F496910

General Info

Members Datasets Scaffolds Average Seq Length
2551 683 2429 189

Family's Representative Sequence

Representative Sequence 3300049649|Ga0501198_000191|Ga0501198_000191_4076_4657
Length 193
Sequence MARPVAYNVNEKPLVKDISVAEMPEGYQGEGFFASKLNDVVGLARKNSIWPLPFATSCCGIEFMATMASHYDLARFGSERVGFSPRQCDLLMVGTVAKKMAPVVKQVYLQMAEPRWVIAVGACACSGGIFDTYSVLQGIDQVVPVDVYVPGCPPRPEAIIDGVIRIQDLIGKESLRRRNSDHYKKLLESYGIQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
6 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
7 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
8 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
9 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
10 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
11 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
12 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
13 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
14 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
15 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
16 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
17 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
18 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
19 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
20 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
21 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
22 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
23 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
24 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
25 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
26 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
27 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
28 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
29 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
30 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
31 2738541278 Niastella sp. CF465 Isolate Unclassified
32 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
33 2738541283 Pedobacter sp. OK701 Isolate Unclassified
34 2738541284 Pedobacter sp. YR016 Isolate Unclassified
35 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
36 2738541302 Pedobacter sp. CF074 Isolate Unclassified
37 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
38 2738543023 Pedobacter sp. OK628 Isolate Unclassified
39 2739367651 Pedobacter sp. OK291 Isolate Unclassified
40 2739367656 Pedobacter sp. CF523 Isolate Unclassified
41 2739367663 Pedobacter sp. YR510 Isolate Unclassified
42 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
43 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
44 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
45 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
46 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
47 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
48 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
49 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
50 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
51 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
52 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
53 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
54 2818991437 Pedobacter terrae 518 Isolate Unclassified
55 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
56 2818991444 Filimonas endophytica 3197 Isolate Unclassified
57 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
58 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
59 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
60 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
61 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
62 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
63 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
64 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
65 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
66 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
67 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
68 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
69 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
70 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
71 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
72 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
73 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
74 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
75 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
76 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
77 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
78 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
79 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
80 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
81 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
82 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
83 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
84 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
85 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
86 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
87 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
88 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
89 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
90 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
91 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
92 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
93 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
94 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
95 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
96 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
97 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
98 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
99 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
100 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
101 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
102 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
103 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
104 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
105 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
106 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
107 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
108 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
109 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
110 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
111 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
112 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
113 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
114 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
115 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
116 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
117 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
118 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
119 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
120 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
121 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
122 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
123 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
124 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
125 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
126 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
127 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
128 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
129 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
130 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
131 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
132 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
133 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
134 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
135 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
136 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
137 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
138 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
139 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
140 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
141 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
142 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
143 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
144 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
145 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
146 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
147 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
148 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
152 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
153 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
154 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
155 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
156 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
157 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
158 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
159 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
160 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
161 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
162 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
163 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
164 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
165 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
171 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
172 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
173 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
179 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
184 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
185 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
186 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
187 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
188 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
189 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
190 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
191 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
192 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
193 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
194 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
195 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
196 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
197 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
198 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
199 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
200 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
201 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
202 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
203 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
204 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
205 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
206 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
