 | 3300025972 | Bacteria | 2808 |
| 809 | Ga0207668_10059474 | 3300025972 | Bacteria | 2678 |
| 810 | Ga0207668_10137408 | 3300025972 | Bacteria | 1874 |
| 811 | Ga0207640_10225598 | 3300025981 | Bacteria | 1437 |
| 812 | Ga0207658_10155695 | 3300025986 | Bacteria | 1867 |
| 813 | Ga0207658_10217649 | 3300025986 | Bacteria | 1605 |
| 814 | Ga0207658_10433128 | 3300025986 | Bacteria | 1162 |
| 815 | Ga0207677_10004998 | 3300026023 | Bacteria | 7160 |
| 816 | Ga0207677_10579091 | 3300026023 | Bacteria | 982 |
| 817 | Ga0207703_10001682 | 3300026035 | Bacteria | 19893 |
| 818 | Ga0207703_10011007 | 3300026035 | Bacteria | 7048 |
| 819 | Ga0207703_10100954 | 3300026035 | Bacteria | 2446 |
| 820 | Ga0207703_10112645 | 3300026035 | Bacteria | 2324 |
| 821 | Ga0207639_10011475 | 3300026041 | Bacteria | 6156 |
| 822 | Ga0207639_10076759 | 3300026041 | Bacteria | 2631 |
| 823 | Ga0207639_10087124 | 3300026041 | Bacteria | 2488 |
| 824 | Ga0207678_10000245 | 3300026067 | Bacteria | 49012 |
| 825 | Ga0207678_10010214 | 3300026067 | Bacteria | 8241 |
| 826 | Ga0207678_10079912 | 3300026067 | Bacteria | 2799 |
| 827 | Ga0207678_10111326 | 3300026067 | Bacteria | 2335 |
| 828 | Ga0207678_10133405 | 3300026067 | Bacteria | 2119 |
| 829 | Ga0207678_10338031 | 3300026067 | Bacteria | 1297 |
| 830 | Ga0207678_10535513 | 3300026067 | Bacteria | 1023 |
| 831 | Ga0207708_10000114 | 3300026075 | Bacteria | 61971 |
| 832 | Ga0207708_10003612 | 3300026075 | Bacteria | 11400 |
| 833 | Ga0207708_10005145 | 3300026075 | Bacteria | 9649 |
| 834 | Ga0207708_10055868 | 3300026075 | Bacteria | 3011 |
| 835 | Ga0207708_10177349 | 3300026075 | Bacteria | 1690 |
| 836 | Ga0207708_10229961 | 3300026075 | Bacteria | 1489 |
| 837 | Ga0207702_10006836 | 3300026078 | Bacteria | 9782 |
| 838 | Ga0207702_10008706 | 3300026078 | Bacteria | 8559 |
| 839 | Ga0207702_10029050 | 3300026078 | Bacteria | 4599 |
| 840 | Ga0207702_10054191 | 3300026078 | Bacteria | 3398 |
| 841 | Ga0207702_10120775 | 3300026078 | Bacteria | 2345 |
| 842 | Ga0207641_10008353 | 3300026088 | Bacteria | 8555 |
| 843 | Ga0207641_10010010 | 3300026088 | Bacteria | 7800 |
| 844 | Ga0207641_10250705 | 3300026088 | Bacteria | 1653 |
| 845 | Ga0207648_10001736 | 3300026089 | Bacteria | 23850 |
| 846 | Ga0207648_10216150 | 3300026089 | Bacteria | 1702 |
| 847 | Ga0207676_10001967 | 3300026095 | Bacteria | 14966 |
| 848 | Ga0207676_10036284 | 3300026095 | Bacteria | 3749 |
| 849 | Ga0207676_10233222 | 3300026095 | Bacteria | 1647 |
| 850 | Ga0207674_10001070 | 3300026116 | Bacteria | 35647 |
| 851 | Ga0207674_10022820 | 3300026116 | Bacteria | 6715 |
| 852 | Ga0207674_10176613 | 3300026116 | Bacteria | 2088 |
| 853 | Ga0207674_10181948 | 3300026116 | Bacteria | 2053 |
| 854 | Ga0207675_100009348 | 3300026118 | Bacteria | 9187 |
| 855 | Ga0207675_100012148 | 3300026118 | Bacteria | 8044 |
| 856 | Ga0207675_100062369 | 3300026118 | Bacteria | 3481 |
| 857 | Ga0207675_100206359 | 3300026118 | Bacteria | 1888 |
| 858 | Ga0207675_100373408 | 3300026118 | Bacteria | 1401 |
| 859 | Ga0207683_10000454 | 3300026121 | Bacteria | 38017 |
| 860 | Ga0207683_10008437 | 3300026121 | Bacteria | 8820 |
| 861 | Ga0207683_10225670 | 3300026121 | Bacteria | 1708 |
| 862 | Ga0207683_10287481 | 3300026121 | Bacteria | 1503 |
| 863 | Ga0207698_10011789 | 3300026142 | Bacteria | 5685 |
| 864 | Ga0207698_10144721 | 3300026142 | Bacteria | 2054 |
| 865 | Ga0207698_10266057 | 3300026142 | Bacteria | 1578 |
| 866 | Ga0209281_1000082 | 3300027111 | Bacteria | 257684 |
| 867 | Ga0209281_1000110 | 3300027111 | Bacteria | 215631 |
| 868 | Ga0209281_1000178 | 3300027111 | Bacteria | 148152 |
| 869 | Ga0209281_1000417 | 3300027111 | Bacteria | 64228 |
| 870 | Ga0209281_1000459 | 3300027111 | Bacteria | 57396 |
| 871 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 872 | Ga0209371_1000534 | 3300027312 | Bacteria | 36079 |
| 873 | Ga0209371_1000686 | 3300027312 | Bacteria | 29005 |
| 874 | Ga0209371_1006547 | 3300027312 | Bacteria | 4287 |
| 875 | Ga0209969_1009492 | 3300027360 | Bacteria | 1388 |
| 876 | Ga0209967_1001984 | 3300027364 | Bacteria | 2638 |
| 877 | Ga0209981_1007998 | 3300027378 | Bacteria | 1431 |
| 878 | Ga0210000_1000744 | 3300027462 | Bacteria | 4520 |
| 879 | Ga0209995_1004105 | 3300027471 | Bacteria | 2324 |
| 880 | Ga0209282_1000006 | 3300027666 | Bacteria | 276998 |
| 881 | Ga0209282_1000023 | 3300027666 | Bacteria | 173309 |
| 882 | Ga0209282_1003316 | 3300027666 | Bacteria | 9548 |
| 883 | Ga0209282_1015395 | 3300027666 | Bacteria | 4867 |
| 884 | Ga0209588_1031076 | 3300027671 | Bacteria | 1707 |
| 885 | Ga0209971_1005098 | 3300027682 | Bacteria | 3120 |
| 886 | Ga0209971_1013510 | 3300027682 | Bacteria | 1935 |
| 887 | Ga0209813_10003330 | 3300027866 | Bacteria | 3753 |
| 888 | Ga0209813_10005127 | 3300027866 | Bacteria | 3167 |
| 889 | Ga0209813_10056536 | 3300027866 | Bacteria | 1242 |
| 890 | Ga0207428_10000624 | 3300027907 | Bacteria | 41590 |
| 891 | Ga0207428_10006066 | 3300027907 | Bacteria | 11172 |
| 892 | Ga0207428_10007115 | 3300027907 | Bacteria | 10236 |
| 893 | Ga0207428_10025045 | 3300027907 | Bacteria | 4999 |
| 894 | Ga0207428_10040791 | 3300027907 | Bacteria | 3761 |
| 895 | Ga0207428_10111880 | 3300027907 | Bacteria | 2101 |
| 896 | Ga0268266_10000594 | 3300028379 | Bacteria | 49521 |
| 897 | Ga0268266_10001956 | 3300028379 | Bacteria | 23149 |
| 898 | Ga0268266_10002242 | 3300028379 | Bacteria | 21057 |
| 899 | Ga0268266_10090419 | 3300028379 | Bacteria | 2683 |
| 900 | Ga0268266_10113076 | 3300028379 | Bacteria | 2407 |
| 901 | Ga0268266_10116611 | 3300028379 | Bacteria | 2372 |
| 902 | Ga0268266_10251918 | 3300028379 | Bacteria | 1633 |
| 903 | Ga0268266_10277140 | 3300028379 | Bacteria | 1558 |
| 904 | Ga0268266_10280692 | 3300028379 | Bacteria | 1549 |
| 905 | Ga0268265_10010310 | 3300028380 | Bacteria | 6309 |
| 906 | Ga0268265_10013313 | 3300028380 | Bacteria | 5588 |
| 907 | Ga0268265_10173588 | 3300028380 | Bacteria | 1845 |
| 908 | Ga0268264_10002112 | 3300028381 | Bacteria | 17710 |
| 909 | Ga0268264_10008605 | 3300028381 | Bacteria | 8480 |
| 910 | Ga0268264_10054830 | 3300028381 | Bacteria | 3330 |
| 911 | Ga0268264_10092980 | 3300028381 | Bacteria | 2604 |
| 912 | Ga0265337_1027756 | 3300028556 | Bacteria | 1704 |
| 913 | Ga0265318_10046624 | 3300028577 | Bacteria | 1635 |
| 914 | Ga0307515_10001890 | 3300028794 | Bacteria | 46604 |
| 915 | Ga0307515_10004497 | 3300028794 | Bacteria | 28840 |
| 916 | Ga0307515_10012438 | 3300028794 | Bacteria | 16010 |
| 917 | Ga0307515_10048889 | 3300028794 | Bacteria | 6384 |
| 918 | Ga0307515_10138425 | 3300028794 | Bacteria | 2628 |
| 919 | Ga0307515_10300625 | 3300028794 | Bacteria | 1290 |
| 920 | Ga0265338_10001544 | 3300028800 | Bacteria | 37206 |
| 921 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 922 | Ga0268256_1001706 | 3300030500 | Bacteria | 12533 |
| 923 | Ga0268256_1004290 | 3300030500 | Bacteria | 5971 |
| 924 | Ga0268256_1005810 | 3300030500 | Bacteria | 4744 |
| 925 | Ga0307512_10145519 | 3300030522 | Bacteria | 1435 |
| 926 | Ga0316181_1049652 | 3300030744 | Bacteria | 4297 |
| 927 | Ga0265330_10039535 | 3300031235 | Bacteria | 2095 |
| 928 | Ga0265332_10027782 | 3300031238 | Bacteria | 2478 |
| 929 | Ga0265332_10028322 | 3300031238 | Bacteria | 2453 |
| 930 | Ga0265332_10088275 | 3300031238 | Bacteria | 1312 |
| 931 | Ga0265325_10000034 | 3300031241 | Bacteria | 99371 |
| 932 | Ga0265325_10001708 | 3300031241 | Bacteria | 15269 |
| 933 | Ga0265325_10004418 | 3300031241 | Bacteria | 8892 |
| 934 | Ga0265325_10014336 | 3300031241 | Bacteria | 4483 |
| 935 | Ga0265325_10015145 | 3300031241 | Bacteria | 4344 |
| 936 | Ga0265325_10021210 | 3300031241 | Bacteria | 3574 |
| 937 | Ga0265325_10054261 | 3300031241 | Bacteria | 2052 |
| 938 | Ga0265340_10000573 | 3300031247 | Bacteria | 20425 |
| 939 | Ga0265340_10005082 | 3300031247 | Bacteria | 7317 |
| 940 | Ga0265340_10009717 | 3300031247 | Bacteria | 5157 |
| 941 | Ga0265340_10009784 | 3300031247 | Bacteria | 5139 |
| 942 | Ga0265340_10016580 | 3300031247 | Bacteria | 3814 |
| 943 | Ga0265340_10022812 | 3300031247 | Bacteria | 3196 |
| 944 | Ga0265340_10036542 | 3300031247 | Bacteria | 2434 |
| 945 | Ga0265339_10001994 | 3300031249 | Bacteria | 14995 |
| 946 | Ga0265331_10016364 | 3300031250 | Bacteria | 3895 |
| 947 | Ga0265316_10004461 | 3300031344 | Bacteria | 13928 |
| 948 | Ga0265316_10163938 | 3300031344 | Bacteria | 1661 |
| 949 | Ga0307513_10008284 | 3300031456 | Bacteria | 13326 |
| 950 | Ga0307513_10065459 | 3300031456 | Bacteria | 3824 |
| 951 | Ga0307513_10175906 | 3300031456 | Bacteria | 2011 |
| 952 | Ga0307513_10327763 | 3300031456 | Bacteria | 1287 |
| 953 | Ga0307509_10037843 | 3300031507 | Bacteria | 5271 |
| 954 | Ga0307408_100033455 | 3300031548 | Bacteria | 3592 |
| 955 | Ga0265313_10000176 | 3300031595 | Bacteria | 68037 |
| 956 | Ga0265313_10006492 | 3300031595 | Bacteria | 8266 |
| 957 | Ga0265313_10009374 | 3300031595 | Bacteria | 6360 |
| 958 | Ga0265313_10025763 | 3300031595 | Bacteria | 3110 |
| 959 | Ga0265313_10053957 | 3300031595 | Bacteria | 1911 |
| 960 | Ga0316575_10023815 | 3300031665 | Bacteria | 2368 |
| 961 | Ga0265314_10001108 | 3300031711 | Bacteria | 31108 |
| 962 | Ga0265314_10038822 | 3300031711 | Bacteria | 3437 |
| 963 | Ga0265314_10042680 | 3300031711 | Bacteria | 3232 |
| 964 | Ga0265314_10084309 | 3300031711 | Bacteria | 2086 |
| 965 | Ga0265342_10000175 | 3300031712 | Bacteria | 71083 |
| 966 | Ga0265342_10000203 | 3300031712 | Bacteria | 66540 |
| 967 | Ga0265342_10004092 | 3300031712 | Bacteria | 11625 |
| 968 | Ga0265342_10015115 | 3300031712 | Bacteria | 5091 |
| 969 | Ga0265342_10027918 | 3300031712 | Bacteria | 3520 |
| 970 | Ga0316576_10025908 | 3300031727 | Bacteria | 4109 |
| 971 | Ga0316578_10019852 | 3300031728 | Bacteria | 3707 |
| 972 | Ga0307516_10149293 | 3300031730 | Bacteria | 2100 |
| 973 | Ga0307405_10021829 | 3300031731 | Bacteria | 3606 |
| 974 | Ga0307405_10091050 | 3300031731 | Bacteria | 2020 |
| 975 | Ga0307406_10208623 | 3300031901 | Bacteria | 1444 |
| 976 | Ga0307412_10004632 | 3300031911 | Bacteria | 7665 |
| 977 | Ga0315914_1000003 | 3300031967 | Bacteria | 314370 |
| 978 | Ga0315914_1000016 | 3300031967 | Bacteria | 126814 |
| 979 | Ga0307409_100037634 | 3300031995 | Bacteria | 3569 |
| 980 | Ga0307409_100108590 | 3300031995 | Bacteria | 2321 |
| 981 | Ga0307409_100540779 | 3300031995 | Bacteria | 1142 |
| 982 | Ga0307416_100248534 | 3300032002 | Bacteria | 1729 |
| 983 | Ga0307414_10037748 | 3300032004 | Bacteria | 3237 |
| 984 | Ga0307414_10150389 | 3300032004 | Bacteria | 1836 |
| 985 | Ga0307414_10225659 | 3300032004 | Bacteria | 1541 |
| 986 | Ga0307411_10027540 | 3300032005 | Bacteria | 3441 |
| 987 | Ga0307510_10137701 | 3300033180 | Bacteria | 2094 |
| 988 | Ga0315913_1000001 | 3300033430 | Bacteria | 284459 |
| 989 | Ga0315913_1000027 | 3300033430 | Bacteria | 83484 |
| 990 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 991 | Ga0315915_1000008 | 3300033464 | Bacteria | 258517 |
| 992 | Ga0373948_0011197 | 3300034817 | Bacteria | 1581 |
| 993 | Ga0373926_0001015 | 3300035083 | Bacteria | 8216 |
| 994 | Ga0373928_0024966 | 3300035084 | Bacteria | 1285 |
| 995 | Ga0373944_0008316 | 3300035089 | Bacteria | 2803 |
| 996 | Ga0373949_0000224 | 3300035090 | Bacteria | 21520 |
| 997 | Ga0373951_0005963 | 3300035091 | Bacteria | 2809 |
| 998 | Ga0373952_0006162 | 3300035092 | Bacteria | 2211 |
| 999 | Ga0373932_0013433 | 3300035112 | Bacteria | 2037 |
| 1000 | Ga0373936_0002485 | 3300035113 | Bacteria | 6905 |
| 1001 | Ga0373936_0004827 | 3300035113 | Bacteria | 5084 |
| 1002 | Ga0373936_0006776 | 3300035113 | Bacteria | 4312 |
| 1003 | Ga0373936_0008659 | 3300035113 | Bacteria | 3832 |
| 1004 | Ga0373945_0011091 | 3300035116 | Bacteria | 2974 |
| 1005 | Ga0373945_0105284 | 3300035116 | Bacteria | 1108 |
| 1006 | Ga0373953_0003117 | 3300035117 | Bacteria | 5110 |
| 1007 | Ga0373954_0000001 | 3300035118 | Bacteria | 158201 |
| 1008 | Ga0373954_0001191 | 3300035118 | Bacteria | 10445 |
| 1009 | Ga0373954_0006503 | 3300035118 | Bacteria | 5095 |
| 1010 | Ga0373954_0019863 | 3300035118 | Bacteria | 3033 |
| 1011 | Ga0373956_0001924 | 3300035119 | Bacteria | 8571 |
| 1012 | Ga0373956_0017449 | 3300035119 | Bacteria | 3026 |
| 1013 | Ga0373956_0048977 | 3300035119 | Bacteria | 1894 |
| 1014 | Ga0373957_0014910 | 3300035120 | Bacteria | 2664 |
| 1015 | Ga0373957_0093016 | 3300035120 | Bacteria | 1200 |
| 1016 | Ga0373960_0003540 | 3300035121 | Bacteria | 3539 |
| 1017 | Ga0373960_0035704 | 3300035121 | Bacteria | 1412 |
| 1018 | Ga0373943_0072402 | 3300035170 | Bacteria | 1748 |
| 1019 | Ga0373943_0113654 | 3300035170 | Bacteria | 1431 |
| 1020 | Ga0373943_0120506 | 3300035170 | Bacteria | 1394 |
| 1021 | Ga0373946_0007686 | 3300035171 | Bacteria | 3949 |
| 1022 | Ga0373946_0024197 | 3300035171 | Bacteria | 2378 |
| 1023 | Ga0373946_0047267 | 3300035171 | Bacteria | 1787 |
| 1024 | Ga0373955_0000211 | 3300035172 | Bacteria | 24370 |
| 1025 | Ga0373955_0004010 | 3300035172 | Bacteria | 6498 |
| 1026 | Ga0373955_0062921 | 3300035172 | Bacteria | 2053 |
| 1027 | Ga0373955_0078198 | 3300035172 | Bacteria | 1864 |
| 1028 | Ga0373955_0146999 | 3300035172 | Bacteria | 1385 |
| 1029 | Ga0373955_0159577 | 3300035172 | Bacteria | 1330 |
| 1030 | Ga0373942_0004211 | 3300035207 | Bacteria | 3351 |
| 1031 | Ga0373942_0048976 | 3300035207 | Bacteria | 1179 |
| 1032 | Ga0373961_0002900 | 3300035241 | Bacteria | 4345 |
| 1033 | Ga0373961_0098378 | 3300035241 | Bacteria | 944 |
| 1034 | Ga0373962_0005517 | 3300035242 | Bacteria | 3060 |
| 1035 | Ga0373962_0015800 | 3300035242 | Bacteria | 1940 |
| 1036 | Ga0316574_0166237 | 3300035398 | Bacteria | 1421 |
| 1037 | Ga0373924_0005832 | 3300035410 | Bacteria | 4384 |
| 1038 | Ga0373924_0031279 | 3300035410 | Bacteria | 2139 |
| 1039 | Ga0373924_0066750 | 3300035410 | Bacteria | 1513 |
| 1040 | Ga0373931_0000263 | 3300035691 | Bacteria | 22257 |
| 1041 | Ga0373931_0005290 | 3300035691 | Bacteria | 5952 |
| 1042 | Ga0373931_0015912 | 3300035691 | Bacteria | 3694 |
| 1043 | Ga0373931_0025006 | 3300035691 | Bacteria | 3031 |
| 1044 | Ga0373931_0033418 | 3300035691 | Bacteria | 2665 |
| 1045 | Ga0373931_0084866 | 3300035691 | Bacteria | 1754 |
| 1046 | Ga0373931_0216702 | 3300035691 | Bacteria | 1151 |
| 1047 | Ga0373935_0049269 | 3300035692 | Bacteria | 2669 |
| 1048 | Ga0373935_0121849 | 3300035692 | Bacteria | 1743 |
| 1049 | Ga0373935_0205609 | 3300035692 | Bacteria | 1362 |
| 1050 | Ga0373927_0000307 | 3300035695 | Bacteria | 38435 |
| 1051 | Ga0373927_0007289 | 3300035695 | Bacteria | 7502 |
| 1052 | Ga0373927_0011842 | 3300035695 | Bacteria | 5810 |
| 1053 | Ga0373927_0021393 | 3300035695 | Bacteria | 4239 |
| 1054 | Ga0373927_0060671 | 3300035695 | Bacteria | 2447 |
| 1055 | Ga0373927_0095942 | 3300035695 | Bacteria | 1927 |
| 1056 | Ga0373933_0002515 | 3300035724 | Bacteria | 10296 |
| 1057 | Ga0373933_0004328 | 3300035724 | Bacteria | 7796 |
| 1058 | Ga0373933_0014895 | 3300035724 | Bacteria | 4329 |
| 1059 | Ga0373933_0023829 | 3300035724 | Bacteria | 3500 |
| 1060 | Ga0373933_0050166 | 3300035724 | Bacteria | 2490 |
| 1061 | Ga0373933_0052376 | 3300035724 | Bacteria | 2442 |
| 1062 | Ga0373933_0124702 | 3300035724 | Bacteria | 1615 |
| 1063 | Ga0373933_0229299 | 3300035724 | Bacteria | 1193 |
| 1064 | Ga0373947_0025815 | 3300035725 | Bacteria | 3427 |
| 1065 | Ga0373947_0032636 | 3300035725 | Bacteria | 3070 |
| 1066 | Ga0373947_0052934 | 3300035725 | Bacteria | 2446 |
| 1067 | Ga0373947_0084848 | 3300035725 | Bacteria | 1966 |
| 1068 | Ga0373947_0099733 | 3300035725 | Bacteria | 1823 |
| 1069 | Ga0373947_0126297 | 3300035725 | Bacteria | 1629 |
| 1070 | Ga0373947_0287859 | 3300035725 | Bacteria | 1093 |
| 1071 | Ga0373937_0000009 | 3300036401 | Bacteria | 169521 |
| 1072 | Ga0373937_0000524 | 3300036401 | Bacteria | 34277 |
| 1073 | Ga0373937_0001146 | 3300036401 | Bacteria | 22227 |
| 1074 | Ga0373937_0052053 | 3300036401 | Bacteria | 3753 |
| 1075 | Ga0373937_0088397 | 3300036401 | Bacteria | 2868 |
| 1076 | Ga0373937_0201561 | 3300036401 | Bacteria | 1870 |
| 1077 | Ga0373937_0318568 | 3300036401 | Bacteria | 1471 |
| 1078 | Ga0316582_0222298 | 3300036647 | Bacteria | 1291 |
| 1079 | Ga0373925_0000194 | 3300037068 | Bacteria | 66124 |
| 1080 | Ga0373925_0003316 | 3300037068 | Bacteria | 12509 |
| 1081 | Ga0373925_0022002 | 3300037068 | Bacteria | 4647 |
| 1082 | Ga0373925_0027273 | 3300037068 | Bacteria | 4182 |
| 1083 | Ga0373925_0113013 | 3300037068 | Bacteria | 2100 |
| 1084 | Ga0373925_0125977 | 3300037068 | Bacteria | 1993 |
| 1085 | Ga0373925_0330582 | 3300037068 | Bacteria | 1235 |
| 1086 | Ga0395899_0033298 | 3300037312 | Bacteria | 3870 |
| 1087 | Ga0395899_0089182 | 3300037312 | Bacteria | 2237 |
| 1088 | Ga0395899_0169900 | 3300037312 | Bacteria | 1536 |
| 1089 | Ga0395900_0004702 | 3300037418 | Bacteria | 14395 |
| 1090 | Ga0395900_0105149 | 3300037418 | Bacteria | 2900 |
| 1091 | Ga0395900_0120084 | 3300037418 | Bacteria | 2697 |
| 1092 | Ga0395900_0162899 | 3300037418 | Bacteria | 2274 |
| 1093 | Ga0395900_0185454 | 3300037418 | Bacteria | 2112 |
| 1094 | Ga0395900_0452707 | 3300037418 | Bacteria | 1240 |
| 1095 | Ga0395898_0029116 | 3300037466 | Bacteria | 5532 |
| 1096 | Ga0395898_0036536 | 3300037466 | Bacteria | 4877 |
| 1097 | Ga0395898_0059206 | 3300037466 | Bacteria | 3727 |
| 1098 | Ga0395898_0466985 | 3300037466 | Bacteria | 1201 |
| 1099 | Ga0395905_0000247 | 3300037471 | Bacteria | 81281 |
| 1100 | Ga0395905_0072572 | 3300037471 | Bacteria | 3227 |
| 1101 | Ga0395905_0087942 | 3300037471 | Bacteria | 2913 |
| 1102 | Ga0395905_0108653 | 3300037471 | Bacteria | 2604 |
| 1103 | Ga0395905_0109022 | 3300037471 | Bacteria | 2599 |
| 1104 | Ga0436364_0031070 | 3300037853 | Bacteria | 2089 |
| 1105 | Ga0436364_0115455 | 3300037853 | Bacteria | 6268 |
| 1106 | Ga0436364_0155142 | 3300037853 | Bacteria | 1787 |
| 1107 | Ga0436364_0774424 | 3300037853 | Bacteria | 7548 |
| 1108 | Ga0436364_0976983 | 3300037853 | Bacteria | 1284 |
| 1109 | Ga0436364_0990934 | 3300037853 | Bacteria | 27491 |
| 1110 | Ga0436364_1147744 | 3300037853 | Bacteria | 3523 |
| 1111 | Ga0395901_0019114 | 3300038443 | Bacteria | 7006 |
| 1112 | Ga0395901_0056175 | 3300038443 | Bacteria | 4095 |
| 1113 | Ga0395901_0074592 | 3300038443 | Bacteria | 3539 |
| 1114 | Ga0395901_0095982 | 3300038443 | Bacteria | 3107 |
| 1115 | Ga0395901_0153653 | 3300038443 | Bacteria | 2417 |
| 1116 | Ga0395901_0200004 | 3300038443 | Bacteria | 2095 |
| 1117 | Ga0395901_0316458 | 3300038443 | Bacteria | 1616 |
| 1118 | Ga0395901_0581085 | 3300038443 | Bacteria | 1132 |
| 1119 | Ga0400483_016265 | 3300039062 | Bacteria | 1736 |
| 1120 | Ga0400483_150203 | 3300039062 | Bacteria | 1773 |
| 1121 | Ga0436365_0017591 | 3300039437 | Bacteria | 2538 |
| 1122 | Ga0436365_0536235 | 3300039437 | Bacteria | 9986 |
| 1123 | Ga0436365_0582386 | 3300039437 | Bacteria | 49347 |
| 1124 | Ga0436365_0836133 | 3300039437 | Bacteria | 111215 |
| 1125 | Ga0436365_0920082 | 3300039437 | Bacteria | 14215 |
| 1126 | Ga0436365_1093511 | 3300039437 | Bacteria | 15092 |
| 1127 | Ga0436365_1332159 | 3300039437 | Bacteria | 25414 |
| 1128 | Ga0436365_1445989 | 3300039437 | Bacteria | 1494 |
| 1129 | Ga0436365_1644321 | 3300039437 | Bacteria | 2850 |
| 1130 | Ga0436365_1673482 | 3300039437 | Bacteria | 1548 |
| 1131 | Ga0436360_0436684 | 3300039438 | Bacteria | 1208 |
| 1132 | Ga0436360_0621837 | 3300039438 | Bacteria | 1579 |
| 1133 | Ga0436360_1072416 | 3300039438 | Bacteria | 4787 |
| 1134 | Ga0436360_1151605 | 3300039438 | Unclassified | 3911 |
| 1135 | Ga0436361_0359473 | 3300039447 | Bacteria | 1646 |
| 1136 | Ga0436361_0472526 | 3300039447 | Bacteria | 3708 |
| 1137 | Ga0436361_0841184 | 3300039447 | Bacteria | 2152 |
| 1138 | Ga0436363_0065264 | 3300039450 | Bacteria | 3683 |
| 1139 | Ga0436363_0480840 | 3300039450 | Bacteria | 15596 |
| 1140 | Ga0436363_0502334 | 3300039450 | Bacteria | 1545 |
| 1141 | Ga0436363_1483637 | 3300039450 | Bacteria | 1389 |
| 1142 | Ga0436362_0163701 | 3300039453 | Bacteria | 2023 |
| 1143 | Ga0436362_0273395 | 3300039453 | Bacteria | 7027 |
| 1144 | Ga0439453_0004011 | 3300041408 | Bacteria | 2162 |
| 1145 | Ga0439441_000433 | 3300042001 | Bacteria | 4442 |
| 1146 | Ga0439448_0029587 | 3300042005 | Bacteria | 1734 |
| 1147 | Ga0439449_0006504 | 3300042007 | Bacteria | 4465 |
| 1148 | Ga0439449_0082289 | 3300042007 | Bacteria | 1187 |
| 1149 | Ga0439450_021898 | 3300042008 | Bacteria | 1376 |
| 1150 | Ga0439463_029344 | 3300042016 | Bacteria | 1386 |
| 1151 | Ga0450888_000640 | 3300042126 | Bacteria | 3333 |
| 1152 | Ga0439435_0044619 | 3300042436 | Bacteria | 1250 |
| 1153 | Ga0439444_0010606 | 3300042437 | Bacteria | 1475 |
| 1154 | Ga0439459_0027578 | 3300042438 | Bacteria | 1135 |
| 1155 | Ga0439464_0029077 | 3300042439 | Bacteria | 1543 |
| 1156 | Ga0439460_0057258 | 3300042461 | Bacteria | 1182 |
| 1157 | Ga0466963_0055803 | 3300044694 | Bacteria | 2628 |
| 1158 | Ga0466963_0243349 | 3300044694 | Bacteria | 1262 |
| 1159 | Ga0466964_0043964 | 3300044706 | Bacteria | 1813 |
| 1160 | Ga0453684_0228680 | 3300044712 | Bacteria | 2149 |
| 1161 | Ga0466971_0030184 | 3300044719 | Bacteria | 2426 |
| 1162 | Ga0466970_0058045 | 3300044765 | Bacteria | 2071 |
| 1163 | Ga0466970_0121864 | 3300044765 | Bacteria | 1429 |
| 1164 | Ga0466957_0018581 | 3300044842 | Bacteria | 4083 |
| 1165 | Ga0466957_0040720 | 3300044842 | Bacteria | 2807 |
| 1166 | Ga0466960_0094443 | 3300044901 | Bacteria | 1530 |
| 1167 | Ga0466959_0036483 | 3300045049 | Bacteria | 3633 |
| 1168 | Ga0466959_0082126 | 3300045049 | Bacteria | 2322 |
| 1169 | Ga0466959_0252367 | 3300045049 | Bacteria | 1216 |
| 1170 | Ga0451576_0000220 | 3300045051 | Bacteria | 141261 |
| 1171 | Ga0451576_0007851 | 3300045051 | Bacteria | 12646 |
| 1172 | Ga0451576_0052322 | 3300045051 | Bacteria | 4279 |
| 1173 | Ga0451576_0342508 | 3300045051 | Bacteria | 1565 |
| 1174 | Ga0466967_0039921 | 3300045976 | Bacteria | 4038 |
| 1175 | Ga0466967_0054386 | 3300045976 | Bacteria | 3522 |
| 1176 | Ga0466967_0102676 | 3300045976 | Bacteria | 2616 |
| 1177 | Ga0466967_0250502 | 3300045976 | Bacteria | 1692 |
| 1178 | Ga0495592_0000422 | 3300046454 | Bacteria | 32126 |
| 1179 | Ga0495592_0008218 | 3300046454 | Bacteria | 7837 |
| 1180 | Ga0495603_0013575 | 3300046455 | Bacteria | 4928 |
| 1181 | Ga0495603_0073805 | 3300046455 | Bacteria | 2004 |
| 1182 | Ga0495629_0010732 | 3300046459 | Bacteria | 6663 |
| 1183 | Ga0495629_0178950 | 3300046459 | Bacteria | 1470 |
| 1184 | Ga0495638_0003388 | 3300046460 | Bacteria | 12561 |
| 1185 | Ga0495638_0004884 | 3300046460 | Bacteria | 10085 |
| 1186 | Ga0495638_0016499 | 3300046460 | Bacteria | 4945 |
| 1187 | Ga0495638_0059109 | 3300046460 | Bacteria | 2375 |
| 1188 | Ga0495641_0026188 | 3300046461 | Bacteria | 2849 |
| 1189 | Ga0495651_0003394 | 3300046462 | Bacteria | 12218 |
| 1190 | Ga0495651_0214779 | 3300046462 | Bacteria | 1336 |
| 1191 | Ga0495653_0000032 | 3300046463 | Bacteria | 132763 |
| 1192 | Ga0495653_0012696 | 3300046463 | Bacteria | 6881 |
| 1193 | Ga0495650_0034472 | 3300046471 | Bacteria | 2240 |
| 1194 | Ga0495580_0007921 | 3300046472 | Bacteria | 8498 |
| 1195 | Ga0495582_0014056 | 3300046473 | Bacteria | 4407 |
| 1196 | Ga0495582_0054498 | 3300046473 | Bacteria | 2205 |
| 1197 | Ga0495582_0061613 | 3300046473 | Bacteria | 2072 |
| 1198 | Ga0495605_0000998 | 3300046474 | Bacteria | 19122 |
| 1199 | Ga0495639_0020303 | 3300046475 | Bacteria | 2903 |
| 1200 | Ga0495639_0039292 | 3300046475 | Bacteria | 2128 |
| 1201 | Ga0495662_0007582 | 3300046476 | Bacteria | 5356 |
| 1202 | Ga0495662_0071800 | 3300046476 | Bacteria | 1678 |
| 1203 | Ga0495662_0111810 | 3300046476 | Bacteria | 1339 |
| 1204 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 1205 | Ga0495664_0042324 | 3300046477 | Bacteria | 2697 |
| 1206 | Ga0495584_0105914 | 3300046491 | Bacteria | 1422 |
| 1207 | Ga0495585_0011596 | 3300046492 | Bacteria | 5212 |
| 1208 | Ga0495585_0027859 | 3300046492 | Bacteria | 3224 |
| 1209 | Ga0495594_0142096 | 3300046499 | Bacteria | 1362 |
| 1210 | Ga0495607_0000153 | 3300046501 | Bacteria | 72099 |
| 1211 | Ga0495607_0046587 | 3300046501 | Bacteria | 2545 |
| 1212 | Ga0495583_0003578 | 3300046506 | Bacteria | 11679 |
| 1213 | Ga0495583_0010063 | 3300046506 | Bacteria | 5569 |
| 1214 | Ga0495606_0002805 | 3300046507 | Bacteria | 19397 |
| 1215 | Ga0495606_0005629 | 3300046507 | Bacteria | 11889 |
| 1216 | Ga0495606_0046520 | 3300046507 | Bacteria | 2867 |
| 1217 | Ga0495606_0095951 | 3300046507 | Bacteria | 1815 |
| 1218 | Ga0495606_0140452 | 3300046507 | Bacteria | 1427 |
| 1219 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 1220 | Ga0495608_0002249 | 3300046511 | Bacteria | 13939 |
| 1221 | Ga0495608_0095522 | 3300046511 | Bacteria | 1920 |
| 1222 | Ga0495610_0002088 | 3300046512 | Bacteria | 17067 |
| 1223 | Ga0495610_0031912 | 3300046512 | Bacteria | 2743 |
| 1224 | Ga0495610_0114606 | 3300046512 | Bacteria | 1190 |
| 1225 | Ga0495616_0015211 | 3300046513 | Bacteria | 4281 |
| 1226 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 1227 | Ga0495618_0001172 | 3300046514 | Bacteria | 17756 |
| 1228 | Ga0495618_0113401 | 3300046514 | Bacteria | 1736 |
| 1229 | Ga0495620_0053665 | 3300046515 | Bacteria | 1706 |
| 1230 | Ga0495620_0066403 | 3300046515 | Bacteria | 1486 |
| 1231 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 1232 | Ga0495628_0036636 | 3300046516 | Bacteria | 3935 |
| 1233 | Ga0495630_0002397 | 3300046517 | Bacteria | 13021 |
| 1234 | Ga0495630_0010749 | 3300046517 | Bacteria | 6610 |
| 1235 | Ga0495630_0079890 | 3300046517 | Bacteria | 2467 |
| 1236 | Ga0495630_0098248 | 3300046517 | Bacteria | 2215 |
| 1237 | Ga0495630_0109284 | 3300046517 | Bacteria | 2095 |
| 1238 | Ga0495631_0002952 | 3300046518 | Bacteria | 9418 |
| 1239 | Ga0495632_0019934 | 3300046519 | Bacteria | 3643 |
| 1240 | Ga0495632_0039034 | 3300046519 | Bacteria | 2400 |
| 1241 | Ga0495637_0058673 | 3300046520 | Bacteria | 1586 |
| 1242 | Ga0495643_0043383 | 3300046522 | Bacteria | 2448 |
| 1243 | Ga0495643_0071616 | 3300046522 | Bacteria | 1819 |
| 1244 | Ga0495643_0109687 | 3300046522 | Bacteria | 1404 |
| 1245 | Ga0495666_0005885 | 3300046526 | Bacteria | 6177 |
| 1246 | Ga0495666_0127107 | 3300046526 | Bacteria | 1192 |
| 1247 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 1248 | Ga0495652_0028155 | 3300046529 | Bacteria | 4948 |
| 1249 | Ga0495652_0063179 | 3300046529 | Bacteria | 3118 |
| 1250 | Ga0495652_0369195 | 3300046529 | Bacteria | 1023 |
| 1251 | Ga0495654_0000258 | 3300046530 | Bacteria | 48532 |
| 1252 | Ga0495640_0000094 | 3300046533 | Bacteria | 51238 |
| 1253 | Ga0495640_0005042 | 3300046533 | Bacteria | 10490 |
| 1254 | Ga0495640_0058151 | 3300046533 | Bacteria | 2637 |
| 1255 | Ga0495640_0058737 | 3300046533 | Bacteria | 2622 |
| 1256 | Ga0495640_0064896 | 3300046533 | Bacteria | 2467 |
| 1257 | Ga0495640_0098706 | 3300046533 | Bacteria | 1919 |
| 1258 | Ga0495640_0130390 | 3300046533 | Bacteria | 1628 |
| 1259 | Ga0495586_0002047 | 3300046535 | Bacteria | 10948 |
| 1260 | Ga0495586_0259900 | 3300046535 | Bacteria | 991 |
| 1261 | Ga0495587_0000086 | 3300046536 | Bacteria | 72022 |
| 1262 | Ga0495587_0009385 | 3300046536 | Bacteria | 6272 |
| 1263 | Ga0495609_0024772 | 3300046538 | Bacteria | 2751 |
| 1264 | Ga0495609_0059071 | 3300046538 | Bacteria | 1696 |
| 1265 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 1266 | Ga0495645_0102950 | 3300046543 | Bacteria | 2029 |
| 1267 | Ga0495622_0005250 | 3300046557 | Bacteria | 6006 |
| 1268 | Ga0495622_0050170 | 3300046557 | Bacteria | 1937 |
| 1269 | Ga0495633_0068402 | 3300046558 | Bacteria | 1658 |
| 1270 | Ga0495633_0092161 | 3300046558 | Bacteria | 1408 |
| 1271 | Ga0495633_0165699 | 3300046558 | Bacteria | 1019 |
| 1272 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 1273 | Ga0495667_0014053 | 3300046559 | Bacteria | 5404 |
| 1274 | Ga0495667_0019175 | 3300046559 | Bacteria | 4616 |
| 1275 | Ga0495667_0113594 | 3300046559 | Bacteria | 1750 |
| 1276 | Ga0495667_0130547 | 3300046559 | Bacteria | 1621 |
| 1277 | Ga0495656_0009753 | 3300046615 | Bacteria | 3465 |
| 1278 | Ga0495656_0052249 | 3300046615 | Bacteria | 1752 |
| 1279 | Ga0495656_0104757 | 3300046615 | Bacteria | 1314 |
| 1280 | Ga0495668_0016948 | 3300046616 | Bacteria | 4231 |
| 1281 | Ga0495668_0019056 | 3300046616 | Bacteria | 3961 |
| 1282 | Ga0495634_0000223 | 3300046642 | Bacteria | 53103 |
| 1283 | Ga0495634_0006047 | 3300046642 | Bacteria | 9235 |
| 1284 | Ga0495634_0119794 | 3300046642 | Bacteria | 1686 |
| 1285 | Ga0495634_0205337 | 3300046642 | Bacteria | 1222 |
| 1286 | Ga0495625_0006387 | 3300046660 | Bacteria | 10511 |
| 1287 | Ga0495625_0089615 | 3300046660 | Bacteria | 2129 |
| 1288 | Ga0495625_0092453 | 3300046660 | Bacteria | 2090 |
| 1289 | Ga0495625_0115376 | 3300046660 | Bacteria | 1833 |
| 1290 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 1291 | Ga0495635_0178241 | 3300046663 | Bacteria | 1445 |
| 1292 | Ga0495659_0049900 | 3300046664 | Bacteria | 1521 |
| 1293 | Ga0495588_0000431 | 3300046674 | Bacteria | 22035 |
| 1294 | Ga0495588_0116141 | 3300046674 | Bacteria | 1410 |
| 1295 | Ga0495657_0000058 | 3300046675 | Bacteria | 97827 |
| 1296 | Ga0495657_0035630 | 3300046675 | Bacteria | 3447 |
| 1297 | Ga0495599_0000007 | 3300046678 | Bacteria | 236638 |
| 1298 | Ga0495599_0005526 | 3300046678 | Bacteria | 7574 |
| 1299 | Ga0495599_0079504 | 3300046678 | Bacteria | 2047 |
| 1300 | Ga0495623_0000085 | 3300046679 | Bacteria | 55527 |
| 1301 | Ga0495623_0003882 | 3300046679 | Bacteria | 9855 |
| 1302 | Ga0495623_0030375 | 3300046679 | Bacteria | 3476 |
| 1303 | Ga0495646_0000021 | 3300046680 | Bacteria | 115358 |
| 1304 | Ga0495646_0019315 | 3300046680 | Bacteria | 4315 |
| 1305 | Ga0495647_0013785 | 3300046681 | Bacteria | 2807 |
| 1306 | Ga0495647_0108254 | 3300046681 | Bacteria | 1157 |
| 1307 | Ga0495658_0004005 | 3300046683 | Bacteria | 7261 |
| 1308 | Ga0495658_0012740 | 3300046683 | Bacteria | 4268 |
| 1309 | Ga0495658_0078031 | 3300046683 | Bacteria | 1938 |
| 1310 | Ga0495658_0232336 | 3300046683 | Bacteria | 1157 |
| 1311 | Ga0495669_0080020 | 3300046684 | Bacteria | 1499 |
| 1312 | Ga0495613_0020157 | 3300046689 | Bacteria | 4968 |
| 1313 | Ga0495613_0233661 | 3300046689 | Bacteria | 1287 |
| 1314 | Ga0495613_0280445 | 3300046689 | Bacteria | 1157 |
| 1315 | Ga0495624_0023846 | 3300046690 | Bacteria | 4031 |
| 1316 | Ga0495624_0037339 | 3300046690 | Bacteria | 3127 |
| 1317 | Ga0495624_0042972 | 3300046690 | Bacteria | 2885 |
| 1318 | Ga0495624_0064122 | 3300046690 | Bacteria | 2296 |
| 1319 | Ga0495624_0189637 | 3300046690 | Bacteria | 1251 |
| 1320 | Ga0495670_0063095 | 3300046691 | Bacteria | 1865 |
| 1321 | Ga0495670_0063856 | 3300046691 | Bacteria | 1854 |
| 1322 | Ga0495670_0091987 | 3300046691 | Bacteria | 1553 |
| 1323 | Ga0495671_0029760 | 3300046692 | Bacteria | 2801 |
| 1324 | Ga0495600_0000001 | 3300046809 | Bacteria | 214870 |
| 1325 | Ga0495600_0001574 | 3300046809 | Bacteria | 12692 |
| 1326 | Ga0495600_0121927 | 3300046809 | Bacteria | 1695 |
| 1327 | Ga0495660_0007210 | 3300046810 | Bacteria | 6544 |
| 1328 | Ga0495581_0028095 | 3300047315 | Bacteria | 3261 |
| 1329 | Ga0495581_0049865 | 3300047315 | Bacteria | 2418 |
| 1330 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 1331 | Ga0495604_0000150 | 3300047317 | Bacteria | 60582 |
| 1332 | Ga0495604_0003714 | 3300047317 | Bacteria | 12160 |
| 1333 | Ga0495604_0040829 | 3300047317 | Bacteria | 3641 |
| 1334 | Ga0495604_0048000 | 3300047317 | Bacteria | 3322 |
| 1335 | Ga0495604_0085328 | 3300047317 | Bacteria | 2356 |
| 1336 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 1337 | Ga0495674_0040455 | 3300047319 | Bacteria | 4169 |
| 1338 | Ga0495674_0044067 | 3300047319 | Bacteria | 3968 |
| 1339 | Ga0495674_0058092 | 3300047319 | Bacteria | 3384 |
| 1340 | Ga0495674_0061596 | 3300047319 | Bacteria | 3269 |
| 1341 | Ga0495674_0342084 | 3300047319 | Bacteria | 1216 |
| 1342 | Ga0495672_0130328 | 3300047320 | Bacteria | 1324 |
| 1343 | Ga0495676_0048721 | 3300047321 | Bacteria | 3413 |
| 1344 | Ga0495680_0000245 | 3300047322 | Bacteria | 59987 |
| 1345 | Ga0495680_0000699 | 3300047322 | Bacteria | 37651 |
| 1346 | Ga0495680_0287053 | 3300047322 | Bacteria | 1158 |
| 1347 | Ga0495687_016135 | 3300047443 | Bacteria | 3767 |
| 1348 | Ga0495675_0002083 | 3300047444 | Bacteria | 11942 |
| 1349 | Ga0495681_0005448 | 3300047470 | Bacteria | 8512 |
| 1350 | Ga0495684_0000084 | 3300047471 | Bacteria | 65600 |
| 1351 | Ga0495684_0011394 | 3300047471 | Bacteria | 6866 |
| 1352 | Ga0495686_0000422 | 3300047472 | Bacteria | 66571 |
| 1353 | Ga0495686_0012523 | 3300047472 | Bacteria | 5930 |
| 1354 | Ga0495686_0085933 | 3300047472 | Bacteria | 1915 |
| 1355 | Ga0495686_0126838 | 3300047472 | Bacteria | 1517 |
| 1356 | Ga0495593_0000733 | 3300047673 | Bacteria | 19034 |
| 1357 | Ga0495593_0024774 | 3300047673 | Bacteria | 3322 |
| 1358 | Ga0495593_0041197 | 3300047673 | Bacteria | 2484 |
| 1359 | Ga0495602_0000073 | 3300048088 | Bacteria | 98745 |
| 1360 | Ga0495602_0018808 | 3300048088 | Bacteria | 6881 |
| 1361 | Ga0495602_0070373 | 3300048088 | Bacteria | 2994 |
| 1362 | Ga0495626_0045815 | 3300048091 | Bacteria | 2040 |
| 1363 | Ga0496100_0053486 | 3300048903 | Bacteria | 2629 |
| 1364 | Ga0496100_0061223 | 3300048903 | Bacteria | 2480 |
| 1365 | Ga0496100_0092105 | 3300048903 | Bacteria | 2071 |
| 1366 | Ga0496100_0207717 | 3300048903 | Bacteria | 1431 |
| 1367 | Ga0496100_0284529 | 3300048903 | Bacteria | 1233 |
| 1368 | Ga0496101_0007599 | 3300048904 | Bacteria | 7038 |
| 1369 | Ga0496101_0161732 | 3300048904 | Bacteria | 1717 |
| 1370 | Ga0496101_0226311 | 3300048904 | Bacteria | 1453 |
| 1371 | Ga0496101_0227971 | 3300048904 | Bacteria | 1447 |
| 1372 | Ga0496101_0255239 | 3300048904 | Bacteria | 1367 |
| 1373 | Ga0496101_0289863 | 3300048904 | Bacteria | 1280 |
| 1374 | Ga0496101_0296054 | 3300048904 | Bacteria | 1267 |
| 1375 | Ga0496102_0000742 | 3300048905 | Bacteria | 31941 |
| 1376 | Ga0496102_0000871 | 3300048905 | Bacteria | 28857 |
| 1377 | Ga0496102_0036824 | 3300048905 | Bacteria | 4409 |
| 1378 | Ga0496102_0039482 | 3300048905 | Bacteria | 4266 |
| 1379 | Ga0496102_0089273 | 3300048905 | Bacteria | 2851 |
| 1380 | Ga0496102_0094089 | 3300048905 | Bacteria | 2776 |
| 1381 | Ga0496102_0131352 | 3300048905 | Bacteria | 2344 |