207 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
208 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
209 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
210 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
211 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
212 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
213 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
214 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
215 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
216 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
217 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
218 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
219 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
220 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
221 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
222 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
223 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
224 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
225 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
226 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
227 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
228 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
229 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
230 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
231 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
232 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
233 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
234 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
235 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
236 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
237 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
238 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
239 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
240 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
241 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
242 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
243 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
244 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
245 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
246 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
247 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
248 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
249 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
250 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
251 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
252 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
253 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
254 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
255 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
256 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
257 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
258 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
259 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
260 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
261 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
262 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
263 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
264 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
265 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
266 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
267 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
268 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
269 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
270 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
271 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
272 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
273 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
274 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
275 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
277 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
278 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
279 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
280 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
281 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
282 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
284 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
285 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
286 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
288 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
289 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
291 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
292 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
294 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
295 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
297 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
361 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
363 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
364 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
369 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
370 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
371 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
372 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
373 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
374 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
375 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
376 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
377 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
378 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
379 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
380 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
381 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
382 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
383 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
384 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
385 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
386 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
387 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
388 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
389 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
390 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
391 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
392 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
393 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
394 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
395 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
396 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
397 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
398 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
399 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
400 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
401 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
402 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
403 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
404 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
405 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
406 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
407 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
408 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
409 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
410 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
411 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
412 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
413 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
414 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
415 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
416 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
417 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
418 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
419 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
420 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
421 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
422 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
423 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
424 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
425 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
426 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
427 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
428 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
429 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
430 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
431 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
432 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
433 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
434 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
435 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
436 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
437 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
438 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
439 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
440 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
441 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
442 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
443 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
444 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
445 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
446 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
447 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
448 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
449 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
450 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
451 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
452 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
453 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
454 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
455 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
456 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
457 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
458 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
459 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
460 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
461 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
462 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
463 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
464 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
465 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
466 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
467 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
468 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
469 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
470 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
471 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
472 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
473 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
474 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
475 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
476 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
477 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
478 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
479 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
480 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
481 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
482 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
483 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
484 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
485 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
486 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
487 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
488 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
489 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
490 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
491 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
492 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
493 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
494 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
495 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
496 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
497 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
498 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
499 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
500 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
501 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
502 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
503 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
504 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
505 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
506 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
507 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
508 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
509 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
510 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
511 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
512 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
513 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
514 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
515 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
516 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
517 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
518 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
519 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
520 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
521 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
522 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
523 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
524 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
525 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
526 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
527 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
528 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
529 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
530 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
531 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
532 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
533 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
534 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
535 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
536 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
537 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
538 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
539 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
540 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
541 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
542 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
543 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
544 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
545 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
546 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
547 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
548 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
549 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
550 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
551 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
552 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
553 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
554 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
557 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
558 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
559 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
560 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
571 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
572 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
573 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
574 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
575 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
576 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
581 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
582 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
583 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
584 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
585 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
586 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
587 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
588 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
589 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
590 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
591 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
592 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
593 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
594 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
595 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
596 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
597 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
598 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
599 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
600 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
601 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
602 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
603 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
604 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
605 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
606 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
607 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
608 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
609 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
610 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
611 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
612 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
613 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
614 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
615 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
616 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
617 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
618 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
619 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
620 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
621 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
622 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
623 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
624 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
625 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
626 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
627 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
628 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
631 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
632 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
633 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
634 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
635 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
636 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
637 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
638 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
639 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
640 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
641 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
642 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
643 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
644 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
645 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
646 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
647 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
648 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
649 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
650 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
651 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
652 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
653 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
654 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
655 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
656 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
657 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
658 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
659 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
660 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
661 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
662 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
663 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
664 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
665 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
666 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
667 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
668 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
669 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
670 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
671 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
672 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
673 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
674 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
675 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
676 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
677 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
678 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
679 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