| 1382 | Ga0496102_0222394 | 3300048905 | Bacteria | 1780 |
| 1383 | Ga0496102_0270142 | 3300048905 | Bacteria | 1603 |
| 1384 | Ga0496103_0003369 | 3300048906 | Bacteria | 9767 |
| 1385 | Ga0496103_0005846 | 3300048906 | Bacteria | 7346 |
| 1386 | Ga0496103_0043886 | 3300048906 | Bacteria | 2754 |
| 1387 | Ga0496103_0170466 | 3300048906 | Bacteria | 1398 |
| 1388 | Ga0496104_0000317 | 3300048907 | Bacteria | 42918 |
| 1389 | Ga0496104_0000445 | 3300048907 | Bacteria | 35921 |
| 1390 | Ga0496104_0000530 | 3300048907 | Bacteria | 32802 |
| 1391 | Ga0496104_0002241 | 3300048907 | Bacteria | 16685 |
| 1392 | Ga0496104_0002378 | 3300048907 | Bacteria | 16215 |
| 1393 | Ga0496104_0016654 | 3300048907 | Bacteria | 6680 |
| 1394 | Ga0496104_0034739 | 3300048907 | Bacteria | 4702 |
| 1395 | Ga0496104_0050423 | 3300048907 | Bacteria | 3927 |
| 1396 | Ga0496104_0053959 | 3300048907 | Bacteria | 3798 |
| 1397 | Ga0496104_0112248 | 3300048907 | Bacteria | 2614 |
| 1398 | Ga0496104_0145895 | 3300048907 | Bacteria | 2272 |
| 1399 | Ga0496104_0173119 | 3300048907 | Bacteria | 2069 |
| 1400 | Ga0496104_0188496 | 3300048907 | Bacteria | 1973 |
| 1401 | Ga0496104_0276801 | 3300048907 | Bacteria | 1591 |
| 1402 | Ga0496104_0306548 | 3300048907 | Bacteria | 1500 |
| 1403 | Ga0496104_0346180 | 3300048907 | Bacteria | 1399 |
| 1404 | Ga0496105_0000485 | 3300048908 | Bacteria | 26121 |
| 1405 | Ga0496105_0000514 | 3300048908 | Bacteria | 25562 |
| 1406 | Ga0496105_0005876 | 3300048908 | Bacteria | 9357 |
| 1407 | Ga0496105_0006690 | 3300048908 | Bacteria | 8873 |
| 1408 | Ga0496105_0007602 | 3300048908 | Bacteria | 8402 |
| 1409 | Ga0496105_0010080 | 3300048908 | Bacteria | 7417 |
| 1410 | Ga0496105_0012574 | 3300048908 | Bacteria | 6706 |
| 1411 | Ga0496105_0014128 | 3300048908 | Bacteria | 6353 |
| 1412 | Ga0496105_0053871 | 3300048908 | Bacteria | 3322 |
| 1413 | Ga0496105_0252534 | 3300048908 | Bacteria | 1428 |
| 1414 | Ga0496106_0001604 | 3300048909 | Bacteria | 17003 |
| 1415 | Ga0496106_0003648 | 3300048909 | Bacteria | 11477 |
| 1416 | Ga0496106_0063690 | 3300048909 | Bacteria | 2803 |
| 1417 | Ga0496106_0129156 | 3300048909 | Bacteria | 1981 |
| 1418 | Ga0496106_0241648 | 3300048909 | Bacteria | 1443 |
| 1419 | Ga0496107_0000769 | 3300048910 | Bacteria | 18509 |
| 1420 | Ga0496107_0005678 | 3300048910 | Bacteria | 8538 |
| 1421 | Ga0496107_0018433 | 3300048910 | Bacteria | 4915 |
| 1422 | Ga0496107_0056732 | 3300048910 | Bacteria | 2830 |
| 1423 | Ga0496107_0139352 | 3300048910 | Bacteria | 1793 |
| 1424 | Ga0496107_0183310 | 3300048910 | Bacteria | 1555 |
| 1425 | Ga0496107_0268179 | 3300048910 | Bacteria | 1271 |
| 1426 | Ga0496108_0003421 | 3300048911 | Bacteria | 12733 |
| 1427 | Ga0496108_0005811 | 3300048911 | Bacteria | 10000 |
| 1428 | Ga0496108_0020092 | 3300048911 | Bacteria | 5488 |
| 1429 | Ga0496108_0022495 | 3300048911 | Bacteria | 5184 |
| 1430 | Ga0496108_0099532 | 3300048911 | Bacteria | 2478 |
| 1431 | Ga0496108_0206057 | 3300048911 | Bacteria | 1707 |
| 1432 | Ga0496108_0245343 | 3300048911 | Bacteria | 1558 |
| 1433 | Ga0496109_0052258 | 3300048912 | Bacteria | 3724 |
| 1434 | Ga0496109_0052763 | 3300048912 | Bacteria | 3707 |
| 1435 | Ga0496109_0100189 | 3300048912 | Bacteria | 2687 |
| 1436 | Ga0496109_0109831 | 3300048912 | Bacteria | 2564 |
| 1437 | Ga0496109_0125347 | 3300048912 | Bacteria | 2394 |
| 1438 | Ga0496109_0169939 | 3300048912 | Bacteria | 2045 |
| 1439 | Ga0496109_0230438 | 3300048912 | Bacteria | 1742 |
| 1440 | Ga0496109_0457617 | 3300048912 | Bacteria | 1205 |
| 1441 | Ga0496109_0463250 | 3300048912 | Bacteria | 1197 |
| 1442 | Ga0496110_0001191 | 3300048913 | Bacteria | 18527 |
| 1443 | Ga0496110_0001539 | 3300048913 | Bacteria | 16772 |
| 1444 | Ga0496110_0001886 | 3300048913 | Bacteria | 15483 |
| 1445 | Ga0496110_0002034 | 3300048913 | Bacteria | 15073 |
| 1446 | Ga0496110_0006680 | 3300048913 | Bacteria | 9168 |
| 1447 | Ga0496110_0022057 | 3300048913 | Bacteria | 5401 |
| 1448 | Ga0496110_0130702 | 3300048913 | Bacteria | 2267 |
| 1449 | Ga0496110_0160498 | 3300048913 | Bacteria | 2038 |
| 1450 | Ga0496110_0161733 | 3300048913 | Bacteria | 2030 |
| 1451 | Ga0496110_0172954 | 3300048913 | Bacteria | 1960 |
| 1452 | Ga0496110_0198313 | 3300048913 | Bacteria | 1823 |
| 1453 | Ga0496110_0397212 | 3300048913 | Bacteria | 1257 |
| 1454 | Ga0496111_0000072 | 3300048914 | Bacteria | 41891 |
| 1455 | Ga0496111_0000641 | 3300048914 | Bacteria | 18442 |
| 1456 | Ga0496111_0004377 | 3300048914 | Bacteria | 8918 |
| 1457 | Ga0496111_0005434 | 3300048914 | Bacteria | 8164 |
| 1458 | Ga0496111_0007231 | 3300048914 | Bacteria | 7261 |
| 1459 | Ga0496111_0009427 | 3300048914 | Bacteria | 6515 |
| 1460 | Ga0496111_0017287 | 3300048914 | Bacteria | 4985 |
| 1461 | Ga0496111_0049553 | 3300048914 | Bacteria | 3029 |
| 1462 | Ga0496111_0207264 | 3300048914 | Bacteria | 1457 |
| 1463 | Ga0496112_0000112 | 3300048915 | Bacteria | 50370 |
| 1464 | Ga0496112_0022204 | 3300048915 | Bacteria | 6048 |
| 1465 | Ga0496112_0039797 | 3300048915 | Bacteria | 4594 |
| 1466 | Ga0496112_0046586 | 3300048915 | Bacteria | 4253 |
| 1467 | Ga0496112_0082097 | 3300048915 | Bacteria | 3188 |
| 1468 | Ga0496112_0120503 | 3300048915 | Bacteria | 2593 |
| 1469 | Ga0496112_0124913 | 3300048915 | Bacteria | 2544 |
| 1470 | Ga0496112_0167656 | 3300048915 | Bacteria | 2162 |
| 1471 | Ga0496112_0187003 | 3300048915 | Bacteria | 2034 |
| 1472 | Ga0496112_0254516 | 3300048915 | Bacteria | 1706 |
| 1473 | Ga0496112_0266507 | 3300048915 | Bacteria | 1662 |
| 1474 | Ga0496112_0365346 | 3300048915 | Bacteria | 1385 |
| 1475 | Ga0496113_0000058 | 3300048916 | Bacteria | 47947 |
| 1476 | Ga0496113_0010750 | 3300048916 | Bacteria | 6068 |
| 1477 | Ga0496113_0034796 | 3300048916 | Bacteria | 3679 |
| 1478 | Ga0496113_0038211 | 3300048916 | Bacteria | 3529 |
| 1479 | Ga0496113_0093805 | 3300048916 | Bacteria | 2318 |
| 1480 | Ga0496113_0096795 | 3300048916 | Bacteria | 2282 |
| 1481 | Ga0496113_0124169 | 3300048916 | Bacteria | 2021 |
| 1482 | Ga0496113_0127165 | 3300048916 | Bacteria | 1996 |
| 1483 | Ga0496113_0129897 | 3300048916 | Bacteria | 1976 |
| 1484 | Ga0496113_0176816 | 3300048916 | Bacteria | 1691 |
| 1485 | Ga0496113_0284026 | 3300048916 | Bacteria | 1324 |
| 1486 | Ga0496114_0007803 | 3300048917 | Bacteria | 8465 |
| 1487 | Ga0496114_0122586 | 3300048917 | Bacteria | 2237 |
| 1488 | Ga0496114_0238531 | 3300048917 | Bacteria | 1598 |
| 1489 | Ga0496114_0271651 | 3300048917 | Bacteria | 1494 |
| 1490 | Ga0496115_0027599 | 3300048918 | Bacteria | 4443 |
| 1491 | Ga0496115_0031287 | 3300048918 | Bacteria | 4192 |
| 1492 | Ga0496115_0055864 | 3300048918 | Bacteria | 3172 |
| 1493 | Ga0496115_0091711 | 3300048918 | Bacteria | 2483 |
| 1494 | Ga0496115_0103261 | 3300048918 | Bacteria | 2338 |
| 1495 | Ga0496115_0132373 | 3300048918 | Bacteria | 2055 |
| 1496 | Ga0496115_0222208 | 3300048918 | Bacteria | 1559 |
| 1497 | Ga0496115_0368499 | 3300048918 | Bacteria | 1169 |
| 1498 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 1499 | Ga0496116_0012408 | 3300048919 | Bacteria | 6966 |
| 1500 | Ga0496116_0012509 | 3300048919 | Bacteria | 6928 |
| 1501 | Ga0496116_0019060 | 3300048919 | Bacteria | 5268 |
| 1502 | Ga0496116_0040535 | 3300048919 | Bacteria | 3206 |
| 1503 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 1504 | Ga0496117_0011023 | 3300048920 | Bacteria | 8139 |
| 1505 | Ga0496117_0011870 | 3300048920 | Bacteria | 7751 |
| 1506 | Ga0496117_0014595 | 3300048920 | Bacteria | 6759 |
| 1507 | Ga0496117_0024058 | 3300048920 | Bacteria | 4830 |
| 1508 | Ga0496117_0031515 | 3300048920 | Bacteria | 4045 |
| 1509 | Ga0496117_0065649 | 3300048920 | Bacteria | 2466 |
| 1510 | Ga0496118_0007166 | 3300048921 | Bacteria | 11925 |
| 1511 | Ga0496118_0017115 | 3300048921 | Bacteria | 6617 |
| 1512 | Ga0496118_0056878 | 3300048921 | Bacteria | 2936 |
| 1513 | Ga0496118_0110647 | 3300048921 | Bacteria | 1824 |
| 1514 | Ga0496118_0144860 | 3300048921 | Bacteria | 1498 |
| 1515 | Ga0496119_0008094 | 3300048922 | Bacteria | 9317 |
| 1516 | Ga0496119_0034851 | 3300048922 | Bacteria | 3305 |
| 1517 | Ga0496119_0055006 | 3300048922 | Bacteria | 2420 |
| 1518 | Ga0496119_0104261 | 3300048922 | Bacteria | 1587 |
| 1519 | Ga0496119_0140261 | 3300048922 | Bacteria | 1306 |
| 1520 | Ga0496120_0000337 | 3300048923 | Bacteria | 78140 |
| 1521 | Ga0496120_0001370 | 3300048923 | Bacteria | 29844 |
| 1522 | Ga0496120_0021465 | 3300048923 | Bacteria | 4081 |
| 1523 | Ga0496120_0058289 | 3300048923 | Bacteria | 2170 |
| 1524 | Ga0496120_0090646 | 3300048923 | Bacteria | 1634 |
| 1525 | Ga0496120_0150688 | 3300048923 | Bacteria | 1169 |
| 1526 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 1527 | Ga0496121_0002534 | 3300048924 | Bacteria | 27692 |
| 1528 | Ga0496121_0012777 | 3300048924 | Bacteria | 9096 |
| 1529 | Ga0496121_0026378 | 3300048924 | Bacteria | 5478 |
| 1530 | Ga0496121_0030244 | 3300048924 | Bacteria | 4977 |
| 1531 | Ga0496121_0064178 | 3300048924 | Bacteria | 2995 |
| 1532 | Ga0496121_0106282 | 3300048924 | Bacteria | 2152 |
| 1533 | Ga0496121_0112075 | 3300048924 | Bacteria | 2079 |
| 1534 | Ga0496121_0112864 | 3300048924 | Bacteria | 2069 |
| 1535 | Ga0496121_0145201 | 3300048924 | Bacteria | 1754 |
| 1536 | Ga0496121_0155265 | 3300048924 | Bacteria | 1680 |
| 1537 | Ga0496121_0155763 | 3300048924 | Bacteria | 1676 |
| 1538 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 1539 | Ga0496122_0000137 | 3300048925 | Bacteria | 170016 |
| 1540 | Ga0496122_0013243 | 3300048925 | Bacteria | 8087 |
| 1541 | Ga0496122_0015622 | 3300048925 | Bacteria | 7243 |
| 1542 | Ga0496122_0023847 | 3300048925 | Bacteria | 5374 |
| 1543 | Ga0496122_0029495 | 3300048925 | Bacteria | 4625 |
| 1544 | Ga0496122_0041958 | 3300048925 | Bacteria | 3607 |
| 1545 | Ga0496122_0042708 | 3300048925 | Bacteria | 3563 |
| 1546 | Ga0496122_0057097 | 3300048925 | Bacteria | 2903 |
| 1547 | Ga0496122_0057689 | 3300048925 | Bacteria | 2880 |
| 1548 | Ga0496122_0082611 | 3300048925 | Bacteria | 2230 |
| 1549 | Ga0496122_0134606 | 3300048925 | Bacteria | 1561 |
| 1550 | Ga0496122_0177611 | 3300048925 | Bacteria | 1274 |
| 1551 | Ga0496122_0198344 | 3300048925 | Bacteria | 1176 |
| 1552 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 1553 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 1554 | Ga0496123_0006417 | 3300048926 | Bacteria | 11402 |
| 1555 | Ga0496123_0026974 | 3300048926 | Bacteria | 4289 |
| 1556 | Ga0496123_0078386 | 3300048926 | Bacteria | 2024 |
| 1557 | Ga0496123_0151012 | 3300048926 | Bacteria | 1253 |
| 1558 | Ga0496123_0154375 | 3300048926 | Bacteria | 1233 |
| 1559 | Ga0496123_0165177 | 3300048926 | Bacteria | 1175 |
| 1560 | Ga0496124_0000174 | 3300048927 | Bacteria | 129228 |
| 1561 | Ga0496124_0001771 | 3300048927 | Bacteria | 30049 |
| 1562 | Ga0496124_0006219 | 3300048927 | Bacteria | 13078 |
| 1563 | Ga0496124_0026047 | 3300048927 | Bacteria | 5280 |
| 1564 | Ga0496124_0034417 | 3300048927 | Bacteria | 4446 |
| 1565 | Ga0496124_0034422 | 3300048927 | Bacteria | 4446 |
| 1566 | Ga0496124_0036141 | 3300048927 | Bacteria | 4313 |
| 1567 | Ga0496124_0049497 | 3300048927 | Bacteria | 3585 |
| 1568 | Ga0496124_0108721 | 3300048927 | Bacteria | 2236 |
| 1569 | Ga0496124_0178713 | 3300048927 | Bacteria | 1635 |
| 1570 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 1571 | Ga0496125_0012335 | 3300048928 | Bacteria | 8491 |
| 1572 | Ga0496125_0035505 | 3300048928 | Bacteria | 4371 |
| 1573 | Ga0496125_0069923 | 3300048928 | Bacteria | 2751 |
| 1574 | Ga0496125_0136186 | 3300048928 | Bacteria | 1717 |
| 1575 | Ga0496125_0142009 | 3300048928 | Bacteria | 1668 |
| 1576 | Ga0496125_0154175 | 3300048928 | Bacteria | 1572 |
| 1577 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 1578 | Ga0496126_0033060 | 3300048929 | Bacteria | 4868 |
| 1579 | Ga0496126_0038419 | 3300048929 | Bacteria | 4455 |
| 1580 | Ga0496126_0042064 | 3300048929 | Bacteria | 4223 |
| 1581 | Ga0496126_0061969 | 3300048929 | Bacteria | 3358 |
| 1582 | Ga0496126_0074572 | 3300048929 | Bacteria | 3013 |
| 1583 | Ga0496126_0084838 | 3300048929 | Bacteria | 2793 |
| 1584 | Ga0496126_0102611 | 3300048929 | Bacteria | 2500 |
| 1585 | Ga0496126_0121485 | 3300048929 | Bacteria | 2264 |
| 1586 | Ga0496126_0125683 | 3300048929 | Unclassified | 2220 |
| 1587 | Ga0496126_0207275 | 3300048929 | Bacteria | 1652 |
| 1588 | Ga0496126_0252274 | 3300048929 | Bacteria | 1470 |
| 1589 | Ga0495678_012901 | 3300049459 | Bacteria | 3941 |
| 1590 | Ga0501031_0000007 | 3300049568 | Bacteria | 166008 |
| 1591 | Ga0501031_0005116 | 3300049568 | Bacteria | 8542 |
| 1592 | Ga0501031_0012352 | 3300049568 | Bacteria | 5570 |
| 1593 | Ga0501031_0090643 | 3300049568 | Bacteria | 1994 |
| 1594 | Ga0501031_0228223 | 3300049568 | Bacteria | 1212 |
| 1595 | Ga0501032_0000007 | 3300049569 | Bacteria | 253881 |
| 1596 | Ga0501032_0001879 | 3300049569 | Bacteria | 16587 |
| 1597 | Ga0501032_0016543 | 3300049569 | Bacteria | 5186 |
| 1598 | Ga0501032_0048609 | 3300049569 | Bacteria | 2863 |
| 1599 | Ga0501032_0198364 | 3300049569 | Bacteria | 1310 |
| 1600 | Ga0501032_0215853 | 3300049569 | Bacteria | 1249 |
| 1601 | Ga0501032_0238153 | 3300049569 | Bacteria | 1183 |
| 1602 | Ga0501032_0359550 | 3300049569 | Bacteria | 937 |
| 1603 | Ga0501033_0000040 | 3300049570 | Bacteria | 142586 |
| 1604 | Ga0501033_0004368 | 3300049570 | Bacteria | 11331 |
| 1605 | Ga0501033_0025128 | 3300049570 | Bacteria | 4487 |
| 1606 | Ga0501033_0091662 | 3300049570 | Bacteria | 2223 |
| 1607 | Ga0501033_0160838 | 3300049570 | Bacteria | 1617 |
| 1608 | Ga0501033_0196653 | 3300049570 | Bacteria | 1441 |
| 1609 | Ga0501033_0252776 | 3300049570 | Bacteria | 1249 |
| 1610 | Ga0501034_0000029 | 3300049571 | Bacteria | 253881 |
| 1611 | Ga0501034_0000162 | 3300049571 | Bacteria | 125834 |
| 1612 | Ga0501034_0001131 | 3300049571 | Bacteria | 37119 |
| 1613 | Ga0501034_0002653 | 3300049571 | Bacteria | 21171 |
| 1614 | Ga0501034_0012919 | 3300049571 | Bacteria | 8611 |
| 1615 | Ga0501034_0018360 | 3300049571 | Bacteria | 7173 |
| 1616 | Ga0501034_0023629 | 3300049571 | Bacteria | 6262 |
| 1617 | Ga0501034_0024938 | 3300049571 | Bacteria | 6083 |
| 1618 | Ga0501034_0032448 | 3300049571 | Bacteria | 5303 |
| 1619 | Ga0501034_0032682 | 3300049571 | Bacteria | 5284 |
| 1620 | Ga0501034_0094910 | 3300049571 | Bacteria | 2979 |
| 1621 | Ga0501034_0124971 | 3300049571 | Bacteria | 2558 |
| 1622 | Ga0501034_0209902 | 3300049571 | Bacteria | 1903 |
| 1623 | Ga0501034_0240878 | 3300049571 | Bacteria | 1755 |
| 1624 | Ga0501034_0274978 | 3300049571 | Bacteria | 1624 |
| 1625 | Ga0501034_0347697 | 3300049571 | Bacteria | 1411 |
| 1626 | Ga0501034_0395900 | 3300049571 | Bacteria | 1304 |
| 1627 | Ga0501036_0000004 | 3300049572 | Bacteria | 253881 |
| 1628 | Ga0501036_0000559 | 3300049572 | Bacteria | 26726 |
| 1629 | Ga0501036_0003243 | 3300049572 | Bacteria | 12966 |
| 1630 | Ga0501036_0003303 | 3300049572 | Bacteria | 12872 |
| 1631 | Ga0501036_0024551 | 3300049572 | Bacteria | 5082 |
| 1632 | Ga0501036_0072485 | 3300049572 | Bacteria | 2911 |
| 1633 | Ga0501036_0195620 | 3300049572 | Bacteria | 1701 |
| 1634 | Ga0501036_0375031 | 3300049572 | Bacteria | 1187 |
| 1635 | Ga0501036_0441372 | 3300049572 | Bacteria | 1085 |
| 1636 | Ga0501037_0000004 | 3300049573 | Bacteria | 253989 |
| 1637 | Ga0501037_0018226 | 3300049573 | Bacteria | 5172 |
| 1638 | Ga0501037_0018455 | 3300049573 | Bacteria | 5143 |
| 1639 | Ga0501037_0051520 | 3300049573 | Bacteria | 3011 |
| 1640 | Ga0501037_0061394 | 3300049573 | Bacteria | 2740 |
| 1641 | Ga0501037_0095581 | 3300049573 | Bacteria | 2148 |
| 1642 | Ga0501037_0098608 | 3300049573 | Bacteria | 2110 |
| 1643 | Ga0501037_0120734 | 3300049573 | Bacteria | 1884 |
| 1644 | Ga0501037_0131113 | 3300049573 | Bacteria | 1797 |
| 1645 | Ga0501037_0214723 | 3300049573 | Bacteria | 1355 |
| 1646 | Ga0501037_0241800 | 3300049573 | Bacteria | 1265 |
| 1647 | Ga0501037_0242343 | 3300049573 | Bacteria | 1263 |
| 1648 | Ga0501037_0246140 | 3300049573 | Bacteria | 1252 |
| 1649 | Ga0501038_0000005 | 3300049574 | Bacteria | 253881 |
| 1650 | Ga0501038_0005084 | 3300049574 | Bacteria | 12226 |
| 1651 | Ga0501038_0011772 | 3300049574 | Bacteria | 7982 |
| 1652 | Ga0501038_0025190 | 3300049574 | Bacteria | 5303 |
| 1653 | Ga0501038_0082991 | 3300049574 | Bacteria | 2698 |
| 1654 | Ga0501038_0391569 | 3300049574 | Bacteria | 1076 |
| 1655 | Ga0501039_0000009 | 3300049575 | Bacteria | 253881 |
| 1656 | Ga0501039_0005792 | 3300049575 | Bacteria | 9359 |
| 1657 | Ga0501039_0011081 | 3300049575 | Bacteria | 6870 |
| 1658 | Ga0501039_0039986 | 3300049575 | Bacteria | 3621 |
| 1659 | Ga0501039_0070455 | 3300049575 | Bacteria | 2716 |
| 1660 | Ga0501039_0094286 | 3300049575 | Bacteria | 2333 |
| 1661 | Ga0501039_0100506 | 3300049575 | Bacteria | 2257 |
| 1662 | Ga0501040_0009812 | 3300049576 | Bacteria | 6250 |
| 1663 | Ga0501040_0028962 | 3300049576 | Bacteria | 3735 |
| 1664 | Ga0501040_0141790 | 3300049576 | Bacteria | 1693 |
| 1665 | Ga0501040_0204409 | 3300049576 | Bacteria | 1403 |
| 1666 | Ga0501042_0010639 | 3300049578 | Bacteria | 6180 |
| 1667 | Ga0501042_0081362 | 3300049578 | Bacteria | 2321 |
| 1668 | Ga0501042_0098549 | 3300049578 | Bacteria | 2102 |
| 1669 | Ga0501043_0000736 | 3300049579 | Bacteria | 29004 |
| 1670 | Ga0501043_0001227 | 3300049579 | Bacteria | 22604 |
| 1671 | Ga0501043_0003174 | 3300049579 | Bacteria | 13596 |
| 1672 | Ga0501043_0010595 | 3300049579 | Bacteria | 7218 |
| 1673 | Ga0501043_0014872 | 3300049579 | Bacteria | 6091 |
| 1674 | Ga0501043_0031243 | 3300049579 | Bacteria | 4187 |
| 1675 | Ga0501043_0044063 | 3300049579 | Bacteria | 3507 |
| 1676 | Ga0501043_0129343 | 3300049579 | Bacteria | 1979 |
| 1677 | Ga0501043_0154261 | 3300049579 | Bacteria | 1796 |
| 1678 | Ga0501043_0171778 | 3300049579 | Bacteria | 1691 |
| 1679 | Ga0501043_0173770 | 3300049579 | Bacteria | 1680 |
| 1680 | Ga0501043_0212217 | 3300049579 | Bacteria | 1500 |
| 1681 | Ga0501043_0274914 | 3300049579 | Bacteria | 1292 |
| 1682 | Ga0501046_0001837 | 3300049580 | Bacteria | 20235 |
| 1683 | Ga0501046_0007945 | 3300049580 | Bacteria | 9282 |
| 1684 | Ga0501046_0029996 | 3300049580 | Bacteria | 4418 |
| 1685 | Ga0501046_0045435 | 3300049580 | Bacteria | 3489 |
| 1686 | Ga0501046_0061840 | 3300049580 | Bacteria | 2926 |
| 1687 | Ga0501046_0223548 | 3300049580 | Bacteria | 1393 |
| 1688 | Ga0501047_0003137 | 3300049581 | Bacteria | 15685 |
| 1689 | Ga0501047_0011635 | 3300049581 | Bacteria | 8322 |
| 1690 | Ga0501047_0012748 | 3300049581 | Bacteria | 7964 |
| 1691 | Ga0501047_0017683 | 3300049581 | Bacteria | 6831 |
| 1692 | Ga0501047_0029724 | 3300049581 | Bacteria | 5267 |
| 1693 | Ga0501047_0032514 | 3300049581 | Bacteria | 5036 |
| 1694 | Ga0501047_0038887 | 3300049581 | Bacteria | 4602 |
| 1695 | Ga0501047_0137136 | 3300049581 | Bacteria | 2327 |
| 1696 | Ga0501047_0140640 | 3300049581 | Bacteria | 2292 |
| 1697 | Ga0501047_0151851 | 3300049581 | Bacteria | 2192 |
| 1698 | Ga0501047_0158778 | 3300049581 | Bacteria | 2133 |
| 1699 | Ga0501047_0183852 | 3300049581 | Bacteria | 1956 |
| 1700 | Ga0501047_0244202 | 3300049581 | Bacteria | 1645 |
| 1701 | Ga0501047_0283845 | 3300049581 | Bacteria | 1500 |
| 1702 | Ga0501047_0391781 | 3300049581 | Bacteria | 1222 |
| 1703 | Ga0501048_0000151 | 3300049582 | Bacteria | 42561 |
| 1704 | Ga0501048_0008611 | 3300049582 | Bacteria | 7703 |
| 1705 | Ga0501048_0031194 | 3300049582 | Bacteria | 3856 |
| 1706 | Ga0501048_0224232 | 3300049582 | Bacteria | 1334 |
| 1707 | Ga0501048_0245865 | 3300049582 | Bacteria | 1270 |
| 1708 | Ga0501048_0287435 | 3300049582 | Bacteria | 1169 |
| 1709 | Ga0501067_0041815 | 3300049583 | Bacteria | 2545 |
| 1710 | Ga0501067_0069865 | 3300049583 | Bacteria | 1945 |
| 1711 | Ga0501068_0008727 | 3300049584 | Bacteria | 5652 |
| 1712 | Ga0501068_0014566 | 3300049584 | Bacteria | 4499 |
| 1713 | Ga0501068_0021116 | 3300049584 | Bacteria | 3800 |
| 1714 | Ga0501068_0039568 | 3300049584 | Bacteria | 2827 |
| 1715 | Ga0501068_0143092 | 3300049584 | Bacteria | 1499 |
| 1716 | Ga0501068_0204433 | 3300049584 | Bacteria | 1253 |
| 1717 | Ga0501068_0221066 | 3300049584 | Bacteria | 1204 |
| 1718 | Ga0501069_0002411 | 3300049585 | Bacteria | 9502 |
| 1719 | Ga0501069_0026629 | 3300049585 | Bacteria | 3167 |
| 1720 | Ga0501069_0033702 | 3300049585 | Bacteria | 2821 |
| 1721 | Ga0501069_0034085 | 3300049585 | Bacteria | 2804 |
| 1722 | Ga0501070_0005227 | 3300049586 | Bacteria | 11067 |
| 1723 | Ga0501070_0005894 | 3300049586 | Bacteria | 10451 |
| 1724 | Ga0501070_0010861 | 3300049586 | Bacteria | 7692 |
| 1725 | Ga0501070_0020723 | 3300049586 | Bacteria | 5515 |
| 1726 | Ga0501070_0026632 | 3300049586 | Bacteria | 4851 |
| 1727 | Ga0501070_0028069 | 3300049586 | Bacteria | 4719 |
| 1728 | Ga0501070_0030737 | 3300049586 | Bacteria | 4498 |
| 1729 | Ga0501070_0049766 | 3300049586 | Bacteria | 3479 |
| 1730 | Ga0501070_0081113 | 3300049586 | Bacteria | 2684 |
| 1731 | Ga0501070_0082113 | 3300049586 | Bacteria | 2667 |
| 1732 | Ga0501070_0299565 | 3300049586 | Bacteria | 1310 |
| 1733 | Ga0501070_0301677 | 3300049586 | Bacteria | 1305 |
| 1734 | Ga0501071_0011715 | 3300049587 | Bacteria | 5918 |
| 1735 | Ga0501071_0025628 | 3300049587 | Bacteria | 4133 |
| 1736 | Ga0501071_0202093 | 3300049587 | Bacteria | 1493 |
| 1737 | Ga0501071_0240335 | 3300049587 | Bacteria | 1365 |
| 1738 | Ga0501072_0070380 | 3300049588 | Bacteria | 2763 |
| 1739 | Ga0501072_0128970 | 3300049588 | Bacteria | 2015 |
| 1740 | Ga0501072_0179329 | 3300049588 | Bacteria | 1690 |
| 1741 | Ga0501073_0001201 | 3300049589 | Bacteria | 18879 |
| 1742 | Ga0501073_0005720 | 3300049589 | Bacteria | 9301 |
| 1743 | Ga0501073_0006498 | 3300049589 | Bacteria | 8696 |
| 1744 | Ga0501073_0009708 | 3300049589 | Bacteria | 7090 |
| 1745 | Ga0501073_0010790 | 3300049589 | Bacteria | 6689 |
| 1746 | Ga0501073_0025551 | 3300049589 | Bacteria | 4233 |
| 1747 | Ga0501073_0037567 | 3300049589 | Bacteria | 3437 |
| 1748 | Ga0501073_0065647 | 3300049589 | Bacteria | 2530 |
| 1749 | Ga0501073_0094938 | 3300049589 | Bacteria | 2071 |
| 1750 | Ga0501073_0097070 | 3300049589 | Bacteria | 2047 |
| 1751 | Ga0501073_0100648 | 3300049589 | Bacteria | 2007 |
| 1752 | Ga0501073_0177116 | 3300049589 | Bacteria | 1476 |
| 1753 | Ga0501073_0194279 | 3300049589 | Bacteria | 1404 |
| 1754 | Ga0501073_0202869 | 3300049589 | Bacteria | 1371 |
| 1755 | Ga0501073_0203106 | 3300049589 | Bacteria | 1370 |
| 1756 | Ga0501073_0209012 | 3300049589 | Bacteria | 1349 |
| 1757 | Ga0501074_0005855 | 3300049590 | Bacteria | 8869 |
| 1758 | Ga0501074_0012718 | 3300049590 | Bacteria | 6119 |
| 1759 | Ga0501074_0018996 | 3300049590 | Bacteria | 4993 |
| 1760 | Ga0501074_0124494 | 3300049590 | Bacteria | 1843 |
| 1761 | Ga0501074_0343333 | 3300049590 | Bacteria | 1060 |
| 1762 | Ga0501075_0149379 | 3300049591 | Bacteria | 1781 |
| 1763 | Ga0501075_0315670 | 3300049591 | Bacteria | 1191 |
| 1764 | Ga0501076_0111203 | 3300049592 | Bacteria | 2214 |
| 1765 | Ga0501076_0205327 | 3300049592 | Bacteria | 1609 |
| 1766 | Ga0501076_0234740 | 3300049592 | Bacteria | 1500 |
| 1767 | Ga0501076_0423612 | 3300049592 | Bacteria | 1095 |
| 1768 | Ga0501077_0020579 | 3300049593 | Bacteria | 4177 |
| 1769 | Ga0501077_0033219 | 3300049593 | Bacteria | 3284 |
| 1770 | Ga0501077_0041605 | 3300049593 | Bacteria | 2924 |
| 1771 | Ga0501077_0052209 | 3300049593 | Bacteria | 2597 |
| 1772 | Ga0501077_0069047 | 3300049593 | Bacteria | 2240 |
| 1773 | Ga0501079_0031480 | 3300049741 | Bacteria | 4078 |
| 1774 | Ga0501079_0032061 | 3300049741 | Bacteria | 4039 |
| 1775 | Ga0501079_0044969 | 3300049741 | Bacteria | 3408 |
| 1776 | Ga0501079_0053474 | 3300049741 | Bacteria | 3115 |
| 1777 | Ga0501079_0070652 | 3300049741 | Bacteria | 2696 |
| 1778 | Ga0501079_0118501 | 3300049741 | Bacteria | 2058 |
| 1779 | Ga0501079_0194645 | 3300049741 | Bacteria | 1583 |
| 1780 | Ga0501080_0000130 | 3300049742 | Bacteria | 53465 |
| 1781 | Ga0501080_0007728 | 3300049742 | Bacteria | 9722 |
| 1782 | Ga0501080_0007746 | 3300049742 | Bacteria | 9710 |
| 1783 | Ga0501080_0016485 | 3300049742 | Bacteria | 6824 |
| 1784 | Ga0501080_0022690 | 3300049742 | Bacteria | 5815 |
| 1785 | Ga0501080_0024231 | 3300049742 | Bacteria | 5626 |
| 1786 | Ga0501080_0066799 | 3300049742 | Bacteria | 3344 |
| 1787 | Ga0501080_0129552 | 3300049742 | Bacteria | 2335 |
| 1788 | Ga0501080_0185972 | 3300049742 | Bacteria | 1910 |
| 1789 | Ga0501080_0318785 | 3300049742 | Bacteria | 1408 |
| 1790 | Ga0501080_0369493 | 3300049742 | Bacteria | 1293 |
| 1791 | Ga0501080_0369927 | 3300049742 | Bacteria | 1292 |
| 1792 | Ga0501080_0378711 | 3300049742 | Bacteria | 1275 |
| 1793 | Ga0501081_0011150 | 3300049743 | Bacteria | 5878 |
| 1794 | Ga0501081_0019570 | 3300049743 | Bacteria | 4508 |
| 1795 | Ga0501081_0069515 | 3300049743 | Bacteria | 2453 |
| 1796 | Ga0501081_0126740 | 3300049743 | Bacteria | 1822 |
| 1797 | Ga0501081_0203385 | 3300049743 | Bacteria | 1437 |
| 1798 | Ga0501083_0000480 | 3300049744 | Bacteria | 25565 |
| 1799 | Ga0501083_0002243 | 3300049744 | Bacteria | 13202 |
| 1800 | Ga0501083_0014715 | 3300049744 | Bacteria | 5469 |
| 1801 | Ga0501083_0014948 | 3300049744 | Bacteria | 5432 |
| 1802 | Ga0501083_0015468 | 3300049744 | Bacteria | 5344 |
| 1803 | Ga0501083_0016876 | 3300049744 | Bacteria | 5100 |
| 1804 | Ga0501083_0028904 | 3300049744 | Bacteria | 3819 |
| 1805 | Ga0501083_0116923 | 3300049744 | Bacteria | 1750 |
| 1806 | Ga0501083_0139768 | 3300049744 | Bacteria | 1586 |
| 1807 | Ga0501083_0155240 | 3300049744 | Bacteria | 1498 |
| 1808 | Ga0501280_006888 | 3300049776 | Bacteria | 1597 |
| 1809 | Ga0501035_0000014 | 3300049822 | Bacteria | 253874 |
| 1810 | Ga0501035_0000127 | 3300049822 | Bacteria | 92397 |
| 1811 | Ga0501035_0002914 | 3300049822 | Bacteria | 16472 |
| 1812 | Ga0501035_0004040 | 3300049822 | Bacteria | 13976 |
| 1813 | Ga0501035_0026490 | 3300049822 | Bacteria | 5303 |
| 1814 | Ga0501035_0093817 | 3300049822 | Bacteria | 2640 |
| 1815 | Ga0501035_0114415 | 3300049822 | Bacteria | 2362 |
| 1816 | Ga0501035_0150290 | 3300049822 | Bacteria | 2021 |
| 1817 | Ga0501035_0155418 | 3300049822 | Bacteria | 1983 |
| 1818 | Ga0501035_0191598 | 3300049822 | Bacteria | 1758 |
| 1819 | Ga0501035_0219976 | 3300049822 | Bacteria | 1622 |
| 1820 | Ga0501035_0241391 | 3300049822 | Bacteria | 1536 |
| 1821 | Ga0501035_0349186 | 3300049822 | Bacteria | 1238 |
| 1822 | Ga0501044_0000012 | 3300049823 | Bacteria | 253881 |
| 1823 | Ga0501044_0000636 | 3300049823 | Bacteria | 42394 |
| 1824 | Ga0501044_0004042 | 3300049823 | Bacteria | 16455 |
| 1825 | Ga0501044_0013256 | 3300049823 | Bacteria | 8924 |
| 1826 | Ga0501044_0034514 | 3300049823 | Bacteria | 5303 |
| 1827 | Ga0501044_0034727 | 3300049823 | Bacteria | 5286 |
| 1828 | Ga0501044_0036318 | 3300049823 | Bacteria | 5155 |
| 1829 | Ga0501044_0089568 | 3300049823 | Bacteria | 3105 |
| 1830 | Ga0501044_0126626 | 3300049823 | Bacteria | 2551 |
| 1831 | Ga0501044_0132604 | 3300049823 | Bacteria | 2485 |
| 1832 | Ga0501044_0172623 | 3300049823 | Bacteria | 2132 |
| 1833 | Ga0501044_0272868 | 3300049823 | Bacteria | 1626 |
| 1834 | Ga0501044_0327007 | 3300049823 | Bacteria | 1456 |
| 1835 | Ga0501044_0357737 | 3300049823 | Bacteria | 1378 |
| 1836 | Ga0501044_0378722 | 3300049823 | Bacteria | 1330 |
| 1837 | Ga0501044_0382740 | 3300049823 | Bacteria | 1322 |
| 1838 | Ga0501044_0417700 | 3300049823 | Bacteria | 1252 |
| 1839 | Ga0501044_0472676 | 3300049823 | Bacteria | 1157 |
| 1840 | Ga0501045_0011533 | 3300049824 | Bacteria | 6207 |
| 1841 | Ga0501045_0204455 | 3300049824 | Bacteria | 1471 |
| 1842 | Ga0501045_0240036 | 3300049824 | Bacteria | 1349 |
| 1843 | nmdc:mga03683_23316_c1 | 3300050489 | Bacteria | 2410 |
| 1844 | nmdc:mga03n38_2857_c1 | 3300050490 | Bacteria | 5436 |
| 1845 | nmdc:mga00v17_100626_c1 | 3300050491 | Bacteria | 1824 |
| 1846 | nmdc:mga00v17_150906_c1 | 3300050491 | Bacteria | 1493 |
| 1847 | nmdc:mga00v17_15278_c1 | 3300050491 | Bacteria | 4307 |
| 1848 | nmdc:mga00v17_183_c1 | 3300050491 | Bacteria | 37432 |
| 1849 | nmdc:mga0yw44_180716_c1 | 3300050492 | Bacteria | 1388 |
| 1850 | nmdc:mga0yw44_30581_c1 | 3300050492 | Bacteria | 3123 |
| 1851 | nmdc:mga0yw44_35481_c1 | 3300050492 | Bacteria | 2931 |
| 1852 | nmdc:mga0yw44_501_c1 | 3300050492 | Bacteria | 13990 |
| 1853 | nmdc:mga0yw44_72364_c1 | 3300050492 | Bacteria | 2143 |
| 1854 | nmdc:mga0yw44_751_c1 | 3300050492 | Bacteria | 12016 |
| 1855 | nmdc:mga0k408_198452_c1 | 3300050493 | Bacteria | 1198 |
| 1856 | nmdc:mga06z11_10620_c1 | 3300050494 | Bacteria | 3933 |
| 1857 | nmdc:mga06z11_151928_c1 | 3300050494 | Bacteria | 1317 |
| 1858 | nmdc:mga06z11_23381_c1 | 3300050494 | Bacteria | 2903 |
| 1859 | nmdc:mga06z11_236801_c1 | 3300050494 | Bacteria | 1071 |
| 1860 | nmdc:mga06z11_3201_c1 | 3300050494 | Bacteria | 6326 |
| 1861 | nmdc:mga06z11_53691_c1 | 3300050494 | Bacteria | 2074 |
| 1862 | nmdc:mga06z11_54516_c1 | 3300050494 | Bacteria | 2061 |
| 1863 | nmdc:mga04h51_121517_c1 | 3300050495 | Bacteria | 973 |
| 1864 | nmdc:mga04h51_3760_c1 | 3300050495 | Bacteria | 3720 |
| 1865 | nmdc:mga04h51_43502_c1 | 3300050495 | Bacteria | 1478 |
| 1866 | nmdc:mga04h51_788_c1 | 3300050495 | Bacteria | 7354 |
| 1867 | nmdc:mga05p37_210744_c1 | 3300050507 | Bacteria | 2349 |
| 1868 | nmdc:mga05p37_26679_c1 | 3300050507 | Bacteria | 7025 |
| 1869 | nmdc:mga05p37_268_c1 | 3300050507 | Bacteria | 53897 |
| 1870 | nmdc:mga05p37_334572_c1 | 3300050507 | Bacteria | 1787 |
| 1871 | nmdc:mga05p37_38333_c1 | 3300050507 | Bacteria | 5878 |
| 1872 | nmdc:mga05p37_39554_c1 | 3300050507 | Bacteria | 5790 |
| 1873 | nmdc:mga05p37_452793_c1 | 3300050507 | Bacteria | 1485 |
| 1874 | nmdc:mga05p37_513092_c1 | 3300050507 | Bacteria | 1373 |
| 1875 | nmdc:mga09592_11852_c1 | 3300050508 | Bacteria | 7092 |
| 1876 | nmdc:mga09592_12086_c1 | 3300050508 | Bacteria | 7026 |
| 1877 | nmdc:mga09592_35342_c1 | 3300050508 | Bacteria | 4183 |
| 1878 | nmdc:mga09592_37456_c1 | 3300050508 | Bacteria | 4069 |
| 1879 | nmdc:mga09592_452739_c1 | 3300050508 | Bacteria | 1107 |
| 1880 | nmdc:mga0qj67_14879_c1 | 3300050509 | Bacteria | 5885 |
| 1881 | nmdc:mga0qj67_26592_c1 | 3300050509 | Bacteria | 4479 |
| 1882 | nmdc:mga0qj67_38702_c1 | 3300050509 | Bacteria | 3742 |
| 1883 | nmdc:mga0qj67_68904_c1 | 3300050509 | Bacteria | 2820 |
| 1884 | nmdc:mga06r32_114999_c1 | 3300050510 | Bacteria | 2649 |
| 1885 | nmdc:mga06r32_133_c1 | 3300050510 | Bacteria | 53973 |
| 1886 | nmdc:mga06r32_137077_c1 | 3300050510 | Bacteria | 2422 |
| 1887 | nmdc:mga06r32_183464_c1 | 3300050510 | Bacteria | 2079 |
| 1888 | nmdc:mga06r32_29045_c1 | 3300050510 | Bacteria | 5178 |
| 1889 | nmdc:mga06r32_339614_c1 | 3300050510 | Bacteria | 1487 |
| 1890 | nmdc:mga06r32_51265_c1 | 3300050510 | Bacteria | 3949 |
| 1891 | nmdc:mga06r32_641990_c1 | 3300050510 | Bacteria | 1030 |
| 1892 | nmdc:mga06r32_83027_c1 | 3300050510 | Bacteria | 3122 |
| 1893 | nmdc:mga08y16_386179_c1 | 3300050511 | Bacteria | 1435 |
| 1894 | nmdc:mga08y16_433948_c1 | 3300050511 | Bacteria | 1342 |
| 1895 | nmdc:mga08y16_459510_c1 | 3300050511 | Bacteria | 1298 |
| 1896 | nmdc:mga08y16_604_c1 | 3300050511 | Bacteria | 33484 |
| 1897 | nmdc:mga08y16_612482_c1 | 3300050511 | Bacteria | 1096 |
| 1898 | nmdc:mga0n895_112572_c1 | 3300050512 | Bacteria | 2738 |
| 1899 | nmdc:mga0n895_1134_c1 | 3300050512 | Bacteria | 19498 |
| 1900 | nmdc:mga0n895_224463_c1 | 3300050512 | Bacteria | 1907 |
| 1901 | nmdc:mga0n895_235723_c1 | 3300050512 | Bacteria | 1857 |
| 1902 | nmdc:mga0n895_242670_c1 | 3300050512 | Bacteria | 1828 |
| 1903 | nmdc:mga0n895_25390_c1 | 3300050512 | Bacteria | 5597 |
| 1904 | nmdc:mga0n895_35109_c1 | 3300050512 | Bacteria | 4832 |
| 1905 | nmdc:mga0n895_5394_c1 | 3300050512 | Bacteria | 10675 |
| 1906 | nmdc:mga0n895_62149_c1 | 3300050512 | Bacteria | 3690 |
| 1907 | nmdc:mga0n895_65341_c1 | 3300050512 | Bacteria | 3601 |
| 1908 | nmdc:mga0n895_69727_c1 | 3300050512 | Bacteria | 3484 |
| 1909 | nmdc:mga0rr50_118925_c1 | 3300050513 | Bacteria | 2100 |
| 1910 | nmdc:mga0rr50_3559_c1 | 3300050513 | Bacteria | 8999 |
| 1911 | nmdc:mga0rr50_4637_c1 | 3300050513 | Bacteria | 8098 |
| 1912 | nmdc:mga08x19_1409_c1 | 3300050514 | Bacteria | 14868 |
| 1913 | nmdc:mga08x19_289710_c1 | 3300050514 | Bacteria | 1136 |
| 1914 | nmdc:mga0a205_269868_c1 | 3300050515 | Bacteria | 1578 |
| 1915 | nmdc:mga0a205_292104_c1 | 3300050515 | Bacteria | 1504 |
| 1916 | nmdc:mga0sz30_5131_c1 | 3300050516 | Bacteria | 4792 |
| 1917 | nmdc:mga0sz30_80_c1 | 3300050516 | Bacteria | 36573 |
| 1918 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 1919 | Ga0495601_0019603 | 3300053077 | Bacteria | 4127 |
| 1920 | Ga0495601_0077667 | 3300053077 | Bacteria | 2126 |
| 1921 | Ga0495601_0080813 | 3300053077 | Bacteria | 2086 |
| 1922 | Ga0495612_0000019 | 3300053078 | Bacteria | 137844 |
| 1923 | Ga0495612_0003729 | 3300053078 | Bacteria | 6330 |
| 1924 | Ga0495612_0007681 | 3300053078 | Bacteria | 4404 |
| 1925 | Ga0500610_0024158 | 3300053079 | Bacteria | 3018 |
| 1926 | Ga0500610_0046673 | 3300053079 | Bacteria | 2250 |
| 1927 | Ga0495655_0003940 | 3300053083 | Bacteria | 2495 |
| 1928 | Ga0495655_0004297 | 3300053083 | Bacteria | 2425 |
| 1929 | Ga0495595_0000015 | 3300053084 | Bacteria | 144946 |
| 1930 | Ga0495595_0000221 | 3300053084 | Bacteria | 22745 |
| 1931 | Ga0495595_0018863 | 3300053084 | Bacteria | 2986 |
| 1932 | Ga0495595_0033870 | 3300053084 | Bacteria | 2307 |
| 1933 | Ga0495595_0035357 | 3300053084 | Bacteria | 2263 |
| 1934 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 1935 | Ga0495619_0001997 | 3300053085 | Bacteria | 13578 |
| 1936 | Ga0495619_0008018 | 3300053085 | Bacteria | 6683 |
| 1937 | Ga0495619_0033841 | 3300053085 | Bacteria | 3320 |
| 1938 | Ga0495619_0040427 | 3300053085 | Bacteria | 3048 |
| 1939 | Ga0500578_0038804 | 3300053086 | Bacteria | 3059 |
| 1940 | Ga0500643_000008 | 3300053087 | Bacteria | 457931 |
| 1941 | Ga0500644_0001056 | 3300053088 | Bacteria | 8189 |
| 1942 | Ga0500644_0092833 | 3300053088 | Bacteria | 1133 |
| 1943 | Ga0500646_0017598 | 3300053090 | Bacteria | 1875 |
| 1944 | Ga0500647_0054562 | 3300053091 | Bacteria | 1923 |
| 1945 | Ga0500651_0013102 | 3300053093 | Bacteria | 5041 |
| 1946 | Ga0500566_0016698 | 3300053094 | Bacteria | 4308 |
| 1947 | Ga0500566_0023437 | 3300053094 | Bacteria | 3624 |
| 1948 | Ga0500566_0037748 | 3300053094 | Bacteria | 2798 |