680 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
681 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
682 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
683 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.61
Metatranscriptomes 1.57
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 5.61
Nodule 0.2
Rhizoplane 0.98
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 6.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1257564 2162886007 Bacteria 5034
2 SwRhRL2b_contig_1903953 2162886007 Bacteria 5593
3 SwRhRL2b_contig_3060273 2162886007 Bacteria 1474
4 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
5 JGI24736J21556_1004496 3300001904 Bacteria 2379
6 JGI24741J21665_1002825 3300001915 Bacteria 4372
7 JGI24741J21665_1024405 3300001915 Bacteria 928
8 JGI24740J21852_10012520 3300001979 Bacteria 3196
9 JGI24740J21852_10026629 3300001979 Bacteria 1934
10 JGI24740J21852_10078365 3300001979 Bacteria 870
11 JGI24739J22299_10031539 3300001989 Bacteria 1831
12 JGI24737J22298_10000060 3300001990 Bacteria 32592
13 JGI24737J22298_10009666 3300001990 Bacteria 3198
14 JGI24737J22298_10012518 3300001990 Bacteria 2767
15 JGI24743J22301_10019000 3300001991 Bacteria 1303
16 JGI24735J21928_10000032 3300002067 Bacteria 72360
17 JGI24744J21845_10003750 3300002077 Bacteria 3137
18 JGI24744J21845_10027116 3300002077 Bacteria 1108
19 JGI24751J29686_10003202 3300002459 Bacteria 3296
20 JGI25162J39368_1000162 3300002737 Bacteria 74157
21 JGI25162J39368_1001606 3300002737 Bacteria 11358
22 JGI25158J39367_1002825 3300002739 Bacteria 2753
23 JGI25157J39369_1010610 3300002741 Bacteria 1209
24 JGI25157J39369_1012391 3300002741 Bacteria 1085
25 JGI25152J39213_1000064 3300002773 Bacteria 70321
26 JGI25150J39212_1000004 3300002774 Bacteria 417320
27 JGI25151J46595_10000002 3300003187 Bacteria 731381
28 JGI25165J46597_1000742 3300003214 Bacteria 25223
29 JGI25153J46596_10000037 3300003215 Bacteria 182199
30 rootH1_10004943 3300003316 Bacteria 35922
31 rootH1_10004943 3300003323 Bacteria 7849
32 rootH1_10006747 3300003316 Bacteria 3927
33 rootH1_10010867 3300003316 Bacteria 12601
34 rootH1_10069796 3300003316 Unclassified 3852
35 rootH1_10103591 3300003316 Bacteria 2772
36 rootH1_10165346 3300003316 Bacteria 1420
37 rootH2_10000933 3300003320 Bacteria 60850
38 rootH2_10009361 3300003320 Bacteria 18045
39 rootH2_10012714 3300003320 Bacteria 66260
40 rootH2_10065769 3300003320 Bacteria 9761
41 rootH2_10079618 3300003320 Bacteria 1584
42 rootH2_10160238 3300003320 Bacteria 4302
43 rootH2_10219384 3300003320 Bacteria 1229
44 rootH2_10268171 3300003320 Bacteria 1362
45 rootL2_10015405 3300003322 Bacteria 1288
46 rootL2_10066925 3300003322 Bacteria 3101
47 rootL2_10080370 3300003322 Bacteria 6618
48 rootL2_10090698 3300003322 Bacteria 3720
49 rootL2_10103511 3300003322 Bacteria 6322
50 rootL2_10145978 3300003322 Bacteria 2724
51 rootL2_10151186 3300003322 Bacteria 2509
52 rootL2_10160394 3300003322 Bacteria 6640
53 rootL2_10185688 3300003322 Bacteria 1317
54 rootH1_10006156 3300003323 Bacteria 1492
55 rootH1_10016727 3300003323 Bacteria 4201
56 rootH1_10023472 3300003323 Bacteria 8799
57 rootH1_10027403 3300003323 Bacteria 72977
58 rootH1_10031034 3300003323 Bacteria 5747
59 rootH1_10037602 3300003323 Bacteria 6763
60 rootH1_10043337 3300003323 Bacteria 1919
61 rootH1_10071186 3300003323 Bacteria 6016
62 rootH1_10073633 3300003323 Bacteria 12529
63 rootH1_10128965 3300003323 Bacteria 2632
64 rootH1_10285744 3300003323 Bacteria 1603
65 JGI25160J50197_1015521 3300003354 Bacteria 2495
66 JGI25160J50197_1015845 3300003354 Bacteria 2456
67 Ga0006562J51391_1000057 3300003578 Bacteria 14964
68 Ga0006562J51391_1020675 3300003578 Bacteria 3234
69 Ga0055535_1002568 3300003761 Bacteria 6121
70 Ga0055536_1000006 3300003781 Bacteria 347733
71 Ga0055536_1001873 3300003781 Bacteria 12248
72 Ga0055530_10002618 3300003791 Bacteria 11320
73 Ga0055531_10000132 3300003794 Bacteria 85251
74 Ga0058863_10008894 3300004799 Bacteria 11745
75 Ga0058863_11905458 3300004799 Bacteria 1879
76 Ga0058861_11827112 3300004800 Bacteria 5337
77 Ga0058861_12064659 3300004800 Unclassified 1223
78 Ga0058862_10143705 3300004803 Bacteria 8181
79 Ga0065165_1000176 3300005262 Bacteria 113592
80 Ga0065165_1015200 3300005262 Bacteria 2947
81 Ga0065717_1003280 3300005276 Bacteria 1339
82 Ga0065714_10003515 3300005288 Bacteria 13628
83 Ga0065714_10004799 3300005288 Bacteria 5112
84 Ga0065714_10005806 3300005288 Bacteria 5425
85 Ga0065714_10064700 3300005288 Bacteria 22656
86 Ga0065714_10065068 3300005288 Bacteria 13285
87 Ga0065714_10065706 3300005288 Bacteria 8788
88 Ga0065714_10082406 3300005288 Bacteria 2306
89 Ga0065714_10120004 3300005288 Bacteria 1360
90 Ga0065714_10214748 3300005288 Bacteria 857
91 Ga0065704_10000273 3300005289 Bacteria 42739
92 Ga0065704_10002179 3300005289 Bacteria 9547
93 Ga0065704_10070133 3300005289 Bacteria 1266035
94 Ga0065704_10071020 3300005289 Bacteria 13717
95 Ga0065704_10072328 3300005289 Bacteria 8734
96 Ga0065704_10075908 3300005289 Bacteria 5359
97 Ga0065704_10076736 3300005289 Bacteria 4983
98 Ga0065704_10088760 3300005289 Bacteria 2906
99 Ga0065704_10173502 3300005289 Bacteria 1277
100 Ga0065704_10223722 3300005289 Bacteria 1065
101 Ga0065704_10359680 3300005289 Bacteria 765
102 Ga0065712_10001291 3300005290 Bacteria 6319
103 Ga0065712_10019199 3300005290 Bacteria 1584
104 Ga0065712_10024964 3300005290 Bacteria 1500
105 Ga0065712_10027666 3300005290 Bacteria 1394
106 Ga0065712_10193002 3300005290 Bacteria 1140
107 Ga0065712_10305783 3300005290 Bacteria 852
108 Ga0065712_10492629 3300005290 Bacteria 655
109 Ga0065715_10023059 3300005293 Bacteria 1766
110 Ga0065715_10227464 3300005293 Bacteria 1244
111 Ga0065715_10730468 3300005293 Bacteria 639
112 Ga0065707_10315368 3300005295 Bacteria 976
113 Ga0065707_10487592 3300005295 Bacteria 768
114 Ga0070658_10000008 3300005327 Bacteria 319912
115 Ga0070658_10009840 3300005327 Bacteria 7680
116 Ga0070658_10011839 3300005327 Bacteria 7002
117 Ga0070658_10020757 3300005327 Bacteria 5263
118 Ga0070658_10029799 3300005327 Bacteria 4384
119 Ga0070658_10071156 3300005327 Bacteria 2849
120 Ga0070658_10153214 3300005327 Bacteria 1931
121 Ga0070658_10167994 3300005327 Bacteria 1842
122 Ga0070658_10177945 3300005327 Unclassified 1789
123 Ga0070658_10360944 3300005327 Bacteria 1244
124 Ga0070658_10469365 3300005327 Unclassified 1085
125 Ga0070658_10705034 3300005327 Bacteria 876
126 Ga0070658_10747131 3300005327 Bacteria 849
127 Ga0070658_11440536 3300005327 Bacteria 597
128 Ga0070676_10000113 3300005328 Bacteria 29666
129 Ga0070676_10022983 3300005328 Unclassified 3501
130 Ga0070676_10118050 3300005328 Bacteria 1661
131 Ga0070676_10341084 3300005328 Bacteria 1027
132 Ga0070683_100002523 3300005329 Bacteria 14587
133 Ga0070683_100004195 3300005329 Bacteria 11821
134 Ga0070683_100010084 3300005329 Bacteria 8104
135 Ga0070683_100012101 3300005329 Bacteria 7487
136 Ga0070683_100020627 3300005329 Bacteria 5866
137 Ga0070683_100049343 3300005329 Bacteria 3893
138 Ga0070683_100397444 3300005329 Bacteria 1314
139 Ga0070683_100514269 3300005329 Bacteria 1144
140 Ga0070683_100555586 3300005329 Bacteria 1098
141 Ga0070690_100091134 3300005330 Bacteria 2008
142 Ga0070690_100224632 3300005330 Bacteria 1317
143 Ga0070670_100014049 3300005331 Bacteria 6868
144 Ga0070670_100032121 3300005331 Bacteria 4521
145 Ga0070670_100050803 3300005331 Bacteria 3562
146 Ga0070670_100067359 3300005331 Bacteria 3072
147 Ga0070670_100118749 3300005331 Bacteria 2281
148 Ga0070670_100186490 3300005331 Bacteria 1801
149 Ga0070670_100198202 3300005331 Bacteria 1744
150 Ga0070670_100317224 3300005331 Bacteria 1365
151 Ga0070670_100365392 3300005331 Bacteria 1269
152 Ga0070670_100417801 3300005331 Unclassified 1185
153 Ga0070670_100648887 3300005331 Bacteria 947
154 Ga0070670_100986116 3300005331 Bacteria 766
155 Ga0070670_101236346 3300005331 Bacteria 683
156 Ga0070677_10005742 3300005333 Bacteria 4102
157 Ga0070677_10006768 3300005333 Bacteria 3814
158 Ga0070677_10015956 3300005333 Bacteria 2668
159 Ga0070677_10261785 3300005333 Bacteria 863
160 Ga0068869_100003465 3300005334 Bacteria 9646
161 Ga0068869_100010132 3300005334 Bacteria 6135
162 Ga0068869_100032351 3300005334 Bacteria 3685
163 Ga0068869_100039690 3300005334 Bacteria 3363
164 Ga0068869_100069457 3300005334 Bacteria 2605
165 Ga0068869_100078657 3300005334 Bacteria 2456
166 Ga0068869_100092495 3300005334 Bacteria 2276
167 Ga0068869_100149038 3300005334 Bacteria 1813
168 Ga0068869_100281411 3300005334 Bacteria 1338
169 Ga0068869_100585767 3300005334 Bacteria 941
170 Ga0068869_100705845 3300005334 Bacteria 860
171 Ga0070666_10000019 3300005335 Bacteria 185877
172 Ga0070666_10003803 3300005335 Bacteria 9154
173 Ga0070666_10052869 3300005335 Bacteria 2738
174 Ga0070666_10080550 3300005335 Bacteria 2226
175 Ga0070666_10116028 3300005335 Bacteria 1854
176 Ga0070666_10145450 3300005335 Bacteria 1652
177 Ga0070666_10178962 3300005335 Bacteria 1487
178 Ga0070666_10181889 3300005335 Bacteria 1475
179 Ga0070680_100003171 3300005336 Bacteria 12221
180 Ga0070680_100043596 3300005336 Bacteria 3644
181 Ga0070680_100100682 3300005336 Bacteria 2398
182 Ga0070680_100114181 3300005336 Unclassified 2250
183 Ga0070680_100133367 3300005336 Bacteria 2079
184 Ga0070680_100574014 3300005336 Bacteria 967
185 Ga0070680_100751855 3300005336 Bacteria 839
186 Ga0070682_100000095 3300005337 Bacteria 80688
187 Ga0070682_100000129 3300005337 Bacteria 64098
188 Ga0070682_100002730 3300005337 Bacteria 9779
189 Ga0070682_100016072 3300005337 Bacteria 4347
190 Ga0070682_100063227 3300005337 Bacteria 2346
191 Ga0070682_100291711 3300005337 Bacteria 1193
192 Ga0070682_100823296 3300005337 Bacteria 756
193 Ga0068868_100001431 3300005338 Bacteria 16462
194 Ga0068868_100002147 3300005338 Bacteria 13621
195 Ga0068868_100053298 3300005338 Bacteria 3186
196 Ga0068868_100070080 3300005338 Bacteria 2795
197 Ga0068868_100104392 3300005338 Bacteria 2297
198 Ga0068868_100137570 3300005338 Bacteria 2003
199 Ga0068868_100190989 3300005338 Bacteria 1703
200 Ga0068868_100239983 3300005338 Bacteria 1522
201 Ga0070660_100001175 3300005339 Bacteria 17707
202 Ga0070660_100004582 3300005339 Bacteria 9553
203 Ga0070660_100018658 3300005339 Bacteria 5072
204 Ga0070660_100019439 3300005339 Bacteria 4979
205 Ga0070660_100045102 3300005339 Bacteria 3373
206 Ga0070660_100077601 3300005339 Bacteria 2603
207 Ga0070660_100132009 3300005339 Bacteria 1999
208 Ga0070660_100176293 3300005339 Bacteria 1729
209 Ga0070660_100186743 3300005339 Bacteria 1678
210 Ga0070660_100402992 3300005339 Bacteria 1131
211 Ga0070689_100016917 3300005340 Bacteria 5345
212 Ga0070689_100018290 3300005340 Bacteria 5161
213 Ga0070689_100339995 3300005340 Bacteria 1257
214 Ga0070689_100381138 3300005340 Bacteria 1188
215 Ga0070689_101444142 3300005340 Unclassified 622
216 Ga0070691_10000858 3300005341 Bacteria 12290
217 Ga0070687_100006837 3300005343 Bacteria 4704
218 Ga0070687_100125734 3300005343 Bacteria 1473
219 Ga0070687_100145842 3300005343 Bacteria 1384
220 Ga0070661_100016255 3300005344 Bacteria 5259