| 1949 | Ga0500641_0065847 | 3300053096 | Bacteria | 1516 |
| 1950 | Ga0500557_000004 | 3300053105 | Bacteria | 202318 |
| 1951 | Ga0500557_000228 | 3300053105 | Bacteria | 8621 |
| 1952 | Ga0500560_049602 | 3300053107 | Bacteria | 1343 |
| 1953 | Ga0500562_019931 | 3300053108 | Bacteria | 1739 |
| 1954 | Ga0500569_003783 | 3300053109 | Bacteria | 3128 |
| 1955 | Ga0500594_0006340 | 3300053118 | Bacteria | 2653 |
| 1956 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1957 | Ga0500595_000045 | 3300053119 | Bacteria | 90834 |
| 1958 | Ga0500595_002270 | 3300053119 | Bacteria | 9692 |
| 1959 | Ga0500595_004854 | 3300053119 | Bacteria | 5948 |
| 1960 | Ga0500595_018777 | 3300053119 | Bacteria | 2522 |
| 1961 | Ga0500595_036703 | 3300053119 | Bacteria | 1604 |
| 1962 | Ga0500608_015411 | 3300053122 | Bacteria | 3435 |
| 1963 | Ga0500608_125193 | 3300053122 | Bacteria | 1160 |
| 1964 | Ga0500618_000045 | 3300053125 | Bacteria | 110042 |
| 1965 | Ga0500642_0000133 | 3300053130 | Bacteria | 33202 |
| 1966 | Ga0500642_0006925 | 3300053130 | Bacteria | 3774 |
| 1967 | Ga0500652_093992 | 3300053131 | Bacteria | 1252 |
| 1968 | Ga0500658_0011471 | 3300053134 | Bacteria | 3265 |
| 1969 | Ga0500561_0000591 | 3300053137 | Bacteria | 5864 |
| 1970 | Ga0500568_0000116 | 3300053139 | Bacteria | 71883 |
| 1971 | Ga0500568_0001521 | 3300053139 | Bacteria | 14782 |
| 1972 | Ga0500568_0004036 | 3300053139 | Bacteria | 7954 |
| 1973 | Ga0500568_0034341 | 3300053139 | Bacteria | 2076 |
| 1974 | Ga0500573_0000121 | 3300053140 | Bacteria | 30931 |
| 1975 | Ga0500577_0018815 | 3300053142 | Bacteria | 2228 |
| 1976 | Ga0500588_0015558 | 3300053146 | Bacteria | 1950 |
| 1977 | Ga0500590_063879 | 3300053148 | Bacteria | 1844 |
| 1978 | Ga0500604_0002220 | 3300053151 | Bacteria | 5326 |
| 1979 | Ga0500604_0013376 | 3300053151 | Bacteria | 2223 |
| 1980 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1981 | Ga0500616_0000093 | 3300053153 | Bacteria | 183114 |
| 1982 | Ga0500616_0000539 | 3300053153 | Bacteria | 47314 |
| 1983 | Ga0500616_0001502 | 3300053153 | Bacteria | 22017 |
| 1984 | Ga0500616_0142955 | 3300053153 | Bacteria | 1116 |
| 1985 | Ga0500620_017284 | 3300053155 | Bacteria | 2078 |
| 1986 | Ga0500622_0000486 | 3300053156 | Bacteria | 37244 |
| 1987 | Ga0500622_0135580 | 3300053156 | Bacteria | 1179 |
| 1988 | Ga0500624_000519 | 3300053157 | Bacteria | 11133 |
| 1989 | Ga0500624_002151 | 3300053157 | Bacteria | 2735 |
| 1990 | Ga0500627_0088520 | 3300053158 | Bacteria | 1385 |
| 1991 | Ga0500634_0000005 | 3300053161 | Bacteria | 184092 |
| 1992 | Ga0500634_0000507 | 3300053161 | Bacteria | 12661 |
| 1993 | Ga0500634_0001341 | 3300053161 | Bacteria | 9450 |
| 1994 | Ga0500634_0012475 | 3300053161 | Bacteria | 4426 |
| 1995 | Ga0500639_093950 | 3300053163 | Bacteria | 1489 |
| 1996 | Ga0500636_0048382 | 3300053177 | Bacteria | 2503 |
| 1997 | Ga0500645_000051 | 3300053730 | Bacteria | 98521 |
| 1998 | Ga0500645_028192 | 3300053730 | Bacteria | 1701 |
| 1999 | Ga0500609_001805 | 3300053731 | Bacteria | 3106 |
| 2000 | Ga0501084_0017572 | 3300054114 | Bacteria | 5948 |
| 2001 | Ga0501084_0018707 | 3300054114 | Bacteria | 5768 |
| 2002 | Ga0501084_0027038 | 3300054114 | Bacteria | 4793 |
| 2003 | Ga0501084_0036290 | 3300054114 | Bacteria | 4118 |
| 2004 | Ga0501084_0037753 | 3300054114 | Bacteria | 4037 |
| 2005 | Ga0501084_0039088 | 3300054114 | Bacteria | 3969 |
| 2006 | Ga0501084_0046623 | 3300054114 | Bacteria | 3631 |
| 2007 | Ga0501084_0111778 | 3300054114 | Bacteria | 2296 |
| 2008 | Ga0501084_0124646 | 3300054114 | Bacteria | 2167 |
| 2009 | Ga0501084_0142028 | 3300054114 | Bacteria | 2022 |
| 2010 | Ga0501084_0343064 | 3300054114 | Bacteria | 1262 |
| 2011 | Ga0501084_0381536 | 3300054114 | Bacteria | 1191 |
| 2012 | Ga0501084_0405285 | 3300054114 | Bacteria | 1152 |
| 2013 | Ga0501084_0436349 | 3300054114 | Bacteria | 1107 |
| 2014 | Ga0501082_0005230 | 3300060353 | Bacteria | 11281 |
| 2015 | Ga0501082_0026891 | 3300060353 | Bacteria | 4957 |
| 2016 | Ga0501082_0028918 | 3300060353 | Bacteria | 4775 |
| 2017 | Ga0501082_0035666 | 3300060353 | Bacteria | 4286 |
| 2018 | Ga0501082_0038785 | 3300060353 | Bacteria | 4109 |
| 2019 | Ga0501082_0110103 | 3300060353 | Bacteria | 2384 |
| 2020 | Ga0501082_0151312 | 3300060353 | Bacteria | 2016 |
| 2021 | Ga0501082_0165803 | 3300060353 | Bacteria | 1920 |
| 2022 | Ga0501082_0212025 | 3300060353 | Bacteria | 1685 |
| 2023 | Ga0501082_0239897 | 3300060353 | Bacteria | 1577 |
| 2024 | Ga0501082_0253222 | 3300060353 | Bacteria | 1532 |
| 2025 | Ga0501082_0359360 | 3300060353 | Bacteria | 1270 |
| 2026 | Ga0466962_0100198 | 3300061719 | Bacteria | 1391 |
| 2027 | Ga0530510_0081230 | 3300061734 | Bacteria | 2360 |
| 2028 | Ga0530510_0114488 | 3300061734 | Bacteria | 1977 |
| 2029 | Ga0530510_0176347 | 3300061734 | Bacteria | 1584 |
| 2030 | Ga0530510_0216307 | 3300061734 | Bacteria | 1424 |
| 2031 | Ga0530510_0315916 | 3300061734 | Bacteria | 1170 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047317 | Ga0495604_0048000 | Ga0495604_0048000_2476_3297 | 258 |
| 2 | iso_pu_bacteria | 2906378014 | 2906386458 | 261 |
| 3 | 3300031238 | Ga0265332_10088275 | Ga0265332_100882752 | 266 |
| 4 | 3300031241 | Ga0265325_10000034 | Ga0265325_1000003448 | 266 |
| 5 | 3300031595 | Ga0265313_10025763 | Ga0265313_100257632 | 266 |
| 6 | 3300050510 | nmdc:mga06r32_339614_c1 | nmdc:mga06r32_339614_c1_630_1442 | 270 |
| 7 | 3300035171 | Ga0373946_0047267 | Ga0373946_0047267_928_1752 | 274 |
| 8 | 3300035692 | Ga0373935_0049269 | Ga0373935_0049269_1804_2628 | 274 |
| 9 | 3300035121 | Ga0373960_0035704 | Ga0373960_0035704_563_1390 | 275 |
| 10 | 3300035241 | Ga0373961_0098378 | Ga0373961_0098378_78_908 | 276 |
| 11 | 3300044694 | Ga0466963_0243349 | Ga0466963_0243349_392_1222 | 276 |
| 12 | 3300046515 | Ga0495620_0053665 | Ga0495620_0053665_20_865 | 278 |
| 13 | 3300021441 | Ga0213871_10051334 | Ga0213871_100513342 | 279 |
| 14 | 3300039438 | Ga0436360_0621837 | Ga0436360_0621837_570_1412 | 279 |
| 15 | 3300048912 | Ga0496109_0457617 | Ga0496109_0457617_16_870 | 284 |
| 16 | 3300039438 | Ga0436360_1151605 | Ga0436360_1151605_2338_3201 | 285 |
| 17 | 3300005445 | Ga0070708_100074256 | Ga0070708_1000742562 | 286 |
| 18 | iso_pu_bacteria | 2513237156 | 2513985831 | 286 |
| 19 | iso_pu_bacteria | 2909399089 | 2909400515 | 286 |
| 20 | iso_pu_bacteria | 3004289098 | 3004296124 | 286 |
| 21 | 3300048913 | Ga0496110_0002034 | Ga0496110_0002034_14195_15058 | 287 |
| 22 | 3300048916 | Ga0496113_0129897 | Ga0496113_0129897_1092_1961 | 287 |
| 23 | 3300005434 | Ga0070709_10028611 | Ga0070709_100286112 | 288 |
| 24 | 3300005436 | Ga0070713_100025577 | Ga0070713_1000255773 | 288 |
| 25 | 3300005437 | Ga0070710_10004764 | Ga0070710_100047642 | 288 |
| 26 | 3300005439 | Ga0070711_100036220 | Ga0070711_1000362204 | 288 |
| 27 | 3300025906 | Ga0207699_10026433 | Ga0207699_100264332 | 288 |
| 28 | 3300025916 | Ga0207663_10054062 | Ga0207663_100540622 | 288 |
| 29 | 3300025928 | Ga0207700_10065156 | Ga0207700_100651562 | 288 |
| 30 | 3300032004 | Ga0307414_10225659 | Ga0307414_102256592 | 288 |
| 31 | 3300039062 | Ga0400483_016265 | Ga0400483_016265_462_1457 | 288 |
| 32 | 3300049569 | Ga0501032_0359550 | Ga0501032_0359550_10_879 | 288 |
| 33 | 3300046543 | Ga0495645_0102950 | Ga0495645_0102950_1149_2018 | 289 |
| 34 | 3300045049 | Ga0466959_0252367 | Ga0466959_0252367_316_1203 | 292 |
| 35 | 3300048929 | Ga0496126_0252274 | Ga0496126_0252274_42_926 | 294 |
| 36 | 3300010375 | Ga0105239_10264833 | Ga0105239_102648332 | 296 |
| 37 | 3300031247 | Ga0265340_10005082 | Ga0265340_100050827 | 297 |
| 38 | 3300039438 | Ga0436360_1072416 | Ga0436360_1072416_842_1828 | 297 |
| 39 | 3300039437 | Ga0436365_1445989 | Ga0436365_1445989_171_1154 | 299 |
| 40 | 3300042016 | Ga0439463_029344 | Ga0439463_029344_199_1206 | 299 |
| 41 | 3300006871 | Ga0075434_100000211 | Ga0075434_10000021112 | 301 |
| 42 | 3300006914 | Ga0075436_100014215 | Ga0075436_1000142152 | 301 |
| 43 | 3300007076 | Ga0075435_100006459 | Ga0075435_1000064598 | 301 |
| 44 | 3300049590 | Ga0501074_0124494 | Ga0501074_0124494_14_970 | 301 |
| 45 | 3300050512 | nmdc:mga0n895_1134_c1 | nmdc:mga0n895_1134_c1_9709_10638 | 301 |
| 46 | 3300050513 | nmdc:mga0rr50_4637_c1 | nmdc:mga0rr50_4637_c1_6641_7570 | 301 |
| 47 | 3300042436 | Ga0439435_0044619 | Ga0439435_0044619_326_1234 | 302 |
| 48 | 3300048913 | Ga0496110_0161733 | Ga0496110_0161733_524_1435 | 302 |
| 49 | 3300048915 | Ga0496112_0365346 | Ga0496112_0365346_67_978 | 302 |
| 50 | 3300048929 | Ga0496126_0125683 | Ga0496126_0125683_536_1534 | 302 |
| 51 | 3300005458 | Ga0070681_10507171 | Ga0070681_105071711 | 303 |
| 52 | 3300037312 | Ga0395899_0089182 | Ga0395899_0089182_1171_2145 | 303 |
| 53 | 3300037418 | Ga0395900_0105149 | Ga0395900_0105149_1780_2754 | 303 |
| 54 | 3300037466 | Ga0395898_0029116 | Ga0395898_0029116_2600_3574 | 303 |
| 55 | 3300037466 | Ga0395898_0036536 | Ga0395898_0036536_2551_3525 | 303 |
| 56 | 3300038443 | Ga0395901_0019114 | Ga0395901_0019114_1679_2653 | 303 |
| 57 | 3300048922 | Ga0496119_0104261 | Ga0496119_0104261_454_1365 | 303 |
| 58 | 3300049568 | Ga0501031_0000007 | Ga0501031_0000007_38549_39511 | 303 |
| 59 | 3300049569 | Ga0501032_0000007 | Ga0501032_0000007_126498_127460 | 303 |
| 60 | 3300049570 | Ga0501033_0000040 | Ga0501033_0000040_15127_16089 | 303 |
| 61 | 3300049571 | Ga0501034_0000029 | Ga0501034_0000029_126422_127384 | 303 |
| 62 | 3300049572 | Ga0501036_0000004 | Ga0501036_0000004_126422_127384 | 303 |
| 63 | 3300049573 | Ga0501037_0000004 | Ga0501037_0000004_126498_127460 | 303 |
| 64 | 3300049574 | Ga0501038_0000005 | Ga0501038_0000005_126422_127384 | 303 |
| 65 | 3300049575 | Ga0501039_0000009 | Ga0501039_0000009_126422_127384 | 303 |
| 66 | 3300049576 | Ga0501040_0009812 | Ga0501040_0009812_1041_2003 | 303 |
| 67 | 3300049579 | Ga0501043_0001227 | Ga0501043_0001227_15121_16083 | 303 |
| 68 | 3300049580 | Ga0501046_0061840 | Ga0501046_0061840_390_1352 | 303 |
| 69 | 3300049581 | Ga0501047_0003137 | Ga0501047_0003137_14391_15353 | 303 |
| 70 | 3300049586 | Ga0501070_0030737 | Ga0501070_0030737_206_1168 | 303 |
| 71 | 3300049822 | Ga0501035_0000014 | Ga0501035_0000014_126422_127384 | 303 |
| 72 | 3300049823 | Ga0501044_0000012 | Ga0501044_0000012_126498_127460 | 303 |
| 73 | 3300037466 | Ga0395898_0466985 | Ga0395898_0466985_13_987 | 304 |
| 74 | 3300038443 | Ga0395901_0095982 | Ga0395901_0095982_773_1747 | 304 |
| 75 | 3300005518 | Ga0070699_100006683 | Ga0070699_1000066836 | 305 |
| 76 | 3300006844 | Ga0075428_100005911 | Ga0075428_10000591111 | 305 |
| 77 | 3300006846 | Ga0075430_100363525 | Ga0075430_1003635251 | 305 |
| 78 | 3300006880 | Ga0075429_100001213 | Ga0075429_10000121310 | 305 |
| 79 | 3300025913 | Ga0207695_10146155 | Ga0207695_101461552 | 305 |
| 80 | 3300027907 | Ga0207428_10000624 | Ga0207428_1000062440 | 305 |
| 81 | 3300035172 | Ga0373955_0062921 | Ga0373955_0062921_167_1090 | 305 |
| 82 | 3300035724 | Ga0373933_0052376 | Ga0373933_0052376_1239_2162 | 305 |
| 83 | 3300036401 | Ga0373937_0201561 | Ga0373937_0201561_665_1588 | 305 |
| 84 | 3300037418 | Ga0395900_0004702 | Ga0395900_0004702_144_1118 | 305 |
| 85 | 3300037466 | Ga0395898_0059206 | Ga0395898_0059206_2701_3675 | 305 |
| 86 | 3300046559 | Ga0495667_0113594 | Ga0495667_0113594_411_1334 | 305 |
| 87 | 3300049581 | Ga0501047_0151851 | Ga0501047_0151851_173_1150 | 305 |
| 88 | 3300006846 | Ga0075430_100086622 | Ga0075430_1000866222 | 306 |
| 89 | 3300006846 | Ga0075430_100129831 | Ga0075430_1001298313 | 306 |
| 90 | 3300006871 | Ga0075434_100006290 | Ga0075434_1000062907 | 306 |
| 91 | 3300009147 | Ga0114129_10107117 | Ga0114129_101071172 | 306 |
| 92 | 3300025916 | Ga0207663_10023281 | Ga0207663_100232812 | 306 |
| 93 | 3300027682 | Ga0209971_1005098 | Ga0209971_10050984 | 306 |
| 94 | 3300032005 | Ga0307411_10027540 | Ga0307411_100275402 | 306 |
| 95 | 3300042001 | Ga0439441_000433 | Ga0439441_000433_408_1352 | 306 |
| 96 | 3300049578 | Ga0501042_0098549 | Ga0501042_0098549_396_1337 | 306 |
| 97 | 3300050507 | nmdc:mga05p37_334572_c1 | nmdc:mga05p37_334572_c1_380_1363 | 306 |
| 98 | 3300050507 | nmdc:mga05p37_452793_c1 | nmdc:mga05p37_452793_c1_104_1048 | 306 |
| 99 | 3300050508 | nmdc:mga09592_12086_c1 | nmdc:mga09592_12086_c1_719_1663 | 306 |
| 100 | 3300050509 | nmdc:mga0qj67_38702_c1 | nmdc:mga0qj67_38702_c1_260_1201 | 306 |
| 101 | 3300050512 | nmdc:mga0n895_25390_c1 | nmdc:mga0n895_25390_c1_1737_2690 | 306 |
| 102 | 3300009551 | Ga0105238_10292662 | Ga0105238_102926622 | 307 |
| 103 | 3300009551 | Ga0105238_10512926 | Ga0105238_105129262 | 307 |
| 104 | 3300009553 | Ga0105249_10330206 | Ga0105249_103302062 | 307 |
| 105 | 3300013102 | Ga0157371_10123827 | Ga0157371_101238272 | 307 |
| 106 | 3300013306 | Ga0163162_10263359 | Ga0163162_102633591 | 307 |
| 107 | 3300013307 | Ga0157372_10232610 | Ga0157372_102326101 | 307 |
| 108 | 3300013308 | Ga0157375_10096756 | Ga0157375_100967562 | 307 |
| 109 | 3300025918 | Ga0207662_10176713 | Ga0207662_101767132 | 307 |
| 110 | 3300025939 | Ga0207665_10094554 | Ga0207665_100945542 | 307 |
| 111 | 3300027378 | Ga0209981_1007998 | Ga0209981_10079982 | 307 |
| 112 | 3300048909 | Ga0496106_0241648 | Ga0496106_0241648_468_1391 | 307 |
| 113 | 3300048910 | Ga0496107_0183310 | Ga0496107_0183310_247_1170 | 307 |
| 114 | 3300049587 | Ga0501071_0202093 | Ga0501071_0202093_359_1303 | 307 |
| 115 | 3300049593 | Ga0501077_0033219 | Ga0501077_0033219_1096_2040 | 307 |
| 116 | 3300009094 | Ga0111539_10024409 | Ga0111539_100244096 | 308 |
| 117 | 3300027907 | Ga0207428_10040791 | Ga0207428_100407912 | 308 |
| 118 | 3300031235 | Ga0265330_10039535 | Ga0265330_100395352 | 308 |
| 119 | 3300031241 | Ga0265325_10014336 | Ga0265325_100143362 | 308 |
| 120 | 3300031247 | Ga0265340_10009784 | Ga0265340_100097842 | 308 |
| 121 | 3300031712 | Ga0265342_10004092 | Ga0265342_100040924 | 308 |
| 122 | 3300036647 | Ga0316582_0222298 | Ga0316582_0222298_41_1027 | 308 |
| 123 | 3300037068 | Ga0373925_0125977 | Ga0373925_0125977_896_1876 | 308 |
| 124 | 3300046517 | Ga0495630_0010749 | Ga0495630_0010749_2234_3193 | 308 |
| 125 | 3300046533 | Ga0495640_0058737 | Ga0495640_0058737_1595_2554 | 308 |
| 126 | 3300046690 | Ga0495624_0037339 | Ga0495624_0037339_926_1885 | 308 |
| 127 | 3300047315 | Ga0495581_0028095 | Ga0495581_0028095_776_1735 | 308 |
| 128 | 3300049573 | Ga0501037_0098608 | Ga0501037_0098608_702_1676 | 308 |
| 129 | 3300049579 | Ga0501043_0154261 | Ga0501043_0154261_696_1670 | 308 |
| 130 | 3300049586 | Ga0501070_0049766 | Ga0501070_0049766_2153_3127 | 308 |
| 131 | 3300049587 | Ga0501071_0025628 | Ga0501071_0025628_520_1494 | 308 |
| 132 | 3300049589 | Ga0501073_0037567 | Ga0501073_0037567_2001_2975 | 308 |
| 133 | 3300049744 | Ga0501083_0155240 | Ga0501083_0155240_494_1468 | 308 |
| 134 | 3300053077 | Ga0495601_0080813 | Ga0495601_0080813_928_1887 | 308 |
| 135 | 3300060353 | Ga0501082_0239897 | Ga0501082_0239897_290_1264 | 308 |
| 136 | 3300006914 | Ga0075436_100003794 | Ga0075436_1000037945 | 309 |
| 137 | 3300009147 | Ga0114129_10160953 | Ga0114129_101609532 | 309 |
| 138 | 3300025915 | Ga0207693_10229138 | Ga0207693_102291382 | 309 |
| 139 | 3300025949 | Ga0207667_10007911 | Ga0207667_100079119 | 309 |
| 140 | 3300048907 | Ga0496104_0000317 | Ga0496104_0000317_38016_38990 | 309 |
| 141 | 3300048908 | Ga0496105_0000485 | Ga0496105_0000485_20021_20995 | 309 |
| 142 | 3300049581 | Ga0501047_0029724 | Ga0501047_0029724_2987_3937 | 309 |
| 143 | 3300050507 | nmdc:mga05p37_513092_c1 | nmdc:mga05p37_513092_c1_382_1311 | 309 |
| 144 | iso_pu_bacteria | 2738543024 | 2739310542 | 309 |
| 145 | 3300005330 | Ga0070690_100026997 | Ga0070690_1000269972 | 310 |
| 146 | 3300005535 | Ga0070684_100047934 | Ga0070684_1000479343 | 310 |
| 147 | 3300006237 | Ga0097621_100009027 | Ga0097621_1000090276 | 310 |
| 148 | 3300006358 | Ga0068871_100020899 | Ga0068871_1000208992 | 310 |
| 149 | 3300014745 | Ga0157377_10024575 | Ga0157377_100245752 | 310 |
| 150 | 3300025918 | Ga0207662_10047533 | Ga0207662_100475332 | 310 |
| 151 | 3300028577 | Ga0265318_10046624 | Ga0265318_100466242 | 310 |
| 152 | 3300035170 | Ga0373943_0113654 | Ga0373943_0113654_486_1421 | 310 |
| 153 | 3300046535 | Ga0495586_0259900 | Ga0495586_0259900_10_975 | 310 |
| 154 | 3300049576 | Ga0501040_0141790 | Ga0501040_0141790_61_1017 | 310 |
| 155 | 3300049578 | Ga0501042_0081362 | Ga0501042_0081362_705_1661 | 310 |
| 156 | 3300049587 | Ga0501071_0240335 | Ga0501071_0240335_249_1205 | 310 |
| 157 | 3300049588 | Ga0501072_0128970 | Ga0501072_0128970_584_1540 | 310 |
| 158 | 3300049742 | Ga0501080_0007746 | Ga0501080_0007746_5273_6223 | 310 |
| 159 | 3300005345 | Ga0070692_10041373 | Ga0070692_100413732 | 311 |
| 160 | 3300005347 | Ga0070668_100066458 | Ga0070668_1000664582 | 311 |
| 161 | 3300005353 | Ga0070669_100003300 | Ga0070669_1000033009 | 311 |
| 162 | 3300005441 | Ga0070700_100000733 | Ga0070700_1000007339 | 311 |
| 163 | 3300005459 | Ga0068867_100000417 | Ga0068867_10000041721 | 311 |
| 164 | 3300005536 | Ga0070697_100228438 | Ga0070697_1002284382 | 311 |
| 165 | 3300005547 | Ga0070693_100001007 | Ga0070693_10000100710 | 311 |
| 166 | 3300005617 | Ga0068859_100000332 | Ga0068859_10000033241 | 311 |
| 167 | 3300005719 | Ga0068861_100008854 | Ga0068861_1000088542 | 311 |
| 168 | 3300005842 | Ga0068858_100004862 | Ga0068858_10000486210 | 311 |
| 169 | 3300006358 | Ga0068871_100002899 | Ga0068871_1000028992 | 311 |
| 170 | 3300006881 | Ga0068865_100021004 | Ga0068865_1000210042 | 311 |
| 171 | 3300006914 | Ga0075436_100064857 | Ga0075436_1000648573 | 311 |
| 172 | 3300006931 | Ga0097620_100000332 | Ga0097620_10000033212 | 311 |
| 173 | 3300007076 | Ga0075435_100197824 | Ga0075435_1001978242 | 311 |
| 174 | 3300009553 | Ga0105249_10001691 | Ga0105249_100016912 | 311 |
| 175 | 3300013306 | Ga0163162_10099294 | Ga0163162_100992942 | 311 |
| 176 | 3300014326 | Ga0157380_10008288 | Ga0157380_100082885 | 311 |
| 177 | 3300025899 | Ga0207642_10162803 | Ga0207642_101628032 | 311 |
| 178 | 3300025923 | Ga0207681_10008264 | Ga0207681_100082644 | 311 |
| 179 | 3300025935 | Ga0207709_10000917 | Ga0207709_1000091713 | 311 |
| 180 | 3300025935 | Ga0207709_10005820 | Ga0207709_100058204 | 311 |
| 181 | 3300025936 | Ga0207670_10042605 | Ga0207670_100426052 | 311 |
| 182 | 3300025938 | Ga0207704_10005069 | Ga0207704_100050695 | 311 |
| 183 | 3300025961 | Ga0207712_10000763 | Ga0207712_1000076324 | 311 |
| 184 | 3300025961 | Ga0207712_10001549 | Ga0207712_1000154910 | 311 |
| 185 | 3300026035 | Ga0207703_10001682 | Ga0207703_100016826 | 311 |
| 186 | 3300026041 | Ga0207639_10011475 | Ga0207639_100114756 | 311 |
| 187 | 3300026075 | Ga0207708_10000114 | Ga0207708_1000011458 | 311 |
| 188 | 3300028380 | Ga0268265_10013313 | Ga0268265_100133132 | 311 |
| 189 | 3300032002 | Ga0307416_100248534 | Ga0307416_1002485342 | 311 |
| 190 | 3300046517 | Ga0495630_0109284 | Ga0495630_0109284_1021_1959 | 311 |
| 191 | 3300046559 | Ga0495667_0130547 | Ga0495667_0130547_13_951 | 311 |
| 192 | 3300049571 | Ga0501034_0012919 | Ga0501034_0012919_5823_6800 | 311 |
| 193 | 3300049571 | Ga0501034_0024938 | Ga0501034_0024938_676_1662 | 311 |
| 194 | 3300049573 | Ga0501037_0061394 | Ga0501037_0061394_1611_2597 | 311 |
| 195 | 3300049581 | Ga0501047_0244202 | Ga0501047_0244202_226_1203 | 311 |
| 196 | 3300049589 | Ga0501073_0010790 | Ga0501073_0010790_4682_5668 | 311 |
| 197 | 3300054114 | Ga0501084_0381536 | Ga0501084_0381536_142_1128 | 311 |
| 198 | iso_pu_bacteria | 2773857925 | 2774871344 | 311 |
| 199 | iso_pu_bacteria | 2775506901 | 2776258896 | 311 |
| 200 | 3300005295 | Ga0065707_10146168 | Ga0065707_101461682 | 312 |
| 201 | 3300005354 | Ga0070675_100021212 | Ga0070675_1000212122 | 312 |
| 202 | 3300005441 | Ga0070700_100129628 | Ga0070700_1001296282 | 312 |
| 203 | 3300005459 | Ga0068867_100169625 | Ga0068867_1001696252 | 312 |
| 204 | 3300005617 | Ga0068859_100586192 | Ga0068859_1005861922 | 312 |
| 205 | 3300006931 | Ga0097620_100586186 | Ga0097620_1005861862 | 312 |
| 206 | 3300025972 | Ga0207668_10053056 | Ga0207668_100530563 | 312 |
| 207 | 3300027360 | Ga0209969_1009492 | Ga0209969_10094922 | 312 |
| 208 | 3300027364 | Ga0209967_1001984 | Ga0209967_10019843 | 312 |
| 209 | 3300027462 | Ga0210000_1000744 | Ga0210000_10007443 | 312 |
| 210 | 3300027471 | Ga0209995_1004105 | Ga0209995_10041052 | 312 |
| 211 | 3300027682 | Ga0209971_1013510 | Ga0209971_10135102 | 312 |
| 212 | 3300037068 | Ga0373925_0330582 | Ga0373925_0330582_157_1104 | 312 |
| 213 | 3300037418 | Ga0395900_0120084 | Ga0395900_0120084_1625_2569 | 312 |
| 214 | 3300046459 | Ga0495629_0178950 | Ga0495629_0178950_54_998 | 312 |
| 215 | 3300046642 | Ga0495634_0205337 | Ga0495634_0205337_255_1199 | 312 |
| 216 | 3300047320 | Ga0495672_0130328 | Ga0495672_0130328_16_960 | 312 |
| 217 | 3300048922 | Ga0496119_0055006 | Ga0496119_0055006_15_959 | 312 |
| 218 | 3300049571 | Ga0501034_0347697 | Ga0501034_0347697_382_1368 | 312 |
| 219 | 3300049571 | Ga0501034_0395900 | Ga0501034_0395900_51_1037 | 312 |
| 220 | 3300049575 | Ga0501039_0070455 | Ga0501039_0070455_365_1351 | 312 |
| 221 | 3300049579 | Ga0501043_0010595 | Ga0501043_0010595_1396_2382 | 312 |
| 222 | 3300049580 | Ga0501046_0045435 | Ga0501046_0045435_51_1037 | 312 |
| 223 | 3300049584 | Ga0501068_0143092 | Ga0501068_0143092_463_1449 | 312 |
| 224 | 3300049585 | Ga0501069_0034085 | Ga0501069_0034085_1402_2388 | 312 |
| 225 | 3300049741 | Ga0501079_0070652 | Ga0501079_0070652_1187_2173 | 312 |
| 226 | 3300049743 | Ga0501081_0069515 | Ga0501081_0069515_305_1291 | 312 |
| 227 | 3300049822 | Ga0501035_0241391 | Ga0501035_0241391_51_1037 | 312 |
| 228 | 3300054114 | Ga0501084_0124646 | Ga0501084_0124646_352_1338 | 312 |
| 229 | iso_pu_bacteria | 2915980308 | 2915983872 | 312 |
| 230 | iso_pu_bacteria | 2916061851 | 2916068477 | 312 |
| 231 | iso_pu_bacteria | 2921250672 | 2921256182 | 312 |
| 232 | 3300005330 | Ga0070690_100176522 | Ga0070690_1001765222 | 313 |
| 233 | 3300005615 | Ga0070702_100107193 | Ga0070702_1001071932 | 313 |
| 234 | 3300005618 | Ga0068864_100489587 | Ga0068864_1004895872 | 313 |
| 235 | 3300005981 | Ga0081538_10024573 | Ga0081538_100245735 | 313 |
| 236 | 3300021377 | Ga0213874_10022715 | Ga0213874_100227153 | 313 |
| 237 | 3300025918 | Ga0207662_10091273 | Ga0207662_100912732 | 313 |
| 238 | 3300025942 | Ga0207689_10021922 | Ga0207689_100219221 | 313 |
| 239 | 3300026023 | Ga0207677_10579091 | Ga0207677_105790911 | 313 |
| 240 | 3300026075 | Ga0207708_10055868 | Ga0207708_100558681 | 313 |
| 241 | 3300028381 | Ga0268264_10092980 | Ga0268264_100929801 | 313 |
| 242 | 3300028794 | Ga0307515_10004497 | Ga0307515_1000449713 | 313 |
| 243 | 3300031507 | Ga0307509_10037843 | Ga0307509_100378433 | 313 |
| 244 | 3300035692 | Ga0373935_0121849 | Ga0373935_0121849_616_1575 | 313 |
| 245 | 3300039450 | Ga0436363_0480840 | Ga0436363_0480840_9305_10282 | 313 |
| 246 | 3300039450 | Ga0436363_1483637 | Ga0436363_1483637_299_1282 | 313 |
| 247 | 3300049743 | Ga0501081_0203385 | Ga0501081_0203385_336_1295 | 313 |
| 248 | 3300031344 | Ga0265316_10004461 | Ga0265316_100044617 | 314 |
| 249 | 3300031595 | Ga0265313_10053957 | Ga0265313_100539572 | 314 |
| 250 | 3300035083 | Ga0373926_0001015 | Ga0373926_0001015_2020_3027 | 314 |
| 251 | 3300035113 | Ga0373936_0008659 | Ga0373936_0008659_864_1871 | 314 |
| 252 | 3300035725 | Ga0373947_0099733 | Ga0373947_0099733_170_1177 | 314 |
| 253 | 3300046472 | Ga0495580_0007921 | Ga0495580_0007921_6062_7069 | 314 |
| 254 | 3300046473 | Ga0495582_0054498 | Ga0495582_0054498_44_1051 | 314 |
| 255 | 3300046475 | Ga0495639_0020303 | Ga0495639_0020303_211_1218 | 314 |
| 256 | 3300046507 | Ga0495606_0005629 | Ga0495606_0005629_9929_10888 | 314 |
| 257 | 3300046526 | Ga0495666_0005885 | Ga0495666_0005885_1006_2013 | 314 |
| 258 | 3300046535 | Ga0495586_0002047 | Ga0495586_0002047_7407_8414 | 314 |
| 259 | 3300046681 | Ga0495647_0013785 | Ga0495647_0013785_1045_2052 | 314 |
| 260 | 3300046683 | Ga0495658_0004005 | Ga0495658_0004005_1684_2691 | 314 |
| 261 | 3300048924 | Ga0496121_0012777 | Ga0496121_0012777_1733_2692 | 314 |
| 262 | 3300049572 | Ga0501036_0441372 | Ga0501036_0441372_52_1014 | 314 |
| 263 | 3300053091 | Ga0500647_0054562 | Ga0500647_0054562_894_1850 | 314 |
| 264 | 3300054114 | Ga0501084_0343064 | Ga0501084_0343064_121_1083 | 314 |
| 265 | iso_pu_bacteria | 2874123672 | 2874124070 | 314 |
| 266 | 3300005295 | Ga0065707_10134610 | Ga0065707_101346101 | 315 |
| 267 | 3300005347 | Ga0070668_100033602 | Ga0070668_1000336023 | 315 |
| 268 | 3300005563 | Ga0068855_100053304 | Ga0068855_1000533043 | 315 |
| 269 | 3300005615 | Ga0070702_100057852 | Ga0070702_1000578522 | 315 |
| 270 | 3300005842 | Ga0068858_100169232 | Ga0068858_1001692322 | 315 |
| 271 | 3300005937 | Ga0081455_10053792 | Ga0081455_100537922 | 315 |
| 272 | 3300005937 | Ga0081455_10054052 | Ga0081455_100540523 | 315 |
| 273 | 3300006038 | Ga0075365_10014030 | Ga0075365_100140304 | 315 |
| 274 | 3300006844 | Ga0075428_100203688 | Ga0075428_1002036882 | 315 |
| 275 | 3300006847 | Ga0075431_100350704 | Ga0075431_1003507041 | 315 |
| 276 | 3300013105 | Ga0157369_10421652 | Ga0157369_104216523 | 315 |
| 277 | 3300013296 | Ga0157374_10163290 | Ga0157374_101632902 | 315 |
| 278 | 3300013306 | Ga0163162_10045343 | Ga0163162_100453432 | 315 |
| 279 | 3300014325 | Ga0163163_10102773 | Ga0163163_101027733 | 315 |
| 280 | 3300014968 | Ga0157379_10187602 | Ga0157379_101876021 | 315 |
| 281 | 3300026035 | Ga0207703_10100954 | Ga0207703_101009542 | 315 |
| 282 | 3300035118 | Ga0373954_0000001 | Ga0373954_0000001_89567_90535 | 315 |
| 283 | 3300035172 | Ga0373955_0078198 | Ga0373955_0078198_723_1691 | 315 |
| 284 | 3300035724 | Ga0373933_0014895 | Ga0373933_0014895_248_1216 | 315 |
| 285 | 3300036401 | Ga0373937_0000524 | Ga0373937_0000524_10210_11178 | 315 |
| 286 | 3300048904 | Ga0496101_0226311 | Ga0496101_0226311_135_1091 | 315 |
| 287 | 3300048905 | Ga0496102_0094089 | Ga0496102_0094089_88_1044 | 315 |
| 288 | 3300048907 | Ga0496104_0053959 | Ga0496104_0053959_931_1887 | 315 |
| 289 | 3300048908 | Ga0496105_0014128 | Ga0496105_0014128_4035_4991 | 315 |
| 290 | 3300048909 | Ga0496106_0063690 | Ga0496106_0063690_206_1162 | 315 |
| 291 | 3300048911 | Ga0496108_0022495 | Ga0496108_0022495_373_1329 | 315 |
| 292 | 3300048913 | Ga0496110_0006680 | Ga0496110_0006680_7346_8302 | 315 |
| 293 | 3300048915 | Ga0496112_0046586 | Ga0496112_0046586_654_1610 | 315 |
| 294 | 3300048916 | Ga0496113_0038211 | Ga0496113_0038211_1450_2406 | 315 |
| 295 | 3300049572 | Ga0501036_0072485 | Ga0501036_0072485_1767_2720 | 315 |
| 296 | 3300049575 | Ga0501039_0039986 | Ga0501039_0039986_1882_2853 | 315 |
| 297 | 3300049588 | Ga0501072_0179329 | Ga0501072_0179329_537_1490 | 315 |
| 298 | 3300049589 | Ga0501073_0203106 | Ga0501073_0203106_368_1321 | 315 |
| 299 | 3300049742 | Ga0501080_0066799 | Ga0501080_0066799_1983_2936 | 315 |
| 300 | 3300050492 | nmdc:mga0yw44_501_c1 | nmdc:mga0yw44_501_c1_5070_6053 | 315 |
| 301 | 3300050509 | nmdc:mga0qj67_68904_c1 | nmdc:mga0qj67_68904_c1_1748_2731 | 315 |
| 302 | 3300050510 | nmdc:mga06r32_137077_c1 | nmdc:mga06r32_137077_c1_1012_1995 | 315 |
| 303 | iso_pu_bacteria | 2513237351 | 2514587565 | 315 |
| 304 | iso_pu_bacteria | 2738541281 | 2738747453 | 315 |
| 305 | iso_pu_bacteria | 2738543032 | 2739356735 | 315 |
| 306 | iso_pu_bacteria | 2885318864 | 2885320794 | 315 |
| 307 | iso_pu_bacteria | 2888337043 | 2888338313 | 315 |
| 308 | 3300003775 | Ga0055524_1000435 | Ga0055524_100043510 | 316 |
| 309 | 3300003790 | Ga0055528_1000033 | Ga0055528_100003310 | 316 |
| 310 | 3300005440 | Ga0070705_100109820 | Ga0070705_1001098202 | 316 |
| 311 | 3300005545 | Ga0070695_100091171 | Ga0070695_1000911712 | 316 |
| 312 | 3300005548 | Ga0070665_100026701 | Ga0070665_1000267017 | 316 |
| 313 | 3300005719 | Ga0068861_100364620 | Ga0068861_1003646201 | 316 |
| 314 | 3300025273 | Ga0209673_1000157 | Ga0209673_100015710 | 316 |
| 315 | 3300025295 | Ga0209564_1000237 | Ga0209564_100023710 | 316 |
| 316 | 3300025299 | Ga0209256_1000185 | Ga0209256_100018510 | 316 |
| 317 | 3300026067 | Ga0207678_10111326 | Ga0207678_101113262 | 316 |
| 318 | 3300028379 | Ga0268266_10090419 | Ga0268266_100904192 | 316 |
| 319 | 3300031241 | Ga0265325_10054261 | Ga0265325_100542613 | 316 |
| 320 | 3300031711 | Ga0265314_10042680 | Ga0265314_100426803 | 316 |
| 321 | 3300046529 | Ga0495652_0369195 | Ga0495652_0369195_54_1004 | 316 |
| 322 | 3300050511 | nmdc:mga08y16_612482_c1 | nmdc:mga08y16_612482_c1_128_1081 | 316 |
| 323 | 3300050512 | nmdc:mga0n895_224463_c1 | nmdc:mga0n895_224463_c1_231_1214 | 316 |
| 324 | iso_pu_bacteria | 2713897090 | 2715500560 | 316 |
| 325 | iso_pu_bacteria | 2856314179 | 2856318173 | 316 |
| 326 | iso_pu_bacteria | 2906414383 | 2906418210 | 316 |
| 327 | iso_pu_bacteria | 2961170736 | 2961175841 | 316 |
| 328 | iso_pu_bacteria | 2970503327 | 2970508506 | 316 |
| 329 | iso_pu_bacteria | 2979808191 | 2979811845 | 316 |
| 330 | 3300005334 | Ga0068869_100143106 | Ga0068869_1001431063 | 317 |
| 331 | 3300005337 | Ga0070682_100088567 | Ga0070682_1000885673 | 317 |
| 332 | 3300005338 | Ga0068868_100037635 | Ga0068868_1000376353 | 317 |
| 333 | 3300005339 | Ga0070660_100131859 | Ga0070660_1001318591 | 317 |
| 334 | 3300005340 | Ga0070689_100176001 | Ga0070689_1001760013 | 317 |
| 335 | 3300005345 | Ga0070692_10038866 | Ga0070692_100388662 | 317 |
| 336 | 3300005356 | Ga0070674_100048660 | Ga0070674_1000486603 | 317 |
| 337 | 3300005364 | Ga0070673_100044693 | Ga0070673_1000446934 | 317 |
| 338 | 3300005438 | Ga0070701_10162829 | Ga0070701_101628292 | 317 |
| 339 | 3300005441 | Ga0070700_100027128 | Ga0070700_1000271284 | 317 |
| 340 | 3300005456 | Ga0070678_100525533 | Ga0070678_1005255331 | 317 |
| 341 | 3300005459 | Ga0068867_100016190 | Ga0068867_1000161903 | 317 |
| 342 | 3300005459 | Ga0068867_100113901 | Ga0068867_1001139013 | 317 |
| 343 | 3300005535 | Ga0070684_100229585 | Ga0070684_1002295852 | 317 |
| 344 | 3300005539 | Ga0068853_100401731 | Ga0068853_1004017311 | 317 |
| 345 | 3300005543 | Ga0070672_100151621 | Ga0070672_1001516211 | 317 |
| 346 | 3300005544 | Ga0070686_100075392 | Ga0070686_1000753923 | 317 |
| 347 | 3300005548 | Ga0070665_100441668 | Ga0070665_1004416681 | 317 |
| 348 | 3300005563 | Ga0068855_100465137 | Ga0068855_1004651373 | 317 |
| 349 | 3300005564 | Ga0070664_100120215 | Ga0070664_1001202152 | 317 |
| 350 | 3300005578 | Ga0068854_100021398 | Ga0068854_1000213982 | 317 |
| 351 | 3300005615 | Ga0070702_100093894 | Ga0070702_1000938942 | 317 |
| 352 | 3300005718 | Ga0068866_10027915 | Ga0068866_100279152 | 317 |
| 353 | 3300005719 | Ga0068861_100189179 | Ga0068861_1001891792 | 317 |
| 354 | 3300005840 | Ga0068870_10018860 | Ga0068870_100188602 | 317 |
| 355 | 3300005841 | Ga0068863_100214375 | Ga0068863_1002143752 | 317 |
| 356 | 3300005844 | Ga0068862_100284438 | Ga0068862_1002844381 | 317 |
| 357 | 3300006028 | Ga0070717_10016310 | Ga0070717_100163102 | 317 |
| 358 | 3300006163 | Ga0070715_10001875 | Ga0070715_100018751 | 317 |
| 359 | 3300006871 | Ga0075434_100045576 | Ga0075434_1000455763 | 317 |
| 360 | 3300009011 | Ga0105251_10031021 | Ga0105251_100310212 | 317 |
| 361 | 3300009094 | Ga0111539_10148301 | Ga0111539_101483011 | 317 |
| 362 | 3300009553 | Ga0105249_10311215 | Ga0105249_103112152 | 317 |
| 363 | 3300025321 | Ga0207656_10032864 | Ga0207656_100328641 | 317 |
| 364 | 3300025898 | Ga0207692_10151304 | Ga0207692_101513041 | 317 |
| 365 | 3300025901 | Ga0207688_10002122 | Ga0207688_100021229 | 317 |
| 366 | 3300025907 | Ga0207645_10066685 | Ga0207645_100666852 | 317 |
| 367 | 3300025908 | Ga0207643_10045427 | Ga0207643_100454272 | 317 |
| 368 | 3300025914 | Ga0207671_10174406 | Ga0207671_101744062 | 317 |
| 369 | 3300025915 | Ga0207693_10021771 | Ga0207693_100217712 | 317 |
| 370 | 3300025916 | Ga0207663_10045565 | Ga0207663_100455652 | 317 |
| 371 | 3300025919 | Ga0207657_10030427 | Ga0207657_100304272 | 317 |
| 372 | 3300025920 | Ga0207649_10118222 | Ga0207649_101182222 | 317 |
| 373 | 3300025926 | Ga0207659_10038536 | Ga0207659_100385363 | 317 |
| 374 | 3300025927 | Ga0207687_10084687 | Ga0207687_100846872 | 317 |
| 375 | 3300025928 | Ga0207700_10111361 | Ga0207700_101113612 | 317 |
| 376 | 3300025929 | Ga0207664_10085522 | Ga0207664_100855223 | 317 |
| 377 | 3300025931 | Ga0207644_10350477 | Ga0207644_103504771 | 317 |
| 378 | 3300025933 | Ga0207706_10093359 | Ga0207706_100933593 | 317 |
| 379 | 3300025935 | Ga0207709_10005103 | Ga0207709_100051033 | 317 |
| 380 | 3300025936 | Ga0207670_10406824 | Ga0207670_104068241 | 317 |
| 381 | 3300025939 | Ga0207665_10018857 | Ga0207665_100188573 | 317 |
| 382 | 3300025940 | Ga0207691_10101354 | Ga0207691_101013542 | 317 |
| 383 | 3300025960 | Ga0207651_10181570 | Ga0207651_101815702 | 317 |
| 384 | 3300025961 | Ga0207712_10126412 | Ga0207712_101264122 | 317 |
| 385 | 3300026075 | Ga0207708_10005145 | Ga0207708_100051458 | 317 |
| 386 | 3300026088 | Ga0207641_10250705 | Ga0207641_102507051 | 317 |
| 387 | 3300026089 | Ga0207648_10001736 | Ga0207648_1000173617 | 317 |
| 388 | 3300026089 | Ga0207648_10216150 | Ga0207648_102161502 | 317 |
| 389 | 3300026118 | Ga0207675_100009348 | Ga0207675_1000093483 | 317 |
| 390 | 3300026121 | Ga0207683_10225670 | Ga0207683_102256701 | 317 |
| 391 | 3300031711 | Ga0265314_10084309 | Ga0265314_100843091 | 317 |
| 392 | 3300039062 | Ga0400483_150203 | Ga0400483_150203_491_1462 | 317 |
| 393 | 3300039447 | Ga0436361_0841184 | Ga0436361_0841184_852_1805 | 317 |
| 394 | 3300042461 | Ga0439460_0057258 | Ga0439460_0057258_201_1154 | 317 |
| 395 | 3300046533 | Ga0495640_0130390 | Ga0495640_0130390_420_1385 | 317 |
| 396 | 3300048905 | Ga0496102_0222394 | Ga0496102_0222394_648_1631 | 317 |
| 397 | 3300048906 | Ga0496103_0170466 | Ga0496103_0170466_64_1047 | 317 |
| 398 | 3300048910 | Ga0496107_0018433 | Ga0496107_0018433_483_1466 | 317 |
| 399 | 3300048916 | Ga0496113_0176816 | Ga0496113_0176816_546_1499 | 317 |
| 400 | 3300048917 | Ga0496114_0122586 | Ga0496114_0122586_27_980 | 317 |
| 401 | 3300048918 | Ga0496115_0222208 | Ga0496115_0222208_424_1407 | 317 |
| 402 | 3300048923 | Ga0496120_0058289 | Ga0496120_0058289_910_1863 | 317 |
| 403 | 3300048925 | Ga0496122_0198344 | Ga0496122_0198344_202_1155 | 317 |
| 404 | 3300049586 | Ga0501070_0299565 | Ga0501070_0299565_90_1046 | 317 |
| 405 | 3300050495 | nmdc:mga04h51_121517_c1 | nmdc:mga04h51_121517_c1_10_963 | 317 |