221 Ga0070661_100142574 3300005344 Bacteria 1807
222 Ga0070661_100199639 3300005344 Bacteria 1528
223 Ga0070661_100226284 3300005344 Bacteria 1436
224 Ga0070668_100021514 3300005347 Bacteria 4873
225 Ga0070668_100084280 3300005347 Bacteria 2496
226 Ga0070668_100096705 3300005347 Unclassified 2334
227 Ga0070668_100097190 3300005347 Bacteria 2329
228 Ga0070668_100217507 3300005347 Bacteria 1574
229 Ga0070668_100227278 3300005347 Bacteria 1541
230 Ga0070668_100231196 3300005347 Bacteria 1529
231 Ga0070668_100246320 3300005347 Bacteria 1482
232 Ga0070668_100269848 3300005347 Bacteria 1418
233 Ga0070668_100695473 3300005347 Bacteria 896
234 Ga0070668_100877013 3300005347 Bacteria 801
235 Ga0070668_100972031 3300005347 Bacteria 762
236 Ga0070668_101172613 3300005347 Bacteria 695
237 Ga0070669_100081941 3300005353 Bacteria 2405
238 Ga0070669_100289171 3300005353 Bacteria 1315
239 Ga0070669_100558594 3300005353 Bacteria 955
240 Ga0070669_100622949 3300005353 Bacteria 905
241 Ga0070669_100746761 3300005353 Bacteria 829
242 Ga0070675_100010608 3300005354 Bacteria 7203
243 Ga0070675_100016051 3300005354 Bacteria 5934
244 Ga0070675_100020128 3300005354 Bacteria 5325
245 Ga0070675_100066778 3300005354 Bacteria 2975
246 Ga0070675_100307702 3300005354 Bacteria 1397
247 Ga0070675_100479496 3300005354 Bacteria 1118
248 Ga0070675_100791966 3300005354 Bacteria 866
249 Ga0070671_100012313 3300005355 Bacteria 6887
250 Ga0070671_100021137 3300005355 Bacteria 5313
251 Ga0070671_100025759 3300005355 Bacteria 4829
252 Ga0070671_100040709 3300005355 Bacteria 3861
253 Ga0070671_100096203 3300005355 Bacteria 2483
254 Ga0070671_100147690 3300005355 Bacteria 1985
255 Ga0070671_100163464 3300005355 Bacteria 1882
256 Ga0070674_100043751 3300005356 Bacteria 3048
257 Ga0070674_100166966 3300005356 Bacteria 1675
258 Ga0070674_100366262 3300005356 Bacteria 1168
259 Ga0070674_100505825 3300005356 Bacteria 1007
260 Ga0070673_100015990 3300005364 Bacteria 5289
261 Ga0070673_100021179 3300005364 Bacteria 4706
262 Ga0070673_100024565 3300005364 Bacteria 4422
263 Ga0070673_100031579 3300005364 Bacteria 3976
264 Ga0070673_100048611 3300005364 Bacteria 3308
265 Ga0070673_100050664 3300005364 Bacteria 3247
266 Ga0070673_100068025 3300005364 Bacteria 2850
267 Ga0070673_100090256 3300005364 Bacteria 2503
268 Ga0070673_100100579 3300005364 Unclassified 2380
269 Ga0070673_100138403 3300005364 Bacteria 2052
270 Ga0070673_100625436 3300005364 Unclassified 984
271 Ga0070688_100011021 3300005365 Bacteria 5011
272 Ga0070688_100079543 3300005365 Bacteria 2118
273 Ga0070688_100177577 3300005365 Bacteria 1474
274 Ga0070688_100300563 3300005365 Bacteria 1160
275 Ga0070688_100579283 3300005365 Bacteria 856
276 Ga0070659_100001588 3300005366 Bacteria 16376
277 Ga0070659_100001887 3300005366 Bacteria 14999
278 Ga0070659_100007352 3300005366 Bacteria 8002
279 Ga0070659_100014518 3300005366 Bacteria 5887
280 Ga0070659_100020782 3300005366 Bacteria 4991
281 Ga0070659_100128914 3300005366 Bacteria 2053
282 Ga0070659_100154497 3300005366 Unclassified 1873
283 Ga0070659_100266422 3300005366 Bacteria 1422
284 Ga0070659_100815586 3300005366 Bacteria 812
285 Ga0070667_100001113 3300005367 Bacteria 24519
286 Ga0070667_100008643 3300005367 Bacteria 8439
287 Ga0070667_100028980 3300005367 Bacteria 4610
288 Ga0070667_100044905 3300005367 Bacteria 3713
289 Ga0070667_100089179 3300005367 Bacteria 2649
290 Ga0070667_100442337 3300005367 Bacteria 1187
291 Ga0070667_100547520 3300005367 Bacteria 1063
292 Ga0070667_101162088 3300005367 Bacteria 722
293 Ga0070714_100213716 3300005435 Bacteria 1769
294 Ga0070714_100994029 3300005435 Unclassified 816
295 Ga0070713_100221337 3300005436 Bacteria 1717
296 Ga0070701_10260746 3300005438 Bacteria 1050
297 Ga0070700_100205201 3300005441 Bacteria 1387
298 Ga0070700_100292407 3300005441 Bacteria 1186
299 Ga0070700_100385034 3300005441 Bacteria 1050
300 Ga0070700_100653679 3300005441 Bacteria 830
301 Ga0070663_100034247 3300005455 Bacteria 3516
302 Ga0070663_100102270 3300005455 Bacteria 2140
303 Ga0070663_100290414 3300005455 Bacteria 1306
304 Ga0070663_100318360 3300005455 Bacteria 1250
305 Ga0070663_101062607 3300005455 Bacteria 706
306 Ga0070678_100041229 3300005456 Bacteria 3271
307 Ga0070678_100093082 3300005456 Bacteria 2317
308 Ga0070678_100133304 3300005456 Bacteria 1977
309 Ga0070678_100145428 3300005456 Bacteria 1902
310 Ga0070678_100207846 3300005456 Bacteria 1620
311 Ga0070678_101065528 3300005456 Bacteria 745
312 Ga0070662_100000090 3300005457 Bacteria 49884
313 Ga0070662_100013761 3300005457 Bacteria 5388
314 Ga0070662_100020595 3300005457 Bacteria 4495
315 Ga0070662_100044845 3300005457 Bacteria 3170
316 Ga0070662_100469869 3300005457 Bacteria 1046
317 Ga0070662_101206930 3300005457 Bacteria 650
318 Ga0070681_10003733 3300005458 Bacteria 14290
319 Ga0070681_10262735 3300005458 Bacteria 1638
320 Ga0070681_10303247 3300005458 Unclassified 1507
321 Ga0070681_10348262 3300005458 Bacteria 1392
322 Ga0070681_10360094 3300005458 Unclassified 1365
323 Ga0070681_10374827 3300005458 Bacteria 1334
324 Ga0070681_10438147 3300005458 Bacteria 1219
325 Ga0068867_100003787 3300005459 Bacteria 10644
326 Ga0068867_100003995 3300005459 Bacteria 10373
327 Ga0068867_100095660 3300005459 Bacteria 2260
328 Ga0068867_100122969 3300005459 Bacteria 2008
329 Ga0068867_100166696 3300005459 Bacteria 1741
330 Ga0068867_100269765 3300005459 Bacteria 1391
331 Ga0070685_10009878 3300005466 Bacteria 4949
332 Ga0070685_10017611 3300005466 Bacteria 3827
333 Ga0070685_10043331 3300005466 Bacteria 2572
334 Ga0070685_10101051 3300005466 Bacteria 1761
335 Ga0070685_10121805 3300005466 Bacteria 1620
336 Ga0070685_10217088 3300005466 Bacteria 1251
337 Ga0070707_100094122 3300005468 Bacteria 2901
338 Ga0070698_100003913 3300005471 Bacteria 16377
339 Ga0070698_100009186 3300005471 Bacteria 10609
340 Ga0070698_100018931 3300005471 Bacteria 7242
341 Ga0070698_100920352 3300005471 Bacteria 820
342 Ga0070699_100115456 3300005518 Bacteria 2359
343 Ga0070679_100001926 3300005530 Bacteria 18645
344 Ga0070679_100003340 3300005530 Bacteria 14693
345 Ga0070679_100007785 3300005530 Bacteria 10038
346 Ga0070679_100017541 3300005530 Bacteria 6928
347 Ga0070679_100019798 3300005530 Bacteria 6552
348 Ga0070679_100021230 3300005530 Bacteria 6336
349 Ga0070679_100028157 3300005530 Bacteria 5537
350 Ga0070679_100075404 3300005530 Bacteria 3362
351 Ga0070679_100097806 3300005530 Bacteria 2922
352 Ga0070679_100105858 3300005530 Unclassified 2799
353 Ga0070679_100318520 3300005530 Bacteria 1505
354 Ga0070684_100011020 3300005535 Bacteria 7191
355 Ga0070684_100013770 3300005535 Bacteria 6528
356 Ga0070684_100041511 3300005535 Bacteria 3967
357 Ga0070684_100068792 3300005535 Bacteria 3113
358 Ga0070684_100069096 3300005535 Bacteria 3106
359 Ga0070684_100505230 3300005535 Bacteria 1120
360 Ga0070684_100768528 3300005535 Bacteria 900
361 Ga0070684_100872473 3300005535 Bacteria 843
362 Ga0068853_100009960 3300005539 Bacteria 7675
363 Ga0068853_100010281 3300005539 Bacteria 7571
364 Ga0068853_100015446 3300005539 Bacteria 6273
365 Ga0068853_100088553 3300005539 Bacteria 2718
366 Ga0068853_100090035 3300005539 Bacteria 2696
367 Ga0068853_100119055 3300005539 Bacteria 2353
368 Ga0068853_100137181 3300005539 Bacteria 2194
369 Ga0068853_100179102 3300005539 Bacteria 1922
370 Ga0068853_100204056 3300005539 Bacteria 1800
371 Ga0068853_100338480 3300005539 Bacteria 1398
372 Ga0068853_100593340 3300005539 Bacteria 1052
373 Ga0070672_100073382 3300005543 Bacteria 2727
374 Ga0070672_100082408 3300005543 Bacteria 2580
375 Ga0070672_100096604 3300005543 Bacteria 2391
376 Ga0070672_100109252 3300005543 Bacteria 2252
377 Ga0070672_100276326 3300005543 Bacteria 1419
378 Ga0070672_100932625 3300005543 Bacteria 768
379 Ga0070686_100098075 3300005544 Bacteria 1974
380 Ga0070686_100126760 3300005544 Bacteria 1760
381 Ga0070686_100576897 3300005544 Bacteria 883
382 Ga0070693_100002183 3300005547 Bacteria 8968
383 Ga0070693_100011221 3300005547 Bacteria 4509
384 Ga0070693_100759407 3300005547 Bacteria 715
385 Ga0070665_100000094 3300005548 Bacteria 171072
386 Ga0070665_100000118 3300005548 Bacteria 149830
387 Ga0070665_100001841 3300005548 Bacteria 24099
388 Ga0070665_100004249 3300005548 Bacteria 15068
389 Ga0070665_100005115 3300005548 Bacteria 13603
390 Ga0070704_100245233 3300005549 Bacteria 1468
391 Ga0070704_100543283 3300005549 Bacteria 1014
392 Ga0068855_100000049 3300005563 Bacteria 145321
393 Ga0068855_100000155 3300005563 Bacteria 86903
394 Ga0068855_100000399 3300005563 Bacteria 53597
395 Ga0068855_100008055 3300005563 Bacteria 12733
396 Ga0068855_100009093 3300005563 Bacteria 12007
397 Ga0068855_100032317 3300005563 Bacteria 6250
398 Ga0068855_100033231 3300005563 Bacteria 6158
399 Ga0068855_100036378 3300005563 Bacteria 5860
400 Ga0068855_100036486 3300005563 Bacteria 5850
401 Ga0068855_100042488 3300005563 Bacteria 5386
402 Ga0068855_100093079 3300005563 Bacteria 3476
403 Ga0068855_100095021 3300005563 Bacteria 3436
404 Ga0068855_100108103 3300005563 Bacteria 3195
405 Ga0068855_100108837 3300005563 Bacteria 3183
406 Ga0068855_100148740 3300005563 Bacteria 2664
407 Ga0068855_100221428 3300005563 Bacteria 2122
408 Ga0068855_100286965 3300005563 Bacteria 1825
409 Ga0068855_100525032 3300005563 Bacteria 1284
410 Ga0068855_100525660 3300005563 Bacteria 1283
411 Ga0068855_100612950 3300005563 Bacteria 1172
412 Ga0068855_100643795 3300005563 Bacteria 1139
413 Ga0068855_100842384 3300005563 Bacteria 972
414 Ga0068855_100949806 3300005563 Bacteria 906
415 Ga0068855_100965016 3300005563 Bacteria 897
416 Ga0068855_101025487 3300005563 Bacteria 866
417 Ga0068855_101090681 3300005563 Bacteria 835
418 Ga0070664_100001338 3300005564 Bacteria 19647
419 Ga0070664_100621700 3300005564 Bacteria 1003
420 Ga0070664_100855937 3300005564 Bacteria 851
421 Ga0070664_101124003 3300005564 Bacteria 740
422 Ga0068857_100011099 3300005577 Bacteria 7837
423 Ga0068857_100056356 3300005577 Bacteria 3488
424 Ga0068857_100069111 3300005577 Bacteria 3145
425 Ga0068857_100267425 3300005577 Bacteria 1571
426 Ga0068857_100271087 3300005577 Bacteria 1560
427 Ga0068857_100440395 3300005577 Bacteria 1217
428 Ga0068857_100584212 3300005577 Bacteria 1055
429 Ga0068857_100747251 3300005577 Bacteria 932
430 Ga0068857_101162725 3300005577 Bacteria 746
431 Ga0068857_101179859 3300005577 Bacteria 741
432 Ga0068854_100007104 3300005578 Bacteria 7149
433 Ga0068854_100042253 3300005578 Unclassified 3226
434 Ga0068854_100043813 3300005578 Bacteria 3174
435 Ga0068854_100046812 3300005578 Bacteria 3081
436 Ga0068854_100057687 3300005578 Bacteria 2801
437 Ga0068854_100278968 3300005578 Bacteria 1345
438 Ga0068854_100369011 3300005578 Bacteria 1180
439 Ga0068854_100817929 3300005578 Bacteria 813
440 Ga0068854_101203733 3300005578 Bacteria 679
441 Ga0068856_100006224 3300005614 Bacteria 11711
442 Ga0068856_100007465 3300005614 Bacteria 10673
443 Ga0068856_100007533 3300005614 Bacteria 10623
444 Ga0068856_100009814 3300005614 Bacteria 9301
445 Ga0068856_100022984 3300005614 Bacteria 6061