| 406 | 3300050512 | nmdc:mga0n895_235723_c1 | nmdc:mga0n895_235723_c1_22_1005 | 317 |
| 407 | 3300050512 | nmdc:mga0n895_69727_c1 | nmdc:mga0n895_69727_c1_2370_3353 | 317 |
| 408 | 3300053086 | Ga0500578_0038804 | Ga0500578_0038804_117_1073 | 317 |
| 409 | iso_pu_bacteria | 2842694124 | 2842696667 | 317 |
| 410 | iso_pu_bacteria | 2958071322 | 2958073779 | 317 |
| 411 | 3300005436 | Ga0070713_100376483 | Ga0070713_1003764832 | 318 |
| 412 | 3300025944 | Ga0207661_10176323 | Ga0207661_101763232 | 318 |
| 413 | 3300046558 | Ga0495633_0165699 | Ga0495633_0165699_15_971 | 318 |
| 414 | 3300048910 | Ga0496107_0268179 | Ga0496107_0268179_178_1182 | 318 |
| 415 | 3300048929 | Ga0496126_0033060 | Ga0496126_0033060_2587_3630 | 318 |
| 416 | 3300049579 | Ga0501043_0171778 | Ga0501043_0171778_588_1547 | 318 |
| 417 | 3300050493 | nmdc:mga0k408_198452_c1 | nmdc:mga0k408_198452_c1_22_978 | 318 |
| 418 | 3300053146 | Ga0500588_0015558 | Ga0500588_0015558_506_1471 | 318 |
| 419 | 3300060353 | Ga0501082_0035666 | Ga0501082_0035666_2036_2995 | 318 |
| 420 | iso_pu_bacteria | 2513237090 | 2513608658 | 318 |
| 421 | iso_pu_bacteria | 2599185301 | 2599936414 | 318 |
| 422 | iso_pu_bacteria | 2643221551 | 2643774456 | 318 |
| 423 | iso_pu_bacteria | 2643221555 | 2643792901 | 318 |
| 424 | iso_pu_bacteria | 2693429783 | 2694628704 | 318 |
| 425 | iso_pu_bacteria | 2693429784 | 2694637382 | 318 |
| 426 | iso_pu_bacteria | 2847686936 | 2847691116 | 318 |
| 427 | iso_pu_bacteria | 2856314179 | 2856320747 | 318 |
| 428 | iso_pu_bacteria | 2856356410 | 2856356769 | 318 |
| 429 | iso_pu_bacteria | 2869285874 | 2869290327 | 318 |
| 430 | iso_pu_bacteria | 2871429161 | 2871432611 | 318 |
| 431 | iso_pu_bacteria | 2871444079 | 2871444628 | 318 |
| 432 | iso_pu_bacteria | 2874102143 | 2874109133 | 318 |
| 433 | iso_pu_bacteria | 2874146452 | 2874152578 | 318 |
| 434 | iso_pu_bacteria | 2874155637 | 2874159978 | 318 |
| 435 | iso_pu_bacteria | 2876369609 | 2876375749 | 318 |
| 436 | iso_pu_bacteria | 2876377896 | 2876385901 | 318 |
| 437 | iso_pu_bacteria | 2876392853 | 2876398014 | 318 |
| 438 | iso_pu_bacteria | 2876413966 | 2876418494 | 318 |
| 439 | iso_pu_bacteria | 2878035449 | 2878035919 | 318 |
| 440 | iso_pu_bacteria | 2878745973 | 2878750225 | 318 |
| 441 | iso_pu_bacteria | 2881147464 | 2881149912 | 318 |
| 442 | iso_pu_bacteria | 2881161766 | 2881166793 | 318 |
| 443 | iso_pu_bacteria | 2885305155 | 2885308309 | 318 |
| 444 | iso_pu_bacteria | 2885326080 | 2885330834 | 318 |
| 445 | iso_pu_bacteria | 2885334103 | 2885342483 | 318 |
| 446 | iso_pu_bacteria | 2888350351 | 2888355150 | 318 |
| 447 | iso_pu_bacteria | 2889010040 | 2889010129 | 318 |
| 448 | iso_pu_bacteria | 2903492973 | 2903504443 | 318 |
| 449 | iso_pu_bacteria | 2904659560 | 2904664665 | 318 |
| 450 | iso_pu_bacteria | 2906308376 | 2906312583 | 318 |
| 451 | iso_pu_bacteria | 2906321335 | 2906325292 | 318 |
| 452 | iso_pu_bacteria | 2906328253 | 2906330690 | 318 |
| 453 | iso_pu_bacteria | 2906354277 | 2906362971 | 318 |
| 454 | iso_pu_bacteria | 2906414383 | 2906419804 | 318 |
| 455 | iso_pu_bacteria | 2922130491 | 2922134244 | 318 |
| 456 | iso_pu_bacteria | 2922158528 | 2922158899 | 318 |
| 457 | iso_pu_bacteria | 2924726620 | 2924731695 | 318 |
| 458 | iso_pu_bacteria | 2937813078 | 2937819272 | 318 |
| 459 | iso_pu_bacteria | 2937848649 | 2937852010 | 318 |
| 460 | iso_pu_bacteria | 2937891427 | 2937895244 | 318 |
| 461 | iso_pu_bacteria | 2958041894 | 2958044485 | 318 |
| 462 | iso_pu_bacteria | 2958115193 | 2958115506 | 318 |
| 463 | iso_pu_bacteria | 2958130278 | 2958134715 | 318 |
| 464 | iso_pu_bacteria | 2958179912 | 2958186530 | 318 |
| 465 | iso_pu_bacteria | 2961077736 | 2961085029 | 318 |
| 466 | iso_pu_bacteria | 2961114664 | 2961119663 | 318 |
| 467 | iso_pu_bacteria | 2965062239 | 2965069187 | 318 |
| 468 | iso_pu_bacteria | 2968091066 | 2968094764 | 318 |
| 469 | iso_pu_bacteria | 2968097103 | 2968099325 | 318 |
| 470 | iso_pu_bacteria | 2968110612 | 2968115918 | 318 |
| 471 | iso_pu_bacteria | 2968128360 | 2968133666 | 318 |
| 472 | iso_pu_bacteria | 2977843712 | 2977848371 | 318 |
| 473 | iso_pu_bacteria | 2977858184 | 2977863332 | 318 |
| 474 | iso_pu_bacteria | 2977922695 | 2977922975 | 318 |
| 475 | iso_pu_bacteria | 2977942078 | 2977944743 | 318 |
| 476 | iso_pu_bacteria | 2977971508 | 2977976047 | 318 |
| 477 | iso_pu_bacteria | 2977986579 | 2977990132 | 318 |
| 478 | iso_pu_bacteria | 2979742915 | 2979750661 | 318 |
| 479 | iso_pu_bacteria | 2979779861 | 2979785313 | 318 |
| 480 | iso_pu_bacteria | 2996341866 | 2996344260 | 318 |
| 481 | iso_pu_bacteria | 3000135777 | 3000139620 | 318 |
| 482 | iso_pu_bacteria | 3004167301 | 3004167649 | 318 |
| 483 | iso_pu_bacteria | 8004387939 | 8004392533 | 318 |
| 484 | iso_pu_bacteria | 8004445564 | 8004446520 | 318 |
| 485 | iso_pu_bacteria | 8004640170 | 8004645135 | 318 |
| 486 | iso_pu_bacteria | 8004703790 | 8004712062 | 318 |
| 487 | iso_pu_bacteria | 8004714634 | 8004718842 | 318 |
| 488 | 3300003187 | JGI25151J46595_10000069 | JGI25151J46595_100000697 | 319 |
| 489 | 3300005330 | Ga0070690_100000472 | Ga0070690_10000047218 | 319 |
| 490 | 3300005338 | Ga0068868_100000209 | Ga0068868_10000020918 | 319 |
| 491 | 3300005343 | Ga0070687_100000190 | Ga0070687_10000019010 | 319 |
| 492 | 3300005456 | Ga0070678_100230417 | Ga0070678_1002304172 | 319 |
| 493 | 3300005530 | Ga0070679_100002529 | Ga0070679_10000252911 | 319 |
| 494 | 3300005544 | Ga0070686_100000825 | Ga0070686_1000008259 | 319 |
| 495 | 3300005545 | Ga0070695_100000457 | Ga0070695_10000045711 | 319 |
| 496 | 3300009098 | Ga0105245_10000115 | Ga0105245_1000011523 | 319 |
| 497 | 3300009177 | Ga0105248_10243132 | Ga0105248_102431322 | 319 |
| 498 | 3300010375 | Ga0105239_10163319 | Ga0105239_101633192 | 319 |
| 499 | 3300011119 | Ga0105246_10316084 | Ga0105246_103160841 | 319 |
| 500 | 3300013297 | Ga0157378_10001030 | Ga0157378_1000103014 | 319 |
| 501 | 3300013306 | Ga0163162_10112611 | Ga0163162_101126113 | 319 |
| 502 | 3300014968 | Ga0157379_10098205 | Ga0157379_100982052 | 319 |
| 503 | 3300014969 | Ga0157376_10002960 | Ga0157376_100029603 | 319 |
| 504 | 3300025294 | Ga0209025_1000008 | Ga0209025_100000871 | 319 |
| 505 | 3300025929 | Ga0207664_10125164 | Ga0207664_101251642 | 319 |
| 506 | 3300035410 | Ga0373924_0031279 | Ga0373924_0031279_45_1052 | 319 |
| 507 | 3300035695 | Ga0373927_0021393 | Ga0373927_0021393_3021_4028 | 319 |
| 508 | 3300039437 | Ga0436365_0536235 | Ga0436365_0536235_1896_2858 | 319 |
| 509 | 3300044706 | Ga0466964_0043964 | Ga0466964_0043964_411_1379 | 319 |
| 510 | 3300045976 | Ga0466967_0039921 | Ga0466967_0039921_2565_3533 | 319 |
| 511 | 3300046615 | Ga0495656_0009753 | Ga0495656_0009753_322_1311 | 319 |
| 512 | 3300046674 | Ga0495588_0116141 | Ga0495588_0116141_217_1224 | 319 |
| 513 | 3300048928 | Ga0496125_0142009 | Ga0496125_0142009_413_1396 | 319 |
| 514 | 3300048929 | Ga0496126_0084838 | Ga0496126_0084838_119_1102 | 319 |
| 515 | 3300049571 | Ga0501034_0240878 | Ga0501034_0240878_489_1454 | 319 |
| 516 | 3300049579 | Ga0501043_0274914 | Ga0501043_0274914_110_1093 | 319 |
| 517 | 3300049593 | Ga0501077_0052209 | Ga0501077_0052209_548_1516 | 319 |
| 518 | 3300049822 | Ga0501035_0150290 | Ga0501035_0150290_186_1151 | 319 |
| 519 | 3300049823 | Ga0501044_0126626 | Ga0501044_0126626_449_1414 | 319 |
| 520 | 3300050514 | nmdc:mga08x19_1409_c1 | nmdc:mga08x19_1409_c1_10325_11317 | 319 |
| 521 | 3300060353 | Ga0501082_0151312 | Ga0501082_0151312_133_1140 | 319 |
| 522 | iso_pu_bacteria | 2503198000 | 2503199986 | 319 |
| 523 | iso_pu_bacteria | 2508501123 | 2509118500 | 319 |
| 524 | iso_pu_bacteria | 2508501127 | 2509142564 | 319 |
| 525 | iso_pu_bacteria | 2509276018 | 2509369549 | 319 |
| 526 | iso_pu_bacteria | 2510065059 | 2510319279 | 319 |
| 527 | iso_pu_bacteria | 2512875016 | 2512932546 | 319 |
| 528 | iso_pu_bacteria | 2512875024 | 2512960563 | 319 |
| 529 | iso_pu_bacteria | 2513237164 | 2514036347 | 319 |
| 530 | iso_pu_bacteria | 2513237305 | 2514416472 | 319 |
| 531 | iso_pu_bacteria | 2588253730 | 2588518621 | 319 |
| 532 | iso_pu_bacteria | 2597489875 | 2597812152 | 319 |
| 533 | iso_pu_bacteria | 2643221595 | 2643984853 | 319 |
| 534 | iso_pu_bacteria | 2643221627 | 2644153183 | 319 |
| 535 | iso_pu_bacteria | 2687453392 | 2688597232 | 319 |
| 536 | iso_pu_bacteria | 2721755686 | 2723574437 | 319 |
| 537 | iso_pu_bacteria | 2756170246 | 2756671523 | 319 |
| 538 | iso_pu_bacteria | 2791355123 | 2792747980 | 319 |
| 539 | iso_pu_bacteria | 2828305725 | 2828308520 | 319 |
| 540 | iso_pu_bacteria | 2841734538 | 2841738145 | 319 |
| 541 | iso_pu_bacteria | 2844002411 | 2844008566 | 319 |
| 542 | iso_pu_bacteria | 2844009547 | 2844012613 | 319 |
| 543 | iso_pu_bacteria | 2856320880 | 2856323093 | 319 |
| 544 | iso_pu_bacteria | 2856328259 | 2856334853 | 319 |
| 545 | iso_pu_bacteria | 2856334872 | 2856341596 | 319 |
| 546 | iso_pu_bacteria | 2856342000 | 2856347362 | 319 |
| 547 | iso_pu_bacteria | 2857367948 | 2857373943 | 319 |
| 548 | iso_pu_bacteria | 2869234852 | 2869237041 | 319 |
| 549 | iso_pu_bacteria | 2869249662 | 2869251573 | 319 |
| 550 | iso_pu_bacteria | 2869256925 | 2869260108 | 319 |
| 551 | iso_pu_bacteria | 2869264136 | 2869271081 | 319 |
| 552 | iso_pu_bacteria | 2869271264 | 2869277761 | 319 |
| 553 | iso_pu_bacteria | 2869278585 | 2869282644 | 319 |
| 554 | iso_pu_bacteria | 2871451962 | 2871453796 | 319 |
| 555 | iso_pu_bacteria | 2871459585 | 2871461229 | 319 |
| 556 | iso_pu_bacteria | 2871466892 | 2871469077 | 319 |
| 557 | iso_pu_bacteria | 2871474448 | 2871480148 | 319 |
| 558 | iso_pu_bacteria | 2871488783 | 2871493229 | 319 |
| 559 | iso_pu_bacteria | 2874109183 | 2874116408 | 319 |
| 560 | iso_pu_bacteria | 2874116593 | 2874122777 | 319 |
| 561 | iso_pu_bacteria | 2874139085 | 2874142301 | 319 |
| 562 | iso_pu_bacteria | 2874162495 | 2874167969 | 319 |
| 563 | iso_pu_bacteria | 2874168670 | 2874174796 | 319 |
| 564 | iso_pu_bacteria | 2876363079 | 2876365202 | 319 |
| 565 | iso_pu_bacteria | 2876386047 | 2876387917 | 319 |
| 566 | iso_pu_bacteria | 2876399893 | 2876402848 | 319 |
| 567 | iso_pu_bacteria | 2876406927 | 2876410514 | 319 |
| 568 | iso_pu_bacteria | 2876420981 | 2876422967 | 319 |
| 569 | iso_pu_bacteria | 2878738818 | 2878744516 | 319 |
| 570 | iso_pu_bacteria | 2878753008 | 2878757274 | 319 |
| 571 | iso_pu_bacteria | 2878774303 | 2878774958 | 319 |
| 572 | iso_pu_bacteria | 2881845957 | 2881849434 | 319 |
| 573 | iso_pu_bacteria | 2881861095 | 2881866324 | 319 |
| 574 | iso_pu_bacteria | 2882632389 | 2882632553 | 319 |
| 575 | iso_pu_bacteria | 2882912400 | 2882916294 | 319 |
| 576 | iso_pu_bacteria | 2885312484 | 2885312898 | 319 |
| 577 | iso_pu_bacteria | 2885318864 | 2885320518 | 319 |
| 578 | iso_pu_bacteria | 2888343758 | 2888345919 | 319 |
| 579 | iso_pu_bacteria | 2889016732 | 2889018200 | 319 |
| 580 | iso_pu_bacteria | 2903448605 | 2903450202 | 319 |
| 581 | iso_pu_bacteria | 2903492973 | 2903501001 | 319 |
| 582 | iso_pu_bacteria | 2903521522 | 2903522063 | 319 |
| 583 | iso_pu_bacteria | 2903528002 | 2903528441 | 319 |
| 584 | iso_pu_bacteria | 2906363423 | 2906367031 | 319 |
| 585 | iso_pu_bacteria | 2906370794 | 2906376949 | 319 |
| 586 | iso_pu_bacteria | 2906386501 | 2906388706 | 319 |
| 587 | iso_pu_bacteria | 2906393657 | 2906398172 | 319 |
| 588 | iso_pu_bacteria | 2906401398 | 2906403230 | 319 |
| 589 | iso_pu_bacteria | 2906408224 | 2906411344 | 319 |
| 590 | iso_pu_bacteria | 2922151315 | 2922155915 | 319 |
| 591 | iso_pu_bacteria | 2922172374 | 2922177612 | 319 |
| 592 | iso_pu_bacteria | 2924733363 | 2924737885 | 319 |
| 593 | iso_pu_bacteria | 2924741084 | 2924744877 | 319 |
| 594 | iso_pu_bacteria | 2924748358 | 2924749718 | 319 |
| 595 | iso_pu_bacteria | 2924754689 | 2924756982 | 319 |
| 596 | iso_pu_bacteria | 2924776078 | 2924782546 | 319 |
| 597 | iso_pu_bacteria | 2924784321 | 2924786579 | 319 |
| 598 | iso_pu_bacteria | 2937836603 | 2937842623 | 319 |
| 599 | iso_pu_bacteria | 2937861824 | 2937862670 | 319 |
| 600 | iso_pu_bacteria | 2937868953 | 2937869622 | 319 |
| 601 | iso_pu_bacteria | 2937877337 | 2937881188 | 319 |
| 602 | iso_pu_bacteria | 2937972304 | 2937977279 | 319 |
| 603 | iso_pu_bacteria | 2937980651 | 2937985520 | 319 |
| 604 | iso_pu_bacteria | 2958034702 | 2958039427 | 319 |
| 605 | iso_pu_bacteria | 2958041894 | 2958052944 | 319 |
| 606 | iso_pu_bacteria | 2958064165 | 2958064935 | 319 |
| 607 | iso_pu_bacteria | 2958084443 | 2958088255 | 319 |
| 608 | iso_pu_bacteria | 2958092219 | 2958095206 | 319 |
| 609 | iso_pu_bacteria | 2958100919 | 2958102161 | 319 |
| 610 | iso_pu_bacteria | 2958108152 | 2958109801 | 319 |
| 611 | iso_pu_bacteria | 2958122699 | 2958129811 | 319 |
| 612 | iso_pu_bacteria | 2958137437 | 2958141420 | 319 |
| 613 | iso_pu_bacteria | 2958144490 | 2958147691 | 319 |
| 614 | iso_pu_bacteria | 2958158011 | 2958158860 | 319 |
| 615 | iso_pu_bacteria | 2958172287 | 2958175241 | 319 |
| 616 | iso_pu_bacteria | 2961136820 | 2961139807 | 319 |
| 617 | iso_pu_bacteria | 2961170736 | 2961175397 | 319 |
| 618 | iso_pu_bacteria | 2961183825 | 2961184379 | 319 |
| 619 | iso_pu_bacteria | 2963644680 | 2963646657 | 319 |
| 620 | iso_pu_bacteria | 2965025482 | 2965027608 | 319 |
| 621 | iso_pu_bacteria | 2965040258 | 2965043317 | 319 |
| 622 | iso_pu_bacteria | 2965089291 | 2965093491 | 319 |
| 623 | iso_pu_bacteria | 2965119406 | 2965126589 | 319 |
| 624 | iso_pu_bacteria | 2967996073 | 2967999601 | 319 |
| 625 | iso_pu_bacteria | 2968003550 | 2968007959 | 319 |
| 626 | iso_pu_bacteria | 2968016561 | 2968020754 | 319 |
| 627 | iso_pu_bacteria | 2968083720 | 2968090550 | 319 |
| 628 | iso_pu_bacteria | 2968138860 | 2968146538 | 319 |
| 629 | iso_pu_bacteria | 2970469710 | 2970474051 | 319 |
| 630 | iso_pu_bacteria | 2970489779 | 2970490691 | 319 |
| 631 | iso_pu_bacteria | 2970503327 | 2970507985 | 319 |
| 632 | iso_pu_bacteria | 2970510686 | 2970515310 | 319 |
| 633 | iso_pu_bacteria | 2970524798 | 2970527371 | 319 |
| 634 | iso_pu_bacteria | 2970532167 | 2970534296 | 319 |
| 635 | iso_pu_bacteria | 2970540015 | 2970543926 | 319 |
| 636 | iso_pu_bacteria | 2970547951 | 2970552309 | 319 |
| 637 | iso_pu_bacteria | 2970593180 | 2970597253 | 319 |
| 638 | iso_pu_bacteria | 2970627176 | 2970632719 | 319 |
| 639 | iso_pu_bacteria | 2977821940 | 2977826433 | 319 |
| 640 | iso_pu_bacteria | 2977851361 | 2977855583 | 319 |
| 641 | iso_pu_bacteria | 2977872689 | 2977880125 | 319 |
| 642 | iso_pu_bacteria | 2977935797 | 2977940318 | 319 |
| 643 | iso_pu_bacteria | 2979764755 | 2979766351 | 319 |
| 644 | iso_pu_bacteria | 2979808191 | 2979813169 | 319 |
| 645 | iso_pu_bacteria | 2987645492 | 2987647975 | 319 |
| 646 | iso_pu_bacteria | 2987673487 | 2987675409 | 319 |
| 647 | iso_pu_bacteria | 2996348954 | 2996352629 | 319 |
| 648 | iso_pu_bacteria | 2996386984 | 2996390017 | 319 |
| 649 | iso_pu_bacteria | 3004195979 | 3004199814 | 319 |
| 650 | iso_pu_bacteria | 3004211236 | 3004218052 | 319 |
| 651 | iso_pu_bacteria | 3004218560 | 3004220901 | 319 |
| 652 | iso_pu_bacteria | 3004232784 | 3004235697 | 319 |
| 653 | iso_pu_bacteria | 3004248173 | 3004253825 | 319 |
| 654 | iso_pu_bacteria | 3004268573 | 3004273909 | 319 |
| 655 | iso_pu_bacteria | 3004275668 | 3004279311 | 319 |
| 656 | iso_pu_bacteria | 637000159 | 637075640 | 319 |
| 657 | iso_pu_bacteria | 649633066 | 649871786 | 319 |
| 658 | iso_pu_bacteria | 8004312739 | 8004321187 | 319 |
| 659 | iso_pu_bacteria | 8004361976 | 8004363741 | 319 |
| 660 | iso_pu_bacteria | 8004374579 | 8004378849 | 319 |
| 661 | iso_pu_bacteria | 8004395343 | 8004397991 | 319 |
| 662 | iso_pu_bacteria | 8004695233 | 8004700437 | 319 |
| 663 | iso_pu_bacteria | 8004727605 | 8004729761 | 319 |
| 664 | iso_pu_bacteria | 8055617313 | 8055619465 | 319 |
| 665 | 3300003762 | Ga0055542_1000761 | Ga0055542_10007618 | 320 |
| 666 | 3300003763 | Ga0055529_1001880 | Ga0055529_10018805 | 320 |
| 667 | 3300006038 | Ga0075365_10090389 | Ga0075365_100903891 | 320 |
| 668 | 3300006038 | Ga0075365_10289032 | Ga0075365_102890321 | 320 |
| 669 | 3300025254 | Ga0209148_1000080 | Ga0209148_1000080123 | 320 |
| 670 | 3300025272 | Ga0209455_1000171 | Ga0209455_100017132 | 320 |
| 671 | 3300025913 | Ga0207695_10051716 | Ga0207695_100517162 | 320 |
| 672 | 3300028379 | Ga0268266_10002242 | Ga0268266_100022425 | 320 |
| 673 | 3300035113 | Ga0373936_0004827 | Ga0373936_0004827_3617_4612 | 320 |
| 674 | 3300035118 | Ga0373954_0001191 | Ga0373954_0001191_788_1783 | 320 |
| 675 | 3300035120 | Ga0373957_0014910 | Ga0373957_0014910_950_1945 | 320 |
| 676 | 3300035171 | Ga0373946_0007686 | Ga0373946_0007686_2870_3865 | 320 |
| 677 | 3300035172 | Ga0373955_0000211 | Ga0373955_0000211_1210_2205 | 320 |
| 678 | 3300035410 | Ga0373924_0005832 | Ga0373924_0005832_2901_3896 | 320 |
| 679 | 3300035695 | Ga0373927_0011842 | Ga0373927_0011842_1169_2164 | 320 |
| 680 | 3300035724 | Ga0373933_0004328 | Ga0373933_0004328_5940_6935 | 320 |
| 681 | 3300036401 | Ga0373937_0000009 | Ga0373937_0000009_46639_47634 | 320 |
| 682 | 3300037068 | Ga0373925_0000194 | Ga0373925_0000194_64564_65559 | 320 |
| 683 | 3300039438 | Ga0436360_0436684 | Ga0436360_0436684_59_1039 | 320 |
| 684 | 3300039447 | Ga0436361_0472526 | Ga0436361_0472526_2318_3298 | 320 |
| 685 | 3300044712 | Ga0453684_0228680 | Ga0453684_0228680_309_1304 | 320 |
| 686 | 3300045051 | Ga0451576_0000220 | Ga0451576_0000220_17150_18145 | 320 |
| 687 | 3300046454 | Ga0495592_0000422 | Ga0495592_0000422_15420_16415 | 320 |
| 688 | 3300046463 | Ga0495653_0000032 | Ga0495653_0000032_15840_16835 | 320 |
| 689 | 3300046477 | Ga0495664_0000010 | Ga0495664_0000010_220877_221872 | 320 |
| 690 | 3300046507 | Ga0495606_0046520 | Ga0495606_0046520_343_1329 | 320 |
| 691 | 3300046511 | Ga0495608_0000008 | Ga0495608_0000008_46777_47772 | 320 |
| 692 | 3300046514 | Ga0495618_0000002 | Ga0495618_0000002_223150_224145 | 320 |
| 693 | 3300046516 | Ga0495628_0000009 | Ga0495628_0000009_220905_221900 | 320 |
| 694 | 3300046517 | Ga0495630_0002397 | Ga0495630_0002397_7141_8136 | 320 |
| 695 | 3300046529 | Ga0495652_0000011 | Ga0495652_0000011_46467_47462 | 320 |
| 696 | 3300046533 | Ga0495640_0000094 | Ga0495640_0000094_46467_47462 | 320 |
| 697 | 3300046536 | Ga0495587_0000086 | Ga0495587_0000086_24568_25563 | 320 |
| 698 | 3300046543 | Ga0495645_0000010 | Ga0495645_0000010_15840_16835 | 320 |
| 699 | 3300046559 | Ga0495667_0000005 | Ga0495667_0000005_220905_221900 | 320 |
| 700 | 3300046642 | Ga0495634_0000223 | Ga0495634_0000223_2109_3104 | 320 |
| 701 | 3300046663 | Ga0495635_0000008 | Ga0495635_0000008_46450_47445 | 320 |
| 702 | 3300046675 | Ga0495657_0000058 | Ga0495657_0000058_1203_2198 | 320 |
| 703 | 3300046678 | Ga0495599_0000007 | Ga0495599_0000007_46467_47462 | 320 |
| 704 | 3300046679 | Ga0495623_0000085 | Ga0495623_0000085_41977_42972 | 320 |
| 705 | 3300046680 | Ga0495646_0000021 | Ga0495646_0000021_46422_47417 | 320 |
| 706 | 3300046689 | Ga0495613_0020157 | Ga0495613_0020157_2050_3045 | 320 |
| 707 | 3300046690 | Ga0495624_0023846 | Ga0495624_0023846_2428_3423 | 320 |
| 708 | 3300046809 | Ga0495600_0000001 | Ga0495600_0000001_46467_47462 | 320 |
| 709 | 3300047317 | Ga0495604_0000012 | Ga0495604_0000012_220892_221887 | 320 |
| 710 | 3300047319 | Ga0495674_0000011 | Ga0495674_0000011_223178_224173 | 320 |
| 711 | 3300047322 | Ga0495680_0000245 | Ga0495680_0000245_24596_25591 | 320 |
| 712 | 3300047444 | Ga0495675_0002083 | Ga0495675_0002083_4897_5892 | 320 |
| 713 | 3300047471 | Ga0495684_0000084 | Ga0495684_0000084_48766_49761 | 320 |
| 714 | 3300047673 | Ga0495593_0000733 | Ga0495593_0000733_2065_3060 | 320 |
| 715 | 3300048088 | Ga0495602_0000073 | Ga0495602_0000073_46450_47445 | 320 |
| 716 | 3300048908 | Ga0496105_0010080 | Ga0496105_0010080_1070_2074 | 320 |
| 717 | 3300053077 | Ga0495601_0000009 | Ga0495601_0000009_46450_47445 | 320 |
| 718 | 3300053078 | Ga0495612_0000019 | Ga0495612_0000019_90383_91378 | 320 |
| 719 | 3300053084 | Ga0495595_0000015 | Ga0495595_0000015_27705_28700 | 320 |
| 720 | 3300053085 | Ga0495619_0000012 | Ga0495619_0000012_46450_47445 | 320 |
| 721 | 3300053119 | Ga0500595_018777 | Ga0500595_018777_815_1789 | 320 |
| 722 | 3300053156 | Ga0500622_0135580 | Ga0500622_0135580_138_1136 | 320 |
| 723 | iso_pu_bacteria | 2509276022 | 2509394898 | 320 |
| 724 | iso_pu_bacteria | 2643221734 | 2644737110 | 320 |
| 725 | iso_pu_bacteria | 2818991467 | 2819720012 | 320 |
| 726 | iso_pu_bacteria | 2869162929 | 2869163814 | 320 |
| 727 | iso_pu_bacteria | 2924762789 | 2924768133 | 320 |
| 728 | iso_pu_bacteria | 2937822353 | 2937827824 | 320 |
| 729 | iso_pu_bacteria | 2987666974 | 2987671445 | 320 |
| 730 | iso_pu_bacteria | 3004334049 | 3004335746 | 320 |
| 731 | 3300002459 | JGI24751J29686_10007661 | JGI24751J29686_100076613 | 321 |
| 732 | 3300005327 | Ga0070658_10040997 | Ga0070658_100409973 | 321 |
| 733 | 3300005328 | Ga0070676_10071503 | Ga0070676_100715033 | 321 |
| 734 | 3300005331 | Ga0070670_100079159 | Ga0070670_1000791593 | 321 |
| 735 | 3300005334 | Ga0068869_100010254 | Ga0068869_1000102543 | 321 |
| 736 | 3300005335 | Ga0070666_10210667 | Ga0070666_102106671 | 321 |
| 737 | 3300005336 | Ga0070680_100006080 | Ga0070680_1000060802 | 321 |
| 738 | 3300005336 | Ga0070680_100020901 | Ga0070680_1000209012 | 321 |
| 739 | 3300005337 | Ga0070682_100003001 | Ga0070682_1000030012 | 321 |
| 740 | 3300005338 | Ga0068868_100110568 | Ga0068868_1001105682 | 321 |
| 741 | 3300005340 | Ga0070689_100000614 | Ga0070689_10000061417 | 321 |
| 742 | 3300005341 | Ga0070691_10035309 | Ga0070691_100353093 | 321 |
| 743 | 3300005343 | Ga0070687_100099886 | Ga0070687_1000998862 | 321 |
| 744 | 3300005344 | Ga0070661_100054046 | Ga0070661_1000540464 | 321 |
| 745 | 3300005345 | Ga0070692_10006738 | Ga0070692_100067389 | 321 |
| 746 | 3300005354 | Ga0070675_100002866 | Ga0070675_10000286610 | 321 |
| 747 | 3300005355 | Ga0070671_100094543 | Ga0070671_1000945433 | 321 |
| 748 | 3300005365 | Ga0070688_100168955 | Ga0070688_1001689551 | 321 |
| 749 | 3300005366 | Ga0070659_100119241 | Ga0070659_1001192412 | 321 |
| 750 | 3300005440 | Ga0070705_100000320 | Ga0070705_10000032012 | 321 |
| 751 | 3300005441 | Ga0070700_100000571 | Ga0070700_10000057110 | 321 |
| 752 | 3300005455 | Ga0070663_100010835 | Ga0070663_1000108353 | 321 |
| 753 | 3300005456 | Ga0070678_100003166 | Ga0070678_1000031664 | 321 |
| 754 | 3300005459 | Ga0068867_100080280 | Ga0068867_1000802802 | 321 |
| 755 | 3300005466 | Ga0070685_10067945 | Ga0070685_100679453 | 321 |
| 756 | 3300005530 | Ga0070679_100103918 | Ga0070679_1001039184 | 321 |
| 757 | 3300005539 | Ga0068853_100160368 | Ga0068853_1001603683 | 321 |
| 758 | 3300005543 | Ga0070672_100049162 | Ga0070672_1000491623 | 321 |
| 759 | 3300005546 | Ga0070696_100005170 | Ga0070696_1000051705 | 321 |
| 760 | 3300005547 | Ga0070693_100060331 | Ga0070693_1000603312 | 321 |
| 761 | 3300005549 | Ga0070704_100008897 | Ga0070704_1000088973 | 321 |
| 762 | 3300005563 | Ga0068855_100629172 | Ga0068855_1006291721 | 321 |
| 763 | 3300005578 | Ga0068854_100069934 | Ga0068854_1000699342 | 321 |
| 764 | 3300005614 | Ga0068856_100386344 | Ga0068856_1003863442 | 321 |
| 765 | 3300005615 | Ga0070702_100000050 | Ga0070702_10000005012 | 321 |
| 766 | 3300005615 | Ga0070702_100003946 | Ga0070702_1000039464 | 321 |
| 767 | 3300005616 | Ga0068852_100016572 | Ga0068852_1000165722 | 321 |
| 768 | 3300005618 | Ga0068864_100038504 | Ga0068864_1000385048 | 321 |
| 769 | 3300005719 | Ga0068861_100148020 | Ga0068861_1001480202 | 321 |
| 770 | 3300005834 | Ga0068851_10006256 | Ga0068851_100062563 | 321 |
| 771 | 3300005840 | Ga0068870_10040967 | Ga0068870_100409673 | 321 |
| 772 | 3300005841 | Ga0068863_100040400 | Ga0068863_1000404004 | 321 |
| 773 | 3300005842 | Ga0068858_100031069 | Ga0068858_10003106910 | 321 |
| 774 | 3300005843 | Ga0068860_100088103 | Ga0068860_1000881032 | 321 |
| 775 | 3300006237 | Ga0097621_100113558 | Ga0097621_1001135584 | 321 |
| 776 | 3300006844 | Ga0075428_100159870 | Ga0075428_1001598703 | 321 |
| 777 | 3300006871 | Ga0075434_100001777 | Ga0075434_10000177710 | 321 |
| 778 | 3300007076 | Ga0075435_100008023 | Ga0075435_1000080234 | 321 |
| 779 | 3300009011 | Ga0105251_10065134 | Ga0105251_100651342 | 321 |
| 780 | 3300009093 | Ga0105240_10059935 | Ga0105240_100599352 | 321 |
| 781 | 3300009093 | Ga0105240_10259473 | Ga0105240_102594732 | 321 |
| 782 | 3300009094 | Ga0111539_10077044 | Ga0111539_100770444 | 321 |
| 783 | 3300009098 | Ga0105245_10007590 | Ga0105245_100075904 | 321 |
| 784 | 3300009101 | Ga0105247_10028530 | Ga0105247_100285305 | 321 |
| 785 | 3300009148 | Ga0105243_10001566 | Ga0105243_1000156615 | 321 |
| 786 | 3300009174 | Ga0105241_10033070 | Ga0105241_100330701 | 321 |
| 787 | 3300009174 | Ga0105241_10182951 | Ga0105241_101829512 | 321 |
| 788 | 3300009177 | Ga0105248_10047992 | Ga0105248_100479923 | 321 |
| 789 | 3300009545 | Ga0105237_10132128 | Ga0105237_101321281 | 321 |
| 790 | 3300009545 | Ga0105237_10199693 | Ga0105237_101996932 | 321 |
| 791 | 3300009551 | Ga0105238_10013423 | Ga0105238_100134234 | 321 |
| 792 | 3300009551 | Ga0105238_10088560 | Ga0105238_100885602 | 321 |
| 793 | 3300009553 | Ga0105249_10001995 | Ga0105249_100019958 | 321 |
| 794 | 3300009553 | Ga0105249_10548771 | Ga0105249_105487711 | 321 |
| 795 | 3300010375 | Ga0105239_10260239 | Ga0105239_102602391 | 321 |
| 796 | 3300011119 | Ga0105246_10003706 | Ga0105246_1000370610 | 321 |
| 797 | 3300013102 | Ga0157371_10274742 | Ga0157371_102747421 | 321 |
| 798 | 3300013104 | Ga0157370_10026364 | Ga0157370_100263646 | 321 |
| 799 | 3300013104 | Ga0157370_10216944 | Ga0157370_102169441 | 321 |
| 800 | 3300013296 | Ga0157374_10006468 | Ga0157374_100064684 | 321 |
| 801 | 3300013307 | Ga0157372_10171317 | Ga0157372_101713172 | 321 |
| 802 | 3300013308 | Ga0157375_10011994 | Ga0157375_100119948 | 321 |
| 803 | 3300014745 | Ga0157377_10008042 | Ga0157377_100080424 | 321 |
| 804 | 3300014969 | Ga0157376_10381377 | Ga0157376_103813771 | 321 |
| 805 | 3300020070 | Ga0206356_10632670 | Ga0206356_106326701 | 321 |
| 806 | 3300020081 | Ga0206354_10039477 | Ga0206354_100394771 | 321 |
| 807 | 3300020082 | Ga0206353_10339595 | Ga0206353_103395952 | 321 |
| 808 | 3300020082 | Ga0206353_10593657 | Ga0206353_105936571 | 321 |
| 809 | 3300021384 | Ga0213876_10000260 | Ga0213876_1000026030 | 321 |
| 810 | 3300025321 | Ga0207656_10014795 | Ga0207656_100147953 | 321 |
| 811 | 3300025900 | Ga0207710_10051552 | Ga0207710_100515521 | 321 |
| 812 | 3300025901 | Ga0207688_10000213 | Ga0207688_1000021324 | 321 |
| 813 | 3300025904 | Ga0207647_10086211 | Ga0207647_100862111 | 321 |
| 814 | 3300025908 | Ga0207643_10000218 | Ga0207643_1000021817 | 321 |
| 815 | 3300025909 | Ga0207705_10021988 | Ga0207705_100219883 | 321 |
| 816 | 3300025912 | Ga0207707_10069552 | Ga0207707_100695524 | 321 |
| 817 | 3300025913 | Ga0207695_10067364 | Ga0207695_100673642 | 321 |
| 818 | 3300025916 | Ga0207663_10072744 | Ga0207663_100727442 | 321 |
| 819 | 3300025917 | Ga0207660_10194260 | Ga0207660_101942602 | 321 |
| 820 | 3300025918 | Ga0207662_10140258 | Ga0207662_101402582 | 321 |
| 821 | 3300025919 | Ga0207657_10034378 | Ga0207657_100343784 | 321 |
| 822 | 3300025920 | Ga0207649_10007165 | Ga0207649_1000716510 | 321 |
| 823 | 3300025921 | Ga0207652_10029701 | Ga0207652_100297017 | 321 |
| 824 | 3300025925 | Ga0207650_10096013 | Ga0207650_100960133 | 321 |
| 825 | 3300025926 | Ga0207659_10083561 | Ga0207659_100835614 | 321 |
| 826 | 3300025927 | Ga0207687_10068045 | Ga0207687_100680451 | 321 |
| 827 | 3300025931 | Ga0207644_10020710 | Ga0207644_100207103 | 321 |
| 828 | 3300025932 | Ga0207690_10296031 | Ga0207690_102960311 | 321 |
| 829 | 3300025940 | Ga0207691_10035136 | Ga0207691_100351363 | 321 |
| 830 | 3300025941 | Ga0207711_10116460 | Ga0207711_101164602 | 321 |
| 831 | 3300025942 | Ga0207689_10000762 | Ga0207689_1000076210 | 321 |
| 832 | 3300025945 | Ga0207679_10005378 | Ga0207679_100053781 | 321 |
| 833 | 3300025960 | Ga0207651_10341819 | Ga0207651_103418191 | 321 |
| 834 | 3300025981 | Ga0207640_10225598 | Ga0207640_102255982 | 321 |
| 835 | 3300025986 | Ga0207658_10217649 | Ga0207658_102176492 | 321 |
| 836 | 3300026023 | Ga0207677_10004998 | Ga0207677_100049983 | 321 |
| 837 | 3300026035 | Ga0207703_10112645 | Ga0207703_101126452 | 321 |
| 838 | 3300026067 | Ga0207678_10000245 | Ga0207678_1000024510 | 321 |
| 839 | 3300026078 | Ga0207702_10006836 | Ga0207702_100068365 | 321 |
| 840 | 3300026088 | Ga0207641_10008353 | Ga0207641_100083539 | 321 |
| 841 | 3300026118 | Ga0207675_100206359 | Ga0207675_1002063592 | 321 |
| 842 | 3300026121 | Ga0207683_10000454 | Ga0207683_1000045436 | 321 |
| 843 | 3300027907 | Ga0207428_10007115 | Ga0207428_100071155 | 321 |
| 844 | 3300028379 | Ga0268266_10116611 | Ga0268266_101166111 | 321 |
| 845 | 3300028381 | Ga0268264_10054830 | Ga0268264_100548306 | 321 |
| 846 | 3300035113 | Ga0373936_0002485 | Ga0373936_0002485_181_1173 | 321 |
| 847 | 3300035691 | Ga0373931_0033418 | Ga0373931_0033418_1461_2459 | 321 |
| 848 | 3300035691 | Ga0373931_0084866 | Ga0373931_0084866_717_1715 | 321 |
| 849 | 3300037312 | Ga0395899_0033298 | Ga0395899_0033298_30_1007 | 321 |
| 850 | 3300038443 | Ga0395901_0316458 | Ga0395901_0316458_634_1599 | 321 |
| 851 | 3300039437 | Ga0436365_0836133 | Ga0436365_0836133_26241_27212 | 321 |
| 852 | 3300042005 | Ga0439448_0029587 | Ga0439448_0029587_718_1683 | 321 |
| 853 | 3300042008 | Ga0439450_021898 | Ga0439450_021898_350_1315 | 321 |
| 854 | 3300042438 | Ga0439459_0027578 | Ga0439459_0027578_39_1004 | 321 |
| 855 | 3300045049 | Ga0466959_0082126 | Ga0466959_0082126_1290_2282 | 321 |
| 856 | 3300048903 | Ga0496100_0061223 | Ga0496100_0061223_1074_2039 | 321 |
| 857 | 3300048907 | Ga0496104_0050423 | Ga0496104_0050423_995_1960 | 321 |
| 858 | 3300048909 | Ga0496106_0003648 | Ga0496106_0003648_819_1784 | 321 |
| 859 | 3300048914 | Ga0496111_0004377 | Ga0496111_0004377_3610_4575 | 321 |
| 860 | 3300048916 | Ga0496113_0127165 | Ga0496113_0127165_36_1001 | 321 |
| 861 | 3300048917 | Ga0496114_0271651 | Ga0496114_0271651_312_1277 | 321 |
| 862 | 3300049582 | Ga0501048_0224232 | Ga0501048_0224232_82_1101 | 321 |
| 863 | 3300050511 | nmdc:mga08y16_433948_c1 | nmdc:mga08y16_433948_c1_141_1106 | 321 |
| 864 | 3300050512 | nmdc:mga0n895_62149_c1 | nmdc:mga0n895_62149_c1_350_1315 | 321 |
| 865 | 3300050513 | nmdc:mga0rr50_3559_c1 | nmdc:mga0rr50_3559_c1_4018_4983 | 321 |
| 866 | 3300050514 | nmdc:mga08x19_289710_c1 | nmdc:mga08x19_289710_c1_64_1029 | 321 |
| 867 | 3300053163 | Ga0500639_093950 | Ga0500639_093950_260_1252 | 321 |
| 868 | 3300060353 | Ga0501082_0165803 | Ga0501082_0165803_640_1638 | 321 |
| 869 | iso_pu_bacteria | 2507262055 | 2507508308 | 321 |
| 870 | iso_pu_bacteria | 2595698237 | 2596374991 | 321 |
| 871 | iso_pu_bacteria | 2643221547 | 2643758846 | 321 |
| 872 | iso_pu_bacteria | 2643221736 | 2644746177 | 321 |
| 873 | iso_pu_bacteria | 2841760612 | 2841766125 | 321 |
| 874 | iso_pu_bacteria | 2841911363 | 2841911480 | 321 |
| 875 | iso_pu_bacteria | 2841917233 | 2841917943 | 321 |
| 876 | iso_pu_bacteria | 2844104063 | 2844105891 | 321 |
| 877 | iso_pu_bacteria | 2848992105 | 2848998287 | 321 |
| 878 | iso_pu_bacteria | 2851182111 | 2851186390 | 321 |
| 879 | iso_pu_bacteria | 2851246043 | 2851246247 | 321 |
| 880 | iso_pu_bacteria | 2882456835 | 2882460273 | 321 |
| 881 | iso_pu_bacteria | 2889306138 | 2889311892 | 321 |
| 882 | iso_pu_bacteria | 2902330777 | 2902335036 | 321 |
| 883 | iso_pu_bacteria | 2902405164 | 2902411380 | 321 |
| 884 | iso_pu_bacteria | 2928125067 | 2928129914 | 321 |
| 885 | iso_pu_bacteria | 2932401849 | 2932402074 | 321 |
| 886 | iso_pu_bacteria | 2935769743 | 2935771781 | 321 |
| 887 | iso_pu_bacteria | 2935777560 | 2935778780 | 321 |
| 888 | iso_pu_bacteria | 8016603502 | 8016610231 | 321 |
| 889 | iso_pu_bacteria | 8016613128 | 8016614701 | 321 |
| 890 | iso_pu_bacteria | 8019538911 | 8019545142 | 321 |
| 891 | iso_pu_bacteria | 8019547302 | 8019553381 | 321 |
| 892 | iso_pu_bacteria | 8057529695 | 8057531527 | 321 |
| 893 | 3300001979 | JGI24740J21852_10050296 | JGI24740J21852_100502962 | 322 |
| 894 | 3300002705 | JGI25156J39149_1004301 | JGI25156J39149_10043013 | 322 |
| 895 | 3300002741 | JGI25157J39369_1002383 | JGI25157J39369_10023834 | 322 |
| 896 | 3300003214 | JGI25165J46597_1000042 | JGI25165J46597_1000042156 | 322 |
| 897 | 3300005336 | Ga0070680_100020436 | Ga0070680_1000204364 | 322 |
| 898 | 3300005341 | Ga0070691_10073615 | Ga0070691_100736152 | 322 |
| 899 | 3300005347 | Ga0070668_100099546 | Ga0070668_1000995463 | 322 |
| 900 | 3300005347 | Ga0070668_100190190 | Ga0070668_1001901902 | 322 |
| 901 | 3300005347 | Ga0070668_100329184 | Ga0070668_1003291842 | 322 |
| 902 | 3300005365 | Ga0070688_100104138 | Ga0070688_1001041381 | 322 |
| 903 | 3300005440 | Ga0070705_100000101 | Ga0070705_10000010123 | 322 |
| 904 | 3300005441 | Ga0070700_100134966 | Ga0070700_1001349662 | 322 |
| 905 | 3300005444 | Ga0070694_100000321 | Ga0070694_10000032124 | 322 |
| 906 | 3300005444 | Ga0070694_100081356 | Ga0070694_1000813562 | 322 |
| 907 | 3300005455 | Ga0070663_100243504 | Ga0070663_1002435042 | 322 |
| 908 | 3300005458 | Ga0070681_10016232 | Ga0070681_100162323 | 322 |
| 909 | 3300005468 | Ga0070707_100234729 | Ga0070707_1002347292 | 322 |
| 910 | 3300005518 | Ga0070699_100000281 | Ga0070699_10000028129 | 322 |
| 911 | 3300005530 | Ga0070679_100215188 | Ga0070679_1002151882 | 322 |
| 912 | 3300005536 | Ga0070697_100003354 | Ga0070697_1000033543 | 322 |
| 913 | 3300005539 | Ga0068853_100014287 | Ga0068853_1000142877 | 322 |
| 914 | 3300005545 | Ga0070695_100000120 | Ga0070695_10000012014 | 322 |
| 915 | 3300005546 | Ga0070696_100000478 | Ga0070696_10000047818 | 322 |
| 916 | 3300005547 | Ga0070693_100064052 | Ga0070693_1000640522 | 322 |
| 917 | 3300005548 | Ga0070665_100491879 | Ga0070665_1004918792 | 322 |
| 918 | 3300005549 | Ga0070704_100002732 | Ga0070704_1000027328 | 322 |
| 919 | 3300005577 | Ga0068857_100006107 | Ga0068857_1000061073 | 322 |
| 920 | 3300005577 | Ga0068857_100092451 | Ga0068857_1000924513 | 322 |
| 921 | 3300005617 | Ga0068859_100006827 | Ga0068859_1000068275 | 322 |
| 922 | 3300005719 | Ga0068861_100112174 | Ga0068861_1001121742 | 322 |
| 923 | 3300005842 | Ga0068858_100105377 | Ga0068858_1001053773 | 322 |
| 924 | 3300005843 | Ga0068860_100000900 | Ga0068860_10000090012 | 322 |
| 925 | 3300005844 | Ga0068862_100001691 | Ga0068862_10000169119 | 322 |
| 926 | 3300005844 | Ga0068862_100062409 | Ga0068862_1000624093 | 322 |
| 927 | 3300005937 | Ga0081455_10000160 | Ga0081455_1000016032 | 322 |
| 928 | 3300005983 | Ga0081540_1000032 | Ga0081540_100003288 | 322 |
| 929 | 3300006038 | Ga0075365_10007299 | Ga0075365_100072992 | 322 |
| 930 | 3300006038 | Ga0075365_10027063 | Ga0075365_100270632 | 322 |
| 931 | 3300006042 | Ga0075368_10068508 | Ga0075368_100685083 | 322 |
| 932 | 3300006051 | Ga0075364_10014940 | Ga0075364_100149404 | 322 |
| 933 | 3300006051 | Ga0075364_10035025 | Ga0075364_100350254 | 322 |
| 934 | 3300006178 | Ga0075367_10022341 | Ga0075367_100223414 | 322 |
| 935 | 3300006186 | Ga0075369_10014037 | Ga0075369_100140373 | 322 |
| 936 | 3300006844 | Ga0075428_100020360 | Ga0075428_1000203607 | 322 |
| 937 | 3300006844 | Ga0075428_100227622 | Ga0075428_1002276222 | 322 |
| 938 | 3300006844 | Ga0075428_100259450 | Ga0075428_1002594503 | 322 |
| 939 | 3300006846 | Ga0075430_100001639 | Ga0075430_10000163916 | 322 |
| 940 | 3300006846 | Ga0075430_100087775 | Ga0075430_1000877751 | 322 |
| 941 | 3300006846 | Ga0075430_100312493 | Ga0075430_1003124932 | 322 |
| 942 | 3300006847 | Ga0075431_100003545 | Ga0075431_10000354514 | 322 |
| 943 | 3300006847 | Ga0075431_100005435 | Ga0075431_1000054352 | 322 |
| 944 | 3300006847 | Ga0075431_100064679 | Ga0075431_1000646792 | 322 |
| 945 | 3300006847 | Ga0075431_100084861 | Ga0075431_1000848612 | 322 |
| 946 | 3300006847 | Ga0075431_100092037 | Ga0075431_1000920372 | 322 |
| 947 | 3300006847 | Ga0075431_100146448 | Ga0075431_1001464482 | 322 |
| 948 | 3300006871 | Ga0075434_100000371 | Ga0075434_10000037120 | 322 |
| 949 | 3300006871 | Ga0075434_100023631 | Ga0075434_1000236314 | 322 |
| 950 | 3300006880 | Ga0075429_100053625 | Ga0075429_1000536253 | 322 |
| 951 | 3300006914 | Ga0075436_100168696 | Ga0075436_1001686962 | 322 |
| 952 | 3300006931 | Ga0097620_100006827 | Ga0097620_1000068275 | 322 |
| 953 | 3300007076 | Ga0075435_100130816 | Ga0075435_1001308161 | 322 |
| 954 | 3300009092 | Ga0105250_10058295 | Ga0105250_100582952 | 322 |
| 955 | 3300009093 | Ga0105240_10016012 | Ga0105240_100160128 | 322 |
| 956 | 3300009093 | Ga0105240_10211647 | Ga0105240_102116473 | 322 |
| 957 | 3300009094 | Ga0111539_10001777 | Ga0111539_1000177715 | 322 |
| 958 | 3300009094 | Ga0111539_10081452 | Ga0111539_100814523 | 322 |
| 959 | 3300009147 | Ga0114129_10028829 | Ga0114129_100288296 | 322 |
| 960 | 3300009147 | Ga0114129_10039454 | Ga0114129_100394546 | 322 |
| 961 | 3300009147 | Ga0114129_10295577 | Ga0114129_102955773 | 322 |
| 962 | 3300009147 | Ga0114129_10387854 | Ga0114129_103878541 | 322 |
| 963 | 3300009148 | Ga0105243_10058123 | Ga0105243_100581232 | 322 |
| 964 | 3300009551 | Ga0105238_10012662 | Ga0105238_100126625 | 322 |
| 965 | 3300009551 | Ga0105238_10309527 | Ga0105238_103095272 | 322 |
| 966 | 3300009553 | Ga0105249_10008449 | Ga0105249_100084496 | 322 |
| 967 | 3300010375 | Ga0105239_10157282 | Ga0105239_101572822 | 322 |
| 968 | 3300010375 | Ga0105239_10206328 | Ga0105239_102063283 | 322 |
| 969 | 3300011119 | Ga0105246_10024155 | Ga0105246_100241553 | 322 |
| 970 | 3300013105 | Ga0157369_10117120 | Ga0157369_101171202 | 322 |
| 971 | 3300013308 | Ga0157375_10125566 | Ga0157375_101255664 | 322 |
| 972 | 3300014497 | Ga0182008_10042480 | Ga0182008_100424802 | 322 |
| 973 | 3300015261 | Ga0182006_1014659 | Ga0182006_10146593 | 322 |
| 974 | 3300025250 | Ga0209026_1000029 | Ga0209026_1000029180 | 322 |
| 975 | 3300025256 | Ga0209759_1000040 | Ga0209759_100004034 | 322 |
| 976 | 3300025261 | Ga0209233_1000028 | Ga0209233_1000028448 | 322 |
| 977 | 3300025297 | Ga0209758_1020840 | Ga0209758_10208403 | 322 |
| 978 | 3300025904 | Ga0207647_10015916 | Ga0207647_100159163 | 322 |
| 979 | 3300025912 | Ga0207707_10065174 | Ga0207707_100651743 | 322 |
| 980 | 3300025913 | Ga0207695_10123834 | Ga0207695_101238343 | 322 |
| 981 | 3300025913 | Ga0207695_10428145 | Ga0207695_104281451 | 322 |
| 982 | 3300025914 | Ga0207671_10017102 | Ga0207671_100171023 | 322 |
| 983 | 3300025917 | Ga0207660_10001765 | Ga0207660_100017656 | 322 |
| 984 | 3300025921 | Ga0207652_10196331 | Ga0207652_101963312 | 322 |
| 985 | 3300025922 | Ga0207646_10245445 | Ga0207646_102454451 | 322 |
| 986 | 3300025923 | Ga0207681_10144849 | Ga0207681_101448491 | 322 |
| 987 | 3300025936 | Ga0207670_10279153 | Ga0207670_102791532 | 322 |
| 988 | 3300025961 | Ga0207712_10080583 | Ga0207712_100805832 | 322 |
| 989 | 3300025972 | Ga0207668_10059474 | Ga0207668_100594743 | 322 |
| 990 | 3300026041 | Ga0207639_10076759 | Ga0207639_100767592 | 322 |
| 991 | 3300026067 | Ga0207678_10133405 | Ga0207678_101334052 | 322 |
| 992 | 3300026067 | Ga0207678_10338031 | Ga0207678_103380311 | 322 |
| 993 | 3300026075 | Ga0207708_10177349 | Ga0207708_101773492 | 322 |
| 994 | 3300026095 | Ga0207676_10036284 | Ga0207676_100362843 | 322 |
| 995 | 3300026116 | Ga0207674_10001070 | Ga0207674_1000107023 | 322 |
| 996 | 3300026116 | Ga0207674_10022820 | Ga0207674_100228205 | 322 |
| 997 | 3300026118 | Ga0207675_100062369 | Ga0207675_1000623692 | 322 |
| 998 | 3300026118 | Ga0207675_100373408 | Ga0207675_1003734081 | 322 |
| 999 | 3300027866 | Ga0209813_10005127 | Ga0209813_100051273 | 322 |
| 1000 | 3300027866 | Ga0209813_10056536 | Ga0209813_100565362 | 322 |
| 1001 | 3300027907 | Ga0207428_10025045 | Ga0207428_100250456 | 322 |
| 1002 | 3300027907 | Ga0207428_10111880 | Ga0207428_101118801 | 322 |
| 1003 | 3300028380 | Ga0268265_10010310 | Ga0268265_100103108 | 322 |
| 1004 | 3300028380 | Ga0268265_10173588 | Ga0268265_101735882 | 322 |
| 1005 | 3300028381 | Ga0268264_10002112 | Ga0268264_100021126 | 322 |
| 1006 | 3300035084 | Ga0373928_0024966 | Ga0373928_0024966_33_1007 | 322 |
| 1007 | 3300035091 | Ga0373951_0005963 | Ga0373951_0005963_463_1437 | 322 |
| 1008 | 3300035092 | Ga0373952_0006162 | Ga0373952_0006162_439_1413 | 322 |
| 1009 | 3300035112 | Ga0373932_0013433 | Ga0373932_0013433_389_1363 | 322 |
| 1010 | 3300035207 | Ga0373942_0004211 | Ga0373942_0004211_1830_2804 | 322 |
| 1011 | 3300035207 | Ga0373942_0048976 | Ga0373942_0048976_153_1127 | 322 |
| 1012 | 3300035241 | Ga0373961_0002900 | Ga0373961_0002900_3174_4148 | 322 |
| 1013 | 3300035242 | Ga0373962_0005517 | Ga0373962_0005517_320_1294 | 322 |
| 1014 | 3300035242 | Ga0373962_0015800 | Ga0373962_0015800_937_1911 | 322 |
| 1015 | 3300035691 | Ga0373931_0000263 | Ga0373931_0000263_12355_13329 | 322 |
| 1016 | 3300035691 | Ga0373931_0005290 | Ga0373931_0005290_4133_5107 | 322 |
| 1017 | 3300035695 | Ga0373927_0000307 | Ga0373927_0000307_8362_9339 | 322 |
| 1018 | 3300037068 | Ga0373925_0003316 | Ga0373925_0003316_6057_7034 | 322 |
| 1019 | 3300037471 | Ga0395905_0072572 | Ga0395905_0072572_541_1515 | 322 |
| 1020 | 3300038443 | Ga0395901_0056175 | Ga0395901_0056175_1049_2023 | 322 |
| 1021 | 3300038443 | Ga0395901_0074592 | Ga0395901_0074592_1112_2086 | 322 |
| 1022 | 3300045976 | Ga0466967_0250502 | Ga0466967_0250502_436_1410 | 322 |
| 1023 | 3300046462 | Ga0495651_0214779 | Ga0495651_0214779_192_1217 | 322 |
| 1024 | 3300046499 | Ga0495594_0142096 | Ga0495594_0142096_239_1213 | 322 |
| 1025 | 3300046616 | Ga0495668_0019056 | Ga0495668_0019056_1442_2416 | 322 |
| 1026 | 3300046664 | Ga0495659_0049900 | Ga0495659_0049900_355_1332 | 322 |
| 1027 | 3300046809 | Ga0495600_0121927 | Ga0495600_0121927_14_1039 | 322 |
| 1028 | 3300047319 | Ga0495674_0342084 | Ga0495674_0342084_162_1136 | 322 |
| 1029 | 3300048903 | Ga0496100_0053486 | Ga0496100_0053486_1618_2592 | 322 |
| 1030 | 3300048904 | Ga0496101_0255239 | Ga0496101_0255239_299_1273 | 322 |
| 1031 | 3300048905 | Ga0496102_0000742 | Ga0496102_0000742_5719_6693 | 322 |
| 1032 | 3300048906 | Ga0496103_0043886 | Ga0496103_0043886_171_1145 | 322 |
| 1033 | 3300048907 | Ga0496104_0000530 | Ga0496104_0000530_14941_15915 | 322 |
| 1034 | 3300048907 | Ga0496104_0002241 | Ga0496104_0002241_15608_16582 | 322 |
| 1035 | 3300048908 | Ga0496105_0007602 | Ga0496105_0007602_221_1195 | 322 |
| 1036 | 3300048909 | Ga0496106_0001604 | Ga0496106_0001604_7512_8486 | 322 |
| 1037 | 3300048910 | Ga0496107_0005678 | Ga0496107_0005678_5649_6623 | 322 |
| 1038 | 3300048911 | Ga0496108_0020092 | Ga0496108_0020092_3523_4497 | 322 |
| 1039 | 3300048911 | Ga0496108_0099532 | Ga0496108_0099532_1167_2141 | 322 |
| 1040 | 3300048912 | Ga0496109_0109831 | Ga0496109_0109831_912_1886 | 322 |
| 1041 | 3300048912 | Ga0496109_0125347 | Ga0496109_0125347_63_1037 | 322 |
| 1042 | 3300048913 | Ga0496110_0001191 | Ga0496110_0001191_582_1556 | 322 |
| 1043 | 3300048914 | Ga0496111_0005434 | Ga0496111_0005434_881_1855 | 322 |
| 1044 | 3300048915 | Ga0496112_0167656 | Ga0496112_0167656_438_1412 | 322 |
| 1045 | 3300048915 | Ga0496112_0254516 | Ga0496112_0254516_178_1152 | 322 |
| 1046 | 3300048916 | Ga0496113_0096795 | Ga0496113_0096795_935_1909 | 322 |
| 1047 | 3300048916 | Ga0496113_0124169 | Ga0496113_0124169_168_1142 | 322 |
| 1048 | 3300048918 | Ga0496115_0031287 | Ga0496115_0031287_149_1123 | 322 |
| 1049 | 3300048923 | Ga0496120_0001370 | Ga0496120_0001370_21574_22548 | 322 |
| 1050 | 3300048924 | Ga0496121_0106282 | Ga0496121_0106282_599_1573 | 322 |
| 1051 | 3300048929 | Ga0496126_0038419 | Ga0496126_0038419_2282_3256 | 322 |
| 1052 | 3300049570 | Ga0501033_0252776 | Ga0501033_0252776_203_1171 | 322 |
| 1053 | 3300049573 | Ga0501037_0241800 | Ga0501037_0241800_71_1039 | 322 |
| 1054 | 3300049575 | Ga0501039_0094286 | Ga0501039_0094286_1061_2047 | 322 |
| 1055 | 3300049582 | Ga0501048_0245865 | Ga0501048_0245865_50_1024 | 322 |
| 1056 | 3300049588 | Ga0501072_0070380 | Ga0501072_0070380_107_1081 | 322 |
| 1057 | 3300049589 | Ga0501073_0097070 | Ga0501073_0097070_227_1201 | 322 |
| 1058 | 3300049589 | Ga0501073_0177116 | Ga0501073_0177116_207_1175 | 322 |
| 1059 | 3300049591 | Ga0501075_0149379 | Ga0501075_0149379_772_1758 | 322 |
| 1060 | 3300049592 | Ga0501076_0205327 | Ga0501076_0205327_108_1094 | 322 |
| 1061 | 3300049592 | Ga0501076_0234740 | Ga0501076_0234740_318_1292 | 322 |
| 1062 | 3300049593 | Ga0501077_0020579 | Ga0501077_0020579_1407_2393 | 322 |
| 1063 | 3300049593 | Ga0501077_0041605 | Ga0501077_0041605_1923_2897 | 322 |
| 1064 | 3300049741 | Ga0501079_0031480 | Ga0501079_0031480_705_1691 | 322 |
| 1065 | 3300049741 | Ga0501079_0044969 | Ga0501079_0044969_1561_2535 | 322 |
| 1066 | 3300049741 | Ga0501079_0053474 | Ga0501079_0053474_1217_2191 | 322 |
| 1067 | 3300049742 | Ga0501080_0185972 | Ga0501080_0185972_30_1040 | 322 |
| 1068 | 3300049742 | Ga0501080_0369493 | Ga0501080_0369493_139_1107 | 322 |
| 1069 | 3300049743 | Ga0501081_0011150 | Ga0501081_0011150_3951_4925 | 322 |
| 1070 | 3300049743 | Ga0501081_0019570 | Ga0501081_0019570_805_1791 | 322 |
| 1071 | 3300049743 | Ga0501081_0126740 | Ga0501081_0126740_56_1030 | 322 |
| 1072 | 3300049744 | Ga0501083_0139768 | Ga0501083_0139768_383_1351 | 322 |
| 1073 | 3300049822 | Ga0501035_0191598 | Ga0501035_0191598_452_1426 | 322 |
| 1074 | 3300049823 | Ga0501044_0357737 | Ga0501044_0357737_228_1196 | 322 |
| 1075 | 3300050494 | nmdc:mga06z11_10620_c1 | nmdc:mga06z11_10620_c1_447_1421 | 322 |
| 1076 | 3300050494 | nmdc:mga06z11_3201_c1 | nmdc:mga06z11_3201_c1_1857_2831 | 322 |
| 1077 | 3300050495 | nmdc:mga04h51_43502_c1 | nmdc:mga04h51_43502_c1_185_1159 | 322 |
| 1078 | 3300050495 | nmdc:mga04h51_788_c1 | nmdc:mga04h51_788_c1_532_1506 | 322 |
| 1079 | 3300050507 | nmdc:mga05p37_38333_c1 | nmdc:mga05p37_38333_c1_2293_3267 | 322 |
| 1080 | 3300050507 | nmdc:mga05p37_39554_c1 | nmdc:mga05p37_39554_c1_4680_5654 | 322 |
| 1081 | 3300050508 | nmdc:mga09592_35342_c1 | nmdc:mga09592_35342_c1_2724_3698 | 322 |
| 1082 | 3300050508 | nmdc:mga09592_37456_c1 | nmdc:mga09592_37456_c1_2919_3893 | 322 |
| 1083 | 3300050508 | nmdc:mga09592_452739_c1 | nmdc:mga09592_452739_c1_82_1056 | 322 |
| 1084 | 3300050509 | nmdc:mga0qj67_14879_c1 | nmdc:mga0qj67_14879_c1_2551_3525 | 322 |
| 1085 | 3300050510 | nmdc:mga06r32_183464_c1 | nmdc:mga06r32_183464_c1_56_1030 | 322 |
| 1086 | 3300050510 | nmdc:mga06r32_83027_c1 | nmdc:mga06r32_83027_c1_1757_2731 | 322 |
| 1087 | 3300050511 | nmdc:mga08y16_386179_c1 | nmdc:mga08y16_386179_c1_63_1037 | 322 |
| 1088 | 3300050511 | nmdc:mga08y16_459510_c1 | nmdc:mga08y16_459510_c1_147_1157 | 322 |
| 1089 | 3300050512 | nmdc:mga0n895_242670_c1 | nmdc:mga0n895_242670_c1_756_1730 | 322 |
| 1090 | 3300050512 | nmdc:mga0n895_5394_c1 | nmdc:mga0n895_5394_c1_5578_6552 | 322 |
| 1091 | 3300050512 | nmdc:mga0n895_65341_c1 | nmdc:mga0n895_65341_c1_2050_3024 | 322 |
| 1092 | 3300050513 | nmdc:mga0rr50_118925_c1 | nmdc:mga0rr50_118925_c1_69_1043 | 322 |
| 1093 | 3300050515 | nmdc:mga0a205_269868_c1 | nmdc:mga0a205_269868_c1_82_1056 | 322 |
| 1094 | 3300050515 | nmdc:mga0a205_292104_c1 | nmdc:mga0a205_292104_c1_180_1154 | 322 |
| 1095 | 3300053119 | Ga0500595_036703 | Ga0500595_036703_315_1289 | 322 |
| 1096 | 3300053151 | Ga0500604_0013376 | Ga0500604_0013376_285_1259 | 322 |
| 1097 | 3300053155 | Ga0500620_017284 | Ga0500620_017284_526_1500 | 322 |
| 1098 | 3300053161 | Ga0500634_0012475 | Ga0500634_0012475_634_1653 | 322 |
| 1099 | 3300054114 | Ga0501084_0018707 | Ga0501084_0018707_4758_5756 | 322 |
| 1100 | 3300054114 | Ga0501084_0039088 | Ga0501084_0039088_2216_3202 | 322 |
| 1101 | 3300054114 | Ga0501084_0046623 | Ga0501084_0046623_13_987 | 322 |
| 1102 | 3300060353 | Ga0501082_0038785 | Ga0501082_0038785_1707_2681 | 322 |
| 1103 | 3300060353 | Ga0501082_0253222 | Ga0501082_0253222_413_1387 | 322 |
| 1104 | 3300060353 | Ga0501082_0359360 | Ga0501082_0359360_13_987 | 322 |
| 1105 | 3300061734 | Ga0530510_0081230 | Ga0530510_0081230_128_1102 | 322 |
| 1106 | 3300061734 | Ga0530510_0176347 | Ga0530510_0176347_108_1094 | 322 |
| 1107 | 3300061734 | Ga0530510_0315916 | Ga0530510_0315916_123_1097 | 322 |
| 1108 | iso_pu_bacteria | 2511231052 | 2511497567 | 322 |
| 1109 | iso_pu_bacteria | 2512047086 | 2512530009 | 322 |
| 1110 | iso_pu_bacteria | 2512875026 | 2512969748 | 322 |
| 1111 | iso_pu_bacteria | 2513237086 | 2513581830 | 322 |
| 1112 | iso_pu_bacteria | 2513237089 | 2513603096 | 322 |
| 1113 | iso_pu_bacteria | 2513237091 | 2513619286 | 322 |
| 1114 | iso_pu_bacteria | 2513237140 | 2513887190 | 322 |
| 1115 | iso_pu_bacteria | 2513237159 | 2513999346 | 322 |
| 1116 | iso_pu_bacteria | 2513237160 | 2514004533 | 322 |
| 1117 | iso_pu_bacteria | 2515154107 | 2515609856 | 322 |
| 1118 | iso_pu_bacteria | 2516143018 | 2516207744 | 322 |
| 1119 | iso_pu_bacteria | 2517487022 | 2517565373 | 322 |
| 1120 | iso_pu_bacteria | 2524023207 | 2524451439 | 322 |
| 1121 | iso_pu_bacteria | 2551306084 | 2551677229 | 322 |
| 1122 | iso_pu_bacteria | 2551306085 | 2551688381 | 322 |
| 1123 | iso_pu_bacteria | 2551306086 | 2551697038 | 322 |
| 1124 | iso_pu_bacteria | 2551306090 | 2551723128 | 322 |
| 1125 | iso_pu_bacteria | 2551306091 | 2551728089 | 322 |
| 1126 | iso_pu_bacteria | 2551306092 | 2551732558 | 322 |
| 1127 | iso_pu_bacteria | 2551306093 | 2551744798 | 322 |
| 1128 | iso_pu_bacteria | 2582581306 | 2585268513 | 322 |
| 1129 | iso_pu_bacteria | 2582581866 | 2585394053 | 322 |
| 1130 | iso_pu_bacteria | 2690316117 | 2692319277 | 322 |
| 1131 | iso_pu_bacteria | 2751185821 | 2753458950 | 322 |
| 1132 | iso_pu_bacteria | 2758568016 | 2758637820 | 322 |
| 1133 | iso_pu_bacteria | 2775506902 | 2776269284 | 322 |
| 1134 | iso_pu_bacteria | 2775506904 | 2776283577 | 322 |
| 1135 | iso_pu_bacteria | 2791355082 | 2792584698 | 322 |
| 1136 | iso_pu_bacteria | 2791355091 | 2792621513 | 322 |
| 1137 | iso_pu_bacteria | 2791355092 | 2792627799 | 322 |
| 1138 | iso_pu_bacteria | 2791355094 | 2792640231 | 322 |
| 1139 | iso_pu_bacteria | 2802428858 | 2802716174 | 322 |
| 1140 | iso_pu_bacteria | 2802428859 | 2802722788 | 322 |
| 1141 | iso_pu_bacteria | 2802428860 | 2802729067 | 322 |
| 1142 | iso_pu_bacteria | 2802428861 | 2802735461 | 322 |
| 1143 | iso_pu_bacteria | 2802428862 | 2802741963 | 322 |
| 1144 | iso_pu_bacteria | 2802428863 | 2802748413 | 322 |
| 1145 | iso_pu_bacteria | 2842521101 | 2842525138 | 322 |
| 1146 | iso_pu_bacteria | 2847417321 | 2847422214 | 322 |
| 1147 | iso_pu_bacteria | 2855825444 | 2855828399 | 322 |
| 1148 | iso_pu_bacteria | 2855839649 | 2855843511 | 322 |
| 1149 | iso_pu_bacteria | 2855872281 | 2855875657 | 322 |
| 1150 | iso_pu_bacteria | 2858800743 | 2858807227 | 322 |
| 1151 | iso_pu_bacteria | 2894652903 | 2894653438 | 322 |
| 1152 | iso_pu_bacteria | 2915986958 | 2915988994 | 322 |
| 1153 | iso_pu_bacteria | 2915993759 | 2916000139 | 322 |
| 1154 | iso_pu_bacteria | 2916000859 | 2916004801 | 322 |
| 1155 | iso_pu_bacteria | 2916007675 | 2916013131 | 322 |
| 1156 | iso_pu_bacteria | 2916014648 | 2916020232 | 322 |
| 1157 | iso_pu_bacteria | 2916021584 | 2916027052 | 322 |
| 1158 | iso_pu_bacteria | 2916028427 | 2916029960 | 322 |
| 1159 | iso_pu_bacteria | 2916035215 | 2916041103 | 322 |
| 1160 | iso_pu_bacteria | 2916041962 | 2916048581 | 322 |
| 1161 | iso_pu_bacteria | 2916055098 | 2916058731 | 322 |
| 1162 | iso_pu_bacteria | 2916068649 | 2916075417 | 322 |
| 1163 | iso_pu_bacteria | 2921201388 | 2921206922 | 322 |
| 1164 | iso_pu_bacteria | 2921244191 | 2921247674 | 322 |
| 1165 | iso_pu_bacteria | 2921263974 | 2921265381 | 322 |
| 1166 | iso_pu_bacteria | 2921282425 | 2921283172 | 322 |
| 1167 | iso_pu_bacteria | 2921289301 | 2921296026 | 322 |
| 1168 | iso_pu_bacteria | 2921296804 | 2921302011 | 322 |
| 1169 | iso_pu_bacteria | 2924144063 | 2924148971 | 322 |
| 1170 | iso_pu_bacteria | 2924150972 | 2924155387 | 322 |
| 1171 | iso_pu_bacteria | 2924158325 | 2924158639 | 322 |
| 1172 | iso_pu_bacteria | 2924172951 | 2924175838 | 322 |
| 1173 | iso_pu_bacteria | 2924179722 | 2924183889 | 322 |
| 1174 | iso_pu_bacteria | 2924186466 | 2924193443 | 322 |
| 1175 | iso_pu_bacteria | 2924193448 | 2924198816 | 322 |
| 1176 | iso_pu_bacteria | 2924200457 | 2924204690 | 322 |
| 1177 | iso_pu_bacteria | 2924207177 | 2924212266 | 322 |
| 1178 | iso_pu_bacteria | 2924214083 | 2924218484 | 322 |
| 1179 | iso_pu_bacteria | 2924221636 | 2924222441 | 322 |
| 1180 | iso_pu_bacteria | 2924228884 | 2924232552 | 322 |
| 1181 | iso_pu_bacteria | 2936996657 | 2936996677 | 322 |
| 1182 | iso_pu_bacteria | 2937002841 | 2937008416 | 322 |
| 1183 | iso_pu_bacteria | 2937029754 | 2937032369 | 322 |
| 1184 | iso_pu_bacteria | 2937036028 | 2937038355 | 322 |
| 1185 | iso_pu_bacteria | 2937042894 | 2937043468 | 322 |
| 1186 | iso_pu_bacteria | 2937049772 | 2937050476 | 322 |
| 1187 | iso_pu_bacteria | 2937056579 | 2937057129 | 322 |
| 1188 | iso_pu_bacteria | 2937063883 | 2937069047 | 322 |
| 1189 | iso_pu_bacteria | 2937071275 | 2937076748 | 322 |
| 1190 | iso_pu_bacteria | 2937078374 | 2937081832 | 322 |
| 1191 | iso_pu_bacteria | 2937084907 | 2937090306 | 322 |
| 1192 | iso_pu_bacteria | 2937091812 | 2937094936 | 322 |
| 1193 | iso_pu_bacteria | 2937098957 | 2937099159 | 322 |
| 1194 | iso_pu_bacteria | 2937106411 | 2937106763 | 322 |
| 1195 | iso_pu_bacteria | 2937113482 | 2937116903 | 322 |
| 1196 | iso_pu_bacteria | 2937126314 | 2937131844 | 322 |
| 1197 | iso_pu_bacteria | 2957375807 | 2957381045 | 322 |
| 1198 | iso_pu_bacteria | 2957388812 | 2957394318 | 322 |
| 1199 | iso_pu_bacteria | 2957415311 | 2957417882 | 322 |
| 1200 | iso_pu_bacteria | 2957422303 | 2957424865 | 322 |
| 1201 | iso_pu_bacteria | 2957430029 | 2957437058 | 322 |
| 1202 | iso_pu_bacteria | 2957437181 | 2957442765 | 322 |
| 1203 | iso_pu_bacteria | 2957443900 | 2957444077 | 322 |
| 1204 | iso_pu_bacteria | 2957450854 | 2957455011 | 322 |
| 1205 | iso_pu_bacteria | 2957457609 | 2957460764 | 322 |
| 1206 | iso_pu_bacteria | 2957464669 | 2957470742 | 322 |
| 1207 | iso_pu_bacteria | 2957471148 | 2957472812 | 322 |
| 1208 | iso_pu_bacteria | 2957478035 | 2957479280 | 322 |
| 1209 | iso_pu_bacteria | 2957484790 | 2957487220 | 322 |
| 1210 | iso_pu_bacteria | 2957491536 | 2957497404 | 322 |
| 1211 | iso_pu_bacteria | 2957498199 | 2957505435 | 322 |
| 1212 | iso_pu_bacteria | 2957505466 | 2957506370 | 322 |
| 1213 | iso_pu_bacteria | 2960584000 | 2960589899 | 322 |
| 1214 | iso_pu_bacteria | 2960591022 | 2960596663 | 322 |
| 1215 | iso_pu_bacteria | 2960597568 | 2960603233 | 322 |
| 1216 | iso_pu_bacteria | 2960603979 | 2960607537 | 322 |
| 1217 | iso_pu_bacteria | 2960617483 | 2960619243 | 322 |
| 1218 | iso_pu_bacteria | 2960624210 | 2960624702 | 322 |
| 1219 | iso_pu_bacteria | 2960631154 | 2960634559 | 322 |
| 1220 | iso_pu_bacteria | 2960637947 | 2960642938 | 322 |
| 1221 | iso_pu_bacteria | 2960645483 | 2960645959 | 322 |
| 1222 | iso_pu_bacteria | 2960652885 | 2960653489 | 322 |
| 1223 | iso_pu_bacteria | 2960660292 | 2960662602 | 322 |
| 1224 | iso_pu_bacteria | 2960667422 | 2960673012 | 322 |
| 1225 | iso_pu_bacteria | 2960674078 | 2960678368 | 322 |
| 1226 | iso_pu_bacteria | 2960680706 | 2960685754 | 322 |
| 1227 | iso_pu_bacteria | 2960693952 | 2960694981 | 322 |
| 1228 | iso_pu_bacteria | 2964607997 | 2964608269 | 322 |
| 1229 | iso_pu_bacteria | 2964621998 | 2964622291 | 322 |
| 1230 | iso_pu_bacteria | 2964628898 | 2964632209 | 322 |
| 1231 | iso_pu_bacteria | 2964636051 | 2964639383 | 322 |
| 1232 | iso_pu_bacteria | 2964643177 | 2964644892 | 322 |
| 1233 | iso_pu_bacteria | 2964643177 | 2964647658 | 322 |
| 1234 | iso_pu_bacteria | 2964649959 | 2964653465 | 322 |
| 1235 | iso_pu_bacteria | 2964656573 | 2964658568 | 322 |
| 1236 | iso_pu_bacteria | 2964663802 | 2964670479 | 322 |
| 1237 | iso_pu_bacteria | 2964678106 | 2964681504 | 322 |
| 1238 | iso_pu_bacteria | 2964685014 | 2964685566 | 322 |
| 1239 | iso_pu_bacteria | 2964691889 | 2964692311 | 322 |
| 1240 | iso_pu_bacteria | 2964698721 | 2964699246 | 322 |
| 1241 | iso_pu_bacteria | 2964705432 | 2964708819 | 322 |
| 1242 | iso_pu_bacteria | 2964712639 | 2964714525 | 322 |
| 1243 | iso_pu_bacteria | 2964719344 | 2964720166 | 322 |
| 1244 | iso_pu_bacteria | 2967664464 | 2967666370 | 322 |
| 1245 | iso_pu_bacteria | 2967671571 | 2967674233 | 322 |
| 1246 | iso_pu_bacteria | 2967678726 | 2967679625 | 322 |
| 1247 | iso_pu_bacteria | 2967686174 | 2967692661 | 322 |
| 1248 | iso_pu_bacteria | 2967693043 | 2967696541 | 322 |
| 1249 | iso_pu_bacteria | 2967699805 | 2967704537 | 322 |
| 1250 | iso_pu_bacteria | 2967706974 | 2967707748 | 322 |
| 1251 | iso_pu_bacteria | 2967714385 | 2967717109 | 322 |
| 1252 | iso_pu_bacteria | 2967721400 | 2967728519 | 322 |
| 1253 | iso_pu_bacteria | 2967728569 | 2967731776 | 322 |
| 1254 | iso_pu_bacteria | 2967735183 | 2967741643 | 322 |
| 1255 | iso_pu_bacteria | 2967748971 | 2967753953 | 322 |
| 1256 | iso_pu_bacteria | 2967762386 | 2967764269 | 322 |
| 1257 | iso_pu_bacteria | 2967769361 | 2967771862 | 322 |
| 1258 | iso_pu_bacteria | 2967775926 | 2967779495 | 322 |
| 1259 | iso_pu_bacteria | 2970019648 | 2970023850 | 322 |
| 1260 | iso_pu_bacteria | 2970026789 | 2970028491 | 322 |
| 1261 | iso_pu_bacteria | 2970033650 | 2970040773 | 322 |
| 1262 | iso_pu_bacteria | 2970040964 | 2970047526 | 322 |
| 1263 | iso_pu_bacteria | 2970047711 | 2970054126 | 322 |
| 1264 | iso_pu_bacteria | 2970054988 | 2970055268 | 322 |
| 1265 | iso_pu_bacteria | 2970061556 | 2970064179 | 322 |
| 1266 | iso_pu_bacteria | 2970068827 | 2970075942 | 322 |
| 1267 | iso_pu_bacteria | 2970076120 | 2970081912 | 322 |
| 1268 | iso_pu_bacteria | 2970082768 | 2970085826 | 322 |
| 1269 | iso_pu_bacteria | 2970088815 | 2970092334 | 322 |
| 1270 | iso_pu_bacteria | 2970095765 | 2970096227 | 322 |
| 1271 | iso_pu_bacteria | 2970109326 | 2970109639 | 322 |
| 1272 | iso_pu_bacteria | 2970116247 | 2970122226 | 322 |
| 1273 | iso_pu_bacteria | 2970122695 | 2970124994 | 322 |
| 1274 | iso_pu_bacteria | 2970129317 | 2970132525 | 322 |
| 1275 | iso_pu_bacteria | 2970136068 | 2970136899 | 322 |
| 1276 | iso_pu_bacteria | 2970143518 | 2970147091 | 322 |
| 1277 | iso_pu_bacteria | 2970149975 | 2970156072 | 322 |
| 1278 | iso_pu_bacteria | 2970156795 | 2970157611 | 322 |
| 1279 | iso_pu_bacteria | 2970164137 | 2970169435 | 322 |
| 1280 | iso_pu_bacteria | 2970184632 | 2970188966 | 322 |
| 1281 | iso_pu_bacteria | 2970191845 | 2970198616 | 322 |
| 1282 | iso_pu_bacteria | 2977530762 | 2977533165 | 322 |
| 1283 | iso_pu_bacteria | 2977537788 | 2977538336 | 322 |
| 1284 | iso_pu_bacteria | 2977544691 | 2977546237 | 322 |
| 1285 | iso_pu_bacteria | 2977551784 | 2977555674 | 322 |
| 1286 | iso_pu_bacteria | 2977558990 | 2977562914 | 322 |
| 1287 | iso_pu_bacteria | 2977565890 | 2977569638 | 322 |
| 1288 | iso_pu_bacteria | 2977572785 | 2977572950 | 322 |
| 1289 | iso_pu_bacteria | 2977579622 | 2977583111 | 322 |
| 1290 | iso_pu_bacteria | 3002141150 | 3002141966 | 322 |
| 1291 | iso_pu_bacteria | 3003665799 | 3003669458 | 322 |
| 1292 | iso_pu_bacteria | 3003930520 | 3003935853 | 322 |
| 1293 | iso_pu_bacteria | 3005445848 | 3005446592 | 322 |
| 1294 | iso_pu_bacteria | 643692032 | 643823880 | 322 |
| 1295 | iso_pu_bacteria | 648276728 | 648740337 | 322 |
| 1296 | iso_pu_bacteria | 8003992118 | 8003996090 | 322 |
| 1297 | iso_pu_bacteria | 8003999396 | 8004003855 | 322 |
| 1298 | iso_pu_bacteria | 8049293176 | 8049296782 | 322 |
| 1299 | 3300003203 | JGI25406J46586_10013043 | JGI25406J46586_100130434 | 323 |
| 1300 | 3300005327 | Ga0070658_10322566 | Ga0070658_103225661 | 323 |
| 1301 | 3300005539 | Ga0068853_100204447 | Ga0068853_1002044473 | 323 |
| 1302 | 3300005616 | Ga0068852_100235654 | Ga0068852_1002356541 | 323 |
| 1303 | 3300005937 | Ga0081455_10264540 | Ga0081455_102645402 | 323 |
| 1304 | 3300005983 | Ga0081540_1012683 | Ga0081540_10126835 | 323 |
| 1305 | 3300005985 | Ga0081539_10000856 | Ga0081539_1000085665 | 323 |
| 1306 | 3300006038 | Ga0075365_10036306 | Ga0075365_100363062 | 323 |
| 1307 | 3300006038 | Ga0075365_10144556 | Ga0075365_101445563 | 323 |
| 1308 | 3300006042 | Ga0075368_10056250 | Ga0075368_100562502 | 323 |
| 1309 | 3300006048 | Ga0075363_100034177 | Ga0075363_1000341774 | 323 |
| 1310 | 3300006051 | Ga0075364_10097233 | Ga0075364_100972331 | 323 |
| 1311 | 3300006178 | Ga0075367_10071339 | Ga0075367_100713393 | 323 |
| 1312 | 3300009093 | Ga0105240_10194622 | Ga0105240_101946223 | 323 |
| 1313 | 3300010375 | Ga0105239_10148418 | Ga0105239_101484182 | 323 |
| 1314 | 3300010375 | Ga0105239_10200602 | Ga0105239_102006023 | 323 |
| 1315 | 3300013104 | Ga0157370_10224216 | Ga0157370_102242161 | 323 |
| 1316 | 3300013105 | Ga0157369_10273617 | Ga0157369_102736173 | 323 |
| 1317 | 3300013306 | Ga0163162_10092574 | Ga0163162_100925742 | 323 |
| 1318 | 3300014325 | Ga0163163_10000150 | Ga0163163_1000015060 | 323 |
| 1319 | 3300014325 | Ga0163163_10119349 | Ga0163163_101193492 | 323 |
| 1320 | 3300014968 | Ga0157379_10010439 | Ga0157379_100104393 | 323 |
| 1321 | 3300021388 | Ga0213875_10013299 | Ga0213875_100132995 | 323 |
| 1322 | 3300025261 | Ga0209233_1003389 | Ga0209233_10033892 | 323 |
| 1323 | 3300025911 | Ga0207654_10239484 | Ga0207654_102394842 | 323 |
| 1324 | 3300026095 | Ga0207676_10233222 | Ga0207676_102332221 | 323 |
| 1325 | 3300026142 | Ga0207698_10144721 | Ga0207698_101447212 | 323 |
| 1326 | 3300035090 | Ga0373949_0000224 | Ga0373949_0000224_3294_4334 | 323 |
| 1327 | 3300035119 | Ga0373956_0048977 | Ga0373956_0048977_606_1583 | 323 |
| 1328 | 3300037853 | Ga0436364_0115455 | Ga0436364_0115455_4934_5911 | 323 |
| 1329 | 3300037853 | Ga0436364_0976983 | Ga0436364_0976983_210_1187 | 323 |
| 1330 | 3300039437 | Ga0436365_0582386 | Ga0436365_0582386_21332_22309 | 323 |
| 1331 | 3300039437 | Ga0436365_1093511 | Ga0436365_1093511_10773_11750 | 323 |
| 1332 | 3300039450 | Ga0436363_0065264 | Ga0436363_0065264_273_1250 | 323 |
| 1333 | 3300039453 | Ga0436362_0273395 | Ga0436362_0273395_5288_6265 | 323 |
| 1334 | 3300042007 | Ga0439449_0082289 | Ga0439449_0082289_168_1142 | 323 |
| 1335 | 3300046520 | Ga0495637_0058673 | Ga0495637_0058673_147_1118 | 323 |
| 1336 | 3300046557 | Ga0495622_0050170 | Ga0495622_0050170_949_1926 | 323 |
| 1337 | 3300048929 | Ga0496126_0042064 | Ga0496126_0042064_746_1723 | 323 |
| 1338 | 3300048929 | Ga0496126_0061969 | Ga0496126_0061969_823_1800 | 323 |
| 1339 | 3300049568 | Ga0501031_0005116 | Ga0501031_0005116_1706_2683 | 323 |
| 1340 | 3300049569 | Ga0501032_0048609 | Ga0501032_0048609_1194_2171 | 323 |
| 1341 | 3300049570 | Ga0501033_0025128 | Ga0501033_0025128_378_1355 | 323 |
| 1342 | 3300049571 | Ga0501034_0002653 | Ga0501034_0002653_16501_17475 | 323 |
| 1343 | 3300049571 | Ga0501034_0032448 | Ga0501034_0032448_3133_4110 | 323 |
| 1344 | 3300049572 | Ga0501036_0003243 | Ga0501036_0003243_10982_11956 | 323 |
| 1345 | 3300049572 | Ga0501036_0024551 | Ga0501036_0024551_3133_4110 | 323 |
| 1346 | 3300049573 | Ga0501037_0018226 | Ga0501037_0018226_3133_4110 | 323 |
| 1347 | 3300049574 | Ga0501038_0025190 | Ga0501038_0025190_1194_2171 | 323 |
| 1348 | 3300049575 | Ga0501039_0011081 | Ga0501039_0011081_2733_3710 | 323 |
| 1349 | 3300049575 | Ga0501039_0100506 | Ga0501039_0100506_982_1956 | 323 |
| 1350 | 3300049576 | Ga0501040_0028962 | Ga0501040_0028962_1477_2454 | 323 |
| 1351 | 3300049578 | Ga0501042_0010639 | Ga0501042_0010639_1058_2035 | 323 |
| 1352 | 3300049579 | Ga0501043_0000736 | Ga0501043_0000736_26540_27514 | 323 |
| 1353 | 3300049579 | Ga0501043_0014872 | Ga0501043_0014872_3133_4110 | 323 |
| 1354 | 3300049580 | Ga0501046_0007945 | Ga0501046_0007945_2608_3585 | 323 |
| 1355 | 3300049580 | Ga0501046_0029996 | Ga0501046_0029996_3222_4196 | 323 |
| 1356 | 3300049581 | Ga0501047_0012748 | Ga0501047_0012748_973_1950 | 323 |
| 1357 | 3300049582 | Ga0501048_0000151 | Ga0501048_0000151_37181_38155 | 323 |
| 1358 | 3300049582 | Ga0501048_0008611 | Ga0501048_0008611_2236_3213 | 323 |
| 1359 | 3300049583 | Ga0501067_0041815 | Ga0501067_0041815_1464_2441 | 323 |
| 1360 | 3300049584 | Ga0501068_0008727 | Ga0501068_0008727_3424_4401 | 323 |
| 1361 | 3300049586 | Ga0501070_0005227 | Ga0501070_0005227_4950_5924 | 323 |
| 1362 | 3300049586 | Ga0501070_0010861 | Ga0501070_0010861_4488_5465 | 323 |
| 1363 | 3300049586 | Ga0501070_0081113 | Ga0501070_0081113_49_1023 | 323 |
| 1364 | 3300049587 | Ga0501071_0011715 | Ga0501071_0011715_3969_4946 | 323 |
| 1365 | 3300049589 | Ga0501073_0009708 | Ga0501073_0009708_2651_3628 | 323 |
| 1366 | 3300049589 | Ga0501073_0025551 | Ga0501073_0025551_1869_2849 | 323 |
| 1367 | 3300049589 | Ga0501073_0094938 | Ga0501073_0094938_1066_2040 | 323 |
| 1368 | 3300049590 | Ga0501074_0012718 | Ga0501074_0012718_3633_4610 | 323 |
| 1369 | 3300049590 | Ga0501074_0018996 | Ga0501074_0018996_3394_4368 | 323 |
| 1370 | 3300049590 | Ga0501074_0343333 | Ga0501074_0343333_39_1010 | 323 |
| 1371 | 3300049592 | Ga0501076_0111203 | Ga0501076_0111203_405_1385 | 323 |
| 1372 | 3300049742 | Ga0501080_0000130 | Ga0501080_0000130_25881_26855 | 323 |
| 1373 | 3300049742 | Ga0501080_0024231 | Ga0501080_0024231_1202_2179 | 323 |
| 1374 | 3300049744 | Ga0501083_0000480 | Ga0501083_0000480_3808_4782 | 323 |
| 1375 | 3300049744 | Ga0501083_0028904 | Ga0501083_0028904_2719_3696 | 323 |
| 1376 | 3300049822 | Ga0501035_0026490 | Ga0501035_0026490_3133_4110 | 323 |
| 1377 | 3300049823 | Ga0501044_0000636 | Ga0501044_0000636_37209_38183 | 323 |
| 1378 | 3300049823 | Ga0501044_0034514 | Ga0501044_0034514_1194_2171 | 323 |
| 1379 | 3300049823 | Ga0501044_0327007 | Ga0501044_0327007_151_1125 | 323 |
| 1380 | 3300049823 | Ga0501044_0382740 | Ga0501044_0382740_249_1226 | 323 |
| 1381 | 3300049824 | Ga0501045_0011533 | Ga0501045_0011533_1301_2278 | 323 |
| 1382 | 3300049824 | Ga0501045_0240036 | Ga0501045_0240036_324_1298 | 323 |
| 1383 | 3300050491 | nmdc:mga00v17_100626_c1 | nmdc:mga00v17_100626_c1_168_1145 | 323 |
| 1384 | 3300050494 | nmdc:mga06z11_236801_c1 | nmdc:mga06z11_236801_c1_36_1013 | 323 |
| 1385 | 3300053153 | Ga0500616_0142955 | Ga0500616_0142955_67_1044 | 323 |
| 1386 | 3300053161 | Ga0500634_0000507 | Ga0500634_0000507_5788_6762 | 323 |
| 1387 | 3300054114 | Ga0501084_0027038 | Ga0501084_0027038_1243_2223 | 323 |
| 1388 | 3300054114 | Ga0501084_0436349 | Ga0501084_0436349_69_1046 | 323 |
| 1389 | 3300060353 | Ga0501082_0028918 | Ga0501082_0028918_2827_3801 | 323 |
| 1390 | iso_pu_bacteria | 2510065057 | 2510305552 | 323 |
| 1391 | iso_pu_bacteria | 2510461069 | 2510840344 | 323 |
| 1392 | iso_pu_bacteria | 2510917026 | 2511171931 | 323 |
| 1393 | iso_pu_bacteria | 2511231052 | 2511503592 | 323 |
| 1394 | iso_pu_bacteria | 2512047086 | 2512530271 | 323 |
| 1395 | iso_pu_bacteria | 2512875026 | 2512970220 | 323 |
| 1396 | iso_pu_bacteria | 2513237086 | 2513583932 | 323 |
| 1397 | iso_pu_bacteria | 2513237088 | 2513600999 | 323 |
| 1398 | iso_pu_bacteria | 2513237089 | 2513601284 | 323 |
| 1399 | iso_pu_bacteria | 2513237091 | 2513615894 | 323 |
| 1400 | iso_pu_bacteria | 2513237140 | 2513883551 | 323 |
| 1401 | iso_pu_bacteria | 2513237143 | 2513903604 | 323 |
| 1402 | iso_pu_bacteria | 2513237156 | 2513986662 | 323 |
| 1403 | iso_pu_bacteria | 2513237160 | 2514003269 | 323 |
| 1404 | iso_pu_bacteria | 2515154107 | 2515610013 | 323 |
| 1405 | iso_pu_bacteria | 2516653046 | 2516898199 | 323 |
| 1406 | iso_pu_bacteria | 2517487022 | 2517570742 | 323 |
| 1407 | iso_pu_bacteria | 2524023207 | 2524451724 | 323 |
| 1408 | iso_pu_bacteria | 2534681796 | 2535517316 | 323 |
| 1409 | iso_pu_bacteria | 2551306084 | 2551677322 | 323 |
| 1410 | iso_pu_bacteria | 2551306085 | 2551684923 | 323 |
| 1411 | iso_pu_bacteria | 2551306086 | 2551693210 | 323 |
| 1412 | iso_pu_bacteria | 2551306089 | 2551708604 | 323 |
| 1413 | iso_pu_bacteria | 2551306090 | 2551716860 | 323 |
| 1414 | iso_pu_bacteria | 2551306091 | 2551728792 | 323 |
| 1415 | iso_pu_bacteria | 2551306092 | 2551735705 | 323 |
| 1416 | iso_pu_bacteria | 2551306092 | 2551737452 | 323 |
| 1417 | iso_pu_bacteria | 2551306093 | 2551742001 | 323 |
| 1418 | iso_pu_bacteria | 2582581283 | 2585169153 | 323 |
| 1419 | iso_pu_bacteria | 2582581294 | 2585204591 | 323 |
| 1420 | iso_pu_bacteria | 2582581299 | 2585230759 | 323 |
| 1421 | iso_pu_bacteria | 2585427633 | 2585992830 | 323 |
| 1422 | iso_pu_bacteria | 2585427634 | 2586003540 | 323 |
| 1423 | iso_pu_bacteria | 2599185156 | 2599335866 | 323 |
| 1424 | iso_pu_bacteria | 2599185236 | 2599719825 | 323 |
| 1425 | iso_pu_bacteria | 2600254933 | 2600377102 | 323 |
| 1426 | iso_pu_bacteria | 2643221558 | 2643814636 | 323 |
| 1427 | iso_pu_bacteria | 2643221599 | 2644003001 | 323 |
| 1428 | iso_pu_bacteria | 2643221634 | 2644196744 | 323 |
| 1429 | iso_pu_bacteria | 2643221653 | 2644300515 | 323 |
| 1430 | iso_pu_bacteria | 2643221719 | 2644658856 | 323 |
| 1431 | iso_pu_bacteria | 2643221734 | 2644737111 | 323 |
| 1432 | iso_pu_bacteria | 2738541317 | 2738946848 | 323 |
| 1433 | iso_pu_bacteria | 2758568016 | 2758638842 | 323 |