446 Ga0068856_100024339 3300005614 Bacteria 5892
447 Ga0068856_100287983 3300005614 Bacteria 1659
448 Ga0068856_101102393 3300005614 Bacteria 811
449 Ga0070702_100005680 3300005615 Bacteria 5839
450 Ga0068852_100001228 3300005616 Bacteria 17072
451 Ga0068852_100026284 3300005616 Bacteria 4730
452 Ga0068852_100026817 3300005616 Bacteria 4689
453 Ga0068852_100053121 3300005616 Bacteria 3486
454 Ga0068852_100057586 3300005616 Unclassified 3363
455 Ga0068852_100063330 3300005616 Bacteria 3220
456 Ga0068852_100084257 3300005616 Bacteria 2828
457 Ga0068852_100116575 3300005616 Bacteria 2437
458 Ga0068852_100120650 3300005616 Bacteria 2399
459 Ga0068852_100128300 3300005616 Bacteria 2332
460 Ga0068852_100132292 3300005616 Bacteria 2299
461 Ga0068852_100143114 3300005616 Bacteria 2215
462 Ga0068852_100158164 3300005616 Bacteria 2113
463 Ga0068852_100176840 3300005616 Bacteria 2004
464 Ga0068852_100195518 3300005616 Bacteria 1911
465 Ga0068852_100216076 3300005616 Bacteria 1821
466 Ga0068852_100309005 3300005616 Bacteria 1532
467 Ga0068852_100387014 3300005616 Bacteria 1373
468 Ga0068852_100543670 3300005616 Bacteria 1161
469 Ga0068852_100574136 3300005616 Bacteria 1130
470 Ga0068852_100603445 3300005616 Bacteria 1102
471 Ga0068852_100604696 3300005616 Bacteria 1101
472 Ga0068859_100000013 3300005617 Bacteria 291126
473 Ga0068859_100008566 3300005617 Bacteria 10343
474 Ga0068859_100053516 3300005617 Bacteria 4060
475 Ga0068859_100080265 3300005617 Bacteria 3303
476 Ga0068859_100196328 3300005617 Bacteria 2102
477 Ga0068859_100214832 3300005617 Bacteria 2010
478 Ga0068859_100223524 3300005617 Bacteria 1971
479 Ga0068859_100257979 3300005617 Bacteria 1834
480 Ga0068859_100276395 3300005617 Bacteria 1772
481 Ga0068859_100449695 3300005617 Bacteria 1384
482 Ga0068859_100701084 3300005617 Unclassified 1103
483 Ga0068864_100011731 3300005618 Bacteria 7236
484 Ga0068864_100023442 3300005618 Bacteria 5183
485 Ga0068864_100041174 3300005618 Bacteria 3952
486 Ga0068864_100086772 3300005618 Bacteria 2754
487 Ga0068864_100192173 3300005618 Bacteria 1872
488 Ga0068864_100311469 3300005618 Bacteria 1476
489 Ga0068864_100387375 3300005618 Unclassified 1326
490 Ga0068864_100450567 3300005618 Bacteria 1231
491 Ga0068864_100470739 3300005618 Bacteria 1204
492 Ga0068864_100507264 3300005618 Bacteria 1161
493 Ga0068864_100624195 3300005618 Bacteria 1048
494 Ga0068866_10075801 3300005718 Bacteria 1792
495 Ga0068866_10109318 3300005718 Bacteria 1539
496 Ga0068866_10651621 3300005718 Bacteria 717
497 Ga0068866_10691838 3300005718 Bacteria 698
498 Ga0068861_100000312 3300005719 Bacteria 27173
499 Ga0068861_100014267 3300005719 Bacteria 5575
500 Ga0068861_100015944 3300005719 Bacteria 5305
501 Ga0068861_100050333 3300005719 Bacteria 3159
502 Ga0068861_100331551 3300005719 Bacteria 1328
503 Ga0068851_10000057 3300005834 Bacteria 66791
504 Ga0068851_10017757 3300005834 Bacteria 3422
505 Ga0068851_10048887 3300005834 Bacteria 2144
506 Ga0068851_10074681 3300005834 Bacteria 1760
507 Ga0068851_10092462 3300005834 Bacteria 1594
508 Ga0068851_10215870 3300005834 Bacteria 1076
509 Ga0068851_10226410 3300005834 Bacteria 1052
510 Ga0068870_10032860 3300005840 Unclassified 2642
511 Ga0068870_10058060 3300005840 Bacteria 2071
512 Ga0068870_10078974 3300005840 Bacteria 1814
513 Ga0068870_10140803 3300005840 Unclassified 1411
514 Ga0068870_10183555 3300005840 Bacteria 1257
515 Ga0068870_10232698 3300005840 Bacteria 1134
516 Ga0068863_100027191 3300005841 Bacteria 5455
517 Ga0068863_100030176 3300005841 Bacteria 5179
518 Ga0068863_100033391 3300005841 Bacteria 4902
519 Ga0068863_100053348 3300005841 Bacteria 3832
520 Ga0068863_100101854 3300005841 Bacteria 2730
521 Ga0068863_100102300 3300005841 Bacteria 2724
522 Ga0068863_100167403 3300005841 Bacteria 2108
523 Ga0068863_100372752 3300005841 Bacteria 1393
524 Ga0068863_101067213 3300005841 Bacteria 812
525 Ga0068858_100001874 3300005842 Bacteria 21456
526 Ga0068858_100221212 3300005842 Bacteria 1793
527 Ga0068858_100241951 3300005842 Bacteria 1712
528 Ga0068858_100331868 3300005842 Bacteria 1455
529 Ga0068858_100435782 3300005842 Bacteria 1262
530 Ga0068858_100506481 3300005842 Bacteria 1167
531 Ga0068858_100867053 3300005842 Bacteria 882
532 Ga0068858_101236965 3300005842 Bacteria 734
533 Ga0068860_100000052 3300005843 Bacteria 207351
534 Ga0068860_100007595 3300005843 Bacteria 10851
535 Ga0068860_100009555 3300005843 Bacteria 9634
536 Ga0068860_100015974 3300005843 Bacteria 7327
537 Ga0068860_100023223 3300005843 Bacteria 5994
538 Ga0068860_100031592 3300005843 Bacteria 5090
539 Ga0068860_100041513 3300005843 Bacteria 4394
540 Ga0068860_100048720 3300005843 Bacteria 4038
541 Ga0068860_100049434 3300005843 Bacteria 4005
542 Ga0068860_100140662 3300005843 Bacteria 2319
543 Ga0068860_100857331 3300005843 Bacteria 923
544 Ga0068862_100004828 3300005844 Bacteria 11355
545 Ga0068862_100253485 3300005844 Bacteria 1605
546 Ga0068862_100272348 3300005844 Bacteria 1549
547 Ga0068862_100867156 3300005844 Bacteria 886
548 Ga0068862_101461507 3300005844 Bacteria 688
549 Ga0081540_1014543 3300005983 Bacteria 5032
550 Ga0081539_10000418 3300005985 Bacteria 90493
551 Ga0081539_10080981 3300005985 Bacteria 1706
552 Ga0070715_10237450 3300006163 Bacteria 946
553 Ga0075369_10151915 3300006186 Bacteria 1059
554 Ga0075366_10000135 3300006195 Bacteria 30916
555 Ga0075366_10001547 3300006195 Bacteria 11504
556 Ga0075366_10017062 3300006195 Bacteria 4175
557 Ga0075366_10031577 3300006195 Bacteria 3117
558 Ga0075366_10077708 3300006195 Bacteria 1981
559 Ga0075366_10127451 3300006195 Bacteria 1535
560 Ga0075366_10132526 3300006195 Bacteria 1504
561 Ga0075366_10174730 3300006195 Bacteria 1304
562 Ga0075366_10246697 3300006195 Bacteria 1089
563 Ga0075366_10257016 3300006195 Bacteria 1066
564 Ga0097621_100000015 3300006237 Bacteria 92182
565 Ga0097621_100000611 3300006237 Bacteria 25252
566 Ga0097621_100004099 3300006237 Bacteria 10109
567 Ga0097621_100019267 3300006237 Bacteria 5234
568 Ga0097621_100053067 3300006237 Bacteria 3304
569 Ga0097621_100057100 3300006237 Bacteria 3191
570 Ga0097621_100338996 3300006237 Bacteria 1335
571 Ga0097621_100347785 3300006237 Bacteria 1318
572 Ga0097621_100422768 3300006237 Bacteria 1196
573 Ga0097621_100861017 3300006237 Bacteria 842
574 Ga0097621_100871773 3300006237 Bacteria 837
575 Ga0097621_101097882 3300006237 Bacteria 747
576 Ga0097621_101484787 3300006237 Bacteria 643
577 Ga0097621_101487659 3300006237 Bacteria 642
578 Ga0075370_10277191 3300006353 Bacteria 996
579 Ga0068871_100000060 3300006358 Bacteria 59245
580 Ga0068871_100002459 3300006358 Bacteria 12643
581 Ga0068871_100002800 3300006358 Bacteria 11923
582 Ga0068871_100004774 3300006358 Bacteria 9476
583 Ga0068871_100008389 3300006358 Bacteria 7430
584 Ga0068871_100059631 3300006358 Bacteria 3110
585 Ga0068871_100083376 3300006358 Bacteria 2651
586 Ga0068871_100105404 3300006358 Bacteria 2366
587 Ga0068871_100166398 3300006358 Bacteria 1888
588 Ga0068871_100234821 3300006358 Bacteria 1592
589 Ga0068871_100408968 3300006358 Bacteria 1210
590 Ga0068871_100985295 3300006358 Bacteria 784
591 Ga0068871_101117415 3300006358 Bacteria 737
592 Ga0075428_100005379 3300006844 Bacteria 14236
593 Ga0075428_100069423 3300006844 Bacteria 3852
594 Ga0075428_100088136 3300006844 Unclassified 3385
595 Ga0075428_100183101 3300006844 Bacteria 2267
596 Ga0075428_101009966 3300006844 Bacteria 880
597 Ga0075430_100030102 3300006846 Bacteria 4609
598 Ga0075430_100046804 3300006846 Bacteria 3652
599 Ga0075430_100699277 3300006846 Bacteria 836
600 Ga0075431_100016396 3300006847 Bacteria 7520
601 Ga0075431_100044443 3300006847 Bacteria 4582
602 Ga0075429_100001571 3300006880 Bacteria 18757
603 Ga0075429_100017528 3300006880 Bacteria 6193
604 Ga0075429_100032711 3300006880 Bacteria 4520
605 Ga0075429_100850543 3300006880 Bacteria 799
606 Ga0068865_100000345 3300006881 Bacteria 25771
607 Ga0068865_100007984 3300006881 Bacteria 6534
608 Ga0068865_100019485 3300006881 Bacteria 4391
609 Ga0068865_100193554 3300006881 Bacteria 1574
610 Ga0068865_100351127 3300006881 Bacteria 1195
611 Ga0068865_100514893 3300006881 Bacteria 1000
612 Ga0097620_100000013 3300006931 Bacteria 291126
613 Ga0097620_100008566 3300006931 Bacteria 10343
614 Ga0097620_100053513 3300006931 Bacteria 4060
615 Ga0097620_100080272 3300006931 Bacteria 3303
616 Ga0097620_100196335 3300006931 Bacteria 2102
617 Ga0097620_100214838 3300006931 Bacteria 2010
618 Ga0097620_100223516 3300006931 Bacteria 1971
619 Ga0097620_100257997 3300006931 Bacteria 1834
620 Ga0097620_100276406 3300006931 Bacteria 1772
621 Ga0097620_100449684 3300006931 Bacteria 1384
622 Ga0097620_100701020 3300006931 Unclassified 1103
623 Ga0099824_1000074 3300006942 Bacteria 70834
624 Ga0099826_10000420 3300006948 Bacteria 20131
625 Ga0105244_10000018 3300009036 Bacteria 244992
626 Ga0105244_10000065 3300009036 Bacteria 121781
627 Ga0105250_10031124 3300009092 Bacteria 2143
628 Ga0105240_10000066 3300009093 Bacteria 212612
629 Ga0105240_10000731 3300009093 Bacteria 60044
630 Ga0105240_10002021 3300009093 Bacteria 33455
631 Ga0105240_10004400 3300009093 Bacteria 21486
632 Ga0105240_10006482 3300009093 Bacteria 17189
633 Ga0105240_10010451 3300009093 Bacteria 13043
634 Ga0105240_10017229 3300009093 Bacteria 9745
635 Ga0105240_10017470 3300009093 Bacteria 9666
636 Ga0105240_10034174 3300009093 Bacteria 6561
637 Ga0105240_10054425 3300009093 Bacteria 5015
638 Ga0105240_10067640 3300009093 Bacteria 4428
639 Ga0105240_10077048 3300009093 Bacteria 4109
640 Ga0105240_10081011 3300009093 Bacteria 3990
641 Ga0105240_10090249 3300009093 Bacteria 3746
642 Ga0105240_10257149 3300009093 Bacteria 2016
643 Ga0105240_10272468 3300009093 Bacteria 1948
644 Ga0105240_10315134 3300009093 Bacteria 1785
645 Ga0105240_10324341 3300009093 Bacteria 1754
646 Ga0105240_10338956 3300009093 Bacteria 1708
647 Ga0105240_10570047 3300009093 Bacteria 1250
648 Ga0105240_10597481 3300009093 Bacteria 1215
649 Ga0105240_10692617 3300009093 Unclassified 1113
650 Ga0105240_11067978 3300009093 Bacteria 861
651 Ga0105240_11795189 3300009093 Bacteria 639
652 Ga0111539_10003295 3300009094 Bacteria 21340
653 Ga0111539_10020316 3300009094 Bacteria 8182
654 Ga0111539_10272631 3300009094 Bacteria 1969
655 Ga0111539_10808484 3300009094 Bacteria 1091
656 Ga0111539_11339606 3300009094 Unclassified 831
657 Ga0111539_11374491 3300009094 Bacteria 819
658 Ga0111539_11466694 3300009094 Unclassified 791
659 Ga0105245_10046928 3300009098 Bacteria 3861
660 Ga0105247_10002997 3300009101 Bacteria 11192
661 Ga0105247_10011080 3300009101 Bacteria 5440
662 Ga0114129_10021024 3300009147 Bacteria 9269
663 Ga0105243_10000003 3300009148 Bacteria 712931
664 Ga0105243_10000291 3300009148 Bacteria 55308
665 Ga0105243_10168906 3300009148 Bacteria 1893
666 Ga0105243_10373090 3300009148 Bacteria 1317
667 Ga0105241_10000804 3300009174 Bacteria 23826
668 Ga0105241_10001316 3300009174 Bacteria 18866
669 Ga0105241_10001659 3300009174 Bacteria 16968
670 Ga0105241_10006366 3300009174 Bacteria 8698
671 Ga0105241_10012491 3300009174 Bacteria 6226