| 1434 | iso_pu_bacteria | 2802428858 | 2802716575 | 323 |
| 1435 | iso_pu_bacteria | 2802428859 | 2802725388 | 323 |
| 1436 | iso_pu_bacteria | 2802428860 | 2802730520 | 323 |
| 1437 | iso_pu_bacteria | 2802428861 | 2802737507 | 323 |
| 1438 | iso_pu_bacteria | 2802428862 | 2802743103 | 323 |
| 1439 | iso_pu_bacteria | 2802428863 | 2802750526 | 323 |
| 1440 | iso_pu_bacteria | 2818991272 | 2819243487 | 323 |
| 1441 | iso_pu_bacteria | 2818991461 | 2819682968 | 323 |
| 1442 | iso_pu_bacteria | 2821123053 | 2821126401 | 323 |
| 1443 | iso_pu_bacteria | 2838074704 | 2838076068 | 323 |
| 1444 | iso_pu_bacteria | 2838736955 | 2838737124 | 323 |
| 1445 | iso_pu_bacteria | 2841840854 | 2841842507 | 323 |
| 1446 | iso_pu_bacteria | 2842140634 | 2842142287 | 323 |
| 1447 | iso_pu_bacteria | 2842922631 | 2842926982 | 323 |
| 1448 | iso_pu_bacteria | 2854896431 | 2854899753 | 323 |
| 1449 | iso_pu_bacteria | 2854911287 | 2854916425 | 323 |
| 1450 | iso_pu_bacteria | 2854916844 | 2854921022 | 323 |
| 1451 | iso_pu_bacteria | 2855825444 | 2855829762 | 323 |
| 1452 | iso_pu_bacteria | 2855839649 | 2855846042 | 323 |
| 1453 | iso_pu_bacteria | 2857531043 | 2857532962 | 323 |
| 1454 | iso_pu_bacteria | 2858800743 | 2858804224 | 323 |
| 1455 | iso_pu_bacteria | 2899803654 | 2899804069 | 323 |
| 1456 | iso_pu_bacteria | 2913308742 | 2913311792 | 323 |
| 1457 | iso_pu_bacteria | 2915650412 | 2915652684 | 323 |
| 1458 | iso_pu_bacteria | 2915980308 | 2915981286 | 323 |
| 1459 | iso_pu_bacteria | 2915986958 | 2915992653 | 323 |
| 1460 | iso_pu_bacteria | 2915993759 | 2915997341 | 323 |
| 1461 | iso_pu_bacteria | 2916000859 | 2916004201 | 323 |
| 1462 | iso_pu_bacteria | 2916007675 | 2916011816 | 323 |
| 1463 | iso_pu_bacteria | 2916014648 | 2916017441 | 323 |
| 1464 | iso_pu_bacteria | 2916021584 | 2916023643 | 323 |
| 1465 | iso_pu_bacteria | 2916028427 | 2916028689 | 323 |
| 1466 | iso_pu_bacteria | 2916035215 | 2916035646 | 323 |
| 1467 | iso_pu_bacteria | 2916041962 | 2916043504 | 323 |
| 1468 | iso_pu_bacteria | 2916048683 | 2916049781 | 323 |
| 1469 | iso_pu_bacteria | 2916055098 | 2916056079 | 323 |
| 1470 | iso_pu_bacteria | 2916061851 | 2916062147 | 323 |
| 1471 | iso_pu_bacteria | 2916068649 | 2916070826 | 323 |
| 1472 | iso_pu_bacteria | 2916076590 | 2916080345 | 323 |
| 1473 | iso_pu_bacteria | 2917699015 | 2917703990 | 323 |
| 1474 | iso_pu_bacteria | 2919171160 | 2919176038 | 323 |
| 1475 | iso_pu_bacteria | 2920760137 | 2920764804 | 323 |
| 1476 | iso_pu_bacteria | 2920822456 | 2920827195 | 323 |
| 1477 | iso_pu_bacteria | 2921201388 | 2921203804 | 323 |
| 1478 | iso_pu_bacteria | 2921208531 | 2921210564 | 323 |
| 1479 | iso_pu_bacteria | 2921237296 | 2921240183 | 323 |
| 1480 | iso_pu_bacteria | 2921244191 | 2921247942 | 323 |
| 1481 | iso_pu_bacteria | 2921250672 | 2921251792 | 323 |
| 1482 | iso_pu_bacteria | 2921257292 | 2921258150 | 323 |
| 1483 | iso_pu_bacteria | 2921263974 | 2921264313 | 323 |
| 1484 | iso_pu_bacteria | 2921282425 | 2921286093 | 323 |
| 1485 | iso_pu_bacteria | 2921289301 | 2921296443 | 323 |
| 1486 | iso_pu_bacteria | 2921296804 | 2921301851 | 323 |
| 1487 | iso_pu_bacteria | 2924144063 | 2924150001 | 323 |
| 1488 | iso_pu_bacteria | 2924150972 | 2924153641 | 323 |
| 1489 | iso_pu_bacteria | 2924158325 | 2924162869 | 323 |
| 1490 | iso_pu_bacteria | 2924165586 | 2924170470 | 323 |
| 1491 | iso_pu_bacteria | 2924172951 | 2924179446 | 323 |
| 1492 | iso_pu_bacteria | 2924179722 | 2924182879 | 323 |
| 1493 | iso_pu_bacteria | 2924186466 | 2924191318 | 323 |
| 1494 | iso_pu_bacteria | 2924193448 | 2924199876 | 323 |
| 1495 | iso_pu_bacteria | 2924200457 | 2924201125 | 323 |
| 1496 | iso_pu_bacteria | 2924207177 | 2924210877 | 323 |
| 1497 | iso_pu_bacteria | 2924214083 | 2924221104 | 323 |
| 1498 | iso_pu_bacteria | 2924221636 | 2924221702 | 323 |
| 1499 | iso_pu_bacteria | 2924228884 | 2924234466 | 323 |
| 1500 | iso_pu_bacteria | 2929138655 | 2929141908 | 323 |
| 1501 | iso_pu_bacteria | 2936996657 | 2936997294 | 323 |
| 1502 | iso_pu_bacteria | 2937002841 | 2937006425 | 323 |
| 1503 | iso_pu_bacteria | 2937009748 | 2937016239 | 323 |
| 1504 | iso_pu_bacteria | 2937016420 | 2937021096 | 323 |
| 1505 | iso_pu_bacteria | 2937023124 | 2937024878 | 323 |
| 1506 | iso_pu_bacteria | 2937029754 | 2937035774 | 323 |
| 1507 | iso_pu_bacteria | 2937036028 | 2937041595 | 323 |
| 1508 | iso_pu_bacteria | 2937042894 | 2937044690 | 323 |
| 1509 | iso_pu_bacteria | 2937049772 | 2937055386 | 323 |
| 1510 | iso_pu_bacteria | 2937056579 | 2937056602 | 323 |
| 1511 | iso_pu_bacteria | 2937063883 | 2937070961 | 323 |
| 1512 | iso_pu_bacteria | 2937071275 | 2937075878 | 323 |
| 1513 | iso_pu_bacteria | 2937078374 | 2937080836 | 323 |
| 1514 | iso_pu_bacteria | 2937091812 | 2937091980 | 323 |
| 1515 | iso_pu_bacteria | 2937098957 | 2937106168 | 323 |
| 1516 | iso_pu_bacteria | 2937106411 | 2937106587 | 323 |
| 1517 | iso_pu_bacteria | 2937113482 | 2937113662 | 323 |
| 1518 | iso_pu_bacteria | 2937119839 | 2937123463 | 323 |
| 1519 | iso_pu_bacteria | 2937126314 | 2937126559 | 323 |
| 1520 | iso_pu_bacteria | 2957375807 | 2957379484 | 323 |
| 1521 | iso_pu_bacteria | 2957382221 | 2957383499 | 323 |
| 1522 | iso_pu_bacteria | 2957388812 | 2957390819 | 323 |
| 1523 | iso_pu_bacteria | 2957395598 | 2957397654 | 323 |
| 1524 | iso_pu_bacteria | 2957402308 | 2957408699 | 323 |
| 1525 | iso_pu_bacteria | 2957408893 | 2957413212 | 323 |
| 1526 | iso_pu_bacteria | 2957415311 | 2957418592 | 323 |
| 1527 | iso_pu_bacteria | 2957422303 | 2957428686 | 323 |
| 1528 | iso_pu_bacteria | 2957430029 | 2957432247 | 323 |
| 1529 | iso_pu_bacteria | 2957437181 | 2957441798 | 323 |
| 1530 | iso_pu_bacteria | 2957443900 | 2957448015 | 323 |
| 1531 | iso_pu_bacteria | 2957450854 | 2957454021 | 323 |
| 1532 | iso_pu_bacteria | 2957457609 | 2957457941 | 323 |
| 1533 | iso_pu_bacteria | 2957464669 | 2957470082 | 323 |
| 1534 | iso_pu_bacteria | 2957471148 | 2957474318 | 323 |
| 1535 | iso_pu_bacteria | 2957478035 | 2957478232 | 323 |
| 1536 | iso_pu_bacteria | 2957484790 | 2957487793 | 323 |
| 1537 | iso_pu_bacteria | 2957491536 | 2957494230 | 323 |
| 1538 | iso_pu_bacteria | 2957498199 | 2957498388 | 323 |
| 1539 | iso_pu_bacteria | 2957505466 | 2957511221 | 323 |
| 1540 | iso_pu_bacteria | 2960584000 | 2960589020 | 323 |
| 1541 | iso_pu_bacteria | 2960591022 | 2960591949 | 323 |
| 1542 | iso_pu_bacteria | 2960597568 | 2960597768 | 323 |
| 1543 | iso_pu_bacteria | 2960603979 | 2960607156 | 323 |
| 1544 | iso_pu_bacteria | 2960610863 | 2960613430 | 323 |
| 1545 | iso_pu_bacteria | 2960617483 | 2960620789 | 323 |
| 1546 | iso_pu_bacteria | 2960624210 | 2960624758 | 323 |
| 1547 | iso_pu_bacteria | 2960631154 | 2960633971 | 323 |
| 1548 | iso_pu_bacteria | 2960637947 | 2960640629 | 323 |
| 1549 | iso_pu_bacteria | 2960645483 | 2960649898 | 323 |
| 1550 | iso_pu_bacteria | 2960652885 | 2960653463 | 323 |
| 1551 | iso_pu_bacteria | 2960660292 | 2960661110 | 323 |
| 1552 | iso_pu_bacteria | 2960667422 | 2960669457 | 323 |
| 1553 | iso_pu_bacteria | 2960674078 | 2960675999 | 323 |
| 1554 | iso_pu_bacteria | 2960680706 | 2960684859 | 323 |
| 1555 | iso_pu_bacteria | 2960687367 | 2960689781 | 323 |
| 1556 | iso_pu_bacteria | 2960693952 | 2960698324 | 323 |
| 1557 | iso_pu_bacteria | 2964607997 | 2964615076 | 323 |
| 1558 | iso_pu_bacteria | 2964615318 | 2964615604 | 323 |
| 1559 | iso_pu_bacteria | 2964621998 | 2964622062 | 323 |
| 1560 | iso_pu_bacteria | 2964628898 | 2964633049 | 323 |
| 1561 | iso_pu_bacteria | 2964636051 | 2964638581 | 323 |
| 1562 | iso_pu_bacteria | 2964649959 | 2964654532 | 323 |
| 1563 | iso_pu_bacteria | 2964656573 | 2964662510 | 323 |
| 1564 | iso_pu_bacteria | 2964663802 | 2964667342 | 323 |
| 1565 | iso_pu_bacteria | 2964670856 | 2964675575 | 323 |
| 1566 | iso_pu_bacteria | 2964678106 | 2964681134 | 323 |
| 1567 | iso_pu_bacteria | 2964685014 | 2964689700 | 323 |
| 1568 | iso_pu_bacteria | 2964691889 | 2964691990 | 323 |
| 1569 | iso_pu_bacteria | 2964698721 | 2964701435 | 323 |
| 1570 | iso_pu_bacteria | 2964705432 | 2964706842 | 323 |
| 1571 | iso_pu_bacteria | 2964712639 | 2964715243 | 323 |
| 1572 | iso_pu_bacteria | 2964719344 | 2964719413 | 323 |
| 1573 | iso_pu_bacteria | 2967671571 | 2967676410 | 323 |
| 1574 | iso_pu_bacteria | 2967678726 | 2967679327 | 323 |
| 1575 | iso_pu_bacteria | 2967686174 | 2967690642 | 323 |
| 1576 | iso_pu_bacteria | 2967693043 | 2967694438 | 323 |
| 1577 | iso_pu_bacteria | 2967699805 | 2967702101 | 323 |
| 1578 | iso_pu_bacteria | 2967706974 | 2967710709 | 323 |
| 1579 | iso_pu_bacteria | 2967714385 | 2967715142 | 323 |
| 1580 | iso_pu_bacteria | 2967721400 | 2967728246 | 323 |
| 1581 | iso_pu_bacteria | 2967728569 | 2967731064 | 323 |
| 1582 | iso_pu_bacteria | 2967735183 | 2967737723 | 323 |
| 1583 | iso_pu_bacteria | 2967742019 | 2967745950 | 323 |
| 1584 | iso_pu_bacteria | 2967748971 | 2967749744 | 323 |
| 1585 | iso_pu_bacteria | 2967755722 | 2967758129 | 323 |
| 1586 | iso_pu_bacteria | 2967762386 | 2967763289 | 323 |
| 1587 | iso_pu_bacteria | 2967769361 | 2967769678 | 323 |
| 1588 | iso_pu_bacteria | 2967775926 | 2967780383 | 323 |
| 1589 | iso_pu_bacteria | 2970019648 | 2970020290 | 323 |
| 1590 | iso_pu_bacteria | 2970026789 | 2970032823 | 323 |
| 1591 | iso_pu_bacteria | 2970033650 | 2970037531 | 323 |
| 1592 | iso_pu_bacteria | 2970040964 | 2970044810 | 323 |
| 1593 | iso_pu_bacteria | 2970047711 | 2970047794 | 323 |
| 1594 | iso_pu_bacteria | 2970054988 | 2970057621 | 323 |
| 1595 | iso_pu_bacteria | 2970061556 | 2970061746 | 323 |
| 1596 | iso_pu_bacteria | 2970068827 | 2970070592 | 323 |
| 1597 | iso_pu_bacteria | 2970076120 | 2970077911 | 323 |
| 1598 | iso_pu_bacteria | 2970082768 | 2970085376 | 323 |
| 1599 | iso_pu_bacteria | 2970088815 | 2970089003 | 323 |
| 1600 | iso_pu_bacteria | 2970095765 | 2970099810 | 323 |
| 1601 | iso_pu_bacteria | 2970102677 | 2970105522 | 323 |
| 1602 | iso_pu_bacteria | 2970109326 | 2970113177 | 323 |
| 1603 | iso_pu_bacteria | 2970116247 | 2970121710 | 323 |
| 1604 | iso_pu_bacteria | 2970122695 | 2970123483 | 323 |
| 1605 | iso_pu_bacteria | 2970129317 | 2970131083 | 323 |
| 1606 | iso_pu_bacteria | 2970136068 | 2970138694 | 323 |
| 1607 | iso_pu_bacteria | 2970143518 | 2970144870 | 323 |
| 1608 | iso_pu_bacteria | 2970149975 | 2970152979 | 323 |
| 1609 | iso_pu_bacteria | 2970156795 | 2970156946 | 323 |
| 1610 | iso_pu_bacteria | 2970164137 | 2970164379 | 323 |
| 1611 | iso_pu_bacteria | 2970170962 | 2970173029 | 323 |
| 1612 | iso_pu_bacteria | 2970177841 | 2970183155 | 323 |
| 1613 | iso_pu_bacteria | 2970184632 | 2970190072 | 323 |
| 1614 | iso_pu_bacteria | 2970191845 | 2970192422 | 323 |
| 1615 | iso_pu_bacteria | 2977516862 | 2977522751 | 323 |
| 1616 | iso_pu_bacteria | 2977523885 | 2977526110 | 323 |
| 1617 | iso_pu_bacteria | 2977530762 | 2977534407 | 323 |
| 1618 | iso_pu_bacteria | 2977537788 | 2977543135 | 323 |
| 1619 | iso_pu_bacteria | 2977544691 | 2977546523 | 323 |
| 1620 | iso_pu_bacteria | 2977551784 | 2977555012 | 323 |
| 1621 | iso_pu_bacteria | 2977558990 | 2977561450 | 323 |
| 1622 | iso_pu_bacteria | 2977565890 | 2977572542 | 323 |
| 1623 | iso_pu_bacteria | 2977572785 | 2977575916 | 323 |
| 1624 | iso_pu_bacteria | 2977579622 | 2977580027 | 323 |
| 1625 | iso_pu_bacteria | 2989776772 | 2989781071 | 323 |
| 1626 | iso_pu_bacteria | 2996336353 | 2996341249 | 323 |
| 1627 | iso_pu_bacteria | 2996887358 | 2996892615 | 323 |
| 1628 | iso_pu_bacteria | 3000017691 | 3000020498 | 323 |
| 1629 | iso_pu_bacteria | 3005452660 | 3005455140 | 323 |
| 1630 | iso_pu_bacteria | 648276728 | 648736140 | 323 |
| 1631 | iso_pu_bacteria | 8003992118 | 8003998497 | 323 |
| 1632 | iso_pu_bacteria | 8003999396 | 8004002280 | 323 |
| 1633 | iso_pu_bacteria | 8005246636 | 8005251441 | 323 |
| 1634 | iso_pu_bacteria | 8005258706 | 8005264758 | 323 |
| 1635 | iso_pu_bacteria | 8005321885 | 8005327142 | 323 |
| 1636 | iso_pu_bacteria | 8005542996 | 8005546140 | 323 |
| 1637 | iso_pu_bacteria | 8005658619 | 8005661982 | 323 |
| 1638 | iso_pu_bacteria | 8054460903 | 8054464669 | 323 |
| 1639 | 3300005434 | Ga0070709_10005929 | Ga0070709_100059292 | 324 |
| 1640 | 3300005434 | Ga0070709_10034343 | Ga0070709_100343434 | 324 |
| 1641 | 3300005435 | Ga0070714_100016855 | Ga0070714_1000168553 | 324 |
| 1642 | 3300005435 | Ga0070714_100037888 | Ga0070714_1000378885 | 324 |
| 1643 | 3300005435 | Ga0070714_100560028 | Ga0070714_1005600281 | 324 |
| 1644 | 3300005436 | Ga0070713_100025962 | Ga0070713_1000259626 | 324 |
| 1645 | 3300005436 | Ga0070713_100074693 | Ga0070713_1000746932 | 324 |
| 1646 | 3300005436 | Ga0070713_100104650 | Ga0070713_1001046501 | 324 |
| 1647 | 3300005437 | Ga0070710_10022918 | Ga0070710_100229183 | 324 |
| 1648 | 3300005439 | Ga0070711_100000801 | Ga0070711_10000080111 | 324 |
| 1649 | 3300005439 | Ga0070711_100124150 | Ga0070711_1001241503 | 324 |
| 1650 | 3300005455 | Ga0070663_100027751 | Ga0070663_1000277512 | 324 |
| 1651 | 3300005548 | Ga0070665_100076161 | Ga0070665_1000761613 | 324 |
| 1652 | 3300005614 | Ga0068856_100006239 | Ga0068856_1000062397 | 324 |
| 1653 | 3300005841 | Ga0068863_100108817 | Ga0068863_1001088173 | 324 |
| 1654 | 3300006175 | Ga0070712_100171482 | Ga0070712_1001714822 | 324 |
| 1655 | 3300009545 | Ga0105237_10262249 | Ga0105237_102622492 | 324 |
| 1656 | 3300010159 | Ga0099796_10058848 | Ga0099796_100588481 | 324 |
| 1657 | 3300021358 | Ga0213873_10004680 | Ga0213873_100046802 | 324 |
| 1658 | 3300025898 | Ga0207692_10000504 | Ga0207692_100005043 | 324 |
| 1659 | 3300025906 | Ga0207699_10000508 | Ga0207699_1000050811 | 324 |
| 1660 | 3300025915 | Ga0207693_10160234 | Ga0207693_101602342 | 324 |
| 1661 | 3300025916 | Ga0207663_10000732 | Ga0207663_100007325 | 324 |
| 1662 | 3300025916 | Ga0207663_10034225 | Ga0207663_100342253 | 324 |
| 1663 | 3300025928 | Ga0207700_10056062 | Ga0207700_100560621 | 324 |
| 1664 | 3300025928 | Ga0207700_10074501 | Ga0207700_100745012 | 324 |
| 1665 | 3300025929 | Ga0207664_10018977 | Ga0207664_100189772 | 324 |
| 1666 | 3300025929 | Ga0207664_10131642 | Ga0207664_101316421 | 324 |
| 1667 | 3300026067 | Ga0207678_10079912 | Ga0207678_100799122 | 324 |
| 1668 | 3300026078 | Ga0207702_10008706 | Ga0207702_100087066 | 324 |
| 1669 | 3300028379 | Ga0268266_10277140 | Ga0268266_102771402 | 324 |
| 1670 | 3300031456 | Ga0307513_10175906 | Ga0307513_101759063 | 324 |
| 1671 | 3300035725 | Ga0373947_0032636 | Ga0373947_0032636_1932_2906 | 324 |
| 1672 | 3300037068 | Ga0373925_0022002 | Ga0373925_0022002_1439_2413 | 324 |
| 1673 | 3300039437 | Ga0436365_1332159 | Ga0436365_1332159_9185_10168 | 324 |
| 1674 | 3300039450 | Ga0436363_0502334 | Ga0436363_0502334_280_1266 | 324 |
| 1675 | 3300039453 | Ga0436362_0163701 | Ga0436362_0163701_336_1319 | 324 |
| 1676 | 3300045051 | Ga0451576_0007851 | Ga0451576_0007851_7021_8031 | 324 |
| 1677 | 3300046491 | Ga0495584_0105914 | Ga0495584_0105914_344_1327 | 324 |
| 1678 | 3300046512 | Ga0495610_0114606 | Ga0495610_0114606_43_1026 | 324 |
| 1679 | 3300046517 | Ga0495630_0098248 | Ga0495630_0098248_843_1817 | 324 |
| 1680 | 3300046533 | Ga0495640_0058151 | Ga0495640_0058151_1432_2406 | 324 |
| 1681 | 3300048091 | Ga0495626_0045815 | Ga0495626_0045815_107_1090 | 324 |
| 1682 | 3300048912 | Ga0496109_0169939 | Ga0496109_0169939_927_1925 | 324 |
| 1683 | 3300048916 | Ga0496113_0284026 | Ga0496113_0284026_213_1193 | 324 |
| 1684 | 3300048920 | Ga0496117_0011870 | Ga0496117_0011870_5119_6099 | 324 |
| 1685 | 3300048920 | Ga0496117_0065649 | Ga0496117_0065649_940_1920 | 324 |
| 1686 | 3300048923 | Ga0496120_0090646 | Ga0496120_0090646_15_995 | 324 |
| 1687 | 3300048925 | Ga0496122_0177611 | Ga0496122_0177611_280_1260 | 324 |
| 1688 | 3300048926 | Ga0496123_0078386 | Ga0496123_0078386_472_1452 | 324 |
| 1689 | 3300049569 | Ga0501032_0198364 | Ga0501032_0198364_41_1045 | 324 |
| 1690 | 3300049570 | Ga0501033_0196653 | Ga0501033_0196653_109_1089 | 324 |
| 1691 | 3300049573 | Ga0501037_0242343 | Ga0501037_0242343_21_1001 | 324 |
| 1692 | 3300049593 | Ga0501077_0069047 | Ga0501077_0069047_695_1678 | 324 |
| 1693 | 3300049744 | Ga0501083_0002243 | Ga0501083_0002243_6786_7769 | 324 |
| 1694 | 3300053079 | Ga0500610_0046673 | Ga0500610_0046673_368_1351 | 324 |
| 1695 | 3300053096 | Ga0500641_0065847 | Ga0500641_0065847_443_1429 | 324 |
| 1696 | 3300060353 | Ga0501082_0026891 | Ga0501082_0026891_3120_4103 | 324 |
| 1697 | iso_pu_bacteria | 2510917022 | 2511137334 | 324 |
| 1698 | iso_pu_bacteria | 2511231027 | 2511392108 | 324 |
| 1699 | iso_pu_bacteria | 2524023209 | 2524459100 | 324 |
| 1700 | iso_pu_bacteria | 2537561587 | 2537873019 | 324 |
| 1701 | iso_pu_bacteria | 2537561587 | 2537873641 | 324 |
| 1702 | iso_pu_bacteria | 2554235003 | 2554248900 | 324 |
| 1703 | iso_pu_bacteria | 2558860242 | 2559295988 | 324 |
| 1704 | iso_pu_bacteria | 2582581294 | 2585205754 | 324 |
| 1705 | iso_pu_bacteria | 2582581304 | 2585259283 | 324 |
| 1706 | iso_pu_bacteria | 2582581307 | 2585274067 | 324 |
| 1707 | iso_pu_bacteria | 2582581865 | 2585389302 | 324 |
| 1708 | iso_pu_bacteria | 2585427531 | 2585560517 | 324 |
| 1709 | iso_pu_bacteria | 2585427594 | 2585847505 | 324 |
| 1710 | iso_pu_bacteria | 2585427609 | 2585903701 | 324 |
| 1711 | iso_pu_bacteria | 2585428125 | 2587981180 | 324 |
| 1712 | iso_pu_bacteria | 2599185210 | 2599603219 | 324 |
| 1713 | iso_pu_bacteria | 2600255279 | 2601610876 | 324 |
| 1714 | iso_pu_bacteria | 2600255308 | 2601747650 | 324 |
| 1715 | iso_pu_bacteria | 2643221568 | 2643854920 | 324 |
| 1716 | iso_pu_bacteria | 2643221582 | 2643916789 | 324 |
| 1717 | iso_pu_bacteria | 2643221582 | 2643921512 | 324 |
| 1718 | iso_pu_bacteria | 2643221618 | 2644104959 | 324 |
| 1719 | iso_pu_bacteria | 2643221636 | 2644203132 | 324 |
| 1720 | iso_pu_bacteria | 2643221655 | 2644307501 | 324 |
| 1721 | iso_pu_bacteria | 2643221659 | 2644333971 | 324 |
| 1722 | iso_pu_bacteria | 2643221688 | 2644496569 | 324 |
| 1723 | iso_pu_bacteria | 2643221693 | 2644521566 | 324 |
| 1724 | iso_pu_bacteria | 2643221712 | 2644613585 | 324 |
| 1725 | iso_pu_bacteria | 2738541293 | 2738803285 | 324 |
| 1726 | iso_pu_bacteria | 2765235802 | 2765465970 | 324 |
| 1727 | iso_pu_bacteria | 2767802442 | 2770196606 | 324 |
| 1728 | iso_pu_bacteria | 2808606387 | 2808988186 | 324 |
| 1729 | iso_pu_bacteria | 2818991439 | 2819560998 | 324 |
| 1730 | iso_pu_bacteria | 2838675328 | 2838678394 | 324 |
| 1731 | iso_pu_bacteria | 2838675328 | 2838678634 | 324 |
| 1732 | iso_pu_bacteria | 2838714209 | 2838716698 | 324 |
| 1733 | iso_pu_bacteria | 2838714209 | 2838718278 | 324 |
| 1734 | iso_pu_bacteria | 2838719591 | 2838722690 | 324 |
| 1735 | iso_pu_bacteria | 2838719591 | 2838722930 | 324 |
| 1736 | iso_pu_bacteria | 2838724970 | 2838727449 | 324 |
| 1737 | iso_pu_bacteria | 2838724970 | 2838728344 | 324 |
| 1738 | iso_pu_bacteria | 2839993093 | 2839993603 | 324 |
| 1739 | iso_pu_bacteria | 2840764183 | 2840766624 | 324 |
| 1740 | iso_pu_bacteria | 2841846520 | 2841849079 | 324 |
| 1741 | iso_pu_bacteria | 2841846520 | 2841850486 | 324 |
| 1742 | iso_pu_bacteria | 2841859092 | 2841861898 | 324 |
| 1743 | iso_pu_bacteria | 2841859092 | 2841863262 | 324 |
| 1744 | iso_pu_bacteria | 2842124991 | 2842128172 | 324 |
| 1745 | iso_pu_bacteria | 2842124991 | 2842129004 | 324 |
| 1746 | iso_pu_bacteria | 2842130223 | 2842133287 | 324 |
| 1747 | iso_pu_bacteria | 2842130223 | 2842133526 | 324 |
| 1748 | iso_pu_bacteria | 2842152218 | 2842155280 | 324 |
| 1749 | iso_pu_bacteria | 2842152218 | 2842155562 | 324 |
| 1750 | iso_pu_bacteria | 2842170452 | 2842173780 | 324 |
| 1751 | iso_pu_bacteria | 2842170452 | 2842174480 | 324 |
| 1752 | iso_pu_bacteria | 2842175837 | 2842178901 | 324 |
| 1753 | iso_pu_bacteria | 2842175837 | 2842179140 | 324 |
| 1754 | iso_pu_bacteria | 2842187318 | 2842189806 | 324 |
| 1755 | iso_pu_bacteria | 2842187318 | 2842190702 | 324 |
| 1756 | iso_pu_bacteria | 2842211629 | 2842214120 | 324 |
| 1757 | iso_pu_bacteria | 2842211629 | 2842214974 | 324 |
| 1758 | iso_pu_bacteria | 2842224351 | 2842226840 | 324 |
| 1759 | iso_pu_bacteria | 2842224351 | 2842227695 | 324 |
| 1760 | iso_pu_bacteria | 2842298080 | 2842298453 | 324 |
| 1761 | iso_pu_bacteria | 2842333319 | 2842336912 | 324 |
| 1762 | iso_pu_bacteria | 2842357229 | 2842360465 | 324 |
| 1763 | iso_pu_bacteria | 2842509118 | 2842510482 | 324 |
| 1764 | iso_pu_bacteria | 2842515876 | 2842517836 | 324 |
| 1765 | iso_pu_bacteria | 2842515876 | 2842520001 | 324 |
| 1766 | iso_pu_bacteria | 2842871566 | 2842874917 | 324 |
| 1767 | iso_pu_bacteria | 2852387548 | 2852390906 | 324 |
| 1768 | iso_pu_bacteria | 2857576091 | 2857578694 | 324 |
| 1769 | iso_pu_bacteria | 2899792073 | 2899792985 | 324 |
| 1770 | iso_pu_bacteria | 2899792073 | 2899795359 | 324 |
| 1771 | iso_pu_bacteria | 2899845264 | 2899849338 | 324 |
| 1772 | iso_pu_bacteria | 2904578770 | 2904579699 | 324 |
| 1773 | iso_pu_bacteria | 2919114240 | 2919116915 | 324 |
| 1774 | iso_pu_bacteria | 2919114240 | 2919118464 | 324 |
| 1775 | iso_pu_bacteria | 2919119836 | 2919120634 | 324 |
| 1776 | iso_pu_bacteria | 2919166419 | 2919170551 | 324 |
| 1777 | iso_pu_bacteria | 2926754445 | 2926754994 | 324 |
| 1778 | iso_pu_bacteria | 2926754445 | 2926758428 | 324 |
| 1779 | iso_pu_bacteria | 2926760298 | 2926762157 | 324 |
| 1780 | iso_pu_bacteria | 2928521798 | 2928522498 | 324 |
| 1781 | iso_pu_bacteria | 2933006813 | 2933009341 | 324 |
| 1782 | iso_pu_bacteria | 2933006813 | 2933010589 | 324 |
| 1783 | iso_pu_bacteria | 2933011516 | 2933013465 | 324 |
| 1784 | iso_pu_bacteria | 2933011516 | 2933015739 | 324 |
| 1785 | iso_pu_bacteria | 2933594066 | 2933597523 | 324 |
| 1786 | iso_pu_bacteria | 2939669807 | 2939672003 | 324 |
| 1787 | iso_pu_bacteria | 2954011201 | 2954014106 | 324 |
| 1788 | iso_pu_bacteria | 2978969890 | 2978972646 | 324 |
| 1789 | iso_pu_bacteria | 2979089926 | 2979092573 | 324 |
| 1790 | iso_pu_bacteria | 2979095461 | 2979100036 | 324 |
| 1791 | iso_pu_bacteria | 2979100975 | 2979104545 | 324 |
| 1792 | iso_pu_bacteria | 2984509177 | 2984513660 | 324 |
| 1793 | iso_pu_bacteria | 2984518228 | 2984522760 | 324 |
| 1794 | iso_pu_bacteria | 2984537506 | 2984542067 | 324 |
| 1795 | iso_pu_bacteria | 2984587000 | 2984590898 | 324 |
| 1796 | iso_pu_bacteria | 2984601300 | 2984601497 | 324 |
| 1797 | iso_pu_bacteria | 650716007 | 650741203 | 324 |
| 1798 | iso_pu_bacteria | 8003570095 | 8003573125 | 324 |
| 1799 | iso_pu_bacteria | 8003570095 | 8003573735 | 324 |
| 1800 | iso_pu_bacteria | 8046767195 | 8046772547 | 324 |
| 1801 | iso_pu_bacteria | 8056875544 | 8056879741 | 324 |
| 1802 | 3300003214 | JGI25165J46597_1006314 | JGI25165J46597_10063142 | 325 |
| 1803 | 3300003214 | JGI25165J46597_1007664 | JGI25165J46597_10076642 | 325 |
| 1804 | 3300003215 | JGI25153J46596_10002078 | JGI25153J46596_100020785 | 325 |
| 1805 | 3300003771 | Ga0055526_1000017 | Ga0055526_100001738 | 325 |
| 1806 | 3300004625 | Ga0055543_1013268 | Ga0055543_10132682 | 325 |
| 1807 | 3300005262 | Ga0065165_1000231 | Ga0065165_10002315 | 325 |
| 1808 | 3300005262 | Ga0065165_1000313 | Ga0065165_100031350 | 325 |
| 1809 | 3300005327 | Ga0070658_10000595 | Ga0070658_1000059511 | 325 |
| 1810 | 3300005329 | Ga0070683_100105930 | Ga0070683_1001059302 | 325 |
| 1811 | 3300005331 | Ga0070670_100459691 | Ga0070670_1004596911 | 325 |
| 1812 | 3300005334 | Ga0068869_100021520 | Ga0068869_1000215203 | 325 |
| 1813 | 3300005335 | Ga0070666_10030238 | Ga0070666_100302382 | 325 |
| 1814 | 3300005434 | Ga0070709_10152872 | Ga0070709_101528722 | 325 |
| 1815 | 3300005435 | Ga0070714_100167505 | Ga0070714_1001675052 | 325 |
| 1816 | 3300005439 | Ga0070711_100191666 | Ga0070711_1001916662 | 325 |
| 1817 | 3300005455 | Ga0070663_100199670 | Ga0070663_1001996702 | 325 |
| 1818 | 3300005458 | Ga0070681_10120549 | Ga0070681_101205492 | 325 |
| 1819 | 3300005458 | Ga0070681_10130087 | Ga0070681_101300872 | 325 |
| 1820 | 3300005468 | Ga0070707_100232121 | Ga0070707_1002321211 | 325 |
| 1821 | 3300005530 | Ga0070679_100006164 | Ga0070679_1000061644 | 325 |
| 1822 | 3300005548 | Ga0070665_100012792 | Ga0070665_1000127927 | 325 |
| 1823 | 3300005563 | Ga0068855_100099355 | Ga0068855_1000993554 | 325 |
| 1824 | 3300005840 | Ga0068870_10124167 | Ga0068870_101241672 | 325 |
| 1825 | 3300005841 | Ga0068863_100209174 | Ga0068863_1002091741 | 325 |
| 1826 | 3300005844 | Ga0068862_100172162 | Ga0068862_1001721622 | 325 |
| 1827 | 3300005985 | Ga0081539_10013687 | Ga0081539_100136874 | 325 |
| 1828 | 3300006042 | Ga0075368_10034380 | Ga0075368_100343802 | 325 |
| 1829 | 3300006847 | Ga0075431_100020612 | Ga0075431_1000206123 | 325 |
| 1830 | 3300009093 | Ga0105240_10087081 | Ga0105240_100870812 | 325 |
| 1831 | 3300009093 | Ga0105240_10161270 | Ga0105240_101612702 | 325 |
| 1832 | 3300009093 | Ga0105240_10357390 | Ga0105240_103573902 | 325 |
| 1833 | 3300009174 | Ga0105241_10159157 | Ga0105241_101591572 | 325 |
| 1834 | 3300009545 | Ga0105237_10056057 | Ga0105237_100560572 | 325 |
| 1835 | 3300009551 | Ga0105238_10038211 | Ga0105238_100382113 | 325 |
| 1836 | 3300009551 | Ga0105238_10124082 | Ga0105238_101240823 | 325 |
| 1837 | 3300009551 | Ga0105238_10569175 | Ga0105238_105691752 | 325 |
| 1838 | 3300009553 | Ga0105249_10081287 | Ga0105249_100812872 | 325 |
| 1839 | 3300010375 | Ga0105239_10177443 | Ga0105239_101774432 | 325 |
| 1840 | 3300013105 | Ga0157369_10195153 | Ga0157369_101951532 | 325 |
| 1841 | 3300013297 | Ga0157378_10111532 | Ga0157378_101115322 | 325 |
| 1842 | 3300014325 | Ga0163163_10662111 | Ga0163163_106621112 | 325 |
| 1843 | 3300014326 | Ga0157380_10030596 | Ga0157380_100305963 | 325 |
| 1844 | 3300021384 | Ga0213876_10074564 | Ga0213876_100745642 | 325 |
| 1845 | 3300021384 | Ga0213876_10181579 | Ga0213876_101815791 | 325 |
| 1846 | 3300025261 | Ga0209233_1000613 | Ga0209233_100061314 | 325 |
| 1847 | 3300025284 | Ga0209130_1000209 | Ga0209130_100020923 | 325 |
| 1848 | 3300025294 | Ga0209025_1010153 | Ga0209025_10101536 | 325 |
| 1849 | 3300025294 | Ga0209025_1014934 | Ga0209025_10149341 | 325 |
| 1850 | 3300025909 | Ga0207705_10001941 | Ga0207705_100019415 | 325 |
| 1851 | 3300025912 | Ga0207707_10133884 | Ga0207707_101338843 | 325 |
| 1852 | 3300025912 | Ga0207707_10456026 | Ga0207707_104560261 | 325 |
| 1853 | 3300025913 | Ga0207695_10023254 | Ga0207695_100232542 | 325 |
| 1854 | 3300025913 | Ga0207695_10127350 | Ga0207695_101273502 | 325 |
| 1855 | 3300025913 | Ga0207695_10406203 | Ga0207695_104062031 | 325 |
| 1856 | 3300025913 | Ga0207695_10435917 | Ga0207695_104359171 | 325 |
| 1857 | 3300025914 | Ga0207671_10144931 | Ga0207671_101449312 | 325 |
| 1858 | 3300025916 | Ga0207663_10163460 | Ga0207663_101634602 | 325 |
| 1859 | 3300025917 | Ga0207660_10002161 | Ga0207660_100021614 | 325 |
| 1860 | 3300025919 | Ga0207657_10024387 | Ga0207657_100243872 | 325 |
| 1861 | 3300025924 | Ga0207694_10144217 | Ga0207694_101442172 | 325 |
| 1862 | 3300025942 | Ga0207689_10058267 | Ga0207689_100582672 | 325 |
| 1863 | 3300025949 | Ga0207667_10127690 | Ga0207667_101276903 | 325 |
| 1864 | 3300026078 | Ga0207702_10054191 | Ga0207702_100541912 | 325 |
| 1865 | 3300027666 | Ga0209282_1015395 | Ga0209282_10153953 | 325 |
| 1866 | 3300028379 | Ga0268266_10000594 | Ga0268266_1000059413 | 325 |
| 1867 | 3300028379 | Ga0268266_10113076 | Ga0268266_101130762 | 325 |
| 1868 | 3300028379 | Ga0268266_10251918 | Ga0268266_102519181 | 325 |
| 1869 | 3300028379 | Ga0268266_10280692 | Ga0268266_102806922 | 325 |
| 1870 | 3300028800 | Ga0265338_10001544 | Ga0265338_1000154432 | 325 |
| 1871 | 3300031238 | Ga0265332_10027782 | Ga0265332_100277821 | 325 |
| 1872 | 3300031238 | Ga0265332_10028322 | Ga0265332_100283222 | 325 |
| 1873 | 3300031241 | Ga0265325_10021210 | Ga0265325_100212102 | 325 |
| 1874 | 3300031247 | Ga0265340_10016580 | Ga0265340_100165804 | 325 |
| 1875 | 3300031247 | Ga0265340_10022812 | Ga0265340_100228123 | 325 |
| 1876 | 3300031250 | Ga0265331_10016364 | Ga0265331_100163641 | 325 |
| 1877 | 3300031344 | Ga0265316_10163938 | Ga0265316_101639382 | 325 |
| 1878 | 3300031595 | Ga0265313_10009374 | Ga0265313_100093747 | 325 |
| 1879 | 3300031711 | Ga0265314_10038822 | Ga0265314_100388221 | 325 |
| 1880 | 3300031712 | Ga0265342_10015115 | Ga0265342_100151153 | 325 |
| 1881 | 3300031712 | Ga0265342_10027918 | Ga0265342_100279182 | 325 |
| 1882 | 3300031995 | Ga0307409_100108590 | Ga0307409_1001085903 | 325 |
| 1883 | 3300033180 | Ga0307510_10137701 | Ga0307510_101377012 | 325 |
| 1884 | 3300035724 | Ga0373933_0229299 | Ga0373933_0229299_123_1109 | 325 |
| 1885 | 3300037853 | Ga0436364_1147744 | Ga0436364_1147744_1423_2403 | 325 |
| 1886 | 3300039437 | Ga0436365_0017591 | Ga0436365_0017591_737_1717 | 325 |
| 1887 | 3300039437 | Ga0436365_0920082 | Ga0436365_0920082_7253_8233 | 325 |
| 1888 | 3300044765 | Ga0466970_0121864 | Ga0466970_0121864_76_1062 | 325 |
| 1889 | 3300044901 | Ga0466960_0094443 | Ga0466960_0094443_425_1402 | 325 |
| 1890 | 3300045976 | Ga0466967_0102676 | Ga0466967_0102676_482_1525 | 325 |
| 1891 | 3300046460 | Ga0495638_0016499 | Ga0495638_0016499_1218_2195 | 325 |
| 1892 | 3300046492 | Ga0495585_0027859 | Ga0495585_0027859_1195_2172 | 325 |
| 1893 | 3300046515 | Ga0495620_0066403 | Ga0495620_0066403_422_1405 | 325 |
| 1894 | 3300046690 | Ga0495624_0189637 | Ga0495624_0189637_241_1221 | 325 |
| 1895 | 3300046691 | Ga0495670_0091987 | Ga0495670_0091987_516_1493 | 325 |
| 1896 | 3300047319 | Ga0495674_0044067 | Ga0495674_0044067_1208_2188 | 325 |
| 1897 | 3300048905 | Ga0496102_0039482 | Ga0496102_0039482_13_993 | 325 |
| 1898 | 3300048907 | Ga0496104_0276801 | Ga0496104_0276801_114_1094 | 325 |
| 1899 | 3300048908 | Ga0496105_0252534 | Ga0496105_0252534_384_1364 | 325 |
| 1900 | 3300048912 | Ga0496109_0463250 | Ga0496109_0463250_114_1094 | 325 |
| 1901 | 3300048913 | Ga0496110_0172954 | Ga0496110_0172954_458_1450 | 325 |
| 1902 | 3300048914 | Ga0496111_0207264 | Ga0496111_0207264_440_1432 | 325 |
| 1903 | 3300048915 | Ga0496112_0082097 | Ga0496112_0082097_787_1767 | 325 |
| 1904 | 3300048918 | Ga0496115_0368499 | Ga0496115_0368499_72_1058 | 325 |
| 1905 | 3300048921 | Ga0496118_0144860 | Ga0496118_0144860_213_1199 | 325 |
| 1906 | 3300048922 | Ga0496119_0140261 | Ga0496119_0140261_237_1223 | 325 |
| 1907 | 3300048925 | Ga0496122_0057097 | Ga0496122_0057097_1487_2470 | 325 |
| 1908 | 3300048929 | Ga0496126_0102611 | Ga0496126_0102611_854_1840 | 325 |
| 1909 | 3300049569 | Ga0501032_0238153 | Ga0501032_0238153_180_1166 | 325 |
| 1910 | 3300049571 | Ga0501034_0018360 | Ga0501034_0018360_3227_4213 | 325 |
| 1911 | 3300049571 | Ga0501034_0023629 | Ga0501034_0023629_5034_6011 | 325 |
| 1912 | 3300049571 | Ga0501034_0209902 | Ga0501034_0209902_235_1212 | 325 |
| 1913 | 3300049573 | Ga0501037_0131113 | Ga0501037_0131113_632_1615 | 325 |
| 1914 | 3300049574 | Ga0501038_0391569 | Ga0501038_0391569_48_1031 | 325 |
| 1915 | 3300049579 | Ga0501043_0129343 | Ga0501043_0129343_622_1605 | 325 |
| 1916 | 3300049579 | Ga0501043_0173770 | Ga0501043_0173770_470_1447 | 325 |
| 1917 | 3300049581 | Ga0501047_0011635 | Ga0501047_0011635_2401_3378 | 325 |
| 1918 | 3300049581 | Ga0501047_0137136 | Ga0501047_0137136_223_1200 | 325 |
| 1919 | 3300049581 | Ga0501047_0140640 | Ga0501047_0140640_964_1947 | 325 |
| 1920 | 3300049581 | Ga0501047_0158778 | Ga0501047_0158778_520_1512 | 325 |
| 1921 | 3300049581 | Ga0501047_0183852 | Ga0501047_0183852_169_1146 | 325 |
| 1922 | 3300049581 | Ga0501047_0391781 | Ga0501047_0391781_113_1096 | 325 |
| 1923 | 3300049586 | Ga0501070_0020723 | Ga0501070_0020723_2685_3662 | 325 |
| 1924 | 3300049591 | Ga0501075_0315670 | Ga0501075_0315670_101_1081 | 325 |
| 1925 | 3300049742 | Ga0501080_0129552 | Ga0501080_0129552_995_1978 | 325 |
| 1926 | 3300049822 | Ga0501035_0093817 | Ga0501035_0093817_981_1964 | 325 |
| 1927 | 3300049823 | Ga0501044_0034727 | Ga0501044_0034727_835_1812 | 325 |
| 1928 | 3300049823 | Ga0501044_0417700 | Ga0501044_0417700_192_1169 | 325 |
| 1929 | 3300053077 | Ga0495601_0019603 | Ga0495601_0019603_930_1910 | 325 |
| 1930 | 3300053084 | Ga0495595_0033870 | Ga0495595_0033870_1095_2075 | 325 |
| 1931 | 3300053085 | Ga0495619_0033841 | Ga0495619_0033841_691_1668 | 325 |
| 1932 | 3300053087 | Ga0500643_000008 | Ga0500643_000008_323419_324411 | 325 |
| 1933 | 3300053094 | Ga0500566_0016698 | Ga0500566_0016698_475_1461 | 325 |
| 1934 | 3300053105 | Ga0500557_000004 | Ga0500557_000004_73974_74960 | 325 |
| 1935 | 3300053119 | Ga0500595_002270 | Ga0500595_002270_3945_4931 | 325 |
| 1936 | 3300053119 | Ga0500595_004854 | Ga0500595_004854_3483_4460 | 325 |
| 1937 | 3300053130 | Ga0500642_0000133 | Ga0500642_0000133_29474_30460 | 325 |
| 1938 | 3300053139 | Ga0500568_0034341 | Ga0500568_0034341_841_1833 | 325 |
| 1939 | 3300053140 | Ga0500573_0000121 | Ga0500573_0000121_19502_20479 | 325 |
| 1940 | 3300053156 | Ga0500622_0000486 | Ga0500622_0000486_25183_26160 | 325 |
| 1941 | 3300053177 | Ga0500636_0048382 | Ga0500636_0048382_1241_2227 | 325 |
| 1942 | 3300053730 | Ga0500645_028192 | Ga0500645_028192_135_1112 | 325 |
| 1943 | 3300060353 | Ga0501082_0212025 | Ga0501082_0212025_417_1400 | 325 |
| 1944 | iso_pu_bacteria | 2643221643 | 2644242136 | 325 |
| 1945 | iso_pu_bacteria | 2643221736 | 2644746178 | 325 |
| 1946 | iso_pu_bacteria | 2841760612 | 2841766126 | 325 |
| 1947 | iso_pu_bacteria | 2844104063 | 2844105892 | 325 |
| 1948 | iso_pu_bacteria | 2851182111 | 2851186391 | 325 |
| 1949 | iso_pu_bacteria | 2851246043 | 2851246248 | 325 |
| 1950 | iso_pu_bacteria | 8057529695 | 8057531526 | 325 |
| 1951 | 3300005329 | Ga0070683_100133616 | Ga0070683_1001336162 | 326 |
| 1952 | 3300005336 | Ga0070680_100063360 | Ga0070680_1000633601 | 326 |
| 1953 | 3300005339 | Ga0070660_100015769 | Ga0070660_1000157695 | 326 |
| 1954 | 3300005344 | Ga0070661_100046657 | Ga0070661_1000466573 | 326 |
| 1955 | 3300005435 | Ga0070714_100022579 | Ga0070714_1000225795 | 326 |
| 1956 | 3300005458 | Ga0070681_10158097 | Ga0070681_101580972 | 326 |
| 1957 | 3300005546 | Ga0070696_100003819 | Ga0070696_1000038197 | 326 |
| 1958 | 3300005563 | Ga0068855_100236476 | Ga0068855_1002364762 | 326 |
| 1959 | 3300005616 | Ga0068852_100096341 | Ga0068852_1000963412 | 326 |
| 1960 | 3300005616 | Ga0068852_100366447 | Ga0068852_1003664472 | 326 |
| 1961 | 3300006175 | Ga0070712_100339038 | Ga0070712_1003390382 | 326 |
| 1962 | 3300006946 | Ga0079104_1009774 | Ga0079104_10097744 | 326 |
| 1963 | 3300006948 | Ga0099826_10079759 | Ga0099826_100797592 | 326 |
| 1964 | 3300007265 | Ga0099794_10087406 | Ga0099794_100874062 | 326 |
| 1965 | 3300007788 | Ga0099795_10006137 | Ga0099795_100061372 | 326 |
| 1966 | 3300021384 | Ga0213876_10018209 | Ga0213876_100182094 | 326 |
| 1967 | 3300021388 | Ga0213875_10000046 | Ga0213875_10000046102 | 326 |
| 1968 | 3300022739 | Ga0228711_1000045 | Ga0228711_10000456 | 326 |
| 1969 | 3300022740 | Ga0228710_1000036 | Ga0228710_100003696 | 326 |
| 1970 | 3300025245 | Ga0207425_1002206 | Ga0207425_10022062 | 326 |
| 1971 | 3300025258 | Ga0209129_1002679 | Ga0209129_10026798 | 326 |
| 1972 | 3300025294 | Ga0209025_1022482 | Ga0209025_10224823 | 326 |
| 1973 | 3300025294 | Ga0209025_1032144 | Ga0209025_10321442 | 326 |
| 1974 | 3300025297 | Ga0209758_1012600 | Ga0209758_10126002 | 326 |
| 1975 | 3300025297 | Ga0209758_1012869 | Ga0209758_10128692 | 326 |
| 1976 | 3300025912 | Ga0207707_10298046 | Ga0207707_102980462 | 326 |
| 1977 | 3300025917 | Ga0207660_10024327 | Ga0207660_100243273 | 326 |
| 1978 | 3300025919 | Ga0207657_10011619 | Ga0207657_100116195 | 326 |
| 1979 | 3300025920 | Ga0207649_10108977 | Ga0207649_101089771 | 326 |
| 1980 | 3300025921 | Ga0207652_10280474 | Ga0207652_102804741 | 326 |
| 1981 | 3300025921 | Ga0207652_10401741 | Ga0207652_104017411 | 326 |
| 1982 | 3300025929 | Ga0207664_10350825 | Ga0207664_103508252 | 326 |
| 1983 | 3300025944 | Ga0207661_10135602 | Ga0207661_101356022 | 326 |
| 1984 | 3300025949 | Ga0207667_10157624 | Ga0207667_101576242 | 326 |
| 1985 | 3300025949 | Ga0207667_10308230 | Ga0207667_103082301 | 326 |
| 1986 | 3300026142 | Ga0207698_10266057 | Ga0207698_102660572 | 326 |
| 1987 | 3300027111 | Ga0209281_1000178 | Ga0209281_100017823 | 326 |
| 1988 | 3300027111 | Ga0209281_1000417 | Ga0209281_100041767 | 326 |
| 1989 | 3300027666 | Ga0209282_1000023 | Ga0209282_100002349 | 326 |
| 1990 | 3300028556 | Ga0265337_1027756 | Ga0265337_10277561 | 326 |
| 1991 | 3300031241 | Ga0265325_10015145 | Ga0265325_100151454 | 326 |
| 1992 | 3300031247 | Ga0265340_10036542 | Ga0265340_100365422 | 326 |
| 1993 | 3300031456 | Ga0307513_10008284 | Ga0307513_1000828415 | 326 |
| 1994 | 3300031548 | Ga0307408_100033455 | Ga0307408_1000334552 | 326 |
| 1995 | 3300031711 | Ga0265314_10001108 | Ga0265314_1000110831 | 326 |
| 1996 | 3300031712 | Ga0265342_10000203 | Ga0265342_1000020310 | 326 |
| 1997 | 3300031967 | Ga0315914_1000016 | Ga0315914_10000166 | 326 |
| 1998 | 3300033430 | Ga0315913_1000027 | Ga0315913_100002788 | 326 |
| 1999 | 3300033464 | Ga0315915_1000007 | Ga0315915_100000784 | 326 |
| 2000 | 3300035118 | Ga0373954_0019863 | Ga0373954_0019863_1124_2104 | 326 |
| 2001 | 3300035119 | Ga0373956_0017449 | Ga0373956_0017449_469_1449 | 326 |
| 2002 | 3300035172 | Ga0373955_0004010 | Ga0373955_0004010_809_1789 | 326 |
| 2003 | 3300035695 | Ga0373927_0060671 | Ga0373927_0060671_1122_2102 | 326 |
| 2004 | 3300035724 | Ga0373933_0023829 | Ga0373933_0023829_2269_3249 | 326 |
| 2005 | 3300035724 | Ga0373933_0050166 | Ga0373933_0050166_1421_2401 | 326 |
| 2006 | 3300036401 | Ga0373937_0088397 | Ga0373937_0088397_154_1134 | 326 |
| 2007 | 3300037418 | Ga0395900_0162899 | Ga0395900_0162899_719_1702 | 326 |
| 2008 | 3300037853 | Ga0436364_0990934 | Ga0436364_0990934_11596_12576 | 326 |
| 2009 | 3300044694 | Ga0466963_0055803 | Ga0466963_0055803_883_1863 | 326 |
| 2010 | 3300044719 | Ga0466971_0030184 | Ga0466971_0030184_1308_2288 | 326 |
| 2011 | 3300044842 | Ga0466957_0018581 | Ga0466957_0018581_750_1730 | 326 |
| 2012 | 3300045049 | Ga0466959_0036483 | Ga0466959_0036483_2510_3490 | 326 |
| 2013 | 3300045051 | Ga0451576_0052322 | Ga0451576_0052322_1523_2503 | 326 |
| 2014 | 3300045051 | Ga0451576_0342508 | Ga0451576_0342508_115_1095 | 326 |
| 2015 | 3300045976 | Ga0466967_0054386 | Ga0466967_0054386_1907_2887 | 326 |
| 2016 | 3300046476 | Ga0495662_0007582 | Ga0495662_0007582_1396_2433 | 326 |
| 2017 | 3300046514 | Ga0495618_0113401 | Ga0495618_0113401_717_1697 | 326 |
| 2018 | 3300046557 | Ga0495622_0005250 | Ga0495622_0005250_3420_4457 | 326 |
| 2019 | 3300046559 | Ga0495667_0019175 | Ga0495667_0019175_3039_4019 | 326 |
| 2020 | 3300046642 | Ga0495634_0119794 | Ga0495634_0119794_444_1481 | 326 |
| 2021 | 3300046683 | Ga0495658_0078031 | Ga0495658_0078031_65_1102 | 326 |
| 2022 | 3300047317 | Ga0495604_0003714 | Ga0495604_0003714_3328_4365 | 326 |
| 2023 | 3300047317 | Ga0495604_0040829 | Ga0495604_0040829_1678_2658 | 326 |
| 2024 | 3300048913 | Ga0496110_0160498 | Ga0496110_0160498_240_1226 | 326 |
| 2025 | 3300049571 | Ga0501034_0124971 | Ga0501034_0124971_1074_2060 | 326 |
| 2026 | 3300049573 | Ga0501037_0051520 | Ga0501037_0051520_982_1962 | 326 |
| 2027 | 3300049574 | Ga0501038_0082991 | Ga0501038_0082991_218_1201 | 326 |
| 2028 | 3300049579 | Ga0501043_0031243 | Ga0501043_0031243_1485_2468 | 326 |
| 2029 | 3300049581 | Ga0501047_0032514 | Ga0501047_0032514_823_1803 | 326 |
| 2030 | 3300049581 | Ga0501047_0283845 | Ga0501047_0283845_148_1131 | 326 |
| 2031 | 3300049584 | Ga0501068_0221066 | Ga0501068_0221066_119_1108 | 326 |
| 2032 | 3300049586 | Ga0501070_0026632 | Ga0501070_0026632_1044_2027 | 326 |
| 2033 | 3300049589 | Ga0501073_0194279 | Ga0501073_0194279_145_1128 | 326 |
| 2034 | 3300049741 | Ga0501079_0032061 | Ga0501079_0032061_822_1811 | 326 |
| 2035 | 3300049776 | Ga0501280_006888 | Ga0501280_006888_248_1228 | 326 |
| 2036 | 3300049822 | Ga0501035_0219976 | Ga0501035_0219976_379_1365 | 326 |
| 2037 | 3300049822 | Ga0501035_0349186 | Ga0501035_0349186_29_1009 | 326 |
| 2038 | 3300049823 | Ga0501044_0013256 | Ga0501044_0013256_2826_3809 | 326 |
| 2039 | 3300049823 | Ga0501044_0132604 | Ga0501044_0132604_585_1565 | 326 |
| 2040 | 3300049824 | Ga0501045_0204455 | Ga0501045_0204455_248_1237 | 326 |
| 2041 | 3300053077 | Ga0495601_0077667 | Ga0495601_0077667_163_1143 | 326 |
| 2042 | 3300053078 | Ga0495612_0007681 | Ga0495612_0007681_2501_3481 | 326 |
| 2043 | 3300053084 | Ga0495595_0018863 | Ga0495595_0018863_959_1939 | 326 |
| 2044 | 3300053084 | Ga0495595_0035357 | Ga0495595_0035357_986_1966 | 326 |
| 2045 | 3300053085 | Ga0495619_0040427 | Ga0495619_0040427_426_1406 | 326 |
| 2046 | 3300053122 | Ga0500608_015411 | Ga0500608_015411_1489_2469 | 326 |
| 2047 | 3300053139 | Ga0500568_0000116 | Ga0500568_0000116_27096_28076 | 326 |
| 2048 | 3300053148 | Ga0500590_063879 | Ga0500590_063879_317_1354 | 326 |
| 2049 | 3300053157 | Ga0500624_002151 | Ga0500624_002151_688_1698 | 326 |
| 2050 | 3300053161 | Ga0500634_0000005 | Ga0500634_0000005_142895_143875 | 326 |
| 2051 | 3300060353 | Ga0501082_0110103 | Ga0501082_0110103_394_1374 | 326 |
| 2052 | 3300061719 | Ga0466962_0100198 | Ga0466962_0100198_332_1312 | 326 |
| 2053 | 3300061734 | Ga0530510_0216307 | Ga0530510_0216307_338_1327 | 326 |
| 2054 | iso_pu_bacteria | 2919679072 | 2919680441 | 326 |
| 2055 | iso_pu_bacteria | 8024486573 | 8024488524 | 326 |
| 2056 | 3300002459 | JGI24751J29686_10002245 | JGI24751J29686_100022452 | 327 |
| 2057 | 3300003771 | Ga0055526_1013167 | Ga0055526_10131673 | 327 |
| 2058 | 3300003775 | Ga0055524_1003714 | Ga0055524_10037148 | 327 |
| 2059 | 3300003781 | Ga0055536_1004308 | Ga0055536_10043082 | 327 |
| 2060 | 3300003790 | Ga0055528_1011971 | Ga0055528_10119711 | 327 |
| 2061 | 3300003790 | Ga0055528_1035106 | Ga0055528_10351061 | 327 |
| 2062 | 3300003792 | Ga0055540_1000925 | Ga0055540_100092510 | 327 |
| 2063 | 3300003794 | Ga0055531_10000685 | Ga0055531_1000068516 | 327 |
| 2064 | 3300005262 | Ga0065165_1008460 | Ga0065165_10084604 | 327 |
| 2065 | 3300005330 | Ga0070690_100020090 | Ga0070690_1000200901 | 327 |
| 2066 | 3300005331 | Ga0070670_100130783 | Ga0070670_1001307833 | 327 |
| 2067 | 3300005334 | Ga0068869_100151919 | Ga0068869_1001519192 | 327 |
| 2068 | 3300005338 | Ga0068868_100064476 | Ga0068868_1000644762 | 327 |
| 2069 | 3300005340 | Ga0070689_100006652 | Ga0070689_1000066523 | 327 |
| 2070 | 3300005340 | Ga0070689_100007446 | Ga0070689_1000074467 | 327 |
| 2071 | 3300005343 | Ga0070687_100025536 | Ga0070687_1000255364 | 327 |
| 2072 | 3300005347 | Ga0070668_100098437 | Ga0070668_1000984373 | 327 |
| 2073 | 3300005347 | Ga0070668_100156759 | Ga0070668_1001567592 | 327 |
| 2074 | 3300005347 | Ga0070668_100308329 | Ga0070668_1003083291 | 327 |
| 2075 | 3300005355 | Ga0070671_100078678 | Ga0070671_1000786782 | 327 |
| 2076 | 3300005356 | Ga0070674_100025155 | Ga0070674_1000251552 | 327 |
| 2077 | 3300005365 | Ga0070688_100012599 | Ga0070688_1000125992 | 327 |
| 2078 | 3300005365 | Ga0070688_100018867 | Ga0070688_1000188674 | 327 |
| 2079 | 3300005367 | Ga0070667_100005456 | Ga0070667_1000054563 | 327 |
| 2080 | 3300005437 | Ga0070710_10141687 | Ga0070710_101416872 | 327 |
| 2081 | 3300005439 | Ga0070711_100076598 | Ga0070711_1000765982 | 327 |
| 2082 | 3300005439 | Ga0070711_100350158 | Ga0070711_1003501581 | 327 |
| 2083 | 3300005455 | Ga0070663_100025745 | Ga0070663_1000257453 | 327 |
| 2084 | 3300005455 | Ga0070663_100141408 | Ga0070663_1001414082 | 327 |
| 2085 | 3300005456 | Ga0070678_100011827 | Ga0070678_1000118275 | 327 |
| 2086 | 3300005456 | Ga0070678_100043922 | Ga0070678_1000439222 | 327 |
| 2087 | 3300005459 | Ga0068867_100355548 | Ga0068867_1003555481 | 327 |
| 2088 | 3300005468 | Ga0070707_100039104 | Ga0070707_1000391042 | 327 |
| 2089 | 3300005518 | Ga0070699_100021616 | Ga0070699_1000216162 | 327 |
| 2090 | 3300005518 | Ga0070699_100272384 | Ga0070699_1002723842 | 327 |
| 2091 | 3300005530 | Ga0070679_100532617 | Ga0070679_1005326171 | 327 |
| 2092 | 3300005544 | Ga0070686_100262069 | Ga0070686_1002620691 | 327 |
| 2093 | 3300005563 | Ga0068855_100013001 | Ga0068855_1000130013 | 327 |
| 2094 | 3300005564 | Ga0070664_100338396 | Ga0070664_1003383961 | 327 |
| 2095 | 3300005578 | Ga0068854_100107749 | Ga0068854_1001077492 | 327 |
| 2096 | 3300005616 | Ga0068852_100009087 | Ga0068852_1000090874 | 327 |
| 2097 | 3300005617 | Ga0068859_100024736 | Ga0068859_1000247362 | 327 |
| 2098 | 3300005618 | Ga0068864_100012375 | Ga0068864_1000123756 | 327 |
| 2099 | 3300005719 | Ga0068861_100007871 | Ga0068861_1000078716 | 327 |
| 2100 | 3300005840 | Ga0068870_10001906 | Ga0068870_100019063 | 327 |
| 2101 | 3300005841 | Ga0068863_100009237 | Ga0068863_1000092375 | 327 |
| 2102 | 3300005842 | Ga0068858_100019146 | Ga0068858_1000191466 | 327 |
| 2103 | 3300005843 | Ga0068860_100079823 | Ga0068860_1000798231 | 327 |
| 2104 | 3300005843 | Ga0068860_100388544 | Ga0068860_1003885442 | 327 |
| 2105 | 3300005937 | Ga0081455_10003542 | Ga0081455_100035425 | 327 |
| 2106 | 3300005983 | Ga0081540_1002311 | Ga0081540_10023118 | 327 |
| 2107 | 3300006038 | Ga0075365_10041629 | Ga0075365_100416293 | 327 |
| 2108 | 3300006042 | Ga0075368_10050834 | Ga0075368_100508342 | 327 |
| 2109 | 3300006175 | Ga0070712_100002508 | Ga0070712_1000025082 | 327 |
| 2110 | 3300006175 | Ga0070712_100004561 | Ga0070712_1000045612 | 327 |
| 2111 | 3300006175 | Ga0070712_100136445 | Ga0070712_1001364451 | 327 |
| 2112 | 3300006178 | Ga0075367_10002480 | Ga0075367_100024804 | 327 |
| 2113 | 3300006178 | Ga0075367_10039443 | Ga0075367_100394432 | 327 |
| 2114 | 3300006178 | Ga0075367_10164023 | Ga0075367_101640231 | 327 |
| 2115 | 3300006186 | Ga0075369_10009394 | Ga0075369_100093945 | 327 |
| 2116 | 3300006237 | Ga0097621_100051087 | Ga0097621_1000510874 | 327 |
| 2117 | 3300006358 | Ga0068871_100005378 | Ga0068871_1000053782 | 327 |
| 2118 | 3300006844 | Ga0075428_100001220 | Ga0075428_10000122021 | 327 |
| 2119 | 3300006844 | Ga0075428_100053554 | Ga0075428_1000535545 | 327 |
| 2120 | 3300006844 | Ga0075428_100159065 | Ga0075428_1001590651 | 327 |
| 2121 | 3300006846 | Ga0075430_100002472 | Ga0075430_10000247210 | 327 |
| 2122 | 3300006847 | Ga0075431_100000109 | Ga0075431_10000010939 | 327 |
| 2123 | 3300006880 | Ga0075429_100022955 | Ga0075429_1000229555 | 327 |
| 2124 | 3300006880 | Ga0075429_100090593 | Ga0075429_1000905932 | 327 |
| 2125 | 3300006881 | Ga0068865_100038875 | Ga0068865_1000388754 | 327 |
| 2126 | 3300006931 | Ga0097620_100024736 | Ga0097620_1000247362 | 327 |
| 2127 | 3300006946 | Ga0079104_1000063 | Ga0079104_1000063150 | 327 |
| 2128 | 3300006946 | Ga0079104_1007401 | Ga0079104_10074012 | 327 |
| 2129 | 3300007265 | Ga0099794_10018011 | Ga0099794_100180113 | 327 |
| 2130 | 3300009036 | Ga0105244_10078544 | Ga0105244_100785442 | 327 |
| 2131 | 3300009092 | Ga0105250_10026489 | Ga0105250_100264892 | 327 |
| 2132 | 3300009093 | Ga0105240_10044678 | Ga0105240_100446784 | 327 |
| 2133 | 3300009093 | Ga0105240_10305535 | Ga0105240_103055352 | 327 |
| 2134 | 3300009094 | Ga0111539_10061693 | Ga0111539_100616933 | 327 |
| 2135 | 3300009098 | Ga0105245_10137928 | Ga0105245_101379282 | 327 |
| 2136 | 3300009101 | Ga0105247_10011005 | Ga0105247_100110052 | 327 |
| 2137 | 3300009147 | Ga0114129_10000425 | Ga0114129_1000042535 | 327 |
| 2138 | 3300009147 | Ga0114129_10089914 | Ga0114129_100899143 | 327 |
| 2139 | 3300009147 | Ga0114129_10157237 | Ga0114129_101572372 | 327 |
| 2140 | 3300009147 | Ga0114129_10281742 | Ga0114129_102817422 | 327 |
| 2141 | 3300009147 | Ga0114129_10341581 | Ga0114129_103415812 | 327 |
| 2142 | 3300009148 | Ga0105243_10128637 | Ga0105243_101286372 | 327 |
| 2143 | 3300009176 | Ga0105242_10127953 | Ga0105242_101279532 | 327 |
| 2144 | 3300009177 | Ga0105248_10002392 | Ga0105248_1000239213 | 327 |
| 2145 | 3300009177 | Ga0105248_10098637 | Ga0105248_100986374 | 327 |
| 2146 | 3300009177 | Ga0105248_10339674 | Ga0105248_103396742 | 327 |
| 2147 | 3300009551 | Ga0105238_10246639 | Ga0105238_102466391 | 327 |
| 2148 | 3300009553 | Ga0105249_10134656 | Ga0105249_101346562 | 327 |
| 2149 | 3300010375 | Ga0105239_10326482 | Ga0105239_103264822 | 327 |
| 2150 | 3300011119 | Ga0105246_10008619 | Ga0105246_100086193 | 327 |
| 2151 | 3300011119 | Ga0105246_10066455 | Ga0105246_100664552 | 327 |
| 2152 | 3300013100 | Ga0157373_10071974 | Ga0157373_100719741 | 327 |
| 2153 | 3300013100 | Ga0157373_10261002 | Ga0157373_102610021 | 327 |
| 2154 | 3300013102 | Ga0157371_10069114 | Ga0157371_100691142 | 327 |
| 2155 | 3300013104 | Ga0157370_10306328 | Ga0157370_103063281 | 327 |
| 2156 | 3300013105 | Ga0157369_10202001 | Ga0157369_102020012 | 327 |
| 2157 | 3300013250 | Ga0171462_1008 | Ga0171462_1008337 | 327 |
| 2158 | 3300013296 | Ga0157374_10006671 | Ga0157374_100066713 | 327 |
| 2159 | 3300013296 | Ga0157374_10073552 | Ga0157374_100735523 | 327 |
| 2160 | 3300013297 | Ga0157378_10035361 | Ga0157378_100353611 | 327 |
| 2161 | 3300013307 | Ga0157372_10587039 | Ga0157372_105870391 | 327 |
| 2162 | 3300013308 | Ga0157375_10035164 | Ga0157375_100351643 | 327 |
| 2163 | 3300013308 | Ga0157375_10163308 | Ga0157375_101633082 | 327 |
| 2164 | 3300014325 | Ga0163163_10010637 | Ga0163163_100106378 | 327 |
| 2165 | 3300014326 | Ga0157380_10080263 | Ga0157380_100802632 | 327 |
| 2166 | 3300014745 | Ga0157377_10004065 | Ga0157377_100040652 | 327 |
| 2167 | 3300014968 | Ga0157379_10474868 | Ga0157379_104748682 | 327 |
| 2168 | 3300017792 | Ga0163161_10057076 | Ga0163161_100570762 | 327 |
| 2169 | 3300020070 | Ga0206356_10305157 | Ga0206356_103051572 | 327 |
| 2170 | 3300020082 | Ga0206353_11216187 | Ga0206353_112161871 | 327 |
| 2171 | 3300022739 | Ga0228711_1000184 | Ga0228711_100018412 | 327 |
| 2172 | 3300022740 | Ga0228710_1000177 | Ga0228710_100017713 | 327 |
| 2173 | 3300025254 | Ga0209148_1001606 | Ga0209148_10016065 | 327 |
| 2174 | 3300025258 | Ga0209129_1001403 | Ga0209129_10014035 | 327 |
| 2175 | 3300025272 | Ga0209455_1001291 | Ga0209455_10012914 | 327 |
| 2176 | 3300025273 | Ga0209673_1014457 | Ga0209673_10144572 | 327 |
| 2177 | 3300025273 | Ga0209673_1028115 | Ga0209673_10281152 | 327 |
| 2178 | 3300025294 | Ga0209025_1014358 | Ga0209025_10143582 | 327 |
| 2179 | 3300025295 | Ga0209564_1003161 | Ga0209564_10031612 | 327 |
| 2180 | 3300025297 | Ga0209758_1000130 | Ga0209758_100013099 | 327 |
| 2181 | 3300025297 | Ga0209758_1028720 | Ga0209758_10287202 | 327 |
| 2182 | 3300025299 | Ga0209256_1008788 | Ga0209256_10087887 | 327 |
| 2183 | 3300025299 | Ga0209256_1013348 | Ga0209256_10133482 | 327 |
| 2184 | 3300025302 | Ga0207426_1006212 | Ga0207426_10062124 | 327 |
| 2185 | 3300025303 | Ga0209051_1004806 | Ga0209051_10048066 | 327 |
| 2186 | 3300025303 | Ga0209051_1005181 | Ga0209051_10051816 | 327 |
| 2187 | 3300025304 | Ga0209257_1003615 | Ga0209257_10036156 | 327 |
| 2188 | 3300025315 | Ga0207697_10026362 | Ga0207697_100263622 | 327 |
| 2189 | 3300025899 | Ga0207642_10056938 | Ga0207642_100569382 | 327 |
| 2190 | 3300025900 | Ga0207710_10004939 | Ga0207710_100049392 | 327 |
| 2191 | 3300025901 | Ga0207688_10000344 | Ga0207688_100003445 | 327 |
| 2192 | 3300025901 | Ga0207688_10238146 | Ga0207688_102381461 | 327 |
| 2193 | 3300025903 | Ga0207680_10038874 | Ga0207680_100388742 | 327 |
| 2194 | 3300025904 | Ga0207647_10030957 | Ga0207647_100309572 | 327 |
| 2195 | 3300025906 | Ga0207699_10096390 | Ga0207699_100963902 | 327 |
| 2196 | 3300025907 | Ga0207645_10007988 | Ga0207645_100079885 | 327 |
| 2197 | 3300025907 | Ga0207645_10013416 | Ga0207645_100134163 | 327 |
| 2198 | 3300025908 | Ga0207643_10008419 | Ga0207643_100084194 | 327 |
| 2199 | 3300025910 | Ga0207684_10203617 | Ga0207684_102036172 | 327 |
| 2200 | 3300025911 | Ga0207654_10122151 | Ga0207654_101221512 | 327 |
| 2201 | 3300025914 | Ga0207671_10210293 | Ga0207671_102102931 | 327 |
| 2202 | 3300025915 | Ga0207693_10004810 | Ga0207693_1000481010 | 327 |
| 2203 | 3300025915 | Ga0207693_10009374 | Ga0207693_100093743 | 327 |
| 2204 | 3300025915 | Ga0207693_10012513 | Ga0207693_100125136 | 327 |
| 2205 | 3300025915 | Ga0207693_10100901 | Ga0207693_101009013 | 327 |
| 2206 | 3300025915 | Ga0207693_10127360 | Ga0207693_101273602 | 327 |
| 2207 | 3300025918 | Ga0207662_10005862 | Ga0207662_100058625 | 327 |
| 2208 | 3300025922 | Ga0207646_10007326 | Ga0207646_1000732611 | 327 |
| 2209 | 3300025922 | Ga0207646_10103953 | Ga0207646_101039532 | 327 |
| 2210 | 3300025923 | Ga0207681_10028104 | Ga0207681_100281043 | 327 |
| 2211 | 3300025923 | Ga0207681_10041178 | Ga0207681_100411781 | 327 |
| 2212 | 3300025926 | Ga0207659_10019408 | Ga0207659_100194082 | 327 |
| 2213 | 3300025928 | Ga0207700_10286364 | Ga0207700_102863641 | 327 |
| 2214 | 3300025931 | Ga0207644_10007463 | Ga0207644_100074632 | 327 |
| 2215 | 3300025931 | Ga0207644_10053055 | Ga0207644_100530552 | 327 |
| 2216 | 3300025933 | Ga0207706_10003979 | Ga0207706_100039798 | 327 |
| 2217 | 3300025933 | Ga0207706_10377048 | Ga0207706_103770481 | 327 |
| 2218 | 3300025934 | Ga0207686_10023021 | Ga0207686_100230212 | 327 |
| 2219 | 3300025935 | Ga0207709_10013217 | Ga0207709_100132172 | 327 |
| 2220 | 3300025936 | Ga0207670_10004303 | Ga0207670_100043033 | 327 |
| 2221 | 3300025936 | Ga0207670_10010975 | Ga0207670_100109754 | 327 |
| 2222 | 3300025936 | Ga0207670_10107671 | Ga0207670_101076712 | 327 |
| 2223 | 3300025937 | Ga0207669_10145014 | Ga0207669_101450141 | 327 |
| 2224 | 3300025938 | Ga0207704_10010576 | Ga0207704_100105762 | 327 |
| 2225 | 3300025938 | Ga0207704_10123145 | Ga0207704_101231452 | 327 |
| 2226 | 3300025939 | Ga0207665_10217331 | Ga0207665_102173312 | 327 |
| 2227 | 3300025940 | Ga0207691_10005727 | Ga0207691_100057277 | 327 |
| 2228 | 3300025940 | Ga0207691_10080795 | Ga0207691_100807953 | 327 |
| 2229 | 3300025941 | Ga0207711_10257644 | Ga0207711_102576442 | 327 |
| 2230 | 3300025942 | Ga0207689_10023847 | Ga0207689_100238474 | 327 |
| 2231 | 3300025960 | Ga0207651_10045102 | Ga0207651_100451023 | 327 |
| 2232 | 3300025961 | Ga0207712_10013285 | Ga0207712_100132854 | 327 |
| 2233 | 3300025972 | Ga0207668_10137408 | Ga0207668_101374082 | 327 |
| 2234 | 3300025986 | Ga0207658_10155695 | Ga0207658_101556951 | 327 |
| 2235 | 3300025986 | Ga0207658_10433128 | Ga0207658_104331281 | 327 |
| 2236 | 3300026035 | Ga0207703_10011007 | Ga0207703_100110076 | 327 |
| 2237 | 3300026041 | Ga0207639_10087124 | Ga0207639_100871241 | 327 |
| 2238 | 3300026067 | Ga0207678_10010214 | Ga0207678_100102142 | 327 |
| 2239 | 3300026067 | Ga0207678_10535513 | Ga0207678_105355131 | 327 |
| 2240 | 3300026075 | Ga0207708_10003612 | Ga0207708_100036126 | 327 |
| 2241 | 3300026075 | Ga0207708_10229961 | Ga0207708_102299612 | 327 |
| 2242 | 3300026078 | Ga0207702_10029050 | Ga0207702_100290503 | 327 |
| 2243 | 3300026088 | Ga0207641_10010010 | Ga0207641_100100105 | 327 |
| 2244 | 3300026095 | Ga0207676_10001967 | Ga0207676_100019679 | 327 |
| 2245 | 3300026116 | Ga0207674_10181948 | Ga0207674_101819482 | 327 |
| 2246 | 3300026118 | Ga0207675_100012148 | Ga0207675_1000121488 | 327 |
| 2247 | 3300026121 | Ga0207683_10008437 | Ga0207683_100084376 | 327 |
| 2248 | 3300026142 | Ga0207698_10011789 | Ga0207698_100117896 | 327 |
| 2249 | 3300027111 | Ga0209281_1000082 | Ga0209281_1000082246 | 327 |
| 2250 | 3300027111 | Ga0209281_1000110 | Ga0209281_1000110147 | 327 |
| 2251 | 3300027111 | Ga0209281_1000459 | Ga0209281_100045920 | 327 |
| 2252 | 3300027666 | Ga0209282_1000006 | Ga0209282_1000006268 | 327 |
| 2253 | 3300027671 | Ga0209588_1031076 | Ga0209588_10310762 | 327 |
| 2254 | 3300027907 | Ga0207428_10006066 | Ga0207428_100060664 | 327 |
| 2255 | 3300028381 | Ga0268264_10008605 | Ga0268264_100086056 | 327 |
| 2256 | 3300028794 | Ga0307515_10012438 | Ga0307515_100124383 | 327 |
| 2257 | 3300028794 | Ga0307515_10138425 | Ga0307515_101384252 | 327 |
| 2258 | 3300028794 | Ga0307515_10300625 | Ga0307515_103006251 | 327 |
| 2259 | 3300030522 | Ga0307512_10145519 | Ga0307512_101455192 | 327 |
| 2260 | 3300031241 | Ga0265325_10001708 | Ga0265325_1000170813 | 327 |
| 2261 | 3300031241 | Ga0265325_10004418 | Ga0265325_100044184 | 327 |
| 2262 | 3300031247 | Ga0265340_10000573 | Ga0265340_1000057318 | 327 |
| 2263 | 3300031247 | Ga0265340_10009717 | Ga0265340_100097175 | 327 |
| 2264 | 3300031249 | Ga0265339_10001994 | Ga0265339_100019947 | 327 |
| 2265 | 3300031456 | Ga0307513_10065459 | Ga0307513_100654592 | 327 |
| 2266 | 3300031595 | Ga0265313_10000176 | Ga0265313_100001768 | 327 |
| 2267 | 3300031595 | Ga0265313_10006492 | Ga0265313_100064927 | 327 |
| 2268 | 3300031665 | Ga0316575_10023815 | Ga0316575_100238153 | 327 |
| 2269 | 3300031712 | Ga0265342_10000175 | Ga0265342_1000017523 | 327 |
| 2270 | 3300031730 | Ga0307516_10149293 | Ga0307516_101492932 | 327 |
| 2271 | 3300031731 | Ga0307405_10091050 | Ga0307405_100910501 | 327 |
| 2272 | 3300031967 | Ga0315914_1000003 | Ga0315914_1000003323 | 327 |
| 2273 | 3300033430 | Ga0315913_1000001 | Ga0315913_1000001274 | 327 |
| 2274 | 3300033464 | Ga0315915_1000008 | Ga0315915_100000813 | 327 |
| 2275 | 3300034817 | Ga0373948_0011197 | Ga0373948_0011197_446_1429 | 327 |
| 2276 | 3300035089 | Ga0373944_0008316 | Ga0373944_0008316_313_1296 | 327 |
| 2277 | 3300035113 | Ga0373936_0006776 | Ga0373936_0006776_354_1337 | 327 |
| 2278 | 3300035116 | Ga0373945_0011091 | Ga0373945_0011091_972_1955 | 327 |
| 2279 | 3300035116 | Ga0373945_0105284 | Ga0373945_0105284_17_1000 | 327 |
| 2280 | 3300035117 | Ga0373953_0003117 | Ga0373953_0003117_2388_3371 | 327 |
| 2281 | 3300035118 | Ga0373954_0006503 | Ga0373954_0006503_854_1837 | 327 |
| 2282 | 3300035119 | Ga0373956_0001924 | Ga0373956_0001924_185_1168 | 327 |
| 2283 | 3300035120 | Ga0373957_0093016 | Ga0373957_0093016_164_1147 | 327 |
| 2284 | 3300035121 | Ga0373960_0003540 | Ga0373960_0003540_1403_2386 | 327 |
| 2285 | 3300035170 | Ga0373943_0072402 | Ga0373943_0072402_453_1436 | 327 |
| 2286 | 3300035171 | Ga0373946_0024197 | Ga0373946_0024197_914_1897 | 327 |
| 2287 | 3300035172 | Ga0373955_0159577 | Ga0373955_0159577_191_1174 | 327 |
| 2288 | 3300035691 | Ga0373931_0015912 | Ga0373931_0015912_1734_2717 | 327 |
| 2289 | 3300035691 | Ga0373931_0025006 | Ga0373931_0025006_1510_2493 | 327 |
| 2290 | 3300035692 | Ga0373935_0205609 | Ga0373935_0205609_45_1028 | 327 |
| 2291 | 3300035695 | Ga0373927_0007289 | Ga0373927_0007289_4612_5595 | 327 |
| 2292 | 3300035695 | Ga0373927_0095942 | Ga0373927_0095942_276_1259 | 327 |
| 2293 | 3300035724 | Ga0373933_0002515 | Ga0373933_0002515_8005_8988 | 327 |
| 2294 | 3300035725 | Ga0373947_0025815 | Ga0373947_0025815_990_1973 | 327 |
| 2295 | 3300035725 | Ga0373947_0052934 | Ga0373947_0052934_767_1750 | 327 |
| 2296 | 3300035725 | Ga0373947_0084848 | Ga0373947_0084848_706_1689 | 327 |
| 2297 | 3300035725 | Ga0373947_0126297 | Ga0373947_0126297_549_1532 | 327 |
| 2298 | 3300036401 | Ga0373937_0001146 | Ga0373937_0001146_16695_17678 | 327 |
| 2299 | 3300036401 | Ga0373937_0318568 | Ga0373937_0318568_188_1171 | 327 |
| 2300 | 3300037068 | Ga0373925_0027273 | Ga0373925_0027273_2039_3022 | 327 |
| 2301 | 3300037418 | Ga0395900_0185454 | Ga0395900_0185454_518_1501 | 327 |
| 2302 | 3300037471 | Ga0395905_0087942 | Ga0395905_0087942_334_1317 | 327 |
| 2303 | 3300038443 | Ga0395901_0153653 | Ga0395901_0153653_886_1869 | 327 |
| 2304 | 3300039437 | Ga0436365_1673482 | Ga0436365_1673482_278_1264 | 327 |
| 2305 | 3300039447 | Ga0436361_0359473 | Ga0436361_0359473_525_1556 | 327 |
| 2306 | 3300041408 | Ga0439453_0004011 | Ga0439453_0004011_1040_2023 | 327 |
| 2307 | 3300042007 | Ga0439449_0006504 | Ga0439449_0006504_1697_2680 | 327 |
| 2308 | 3300042126 | Ga0450888_000640 | Ga0450888_000640_113_1096 | 327 |
| 2309 | 3300042437 | Ga0439444_0010606 | Ga0439444_0010606_161_1144 | 327 |
| 2310 | 3300042439 | Ga0439464_0029077 | Ga0439464_0029077_419_1423 | 327 |
| 2311 | 3300044765 | Ga0466970_0058045 | Ga0466970_0058045_198_1214 | 327 |
| 2312 | 3300044842 | Ga0466957_0040720 | Ga0466957_0040720_987_1970 | 327 |
| 2313 | 3300046454 | Ga0495592_0008218 | Ga0495592_0008218_1401_2384 | 327 |
| 2314 | 3300046455 | Ga0495603_0013575 | Ga0495603_0013575_1279_2262 | 327 |
| 2315 | 3300046455 | Ga0495603_0073805 | Ga0495603_0073805_381_1364 | 327 |
| 2316 | 3300046459 | Ga0495629_0010732 | Ga0495629_0010732_3991_4974 | 327 |
| 2317 | 3300046460 | Ga0495638_0003388 | Ga0495638_0003388_8171_9154 | 327 |
| 2318 | 3300046460 | Ga0495638_0004884 | Ga0495638_0004884_2348_3331 | 327 |
| 2319 | 3300046460 | Ga0495638_0059109 | Ga0495638_0059109_713_1696 | 327 |
| 2320 | 3300046461 | Ga0495641_0026188 | Ga0495641_0026188_659_1642 | 327 |
| 2321 | 3300046462 | Ga0495651_0003394 | Ga0495651_0003394_8104_9087 | 327 |
| 2322 | 3300046463 | Ga0495653_0012696 | Ga0495653_0012696_4012_4995 | 327 |
| 2323 | 3300046471 | Ga0495650_0034472 | Ga0495650_0034472_285_1268 | 327 |
| 2324 | 3300046473 | Ga0495582_0014056 | Ga0495582_0014056_642_1625 | 327 |
| 2325 | 3300046474 | Ga0495605_0000998 | Ga0495605_0000998_12482_13465 | 327 |
| 2326 | 3300046475 | Ga0495639_0039292 | Ga0495639_0039292_170_1153 | 327 |
| 2327 | 3300046476 | Ga0495662_0071800 | Ga0495662_0071800_124_1107 | 327 |
| 2328 | 3300046476 | Ga0495662_0111810 | Ga0495662_0111810_137_1120 | 327 |
| 2329 | 3300046477 | Ga0495664_0042324 | Ga0495664_0042324_1242_2225 | 327 |
| 2330 | 3300046492 | Ga0495585_0011596 | Ga0495585_0011596_541_1524 | 327 |
| 2331 | 3300046501 | Ga0495607_0046587 | Ga0495607_0046587_501_1484 | 327 |
| 2332 | 3300046506 | Ga0495583_0003578 | Ga0495583_0003578_3032_4015 | 327 |
| 2333 | 3300046506 | Ga0495583_0010063 | Ga0495583_0010063_3674_4657 | 327 |
| 2334 | 3300046507 | Ga0495606_0095951 | Ga0495606_0095951_621_1604 | 327 |
| 2335 | 3300046511 | Ga0495608_0002249 | Ga0495608_0002249_4125_5108 | 327 |
| 2336 | 3300046512 | Ga0495610_0002088 | Ga0495610_0002088_11481_12464 | 327 |
| 2337 | 3300046512 | Ga0495610_0031912 | Ga0495610_0031912_1563_2549 | 327 |
| 2338 | 3300046513 | Ga0495616_0015211 | Ga0495616_0015211_2824_3807 | 327 |
| 2339 | 3300046514 | Ga0495618_0001172 | Ga0495618_0001172_3732_4715 | 327 |
| 2340 | 3300046516 | Ga0495628_0036636 | Ga0495628_0036636_1486_2469 | 327 |
| 2341 | 3300046517 | Ga0495630_0079890 | Ga0495630_0079890_498_1481 | 327 |
| 2342 | 3300046518 | Ga0495631_0002952 | Ga0495631_0002952_282_1265 | 327 |
| 2343 | 3300046519 | Ga0495632_0019934 | Ga0495632_0019934_2506_3489 | 327 |
| 2344 | 3300046519 | Ga0495632_0039034 | Ga0495632_0039034_556_1539 | 327 |
| 2345 | 3300046522 | Ga0495643_0043383 | Ga0495643_0043383_672_1655 | 327 |
| 2346 | 3300046522 | Ga0495643_0109687 | Ga0495643_0109687_335_1318 | 327 |
| 2347 | 3300046529 | Ga0495652_0028155 | Ga0495652_0028155_1150_2133 | 327 |
| 2348 | 3300046529 | Ga0495652_0063179 | Ga0495652_0063179_1291_2283 | 327 |
| 2349 | 3300046530 | Ga0495654_0000258 | Ga0495654_0000258_43114_44109 | 327 |
| 2350 | 3300046533 | Ga0495640_0005042 | Ga0495640_0005042_5697_6680 | 327 |
| 2351 | 3300046533 | Ga0495640_0064896 | Ga0495640_0064896_1088_2071 | 327 |
| 2352 | 3300046533 | Ga0495640_0098706 | Ga0495640_0098706_176_1168 | 327 |
| 2353 | 3300046536 | Ga0495587_0009385 | Ga0495587_0009385_2054_3037 | 327 |
| 2354 | 3300046538 | Ga0495609_0024772 | Ga0495609_0024772_1095_2078 | 327 |
| 2355 | 3300046538 | Ga0495609_0059071 | Ga0495609_0059071_242_1225 | 327 |
| 2356 | 3300046558 | Ga0495633_0068402 | Ga0495633_0068402_255_1238 | 327 |
| 2357 | 3300046559 | Ga0495667_0014053 | Ga0495667_0014053_477_1460 | 327 |
| 2358 | 3300046615 | Ga0495656_0052249 | Ga0495656_0052249_296_1279 | 327 |
| 2359 | 3300046615 | Ga0495656_0104757 | Ga0495656_0104757_134_1117 | 327 |
| 2360 | 3300046616 | Ga0495668_0016948 | Ga0495668_0016948_1298_2281 | 327 |
| 2361 | 3300046642 | Ga0495634_0006047 | Ga0495634_0006047_4896_5879 | 327 |
| 2362 | 3300046660 | Ga0495625_0006387 | Ga0495625_0006387_7329_8312 | 327 |
| 2363 | 3300046660 | Ga0495625_0092453 | Ga0495625_0092453_814_1797 | 327 |
| 2364 | 3300046663 | Ga0495635_0178241 | Ga0495635_0178241_308_1291 | 327 |
| 2365 | 3300046675 | Ga0495657_0035630 | Ga0495657_0035630_572_1555 | 327 |
| 2366 | 3300046678 | Ga0495599_0005526 | Ga0495599_0005526_1742_2725 | 327 |
| 2367 | 3300046678 | Ga0495599_0079504 | Ga0495599_0079504_931_1923 | 327 |
| 2368 | 3300046679 | Ga0495623_0003882 | Ga0495623_0003882_4191_5174 | 327 |
| 2369 | 3300046680 | Ga0495646_0019315 | Ga0495646_0019315_1827_2810 | 327 |
| 2370 | 3300046681 | Ga0495647_0108254 | Ga0495647_0108254_116_1099 | 327 |
| 2371 | 3300046683 | Ga0495658_0012740 | Ga0495658_0012740_583_1566 | 327 |
| 2372 | 3300046683 | Ga0495658_0232336 | Ga0495658_0232336_131_1114 | 327 |
| 2373 | 3300046684 | Ga0495669_0080020 | Ga0495669_0080020_473_1456 | 327 |
| 2374 | 3300046689 | Ga0495613_0233661 | Ga0495613_0233661_272_1255 | 327 |
| 2375 | 3300046689 | Ga0495613_0280445 | Ga0495613_0280445_37_1020 | 327 |
| 2376 | 3300046690 | Ga0495624_0064122 | Ga0495624_0064122_930_1913 | 327 |
| 2377 | 3300046691 | Ga0495670_0063095 | Ga0495670_0063095_302_1285 | 327 |
| 2378 | 3300046691 | Ga0495670_0063856 | Ga0495670_0063856_13_996 | 327 |
| 2379 | 3300046809 | Ga0495600_0001574 | Ga0495600_0001574_6978_7961 | 327 |
| 2380 | 3300046810 | Ga0495660_0007210 | Ga0495660_0007210_4582_5565 | 327 |
| 2381 | 3300047315 | Ga0495581_0049865 | Ga0495581_0049865_1179_2162 | 327 |
| 2382 | 3300047317 | Ga0495604_0000150 | Ga0495604_0000150_50855_51838 | 327 |
| 2383 | 3300047319 | Ga0495674_0040455 | Ga0495674_0040455_2894_3877 | 327 |
| 2384 | 3300047319 | Ga0495674_0058092 | Ga0495674_0058092_2012_2995 | 327 |
| 2385 | 3300047321 | Ga0495676_0048721 | Ga0495676_0048721_2030_3013 | 327 |
| 2386 | 3300047322 | Ga0495680_0000699 | Ga0495680_0000699_28786_29769 | 327 |
| 2387 | 3300047443 | Ga0495687_016135 | Ga0495687_016135_2060_3043 | 327 |
| 2388 | 3300047471 | Ga0495684_0011394 | Ga0495684_0011394_4047_5030 | 327 |
| 2389 | 3300047472 | Ga0495686_0012523 | Ga0495686_0012523_4429_5412 | 327 |
| 2390 | 3300047472 | Ga0495686_0085933 | Ga0495686_0085933_45_1040 | 327 |
| 2391 | 3300047472 | Ga0495686_0126838 | Ga0495686_0126838_245_1231 | 327 |
| 2392 | 3300047673 | Ga0495593_0024774 | Ga0495593_0024774_43_1026 | 327 |
| 2393 | 3300047673 | Ga0495593_0041197 | Ga0495593_0041197_1067_2050 | 327 |
| 2394 | 3300048088 | Ga0495602_0018808 | Ga0495602_0018808_1979_2962 | 327 |
| 2395 | 3300048903 | Ga0496100_0092105 | Ga0496100_0092105_1067_2050 | 327 |
| 2396 | 3300048903 | Ga0496100_0284529 | Ga0496100_0284529_231_1214 | 327 |
| 2397 | 3300048904 | Ga0496101_0007599 | Ga0496101_0007599_2337_3320 | 327 |
| 2398 | 3300048904 | Ga0496101_0161732 | Ga0496101_0161732_714_1697 | 327 |
| 2399 | 3300048904 | Ga0496101_0227971 | Ga0496101_0227971_14_997 | 327 |
| 2400 | 3300048904 | Ga0496101_0296054 | Ga0496101_0296054_52_1035 | 327 |
| 2401 | 3300048905 | Ga0496102_0000871 | Ga0496102_0000871_19667_20650 | 327 |
| 2402 | 3300048905 | Ga0496102_0036824 | Ga0496102_0036824_231_1214 | 327 |
| 2403 | 3300048905 | Ga0496102_0089273 | Ga0496102_0089273_1389_2399 | 327 |
| 2404 | 3300048905 | Ga0496102_0131352 | Ga0496102_0131352_578_1561 | 327 |
| 2405 | 3300048905 | Ga0496102_0270142 | Ga0496102_0270142_39_1022 | 327 |
| 2406 | 3300048906 | Ga0496103_0003369 | Ga0496103_0003369_7654_8637 | 327 |
| 2407 | 3300048906 | Ga0496103_0005846 | Ga0496103_0005846_123_1106 | 327 |
| 2408 | 3300048907 | Ga0496104_0000445 | Ga0496104_0000445_3593_4576 | 327 |
| 2409 | 3300048907 | Ga0496104_0002378 | Ga0496104_0002378_15056_16039 | 327 |
| 2410 | 3300048907 | Ga0496104_0016654 | Ga0496104_0016654_3355_4338 | 327 |
| 2411 | 3300048907 | Ga0496104_0034739 | Ga0496104_0034739_3142_4125 | 327 |
| 2412 | 3300048907 | Ga0496104_0112248 | Ga0496104_0112248_765_1748 | 327 |
| 2413 | 3300048907 | Ga0496104_0145895 | Ga0496104_0145895_124_1107 | 327 |
| 2414 | 3300048907 | Ga0496104_0173119 | Ga0496104_0173119_363_1373 | 327 |
| 2415 | 3300048907 | Ga0496104_0188496 | Ga0496104_0188496_359_1342 | 327 |
| 2416 | 3300048907 | Ga0496104_0306548 | Ga0496104_0306548_193_1176 | 327 |
| 2417 | 3300048907 | Ga0496104_0346180 | Ga0496104_0346180_285_1268 | 327 |
| 2418 | 3300048908 | Ga0496105_0000514 | Ga0496105_0000514_13742_14725 | 327 |
| 2419 | 3300048908 | Ga0496105_0005876 | Ga0496105_0005876_231_1214 | 327 |
| 2420 | 3300048908 | Ga0496105_0006690 | Ga0496105_0006690_4854_5837 | 327 |
| 2421 | 3300048908 | Ga0496105_0012574 | Ga0496105_0012574_3612_4595 | 327 |
| 2422 | 3300048908 | Ga0496105_0053871 | Ga0496105_0053871_1937_2920 | 327 |
| 2423 | 3300048909 | Ga0496106_0129156 | Ga0496106_0129156_322_1305 | 327 |
| 2424 | 3300048910 | Ga0496107_0000769 | Ga0496107_0000769_14323_15306 | 327 |
| 2425 | 3300048910 | Ga0496107_0056732 | Ga0496107_0056732_701_1684 | 327 |
| 2426 | 3300048910 | Ga0496107_0139352 | Ga0496107_0139352_83_1066 | 327 |
| 2427 | 3300048911 | Ga0496108_0003421 | Ga0496108_0003421_7387_8370 | 327 |
| 2428 | 3300048911 | Ga0496108_0005811 | Ga0496108_0005811_7343_8353 | 327 |
| 2429 | 3300048911 | Ga0496108_0206057 | Ga0496108_0206057_211_1194 | 327 |
| 2430 | 3300048911 | Ga0496108_0245343 | Ga0496108_0245343_281_1264 | 327 |