672 Ga0105241_10055756 3300009174 Bacteria 3028
673 Ga0105241_10072874 3300009174 Unclassified 2670
674 Ga0105241_10086415 3300009174 Bacteria 2467
675 Ga0105241_10101556 3300009174 Bacteria 2287
676 Ga0105241_10134118 3300009174 Bacteria 2008
677 Ga0105241_10222885 3300009174 Bacteria 1586
678 Ga0105241_10384155 3300009174 Bacteria 1228
679 Ga0105241_10385563 3300009174 Bacteria 1225
680 Ga0105241_10473048 3300009174 Bacteria 1112
681 Ga0105241_10682991 3300009174 Bacteria 936
682 Ga0105242_10062549 3300009176 Bacteria 3063
683 Ga0105242_10077863 3300009176 Bacteria 2767
684 Ga0105242_10089844 3300009176 Bacteria 2583
685 Ga0105242_10210650 3300009176 Bacteria 1732
686 Ga0105242_10359334 3300009176 Bacteria 1347
687 Ga0105242_11017486 3300009176 Bacteria 837
688 Ga0105242_11073424 3300009176 Bacteria 817
689 Ga0105242_11419701 3300009176 Bacteria 722
690 Ga0105237_10000474 3300009545 Bacteria 57006
691 Ga0105237_10001504 3300009545 Bacteria 30678
692 Ga0105237_10002029 3300009545 Bacteria 25756
693 Ga0105237_10002057 3300009545 Bacteria 25541
694 Ga0105237_10003766 3300009545 Bacteria 17851
695 Ga0105237_10010052 3300009545 Bacteria 10092
696 Ga0105237_10012190 3300009545 Bacteria 9067
697 Ga0105237_10015969 3300009545 Bacteria 7806
698 Ga0105237_10019537 3300009545 Bacteria 6997
699 Ga0105237_10038111 3300009545 Bacteria 4856
700 Ga0105237_10041796 3300009545 Bacteria 4623
701 Ga0105237_10073253 3300009545 Bacteria 3418
702 Ga0105237_10167750 3300009545 Bacteria 2195
703 Ga0105237_10220014 3300009545 Bacteria 1899
704 Ga0105237_10244496 3300009545 Bacteria 1796
705 Ga0105237_10348135 3300009545 Bacteria 1486
706 Ga0105237_10968470 3300009545 Unclassified 858
707 Ga0105238_10014065 3300009551 Bacteria 8091
708 Ga0105238_10029887 3300009551 Bacteria 5548
709 Ga0105238_10030013 3300009551 Bacteria 5534
710 Ga0105238_10040227 3300009551 Bacteria 4738
711 Ga0105238_10040372 3300009551 Bacteria 4729
712 Ga0105238_10149040 3300009551 Bacteria 2315
713 Ga0105238_10169733 3300009551 Bacteria 2158
714 Ga0105249_10000679 3300009553 Bacteria 30951
715 Ga0105249_10001656 3300009553 Bacteria 19521
716 Ga0105249_10005626 3300009553 Bacteria 10839
717 Ga0105249_10029604 3300009553 Bacteria 4947
718 Ga0105249_10035162 3300009553 Bacteria 4542
719 Ga0105249_10036735 3300009553 Bacteria 4444
720 Ga0105249_10045160 3300009553 Bacteria 4006
721 Ga0105249_10056561 3300009553 Bacteria 3591
722 Ga0105249_10065277 3300009553 Bacteria 3348
723 Ga0105249_10131397 3300009553 Bacteria 2391
724 Ga0105249_10214253 3300009553 Bacteria 1892
725 Ga0105249_10558113 3300009553 Bacteria 1196
726 Ga0105249_10917024 3300009553 Bacteria 943
727 Ga0105249_11719512 3300009553 Bacteria 700
728 Ga0105239_10000049 3300010375 Bacteria 177578
729 Ga0105239_10000166 3300010375 Bacteria 94743
730 Ga0105239_10000935 3300010375 Bacteria 41237
731 Ga0105239_10002278 3300010375 Bacteria 24496
732 Ga0105239_10002482 3300010375 Bacteria 23507
733 Ga0105239_10004572 3300010375 Bacteria 16497
734 Ga0105239_10005050 3300010375 Bacteria 15587
735 Ga0105239_10020118 3300010375 Bacteria 7364
736 Ga0105239_10022831 3300010375 Bacteria 6897
737 Ga0105239_10024293 3300010375 Bacteria 6675
738 Ga0105239_10033176 3300010375 Bacteria 5670
739 Ga0105239_10078163 3300010375 Bacteria 3641
740 Ga0105239_10081056 3300010375 Bacteria 3572
741 Ga0105239_10086451 3300010375 Bacteria 3456
742 Ga0105239_10104571 3300010375 Bacteria 3135
743 Ga0105239_10205849 3300010375 Bacteria 2205
744 Ga0105239_10247292 3300010375 Unclassified 2003
745 Ga0105239_10328499 3300010375 Unclassified 1725
746 Ga0105239_10389192 3300010375 Bacteria 1577
747 Ga0105239_10402430 3300010375 Bacteria 1549
748 Ga0105239_10445997 3300010375 Bacteria 1468
749 Ga0105239_10824775 3300010375 Bacteria 1063
750 Ga0105239_11206106 3300010375 Bacteria 872
751 Ga0105246_10036156 3300011119 Bacteria 3307
752 Ga0105246_10284795 3300011119 Bacteria 1327
753 Ga0105246_11032579 3300011119 Bacteria 746
754 Ga0105246_11153912 3300011119 Bacteria 710
755 Ga0157373_10000003 3300013100 Bacteria 454601
756 Ga0157373_10000006 3300013100 Bacteria 261768
757 Ga0157373_10000086 3300013100 Bacteria 80524
758 Ga0157373_10000678 3300013100 Bacteria 26681
759 Ga0157373_10001842 3300013100 Bacteria 16117
760 Ga0157373_10008022 3300013100 Bacteria 7847
761 Ga0157373_10008768 3300013100 Bacteria 7492
762 Ga0157373_10022246 3300013100 Bacteria 4600
763 Ga0157373_10022495 3300013100 Bacteria 4574
764 Ga0157373_10034330 3300013100 Bacteria 3643
765 Ga0157373_10233057 3300013100 Bacteria 1300
766 Ga0157373_10346860 3300013100 Bacteria 1059
767 Ga0157373_10394794 3300013100 Bacteria 991
768 Ga0157373_10425790 3300013100 Bacteria 953
769 Ga0157373_10510669 3300013100 Bacteria 869
770 Ga0157371_10000012 3300013102 Bacteria 355318
771 Ga0157371_10000027 3300013102 Bacteria 269243
772 Ga0157371_10000107 3300013102 Bacteria 126477
773 Ga0157371_10000168 3300013102 Bacteria 95185
774 Ga0157371_10000265 3300013102 Bacteria 71188
775 Ga0157371_10001167 3300013102 Bacteria 28190
776 Ga0157371_10001199 3300013102 Bacteria 27770
777 Ga0157371_10001473 3300013102 Bacteria 24412
778 Ga0157371_10001579 3300013102 Bacteria 23392
779 Ga0157371_10004990 3300013102 Bacteria 11389
780 Ga0157371_10007301 3300013102 Bacteria 8975
781 Ga0157371_10015463 3300013102 Bacteria 5723
782 Ga0157371_10018764 3300013102 Bacteria 5111
783 Ga0157371_10019868 3300013102 Bacteria 4949
784 Ga0157371_10021760 3300013102 Bacteria 4704
785 Ga0157371_10034869 3300013102 Bacteria 3608
786 Ga0157371_10040023 3300013102 Bacteria 3350
787 Ga0157371_10040031 3300013102 Bacteria 3350
788 Ga0157371_10061420 3300013102 Bacteria 2664
789 Ga0157371_10077151 3300013102 Bacteria 2359
790 Ga0157371_10103211 3300013102 Bacteria 2023
791 Ga0157371_10103661 3300013102 Bacteria 2018
792 Ga0157371_10382580 3300013102 Bacteria 1028
793 Ga0157371_10608867 3300013102 Bacteria 813
794 Ga0157370_10000631 3300013104 Bacteria 43919
795 Ga0157370_10000817 3300013104 Bacteria 39404
796 Ga0157370_10001929 3300013104 Bacteria 25519
797 Ga0157370_10002773 3300013104 Bacteria 20941
798 Ga0157370_10003542 3300013104 Bacteria 18268
799 Ga0157370_10003748 3300013104 Bacteria 17761
800 Ga0157370_10005025 3300013104 Bacteria 14939
801 Ga0157370_10005694 3300013104 Bacteria 13928
802 Ga0157370_10009760 3300013104 Bacteria 10190
803 Ga0157370_10012593 3300013104 Bacteria 8765
804 Ga0157370_10017086 3300013104 Bacteria 7329
805 Ga0157370_10029007 3300013104 Bacteria 5436
806 Ga0157370_10033304 3300013104 Bacteria 5024
807 Ga0157370_10037709 3300013104 Bacteria 4682
808 Ga0157370_10037715 3300013104 Bacteria 4682
809 Ga0157370_10040970 3300013104 Bacteria 4470
810 Ga0157370_10045382 3300013104 Bacteria 4216
811 Ga0157370_10045913 3300013104 Bacteria 4190
812 Ga0157370_10049125 3300013104 Bacteria 4040
813 Ga0157370_10060180 3300013104 Bacteria 3607
814 Ga0157370_10110728 3300013104 Bacteria 2567
815 Ga0157370_10121242 3300013104 Bacteria 2441
816 Ga0157370_10122095 3300013104 Bacteria 2432
817 Ga0157370_10133974 3300013104 Bacteria 2310
818 Ga0157370_10165907 3300013104 Bacteria 2054
819 Ga0157370_10183188 3300013104 Bacteria 1945
820 Ga0157370_10194380 3300013104 Bacteria 1883
821 Ga0157370_10195211 3300013104 Bacteria 1879
822 Ga0157370_10213359 3300013104 Bacteria 1789
823 Ga0157370_10246774 3300013104 Bacteria 1651
824 Ga0157370_10269730 3300013104 Bacteria 1572
825 Ga0157370_10269735 3300013104 Bacteria 1572
826 Ga0157370_10347811 3300013104 Bacteria 1366
827 Ga0157370_10381385 3300013104 Bacteria 1298
828 Ga0157370_10399089 3300013104 Bacteria 1266
829 Ga0157370_10526600 3300013104 Bacteria 1084
830 Ga0157370_10631413 3300013104 Bacteria 980
831 Ga0157370_10780039 3300013104 Bacteria 870
832 Ga0157370_10782558 3300013104 Bacteria 868
833 Ga0157370_10946595 3300013104 Bacteria 781
834 Ga0157370_10972975 3300013104 Bacteria 769
835 Ga0157369_10000053 3300013105 Bacteria 162962
836 Ga0157369_10000684 3300013105 Bacteria 43870
837 Ga0157369_10003605 3300013105 Bacteria 18401
838 Ga0157369_10008517 3300013105 Bacteria 11760
839 Ga0157369_10011241 3300013105 Bacteria 10174
840 Ga0157369_10020179 3300013105 Bacteria 7452
841 Ga0157369_10029467 3300013105 Bacteria 6064
842 Ga0157369_10033448 3300013105 Bacteria 5650
843 Ga0157369_10045126 3300013105 Bacteria 4795
844 Ga0157369_10064840 3300013105 Bacteria 3933
845 Ga0157369_10071707 3300013105 Bacteria 3718
846 Ga0157369_10217511 3300013105 Bacteria 2001
847 Ga0157369_10291646 3300013105 Bacteria 1698
848 Ga0157369_10328820 3300013105 Bacteria 1588
849 Ga0157369_10358771 3300013105 Bacteria 1513
850 Ga0157369_10375601 3300013105 Bacteria 1476
851 Ga0157369_10524447 3300013105 Bacteria 1225
852 Ga0157369_10537839 3300013105 Bacteria 1208
853 Ga0157374_10000024 3300013296 Bacteria 265166
854 Ga0157374_10000301 3300013296 Bacteria 45768
855 Ga0157374_10001665 3300013296 Bacteria 18606
856 Ga0157374_10003768 3300013296 Bacteria 12747
857 Ga0157374_10009941 3300013296 Bacteria 8169
858 Ga0157374_10020930 3300013296 Bacteria 5811
859 Ga0157374_10054881 3300013296 Bacteria 3718
860 Ga0157374_10075443 3300013296 Bacteria 3186
861 Ga0157374_10119312 3300013296 Bacteria 2544
862 Ga0157374_10165615 3300013296 Bacteria 2154
863 Ga0157374_10180519 3300013296 Bacteria 2061
864 Ga0157374_10234710 3300013296 Bacteria 1803
865 Ga0157374_10476756 3300013296 Bacteria 1251
866 Ga0157374_10660037 3300013296 Bacteria 1058
867 Ga0157374_10996802 3300013296 Bacteria 857
868 Ga0157378_10007954 3300013297 Bacteria 9254
869 Ga0157378_10011916 3300013297 Bacteria 7615
870 Ga0157378_10031841 3300013297 Bacteria 4658
871 Ga0157378_10039720 3300013297 Unclassified 4174
872 Ga0157378_10051819 3300013297 Bacteria 3651
873 Ga0157378_10082867 3300013297 Bacteria 2901
874 Ga0157378_10104341 3300013297 Bacteria 2591
875 Ga0157378_10113383 3300013297 Bacteria 2489
876 Ga0157378_10184793 3300013297 Bacteria 1963
877 Ga0157378_10589238 3300013297 Bacteria 1122
878 Ga0157378_10602072 3300013297 Unclassified 1110
879 Ga0157378_10625587 3300013297 Bacteria 1090
880 Ga0157378_10924517 3300013297 Bacteria 904
881 Ga0163162_10000012 3300013306 Bacteria 292674
882 Ga0163162_10000078 3300013306 Bacteria 89842
883 Ga0163162_10000595 3300013306 Bacteria 33576
884 Ga0163162_10001403 3300013306 Bacteria 22418
885 Ga0163162_10001696 3300013306 Bacteria 20664
886 Ga0163162_10001704 3300013306 Bacteria 20605
887 Ga0163162_10002066 3300013306 Bacteria 18872
888 Ga0163162_10003815 3300013306 Bacteria 14452
889 Ga0163162_10010491 3300013306 Bacteria 9009
890 Ga0163162_10017517 3300013306 Bacteria 7009
891 Ga0163162_10017686 3300013306 Bacteria 6976
892 Ga0163162_10024693 3300013306 Bacteria 5936
893 Ga0163162_10035073 3300013306 Bacteria 4995
894 Ga0163162_10084028 3300013306 Bacteria 3258
895 Ga0163162_10134450 3300013306 Bacteria 2583
896 Ga0163162_10180794 3300013306 Bacteria 2235
897 Ga0163162_10326168 3300013306 Bacteria 1668
898 Ga0163162_10985073 3300013306 Bacteria 953
899 Ga0163162_11180418 3300013306 Bacteria 868
900 Ga0163162_11252291 3300013306 Unclassified 842
901 Ga0163162_11329679 3300013306 Bacteria 817
902 Ga0163162_11400101 3300013306 Bacteria 796
903 Ga0163162_11487050 3300013306 Bacteria 771
904 Ga0163162_11920664 3300013306 Bacteria 678
905 Ga0157372_10000039 3300013307 Bacteria 165839
906 Ga0157372_10000238 3300013307 Bacteria 60988
907 Ga0157372_10002381 3300013307 Bacteria 20343
908 Ga0157372_10004730 3300013307 Bacteria 14461
909 Ga0157372_10006195 3300013307 Bacteria 12716
910 Ga0157372_10010343 3300013307 Bacteria 9914
911 Ga0157372_10010761 3300013307 Bacteria 9738
912 Ga0157372_10021427 3300013307 Bacteria 6982
913 Ga0157372_10022049 3300013307 Bacteria 6887
914 Ga0157372_10025063 3300013307 Bacteria 6481
915 Ga0157372_10025844 3300013307 Bacteria 6386
916 Ga0157372_10029794 3300013307 Bacteria 5964
917 Ga0157372_10031839 3300013307 Bacteria 5779
918 Ga0157372_10041124 3300013307 Bacteria 5110
919 Ga0157372_10043901 3300013307 Bacteria 4952
920 Ga0157372_10060545 3300013307 Bacteria 4236
921 Ga0157372_10064528 3300013307 Bacteria 4108
922 Ga0157372_10075017 3300013307 Bacteria 3815
923 Ga0157372_10080242 3300013307 Bacteria 3691
924 Ga0157372_10088747 3300013307 Bacteria 3511
925 Ga0157372_10118231 3300013307 Bacteria 3041
926 Ga0157372_10128640 3300013307 Bacteria 2912
927 Ga0157372_10162065 3300013307 Bacteria 2585
928 Ga0157372_10205288 3300013307 Bacteria 2283
929 Ga0157372_10233388 3300013307 Bacteria 2133
930 Ga0157372_10246590 3300013307 Unclassified 2073
931 Ga0157372_10362245 3300013307 Unclassified 1689
932 Ga0157372_10409058 3300013307 Bacteria 1581
933 Ga0157372_10416642 3300013307 Bacteria 1565
934 Ga0157372_10422907 3300013307 Bacteria 1553
935 Ga0157372_10423270 3300013307 Bacteria 1552
936 Ga0157372_10494883 3300013307 Bacteria 1426
937 Ga0157372_10682583 3300013307 Bacteria 1195
938 Ga0157372_10725417 3300013307 Bacteria 1156
939 Ga0157372_11118481 3300013307 Bacteria 911
940 Ga0157372_11342893 3300013307 Bacteria 825
941 Ga0157372_11357522 3300013307 Unclassified 820
942 Ga0157372_11380798 3300013307 Bacteria 812
943 Ga0157372_11501904 3300013307 Bacteria 776
944 Ga0157375_10000614 3300013308 Bacteria 31619
945 Ga0157375_10002275 3300013308 Bacteria 16614
946 Ga0157375_10030368 3300013308 Bacteria 5095
947 Ga0157375_10031734 3300013308 Bacteria 5001
948 Ga0157375_10038007 3300013308 Bacteria 4618
949 Ga0157375_10046085 3300013308 Bacteria 4248
950 Ga0157375_10097674 3300013308 Bacteria 3012
951 Ga0157375_10103606 3300013308 Bacteria 2933
952 Ga0157375_10103859 3300013308 Bacteria 2929
953 Ga0157375_10194045 3300013308 Bacteria 2186
954 Ga0157375_10213188 3300013308 Bacteria 2089
955 Ga0157375_10246878 3300013308 Bacteria 1946
956 Ga0157375_10272471 3300013308 Bacteria 1855
957 Ga0157375_10305241 3300013308 Bacteria 1755
958 Ga0157375_10481728 3300013308 Bacteria 1406
959 Ga0157375_10586198 3300013308 Bacteria 1275
960 Ga0157375_10677124 3300013308 Bacteria 1186
961 Ga0157375_10718957 3300013308 Bacteria 1152
962 Ga0163163_10000352 3300014325 Bacteria 44290
963 Ga0163163_10040541 3300014325 Bacteria 4547
964 Ga0163163_10117758 3300014325 Bacteria 2688
965 Ga0163163_10215022 3300014325 Unclassified 1971
966 Ga0163163_12047592 3300014325 Bacteria 632
967 Ga0157380_10000001 3300014326 Bacteria 254890
968 Ga0157380_10000314 3300014326 Bacteria 29344
969 Ga0157380_10007323 3300014326 Bacteria 7834
970 Ga0157380_10012856 3300014326 Bacteria 6083
971 Ga0157380_10124649 3300014326 Bacteria 2188
972 Ga0157380_10155217 3300014326 Bacteria 1983
973 Ga0157380_10182724 3300014326 Bacteria 1844
974 Ga0157380_10266483 3300014326 Bacteria 1559
975 Ga0157380_10320367 3300014326 Bacteria 1437
976 Ga0157380_10526127 3300014326 Unclassified 1154
977 Ga0157380_10670829 3300014326 Unclassified 1037
978 Ga0182008_10000003 3300014497 Bacteria 456880
979 Ga0182008_10000020 3300014497 Bacteria 228333
980 Ga0182008_10000053 3300014497 Bacteria 102934
981 Ga0182008_10000336 3300014497 Bacteria 36783
982 Ga0182008_10030219 3300014497 Bacteria 2732
983 Ga0182008_10063237 3300014497 Bacteria 1823
984 Ga0182008_10063474 3300014497 Bacteria 1819
985 Ga0157377_10000354 3300014745 Bacteria 20420
986 Ga0157377_10026187 3300014745 Bacteria 3118
987 Ga0157377_10034156 3300014745 Bacteria 2781
988 Ga0157377_10080083 3300014745 Bacteria 1907
989 Ga0157377_10124350 3300014745 Bacteria 1567
990 Ga0157377_10239338 3300014745 Bacteria 1171
991 Ga0157379_10009114 3300014968 Bacteria 8642
992 Ga0157379_10014153 3300014968 Bacteria 6995
993 Ga0157379_10028879 3300014968 Bacteria 4933
994 Ga0157379_10041268 3300014968 Bacteria 4119
995 Ga0157379_10118530 3300014968 Bacteria 2381
996 Ga0157379_10364494 3300014968 Bacteria 1325
997 Ga0157376_10004780 3300014969 Bacteria 9427
998 Ga0157376_10016249 3300014969 Bacteria 5644
999 Ga0157376_10016871 3300014969 Bacteria 5555
1000 Ga0157376_10035644 3300014969 Bacteria 4025
1001 Ga0157376_10224421 3300014969 Bacteria 1742
1002 Ga0157376_10361723 3300014969 Bacteria 1392
1003 Ga0157376_10506107 3300014969 Bacteria 1188
1004 Ga0157376_10517395 3300014969 Bacteria 1176
1005 Ga0157376_10924676 3300014969 Bacteria 891
1006 Ga0182006_1000079 3300015261 Bacteria 122553
1007 Ga0182006_1001480 3300015261 Bacteria 14113
1008 Ga0182006_1001934 3300015261 Bacteria 11766
1009 Ga0182006_1002073 3300015261 Bacteria 11213
1010 Ga0182006_1002254 3300015261 Bacteria 10653
1011 Ga0182006_1005760 3300015261 Bacteria 5847
1012 Ga0182006_1007004 3300015261 Bacteria 5190
1013 Ga0182006_1011176 3300015261 Bacteria 3964
1014 Ga0182006_1044064 3300015261 Bacteria 1741
1015 Ga0182006_1066184 3300015261 Bacteria 1351
1016 Ga0182007_10000005 3300015262 Bacteria 442702
1017 Ga0182007_10018865 3300015262 Bacteria 2491
1018 Ga0182007_10042119 3300015262 Bacteria 1520
1019 Ga0182007_10044795 3300015262 Bacteria 1467
1020 Ga0183373_1007 3300015682 Bacteria 282776
1021 Ga0163161_10000033 3300017792 Bacteria 163809
1022 Ga0163161_10000620 3300017792 Bacteria 28471
1023 Ga0163161_10000968 3300017792 Bacteria 21949
1024 Ga0163161_10004348 3300017792 Bacteria 9872
1025 Ga0163161_10009442 3300017792 Bacteria 6750
1026 Ga0163161_10025972 3300017792 Bacteria 4148
1027 Ga0163161_10033557 3300017792 Bacteria 3667
1028 Ga0163161_10036261 3300017792 Unclassified 3531
1029 Ga0163161_10046581 3300017792 Bacteria 3129
1030 Ga0163161_10084779 3300017792 Bacteria 2337
1031 Ga0163161_10103045 3300017792 Bacteria 2126
1032 Ga0163161_10109733 3300017792 Unclassified 2061
1033 Ga0163161_10128484 3300017792 Bacteria 1910
1034 Ga0163161_10167837 3300017792 Bacteria 1677
1035 Ga0163161_10233663 3300017792 Bacteria 1427
1036 Ga0163161_10303103 3300017792 Bacteria 1259
1037 Ga0163161_10340856 3300017792 Bacteria 1189
1038 Ga0163161_11055249 3300017792 Bacteria 696
1039 Ga0197907_10029441 3300020069 Bacteria 766
1040 Ga0197907_10046094 3300020069 Bacteria 1265
1041 Ga0206356_11317094 3300020070 Bacteria 669
1042 Ga0206351_10513209 3300020077 Bacteria 1248
1043 Ga0206351_10892710 3300020077 Bacteria 6277
1044 Ga0206352_10047560 3300020078 Bacteria 679
1045 Ga0206352_10699063 3300020078 Bacteria 1750
1046 Ga0154015_1051922 3300020610 Bacteria 1236
1047 Ga0213872_10047605 3300021361 Bacteria 1949
1048 Ga0213876_10004817 3300021384 Bacteria 7489
1049 Ga0213876_10056846 3300021384 Bacteria 2065
1050 Ga0224712_10039980 3300022467 Bacteria 1762
1051 Ga0224712_10060786 3300022467 Bacteria 1505
1052 Ga0224712_10153072 3300022467 Bacteria 1023
1053 Ga0209436_101429 3300025208 Bacteria 8382
1054 Ga0207427_100122 3300025231 Bacteria 99064
1055 Ga0209437_100048 3300025233 Bacteria 405107
1056 Ga0209437_100102 3300025233 Bacteria 224216
1057 Ga0209258_100075 3300025242 Bacteria 270751
1058 Ga0207425_1000003 3300025245 Bacteria 1145342
1059 Ga0209646_1001140 3300025246 Bacteria 7798
1060 Ga0209026_1000852 3300025250 Bacteria 15983
1061 Ga0209026_1001432 3300025250 Bacteria 10552
1062 Ga0209026_1003805 3300025250 Bacteria 4773
1063 Ga0209148_1000085 3300025254 Bacteria 265193
1064 Ga0209129_1000022 3300025258 Bacteria 440876
1065 Ga0209233_1000029 3300025261 Bacteria 641642
1066 Ga0209233_1007045 3300025261 Bacteria 3588
1067 Ga0209233_1024411 3300025261 Bacteria 1513
1068 Ga0209455_1005502 3300025272 Bacteria 3900
1069 Ga0209130_1001019 3300025284 Bacteria 21610
1070 Ga0209675_1000051 3300025291 Bacteria 206342
1071 Ga0209676_1000039 3300025292 Bacteria 443158
1072 Ga0209676_1000485 3300025292 Bacteria 64653
1073 Ga0209025_1000007 3300025294 Bacteria 1145109
1074 Ga0209758_1000012 3300025297 Bacteria 949866
1075 Ga0209758_1054772 3300025297 Bacteria 1360
1076 Ga0209050_1000033 3300025298 Bacteria 442615
1077 Ga0209050_1004236 3300025298 Bacteria 9858
1078 Ga0209050_1035857 3300025298 Bacteria 1459
1079 Ga0207426_1000057 3300025302 Bacteria 369548
1080 Ga0207426_1000059 3300025302 Bacteria 363842
1081 Ga0209257_1000004 3300025304 Bacteria 1678347
1082 Ga0209257_1000006 3300025304 Bacteria 1570111
1083 Ga0207697_10011359 3300025315 Bacteria 3768
1084 Ga0207697_10015975 3300025315 Bacteria 3097
1085 Ga0207697_10037974 3300025315 Bacteria 1974
1086 Ga0207697_10066549 3300025315 Bacteria 1506
1087 Ga0207656_10000048 3300025321 Bacteria 46689
1088 Ga0207656_10149680 3300025321 Bacteria 1104
1089 Ga0207656_10151218 3300025321 Bacteria 1099
1090 Ga0207656_10210692 3300025321 Bacteria 942
1091 Ga0207655_1000003 3300025728 Bacteria 1081376
1092 Ga0207655_1066535 3300025728 Bacteria 1361
1093 Ga0207682_10072351 3300025893 Bacteria 1463
1094 Ga0207682_10157835 3300025893 Bacteria 1026
1095 Ga0207682_10195013 3300025893 Unclassified 929
1096 Ga0207682_10340183 3300025893 Bacteria 706
1097 Ga0207642_10072621 3300025899 Bacteria 1643
1098 Ga0207642_10091750 3300025899 Bacteria 1502
1099 Ga0207710_10001252 3300025900 Bacteria 12863
1100 Ga0207688_10022146 3300025901 Bacteria 3476
1101 Ga0207688_10108817 3300025901 Bacteria 1607
1102 Ga0207680_10000586 3300025903 Bacteria 17176
1103 Ga0207680_10016753 3300025903 Bacteria 3855
1104 Ga0207680_10033658 3300025903 Bacteria 2925
1105 Ga0207680_10149582 3300025903 Bacteria 1556
1106 Ga0207680_10153352 3300025903 Bacteria 1538
1107 Ga0207680_10167191 3300025903 Bacteria 1479
1108 Ga0207647_10000018 3300025904 Bacteria 124816
1109 Ga0207647_10000061 3300025904 Bacteria 83985
1110 Ga0207647_10000071 3300025904 Bacteria 79170
1111 Ga0207647_10004528 3300025904 Bacteria 10301
1112 Ga0207647_10014834 3300025904 Bacteria 5360
1113 Ga0207647_10113830 3300025904 Bacteria 1599
1114 Ga0207647_10145048 3300025904 Bacteria 1390
1115 Ga0207685_10331613 3300025905 Bacteria 762
1116 Ga0207645_10000229 3300025907 Bacteria 46502
1117 Ga0207645_10000847 3300025907 Bacteria 25517
1118 Ga0207645_10002256 3300025907 Bacteria 15330
1119 Ga0207645_10024082 3300025907 Bacteria 3950
1120 Ga0207645_10314957 3300025907 Bacteria 1043
1121 Ga0207645_10338490 3300025907 Bacteria 1005
1122 Ga0207643_10012600 3300025908 Bacteria 4565
1123 Ga0207643_10015082 3300025908 Bacteria 4202
1124 Ga0207643_10022947 3300025908 Bacteria 3439
1125 Ga0207643_10103323 3300025908 Bacteria 1673
1126 Ga0207643_10113723 3300025908 Bacteria 1596
1127 Ga0207705_10000026 3300025909 