| 2431 | 3300048912 | Ga0496109_0052258 | Ga0496109_0052258_861_1871 | 327 |
| 2432 | 3300048912 | Ga0496109_0052763 | Ga0496109_0052763_2094_3077 | 327 |
| 2433 | 3300048912 | Ga0496109_0100189 | Ga0496109_0100189_1201_2184 | 327 |
| 2434 | 3300048912 | Ga0496109_0230438 | Ga0496109_0230438_582_1565 | 327 |
| 2435 | 3300048913 | Ga0496110_0001539 | Ga0496110_0001539_2243_3226 | 327 |
| 2436 | 3300048913 | Ga0496110_0001886 | Ga0496110_0001886_9445_10455 | 327 |
| 2437 | 3300048913 | Ga0496110_0022057 | Ga0496110_0022057_1177_2187 | 327 |
| 2438 | 3300048913 | Ga0496110_0130702 | Ga0496110_0130702_1197_2180 | 327 |
| 2439 | 3300048913 | Ga0496110_0198313 | Ga0496110_0198313_58_1041 | 327 |
| 2440 | 3300048913 | Ga0496110_0397212 | Ga0496110_0397212_24_1007 | 327 |
| 2441 | 3300048914 | Ga0496111_0000072 | Ga0496111_0000072_21691_22674 | 327 |
| 2442 | 3300048914 | Ga0496111_0000641 | Ga0496111_0000641_14616_15599 | 327 |
| 2443 | 3300048914 | Ga0496111_0007231 | Ga0496111_0007231_616_1626 | 327 |
| 2444 | 3300048914 | Ga0496111_0009427 | Ga0496111_0009427_2129_3112 | 327 |
| 2445 | 3300048914 | Ga0496111_0017287 | Ga0496111_0017287_215_1198 | 327 |
| 2446 | 3300048914 | Ga0496111_0049553 | Ga0496111_0049553_1875_2858 | 327 |
| 2447 | 3300048915 | Ga0496112_0000112 | Ga0496112_0000112_19188_20171 | 327 |
| 2448 | 3300048915 | Ga0496112_0022204 | Ga0496112_0022204_1143_2153 | 327 |
| 2449 | 3300048915 | Ga0496112_0039797 | Ga0496112_0039797_3592_4575 | 327 |
| 2450 | 3300048915 | Ga0496112_0187003 | Ga0496112_0187003_944_1927 | 327 |
| 2451 | 3300048915 | Ga0496112_0266507 | Ga0496112_0266507_48_1031 | 327 |
| 2452 | 3300048916 | Ga0496113_0000058 | Ga0496113_0000058_21725_22708 | 327 |
| 2453 | 3300048916 | Ga0496113_0010750 | Ga0496113_0010750_4373_5383 | 327 |
| 2454 | 3300048916 | Ga0496113_0034796 | Ga0496113_0034796_2420_3403 | 327 |
| 2455 | 3300048916 | Ga0496113_0093805 | Ga0496113_0093805_1285_2268 | 327 |
| 2456 | 3300048917 | Ga0496114_0007803 | Ga0496114_0007803_5277_6260 | 327 |
| 2457 | 3300048917 | Ga0496114_0238531 | Ga0496114_0238531_565_1548 | 327 |
| 2458 | 3300048918 | Ga0496115_0027599 | Ga0496115_0027599_3229_4212 | 327 |
| 2459 | 3300048918 | Ga0496115_0055864 | Ga0496115_0055864_709_1692 | 327 |
| 2460 | 3300048918 | Ga0496115_0091711 | Ga0496115_0091711_781_1764 | 327 |
| 2461 | 3300048918 | Ga0496115_0103261 | Ga0496115_0103261_1060_2055 | 327 |
| 2462 | 3300048918 | Ga0496115_0132373 | Ga0496115_0132373_447_1430 | 327 |
| 2463 | 3300048920 | Ga0496117_0024058 | Ga0496117_0024058_397_1380 | 327 |
| 2464 | 3300048922 | Ga0496119_0034851 | Ga0496119_0034851_566_1549 | 327 |
| 2465 | 3300048923 | Ga0496120_0150688 | Ga0496120_0150688_22_1005 | 327 |
| 2466 | 3300048924 | Ga0496121_0000034 | Ga0496121_0000034_175807_176790 | 327 |
| 2467 | 3300048924 | Ga0496121_0155265 | Ga0496121_0155265_481_1464 | 327 |
| 2468 | 3300048924 | Ga0496121_0155763 | Ga0496121_0155763_526_1509 | 327 |
| 2469 | 3300048925 | Ga0496122_0000137 | Ga0496122_0000137_22429_23412 | 327 |
| 2470 | 3300048925 | Ga0496122_0023847 | Ga0496122_0023847_593_1576 | 327 |
| 2471 | 3300048925 | Ga0496122_0029495 | Ga0496122_0029495_1069_2052 | 327 |
| 2472 | 3300048925 | Ga0496122_0057097 | Ga0496122_0057097_461_1447 | 327 |
| 2473 | 3300048925 | Ga0496122_0057689 | Ga0496122_0057689_1413_2396 | 327 |
| 2474 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_145128_146111 | 327 |
| 2475 | 3300048926 | Ga0496123_0154375 | Ga0496123_0154375_75_1058 | 327 |
| 2476 | 3300048927 | Ga0496124_0034417 | Ga0496124_0034417_2016_2999 | 327 |
| 2477 | 3300048927 | Ga0496124_0034422 | Ga0496124_0034422_2687_3670 | 327 |
| 2478 | 3300048927 | Ga0496124_0036141 | Ga0496124_0036141_1396_2379 | 327 |
| 2479 | 3300048927 | Ga0496124_0049497 | Ga0496124_0049497_957_1940 | 327 |
| 2480 | 3300048927 | Ga0496124_0108721 | Ga0496124_0108721_711_1709 | 327 |
| 2481 | 3300048928 | Ga0496125_0000030 | Ga0496125_0000030_197713_198696 | 327 |
| 2482 | 3300048928 | Ga0496125_0136186 | Ga0496125_0136186_650_1633 | 327 |
| 2483 | 3300048929 | Ga0496126_0084838 | Ga0496126_0084838_1138_2124 | 327 |
| 2484 | 3300049459 | Ga0495678_012901 | Ga0495678_012901_2204_3187 | 327 |
| 2485 | 3300049568 | Ga0501031_0012352 | Ga0501031_0012352_459_1442 | 327 |
| 2486 | 3300049568 | Ga0501031_0228223 | Ga0501031_0228223_54_1040 | 327 |
| 2487 | 3300049569 | Ga0501032_0016543 | Ga0501032_0016543_1322_2308 | 327 |
| 2488 | 3300049569 | Ga0501032_0215853 | Ga0501032_0215853_135_1118 | 327 |
| 2489 | 3300049571 | Ga0501034_0001131 | Ga0501034_0001131_34884_35870 | 327 |
| 2490 | 3300049571 | Ga0501034_0032682 | Ga0501034_0032682_2090_3076 | 327 |
| 2491 | 3300049571 | Ga0501034_0094910 | Ga0501034_0094910_1071_2054 | 327 |
| 2492 | 3300049571 | Ga0501034_0274978 | Ga0501034_0274978_334_1317 | 327 |
| 2493 | 3300049572 | Ga0501036_0000559 | Ga0501036_0000559_2906_3889 | 327 |
| 2494 | 3300049572 | Ga0501036_0003303 | Ga0501036_0003303_4211_5197 | 327 |
| 2495 | 3300049572 | Ga0501036_0375031 | Ga0501036_0375031_54_1037 | 327 |
| 2496 | 3300049573 | Ga0501037_0018455 | Ga0501037_0018455_3772_4758 | 327 |
| 2497 | 3300049573 | Ga0501037_0214723 | Ga0501037_0214723_192_1175 | 327 |
| 2498 | 3300049573 | Ga0501037_0246140 | Ga0501037_0246140_156_1184 | 327 |
| 2499 | 3300049576 | Ga0501040_0204409 | Ga0501040_0204409_53_1036 | 327 |
| 2500 | 3300049579 | Ga0501043_0044063 | Ga0501043_0044063_741_1727 | 327 |
| 2501 | 3300049579 | Ga0501043_0212217 | Ga0501043_0212217_456_1439 | 327 |
| 2502 | 3300049581 | Ga0501047_0017683 | Ga0501047_0017683_4177_5163 | 327 |
| 2503 | 3300049582 | Ga0501048_0287435 | Ga0501048_0287435_132_1118 | 327 |
| 2504 | 3300049583 | Ga0501067_0069865 | Ga0501067_0069865_637_1623 | 327 |
| 2505 | 3300049584 | Ga0501068_0021116 | Ga0501068_0021116_1493_2479 | 327 |
| 2506 | 3300049584 | Ga0501068_0204433 | Ga0501068_0204433_232_1218 | 327 |
| 2507 | 3300049585 | Ga0501069_0026629 | Ga0501069_0026629_399_1385 | 327 |
| 2508 | 3300049585 | Ga0501069_0033702 | Ga0501069_0033702_244_1230 | 327 |
| 2509 | 3300049586 | Ga0501070_0005894 | Ga0501070_0005894_4693_5679 | 327 |
| 2510 | 3300049586 | Ga0501070_0301677 | Ga0501070_0301677_110_1093 | 327 |
| 2511 | 3300049589 | Ga0501073_0065647 | Ga0501073_0065647_652_1638 | 327 |
| 2512 | 3300049589 | Ga0501073_0100648 | Ga0501073_0100648_987_1970 | 327 |
| 2513 | 3300049589 | Ga0501073_0209012 | Ga0501073_0209012_152_1138 | 327 |
| 2514 | 3300049741 | Ga0501079_0118501 | Ga0501079_0118501_364_1350 | 327 |
| 2515 | 3300049741 | Ga0501079_0194645 | Ga0501079_0194645_208_1194 | 327 |
| 2516 | 3300049742 | Ga0501080_0022690 | Ga0501080_0022690_4211_5197 | 327 |
| 2517 | 3300049742 | Ga0501080_0378711 | Ga0501080_0378711_79_1065 | 327 |
| 2518 | 3300049744 | Ga0501083_0014948 | Ga0501083_0014948_4100_5086 | 327 |
| 2519 | 3300049744 | Ga0501083_0116923 | Ga0501083_0116923_474_1457 | 327 |
| 2520 | 3300049822 | Ga0501035_0000127 | Ga0501035_0000127_86769_87755 | 327 |
| 2521 | 3300049822 | Ga0501035_0004040 | Ga0501035_0004040_3958_4944 | 327 |
| 2522 | 3300049823 | Ga0501044_0036318 | Ga0501044_0036318_2721_3704 | 327 |
| 2523 | 3300049823 | Ga0501044_0089568 | Ga0501044_0089568_525_1508 | 327 |
| 2524 | 3300049823 | Ga0501044_0172623 | Ga0501044_0172623_919_1905 | 327 |
| 2525 | 3300049823 | Ga0501044_0472676 | Ga0501044_0472676_21_1007 | 327 |
| 2526 | 3300050491 | nmdc:mga00v17_15278_c1 | nmdc:mga00v17_15278_c1_2089_3072 | 327 |
| 2527 | 3300050492 | nmdc:mga0yw44_180716_c1 | nmdc:mga0yw44_180716_c1_16_999 | 327 |
| 2528 | 3300050492 | nmdc:mga0yw44_30581_c1 | nmdc:mga0yw44_30581_c1_1572_2555 | 327 |
| 2529 | 3300050492 | nmdc:mga0yw44_35481_c1 | nmdc:mga0yw44_35481_c1_228_1211 | 327 |
| 2530 | 3300050492 | nmdc:mga0yw44_72364_c1 | nmdc:mga0yw44_72364_c1_118_1101 | 327 |
| 2531 | 3300050494 | nmdc:mga06z11_151928_c1 | nmdc:mga06z11_151928_c1_147_1130 | 327 |
| 2532 | 3300050494 | nmdc:mga06z11_23381_c1 | nmdc:mga06z11_23381_c1_1142_2125 | 327 |
| 2533 | 3300050495 | nmdc:mga04h51_3760_c1 | nmdc:mga04h51_3760_c1_1932_2915 | 327 |
| 2534 | 3300050507 | nmdc:mga05p37_210744_c1 | nmdc:mga05p37_210744_c1_536_1519 | 327 |
| 2535 | 3300050507 | nmdc:mga05p37_26679_c1 | nmdc:mga05p37_26679_c1_4714_5697 | 327 |
| 2536 | 3300050507 | nmdc:mga05p37_268_c1 | nmdc:mga05p37_268_c1_37062_38066 | 327 |
| 2537 | 3300050508 | nmdc:mga09592_11852_c1 | nmdc:mga09592_11852_c1_1650_2654 | 327 |
| 2538 | 3300050509 | nmdc:mga0qj67_26592_c1 | nmdc:mga0qj67_26592_c1_2654_3637 | 327 |
| 2539 | 3300050510 | nmdc:mga06r32_133_c1 | nmdc:mga06r32_133_c1_14139_15143 | 327 |
| 2540 | 3300050510 | nmdc:mga06r32_29045_c1 | nmdc:mga06r32_29045_c1_4013_4996 | 327 |
| 2541 | 3300050510 | nmdc:mga06r32_51265_c1 | nmdc:mga06r32_51265_c1_604_1587 | 327 |
| 2542 | 3300050510 | nmdc:mga06r32_641990_c1 | nmdc:mga06r32_641990_c1_32_1015 | 327 |
| 2543 | 3300050511 | nmdc:mga08y16_604_c1 | nmdc:mga08y16_604_c1_3731_4735 | 327 |
| 2544 | 3300050512 | nmdc:mga0n895_112572_c1 | nmdc:mga0n895_112572_c1_191_1174 | 327 |
| 2545 | 3300050512 | nmdc:mga0n895_35109_c1 | nmdc:mga0n895_35109_c1_3009_3992 | 327 |
| 2546 | 3300053078 | Ga0495612_0003729 | Ga0495612_0003729_3663_4646 | 327 |
| 2547 | 3300053079 | Ga0500610_0024158 | Ga0500610_0024158_1268_2251 | 327 |
| 2548 | 3300053083 | Ga0495655_0003940 | Ga0495655_0003940_799_1782 | 327 |
| 2549 | 3300053083 | Ga0495655_0004297 | Ga0495655_0004297_1394_2377 | 327 |
| 2550 | 3300053084 | Ga0495595_0000221 | Ga0495595_0000221_18813_19796 | 327 |
| 2551 | 3300053085 | Ga0495619_0001997 | Ga0495619_0001997_7550_8533 | 327 |
| 2552 | 3300053085 | Ga0495619_0008018 | Ga0495619_0008018_3502_4485 | 327 |
| 2553 | 3300053088 | Ga0500644_0001056 | Ga0500644_0001056_2400_3383 | 327 |
| 2554 | 3300053088 | Ga0500644_0092833 | Ga0500644_0092833_57_1043 | 327 |
| 2555 | 3300053093 | Ga0500651_0013102 | Ga0500651_0013102_2441_3424 | 327 |
| 2556 | 3300053094 | Ga0500566_0023437 | Ga0500566_0023437_1624_2610 | 327 |
| 2557 | 3300053094 | Ga0500566_0037748 | Ga0500566_0037748_1438_2421 | 327 |
| 2558 | 3300053105 | Ga0500557_000228 | Ga0500557_000228_1620_2603 | 327 |
| 2559 | 3300053108 | Ga0500562_019931 | Ga0500562_019931_273_1256 | 327 |
| 2560 | 3300053109 | Ga0500569_003783 | Ga0500569_003783_1699_2682 | 327 |
| 2561 | 3300053118 | Ga0500594_0006340 | Ga0500594_0006340_1199_2182 | 327 |
| 2562 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_112030_113013 | 327 |
| 2563 | 3300053119 | Ga0500595_000045 | Ga0500595_000045_71678_72664 | 327 |
| 2564 | 3300053125 | Ga0500618_000045 | Ga0500618_000045_81668_82663 | 327 |
| 2565 | 3300053131 | Ga0500652_093992 | Ga0500652_093992_259_1242 | 327 |
| 2566 | 3300053134 | Ga0500658_0011471 | Ga0500658_0011471_823_1809 | 327 |
| 2567 | 3300053139 | Ga0500568_0004036 | Ga0500568_0004036_2206_3189 | 327 |
| 2568 | 3300053142 | Ga0500577_0018815 | Ga0500577_0018815_816_1802 | 327 |
| 2569 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_710251_711234 | 327 |
| 2570 | 3300053153 | Ga0500616_0000093 | Ga0500616_0000093_52164_53159 | 327 |
| 2571 | 3300053153 | Ga0500616_0001502 | Ga0500616_0001502_18267_19250 | 327 |
| 2572 | 3300053161 | Ga0500634_0001341 | Ga0500634_0001341_144_1127 | 327 |
| 2573 | 3300053730 | Ga0500645_000051 | Ga0500645_000051_42504_43487 | 327 |
| 2574 | 3300054114 | Ga0501084_0036290 | Ga0501084_0036290_1539_2522 | 327 |
| 2575 | 3300054114 | Ga0501084_0037753 | Ga0501084_0037753_1256_2239 | 327 |
| 2576 | 3300054114 | Ga0501084_0111778 | Ga0501084_0111778_181_1164 | 327 |
| 2577 | 3300054114 | Ga0501084_0142028 | Ga0501084_0142028_171_1157 | 327 |
| 2578 | 3300061734 | Ga0530510_0114488 | Ga0530510_0114488_216_1199 | 327 |
| 2579 | 3300002773 | JGI25152J39213_1000531 | JGI25152J39213_10005313 | 328 |
| 2580 | 3300002773 | JGI25152J39213_1002315 | JGI25152J39213_10023153 | 328 |
| 2581 | 3300002774 | JGI25150J39212_1000024 | JGI25150J39212_100002449 | 328 |
| 2582 | 3300002987 | JGI25159J45721_1001556 | JGI25159J45721_10015567 | 328 |
| 2583 | 3300003187 | JGI25151J46595_10000027 | JGI25151J46595_10000027114 | 328 |
| 2584 | 3300003215 | JGI25153J46596_10000012 | JGI25153J46596_10000012265 | 328 |
| 2585 | 3300003215 | JGI25153J46596_10000517 | JGI25153J46596_100005175 | 328 |
| 2586 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_100000180 | 328 |
| 2587 | 3300003374 | JGI25161J50226_1000047 | JGI25161J50226_100004724 | 328 |
| 2588 | 3300003771 | Ga0055526_1017984 | Ga0055526_10179842 | 328 |
| 2589 | 3300003775 | Ga0055524_1013029 | Ga0055524_10130292 | 328 |
| 2590 | 3300003790 | Ga0055528_1001182 | Ga0055528_10011825 | 328 |
| 2591 | 3300003794 | Ga0055531_10013033 | Ga0055531_100130332 | 328 |
| 2592 | 3300003856 | Ga0058692_1001178 | Ga0058692_10011782 | 328 |
| 2593 | 3300003856 | Ga0058692_1001422 | Ga0058692_10014226 | 328 |
| 2594 | 3300003856 | Ga0058692_1001511 | Ga0058692_10015117 | 328 |
| 2595 | 3300004625 | Ga0055543_1000007 | Ga0055543_1000007115 | 328 |
| 2596 | 3300005262 | Ga0065165_1000357 | Ga0065165_100035723 | 328 |
| 2597 | 3300005262 | Ga0065165_1008048 | Ga0065165_10080483 | 328 |
| 2598 | 3300005331 | Ga0070670_100011566 | Ga0070670_1000115664 | 328 |
| 2599 | 3300005335 | Ga0070666_10229508 | Ga0070666_102295082 | 328 |
| 2600 | 3300005353 | Ga0070669_100124486 | Ga0070669_1001244861 | 328 |
| 2601 | 3300005354 | Ga0070675_100154306 | Ga0070675_1001543062 | 328 |
| 2602 | 3300005355 | Ga0070671_100009666 | Ga0070671_1000096666 | 328 |
| 2603 | 3300005366 | Ga0070659_100129972 | Ga0070659_1001299722 | 328 |
| 2604 | 3300005467 | Ga0070706_100182407 | Ga0070706_1001824074 | 328 |
| 2605 | 3300005471 | Ga0070698_100319420 | Ga0070698_1003194201 | 328 |
| 2606 | 3300005518 | Ga0070699_100296574 | Ga0070699_1002965741 | 328 |
| 2607 | 3300005535 | Ga0070684_100155473 | Ga0070684_1001554731 | 328 |
| 2608 | 3300005548 | Ga0070665_100000961 | Ga0070665_1000009614 | 328 |
| 2609 | 3300005548 | Ga0070665_100075185 | Ga0070665_1000751853 | 328 |
| 2610 | 3300005577 | Ga0068857_100443489 | Ga0068857_1004434892 | 328 |
| 2611 | 3300005844 | Ga0068862_100010969 | Ga0068862_1000109695 | 328 |
| 2612 | 3300006028 | Ga0070717_10048238 | Ga0070717_100482383 | 328 |
| 2613 | 3300006038 | Ga0075365_10121269 | Ga0075365_101212691 | 328 |
| 2614 | 3300006042 | Ga0075368_10006600 | Ga0075368_100066003 | 328 |
| 2615 | 3300006048 | Ga0075363_100008322 | Ga0075363_1000083224 | 328 |
| 2616 | 3300006051 | Ga0075364_10159130 | Ga0075364_101591302 | 328 |
| 2617 | 3300006173 | Ga0070716_100020794 | Ga0070716_1000207944 | 328 |
| 2618 | 3300006177 | Ga0075362_10020700 | Ga0075362_100207002 | 328 |
| 2619 | 3300006186 | Ga0075369_10033295 | Ga0075369_100332952 | 328 |
| 2620 | 3300006948 | Ga0099826_10000120 | Ga0099826_1000012021 | 328 |
| 2621 | 3300006948 | Ga0099826_10010203 | Ga0099826_100102034 | 328 |
| 2622 | 3300009148 | Ga0105243_10002537 | Ga0105243_100025378 | 328 |
| 2623 | 3300010375 | Ga0105239_10248504 | Ga0105239_102485042 | 328 |
| 2624 | 3300011119 | Ga0105246_10211931 | Ga0105246_102119312 | 328 |
| 2625 | 3300011119 | Ga0105246_10213339 | Ga0105246_102133392 | 328 |
| 2626 | 3300013100 | Ga0157373_10049569 | Ga0157373_100495692 | 328 |
| 2627 | 3300013102 | Ga0157371_10111413 | Ga0157371_101114132 | 328 |
| 2628 | 3300013104 | Ga0157370_10000324 | Ga0157370_1000032442 | 328 |
| 2629 | 3300014325 | Ga0163163_10104374 | Ga0163163_101043742 | 328 |
| 2630 | 3300015265 | Ga0182005_1029798 | Ga0182005_10297981 | 328 |
| 2631 | 3300021388 | Ga0213875_10014809 | Ga0213875_100148092 | 328 |
| 2632 | 3300025245 | Ga0207425_1000043 | Ga0207425_1000043112 | 328 |
| 2633 | 3300025258 | Ga0209129_1000072 | Ga0209129_100007282 | 328 |
| 2634 | 3300025258 | Ga0209129_1000226 | Ga0209129_100022617 | 328 |
| 2635 | 3300025273 | Ga0209673_1000239 | Ga0209673_100023985 | 328 |
| 2636 | 3300025284 | Ga0209130_1000145 | Ga0209130_100014580 | 328 |
| 2637 | 3300025284 | Ga0209130_1015990 | Ga0209130_10159902 | 328 |
| 2638 | 3300025294 | Ga0209025_1000120 | Ga0209025_100012082 | 328 |
| 2639 | 3300025294 | Ga0209025_1001416 | Ga0209025_100141624 | 328 |
| 2640 | 3300025294 | Ga0209025_1001755 | Ga0209025_10017553 | 328 |
| 2641 | 3300025295 | Ga0209564_1014218 | Ga0209564_10142183 | 328 |
| 2642 | 3300025297 | Ga0209758_1000059 | Ga0209758_100005922 | 328 |
| 2643 | 3300025297 | Ga0209758_1000111 | Ga0209758_100011182 | 328 |
| 2644 | 3300025297 | Ga0209758_1022623 | Ga0209758_10226232 | 328 |
| 2645 | 3300025298 | Ga0209050_1004722 | Ga0209050_100472210 | 328 |
| 2646 | 3300025299 | Ga0209256_1000619 | Ga0209256_100061935 | 328 |
| 2647 | 3300025302 | Ga0207426_1000011 | Ga0207426_100001180 | 328 |
| 2648 | 3300025303 | Ga0209051_1008002 | Ga0209051_10080022 | 328 |
| 2649 | 3300025303 | Ga0209051_1027204 | Ga0209051_10272041 | 328 |
| 2650 | 3300025304 | Ga0209257_1000997 | Ga0209257_100099716 | 328 |
| 2651 | 3300025903 | Ga0207680_10292765 | Ga0207680_102927651 | 328 |
| 2652 | 3300025910 | Ga0207684_10193153 | Ga0207684_101931533 | 328 |
| 2653 | 3300025925 | Ga0207650_10022208 | Ga0207650_100222083 | 328 |
| 2654 | 3300025929 | Ga0207664_10082568 | Ga0207664_100825683 | 328 |
| 2655 | 3300025929 | Ga0207664_10281055 | Ga0207664_102810551 | 328 |
| 2656 | 3300025931 | Ga0207644_10008328 | Ga0207644_100083288 | 328 |
| 2657 | 3300025933 | Ga0207706_10078106 | Ga0207706_100781062 | 328 |
| 2658 | 3300025939 | Ga0207665_10148182 | Ga0207665_101481822 | 328 |
| 2659 | 3300025960 | Ga0207651_10067158 | Ga0207651_100671582 | 328 |
| 2660 | 3300026116 | Ga0207674_10176613 | Ga0207674_101766132 | 328 |
| 2661 | 3300026121 | Ga0207683_10287481 | Ga0207683_102874811 | 328 |
| 2662 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037179 | 328 |
| 2663 | 3300027312 | Ga0209371_1000534 | Ga0209371_10005345 | 328 |
| 2664 | 3300027312 | Ga0209371_1000686 | Ga0209371_10006862 | 328 |
| 2665 | 3300027312 | Ga0209371_1006547 | Ga0209371_10065474 | 328 |
| 2666 | 3300027666 | Ga0209282_1003316 | Ga0209282_10033166 | 328 |
| 2667 | 3300027866 | Ga0209813_10003330 | Ga0209813_100033303 | 328 |
| 2668 | 3300028379 | Ga0268266_10001956 | Ga0268266_100019563 | 328 |
| 2669 | 3300028794 | Ga0307515_10001890 | Ga0307515_1000189019 | 328 |
| 2670 | 3300028794 | Ga0307515_10048889 | Ga0307515_100488897 | 328 |
| 2671 | 3300030500 | Ga0268256_1000039 | Ga0268256_1000039129 | 328 |
| 2672 | 3300030500 | Ga0268256_1001706 | Ga0268256_100170611 | 328 |
| 2673 | 3300030500 | Ga0268256_1004290 | Ga0268256_10042903 | 328 |
| 2674 | 3300030500 | Ga0268256_1005810 | Ga0268256_10058104 | 328 |
| 2675 | 3300030744 | Ga0316181_1049652 | Ga0316181_10496524 | 328 |
| 2676 | 3300031456 | Ga0307513_10327763 | Ga0307513_103277632 | 328 |
| 2677 | 3300031727 | Ga0316576_10025908 | Ga0316576_100259085 | 328 |
| 2678 | 3300031728 | Ga0316578_10019852 | Ga0316578_100198523 | 328 |
| 2679 | 3300031731 | Ga0307405_10021829 | Ga0307405_100218293 | 328 |
| 2680 | 3300031901 | Ga0307406_10208623 | Ga0307406_102086232 | 328 |
| 2681 | 3300031911 | Ga0307412_10004632 | Ga0307412_100046323 | 328 |
| 2682 | 3300031995 | Ga0307409_100037634 | Ga0307409_1000376343 | 328 |
| 2683 | 3300032004 | Ga0307414_10037748 | Ga0307414_100377483 | 328 |
| 2684 | 3300032004 | Ga0307414_10150389 | Ga0307414_101503892 | 328 |
| 2685 | 3300035170 | Ga0373943_0120506 | Ga0373943_0120506_23_1018 | 328 |
| 2686 | 3300035172 | Ga0373955_0146999 | Ga0373955_0146999_23_1018 | 328 |
| 2687 | 3300035398 | Ga0316574_0166237 | Ga0316574_0166237_351_1352 | 328 |
| 2688 | 3300035410 | Ga0373924_0066750 | Ga0373924_0066750_368_1363 | 328 |
| 2689 | 3300035691 | Ga0373931_0216702 | Ga0373931_0216702_61_1050 | 328 |
| 2690 | 3300035724 | Ga0373933_0124702 | Ga0373933_0124702_192_1187 | 328 |
| 2691 | 3300035725 | Ga0373947_0287859 | Ga0373947_0287859_58_1053 | 328 |
| 2692 | 3300036401 | Ga0373937_0052053 | Ga0373937_0052053_1427_2422 | 328 |
| 2693 | 3300037068 | Ga0373925_0113013 | Ga0373925_0113013_317_1312 | 328 |
| 2694 | 3300037312 | Ga0395899_0169900 | Ga0395899_0169900_279_1274 | 328 |
| 2695 | 3300037418 | Ga0395900_0452707 | Ga0395900_0452707_132_1127 | 328 |
| 2696 | 3300037471 | Ga0395905_0108653 | Ga0395905_0108653_688_1674 | 328 |
| 2697 | 3300037471 | Ga0395905_0109022 | Ga0395905_0109022_1562_2548 | 328 |
| 2698 | 3300037853 | Ga0436364_0774424 | Ga0436364_0774424_64_1059 | 328 |
| 2699 | 3300038443 | Ga0395901_0200004 | Ga0395901_0200004_483_1478 | 328 |
| 2700 | 3300038443 | Ga0395901_0581085 | Ga0395901_0581085_34_1023 | 328 |
| 2701 | 3300039437 | Ga0436365_1644321 | Ga0436365_1644321_1536_2531 | 328 |
| 2702 | 3300046473 | Ga0495582_0061613 | Ga0495582_0061613_102_1097 | 328 |
| 2703 | 3300046501 | Ga0495607_0000153 | Ga0495607_0000153_17657_18649 | 328 |
| 2704 | 3300046507 | Ga0495606_0002805 | Ga0495606_0002805_3129_4115 | 328 |
| 2705 | 3300046507 | Ga0495606_0140452 | Ga0495606_0140452_397_1383 | 328 |
| 2706 | 3300046511 | Ga0495608_0095522 | Ga0495608_0095522_55_1050 | 328 |
| 2707 | 3300046522 | Ga0495643_0071616 | Ga0495643_0071616_453_1463 | 328 |
| 2708 | 3300046526 | Ga0495666_0127107 | Ga0495666_0127107_68_1063 | 328 |
| 2709 | 3300046558 | Ga0495633_0092161 | Ga0495633_0092161_249_1235 | 328 |
| 2710 | 3300046660 | Ga0495625_0089615 | Ga0495625_0089615_1051_2040 | 328 |
| 2711 | 3300046660 | Ga0495625_0115376 | Ga0495625_0115376_448_1434 | 328 |
| 2712 | 3300046674 | Ga0495588_0000431 | Ga0495588_0000431_7521_8558 | 328 |
| 2713 | 3300046679 | Ga0495623_0030375 | Ga0495623_0030375_516_1511 | 328 |
| 2714 | 3300046690 | Ga0495624_0042972 | Ga0495624_0042972_447_1442 | 328 |
| 2715 | 3300046692 | Ga0495671_0029760 | Ga0495671_0029760_709_1746 | 328 |
| 2716 | 3300047317 | Ga0495604_0085328 | Ga0495604_0085328_1039_2034 | 328 |
| 2717 | 3300047319 | Ga0495674_0061596 | Ga0495674_0061596_845_1840 | 328 |
| 2718 | 3300047322 | Ga0495680_0287053 | Ga0495680_0287053_112_1107 | 328 |
| 2719 | 3300047470 | Ga0495681_0005448 | Ga0495681_0005448_7511_8497 | 328 |
| 2720 | 3300047472 | Ga0495686_0000422 | Ga0495686_0000422_47144_48130 | 328 |
| 2721 | 3300048088 | Ga0495602_0070373 | Ga0495602_0070373_322_1317 | 328 |
| 2722 | 3300048903 | Ga0496100_0207717 | Ga0496100_0207717_293_1279 | 328 |
| 2723 | 3300048904 | Ga0496101_0289863 | Ga0496101_0289863_251_1237 | 328 |
| 2724 | 3300048915 | Ga0496112_0120503 | Ga0496112_0120503_977_1972 | 328 |
| 2725 | 3300048915 | Ga0496112_0124913 | Ga0496112_0124913_995_1990 | 328 |
| 2726 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_179649_180635 | 328 |
| 2727 | 3300048919 | Ga0496116_0012408 | Ga0496116_0012408_2733_3770 | 328 |
| 2728 | 3300048919 | Ga0496116_0012509 | Ga0496116_0012509_5188_6174 | 328 |
| 2729 | 3300048919 | Ga0496116_0019060 | Ga0496116_0019060_780_1766 | 328 |
| 2730 | 3300048919 | Ga0496116_0040535 | Ga0496116_0040535_1465_2451 | 328 |
| 2731 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_216943_217980 | 328 |
| 2732 | 3300048920 | Ga0496117_0011023 | Ga0496117_0011023_6165_7151 | 328 |
| 2733 | 3300048920 | Ga0496117_0014595 | Ga0496117_0014595_4559_5545 | 328 |
| 2734 | 3300048920 | Ga0496117_0031515 | Ga0496117_0031515_342_1328 | 328 |
| 2735 | 3300048921 | Ga0496118_0007166 | Ga0496118_0007166_3979_5016 | 328 |
| 2736 | 3300048921 | Ga0496118_0017115 | Ga0496118_0017115_535_1521 | 328 |
| 2737 | 3300048921 | Ga0496118_0056878 | Ga0496118_0056878_775_1761 | 328 |
| 2738 | 3300048921 | Ga0496118_0110647 | Ga0496118_0110647_30_1016 | 328 |
| 2739 | 3300048922 | Ga0496119_0008094 | Ga0496119_0008094_5060_6046 | 328 |
| 2740 | 3300048923 | Ga0496120_0000337 | Ga0496120_0000337_66144_67181 | 328 |
| 2741 | 3300048923 | Ga0496120_0021465 | Ga0496120_0021465_1890_2876 | 328 |
| 2742 | 3300048924 | Ga0496121_0002534 | Ga0496121_0002534_2907_3893 | 328 |
| 2743 | 3300048924 | Ga0496121_0026378 | Ga0496121_0026378_4476_5462 | 328 |
| 2744 | 3300048924 | Ga0496121_0030244 | Ga0496121_0030244_2775_3761 | 328 |
| 2745 | 3300048924 | Ga0496121_0064178 | Ga0496121_0064178_1797_2807 | 328 |
| 2746 | 3300048924 | Ga0496121_0112075 | Ga0496121_0112075_54_1040 | 328 |
| 2747 | 3300048924 | Ga0496121_0112864 | Ga0496121_0112864_807_1793 | 328 |
| 2748 | 3300048924 | Ga0496121_0145201 | Ga0496121_0145201_434_1420 | 328 |
| 2749 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_216931_217968 | 328 |
| 2750 | 3300048925 | Ga0496122_0013243 | Ga0496122_0013243_1066_2052 | 328 |
| 2751 | 3300048925 | Ga0496122_0015622 | Ga0496122_0015622_5482_6468 | 328 |
| 2752 | 3300048925 | Ga0496122_0041958 | Ga0496122_0041958_2353_3363 | 328 |
| 2753 | 3300048925 | Ga0496122_0042708 | Ga0496122_0042708_1595_2584 | 328 |
| 2754 | 3300048925 | Ga0496122_0082611 | Ga0496122_0082611_179_1165 | 328 |
| 2755 | 3300048925 | Ga0496122_0134606 | Ga0496122_0134606_445_1431 | 328 |
| 2756 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_163068_164105 | 328 |
| 2757 | 3300048926 | Ga0496123_0006417 | Ga0496123_0006417_917_1903 | 328 |
| 2758 | 3300048926 | Ga0496123_0026974 | Ga0496123_0026974_1170_2156 | 328 |
| 2759 | 3300048926 | Ga0496123_0151012 | Ga0496123_0151012_85_1071 | 328 |
| 2760 | 3300048926 | Ga0496123_0165177 | Ga0496123_0165177_149_1135 | 328 |
| 2761 | 3300048927 | Ga0496124_0000174 | Ga0496124_0000174_65736_66743 | 328 |
| 2762 | 3300048927 | Ga0496124_0001771 | Ga0496124_0001771_15976_16962 | 328 |
| 2763 | 3300048927 | Ga0496124_0006219 | Ga0496124_0006219_5696_6682 | 328 |
| 2764 | 3300048927 | Ga0496124_0026047 | Ga0496124_0026047_3379_4365 | 328 |
| 2765 | 3300048927 | Ga0496124_0178713 | Ga0496124_0178713_368_1378 | 328 |
| 2766 | 3300048928 | Ga0496125_0012335 | Ga0496125_0012335_3697_4683 | 328 |
| 2767 | 3300048928 | Ga0496125_0035505 | Ga0496125_0035505_221_1213 | 328 |
| 2768 | 3300048928 | Ga0496125_0069923 | Ga0496125_0069923_1066_2052 | 328 |
| 2769 | 3300048928 | Ga0496125_0154175 | Ga0496125_0154175_258_1244 | 328 |
| 2770 | 3300048929 | Ga0496126_0000115 | Ga0496126_0000115_179590_180576 | 328 |
| 2771 | 3300048929 | Ga0496126_0074572 | Ga0496126_0074572_1661_2647 | 328 |
| 2772 | 3300048929 | Ga0496126_0121485 | Ga0496126_0121485_728_1714 | 328 |
| 2773 | 3300049568 | Ga0501031_0090643 | Ga0501031_0090643_581_1570 | 328 |
| 2774 | 3300049569 | Ga0501032_0001879 | Ga0501032_0001879_9133_10122 | 328 |
| 2775 | 3300049570 | Ga0501033_0004368 | Ga0501033_0004368_3751_4740 | 328 |
| 2776 | 3300049570 | Ga0501033_0091662 | Ga0501033_0091662_934_1923 | 328 |
| 2777 | 3300049570 | Ga0501033_0160838 | Ga0501033_0160838_486_1475 | 328 |
| 2778 | 3300049571 | Ga0501034_0000162 | Ga0501034_0000162_50112_51098 | 328 |
| 2779 | 3300049572 | Ga0501036_0195620 | Ga0501036_0195620_88_1077 | 328 |
| 2780 | 3300049573 | Ga0501037_0095581 | Ga0501037_0095581_300_1289 | 328 |
| 2781 | 3300049573 | Ga0501037_0120734 | Ga0501037_0120734_727_1716 | 328 |
| 2782 | 3300049574 | Ga0501038_0005084 | Ga0501038_0005084_962_1951 | 328 |
| 2783 | 3300049574 | Ga0501038_0011772 | Ga0501038_0011772_6576_7565 | 328 |
| 2784 | 3300049575 | Ga0501039_0005792 | Ga0501039_0005792_3302_4291 | 328 |
| 2785 | 3300049579 | Ga0501043_0003174 | Ga0501043_0003174_359_1348 | 328 |
| 2786 | 3300049580 | Ga0501046_0001837 | Ga0501046_0001837_10219_11208 | 328 |
| 2787 | 3300049580 | Ga0501046_0223548 | Ga0501046_0223548_143_1132 | 328 |
| 2788 | 3300049581 | Ga0501047_0038887 | Ga0501047_0038887_3138_4127 | 328 |
| 2789 | 3300049582 | Ga0501048_0031194 | Ga0501048_0031194_1541_2530 | 328 |
| 2790 | 3300049584 | Ga0501068_0014566 | Ga0501068_0014566_2925_3914 | 328 |
| 2791 | 3300049584 | Ga0501068_0039568 | Ga0501068_0039568_368_1357 | 328 |
| 2792 | 3300049585 | Ga0501069_0002411 | Ga0501069_0002411_3038_4027 | 328 |
| 2793 | 3300049586 | Ga0501070_0028069 | Ga0501070_0028069_213_1202 | 328 |
| 2794 | 3300049586 | Ga0501070_0082113 | Ga0501070_0082113_513_1664 | 328 |
| 2795 | 3300049589 | Ga0501073_0001201 | Ga0501073_0001201_6661_7650 | 328 |
| 2796 | 3300049589 | Ga0501073_0005720 | Ga0501073_0005720_7228_8217 | 328 |
| 2797 | 3300049589 | Ga0501073_0006498 | Ga0501073_0006498_2033_3184 | 328 |
| 2798 | 3300049589 | Ga0501073_0202869 | Ga0501073_0202869_274_1305 | 328 |
| 2799 | 3300049590 | Ga0501074_0005855 | Ga0501074_0005855_380_1369 | 328 |
| 2800 | 3300049742 | Ga0501080_0007728 | Ga0501080_0007728_8546_9535 | 328 |
| 2801 | 3300049742 | Ga0501080_0016485 | Ga0501080_0016485_1654_2805 | 328 |
| 2802 | 3300049742 | Ga0501080_0318785 | Ga0501080_0318785_188_1177 | 328 |
| 2803 | 3300049742 | Ga0501080_0369927 | Ga0501080_0369927_144_1175 | 328 |
| 2804 | 3300049744 | Ga0501083_0014715 | Ga0501083_0014715_963_1952 | 328 |
| 2805 | 3300049744 | Ga0501083_0015468 | Ga0501083_0015468_500_1489 | 328 |
| 2806 | 3300049744 | Ga0501083_0016876 | Ga0501083_0016876_400_1551 | 328 |
| 2807 | 3300049822 | Ga0501035_0002914 | Ga0501035_0002914_8845_9834 | 328 |
| 2808 | 3300049822 | Ga0501035_0114415 | Ga0501035_0114415_667_1656 | 328 |
| 2809 | 3300049822 | Ga0501035_0155418 | Ga0501035_0155418_631_1632 | 328 |
| 2810 | 3300049823 | Ga0501044_0004042 | Ga0501044_0004042_12984_13973 | 328 |
| 2811 | 3300049823 | Ga0501044_0272868 | Ga0501044_0272868_500_1489 | 328 |
| 2812 | 3300049823 | Ga0501044_0378722 | Ga0501044_0378722_74_1063 | 328 |
| 2813 | 3300050489 | nmdc:mga03683_23316_c1 | nmdc:mga03683_23316_c1_221_1258 | 328 |
| 2814 | 3300050490 | nmdc:mga03n38_2857_c1 | nmdc:mga03n38_2857_c1_3366_4403 | 328 |
| 2815 | 3300050491 | nmdc:mga00v17_150906_c1 | nmdc:mga00v17_150906_c1_240_1229 | 328 |
| 2816 | 3300050491 | nmdc:mga00v17_183_c1 | nmdc:mga00v17_183_c1_13136_14173 | 328 |
| 2817 | 3300050492 | nmdc:mga0yw44_751_c1 | nmdc:mga0yw44_751_c1_7794_8831 | 328 |
| 2818 | 3300050494 | nmdc:mga06z11_53691_c1 | nmdc:mga06z11_53691_c1_688_1725 | 328 |
| 2819 | 3300050494 | nmdc:mga06z11_54516_c1 | nmdc:mga06z11_54516_c1_177_1214 | 328 |
| 2820 | 3300050516 | nmdc:mga0sz30_80_c1 | nmdc:mga0sz30_80_c1_974_2011 | 328 |
| 2821 | 3300053090 | Ga0500646_0017598 | Ga0500646_0017598_434_1423 | 328 |
| 2822 | 3300053107 | Ga0500560_049602 | Ga0500560_049602_254_1291 | 328 |
| 2823 | 3300053130 | Ga0500642_0006925 | Ga0500642_0006925_1329_2318 | 328 |
| 2824 | 3300053137 | Ga0500561_0000591 | Ga0500561_0000591_1650_2687 | 328 |
| 2825 | 3300053139 | Ga0500568_0001521 | Ga0500568_0001521_12055_13044 | 328 |
| 2826 | 3300053151 | Ga0500604_0002220 | Ga0500604_0002220_905_1894 | 328 |
| 2827 | 3300053153 | Ga0500616_0000539 | Ga0500616_0000539_1038_2027 | 328 |
| 2828 | 3300053157 | Ga0500624_000519 | Ga0500624_000519_10003_10989 | 328 |
| 2829 | 3300053158 | Ga0500627_0088520 | Ga0500627_0088520_59_1045 | 328 |
| 2830 | 3300053731 | Ga0500609_001805 | Ga0500609_001805_1290_2279 | 328 |
| 2831 | 3300054114 | Ga0501084_0017572 | Ga0501084_0017572_3574_4563 | 328 |
| 2832 | 3300054114 | Ga0501084_0405285 | Ga0501084_0405285_26_1015 | 328 |
| 2833 | 3300060353 | Ga0501082_0005230 | Ga0501082_0005230_3919_4908 | 328 |
| 2834 | iso_pu_bacteria | 2643221698 | 2644541540 | 328 |
| 2835 | 3300005262 | Ga0065165_1000313 | Ga0065165_100031349 | 329 |
| 2836 | 3300005439 | Ga0070711_100250879 | Ga0070711_1002508791 | 329 |
| 2837 | 3300005616 | Ga0068852_100064598 | Ga0068852_1000645983 | 329 |
| 2838 | 3300006846 | Ga0075430_100082381 | Ga0075430_1000823813 | 329 |
| 2839 | 3300006847 | Ga0075431_100337982 | Ga0075431_1003379822 | 329 |
| 2840 | 3300010375 | Ga0105239_10103610 | Ga0105239_101036102 | 329 |
| 2841 | 3300013105 | Ga0157369_10005525 | Ga0157369_100055255 | 329 |
| 2842 | 3300013307 | Ga0157372_10096778 | Ga0157372_100967785 | 329 |
| 2843 | 3300025284 | Ga0209130_1000209 | Ga0209130_100020924 | 329 |
| 2844 | 3300025294 | Ga0209025_1014934 | Ga0209025_10149342 | 329 |
| 2845 | 3300025302 | Ga0207426_1009460 | Ga0207426_10094605 | 329 |
| 2846 | 3300026078 | Ga0207702_10120775 | Ga0207702_101207751 | 329 |
| 2847 | 3300031995 | Ga0307409_100540779 | Ga0307409_1005407791 | 329 |
| 2848 | 3300037471 | Ga0395905_0000247 | Ga0395905_0000247_3906_4898 | 329 |
| 2849 | 3300049592 | Ga0501076_0423612 | Ga0501076_0423612_49_1056 | 329 |
| 2850 | 3300050510 | nmdc:mga06r32_114999_c1 | nmdc:mga06r32_114999_c1_342_1349 | 329 |
| 2851 | iso_pu_bacteria | 2909042592 | 2909046450 | 330 |
| 2852 | 3300048929 | Ga0496126_0207275 | Ga0496126_0207275_163_1167 | 332 |
| 2853 | 3300053122 | Ga0500608_125193 | Ga0500608_125193_93_1097 | 332 |
| 2854 | 3300021388 | Ga0213875_10156609 | Ga0213875_101566091 | 333 |
| 2855 | 3300037853 | Ga0436364_0031070 | Ga0436364_0031070_1059_2060 | 333 |
| 2856 | 3300037853 | Ga0436364_0155142 | Ga0436364_0155142_176_1177 | 333 |
| 2857 | 3300001979 | JGI24740J21852_10021610 | JGI24740J21852_100216102 | 334 |
| 2858 | 3300006186 | Ga0075369_10020387 | Ga0075369_100203872 | 334 |
| 2859 | 3300050516 | nmdc:mga0sz30_5131_c1 | nmdc:mga0sz30_5131_c1_3192_4196 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hrz-assembly1.cif.gz_A-2 | the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens | 0.9721 | 1 | 332 |
| 2hrz-assembly1.cif.gz_A-2 | the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens | 0.9521 | 1 | 332 |
| 7cgv-assembly1.cif.gz_C-2 | full consensus l-threonine 3-dehydrogenase, fctdh-iiym (nad+ bound form) | 0.8895 | 1 | 325 |
| 7cgv-assembly1.cif.gz_D-2 | full consensus l-threonine 3-dehydrogenase, fctdh-iiym (nad+ bound form) | 0.8861 | 1 | 325 |
| 7epr-assembly2.cif.gz_C | partial consensus l-threonine 3-dehydrogenase (c-change) | 0.8856 | 2 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hrzA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9541 | 1 | 310 | 3.40.50.720 |
| 2hrzA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9499 | 1 | 310 | 3.40.50.720 |
| 2hrzA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9412 | 183 | 332 | 3.90.25.10 |
| 2hrzA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9319 | 183 | 332 | 3.90.25.10 |
| 3a4vB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8781 | 3 | 324 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A1PP05-F1-model_v4 | UDP-glucose 4-epimerase | 0.9844 | 1 | 330 |
GO:0016491
|
| AF-A0A7X3Z7P9-F1-model_v4 | NAD-dependent epimerase | 0.9842 | 163 | 326 |
|
| AF-A0A159Z7H1-F1-model_v4 | Nucleoside-diphosphate-sugar epimerase | 0.9823 | 1 | 328 |
GO:0016491
|
| AF-A0A530CEN0-F1-model_v4 | NAD-dependent epimerase | 0.9811 | 200 | 333 |
|
| AF-A0A3S2A8I2-F1-model_v4 | NAD-dependent epimerase | 0.981 | 136 | 333 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar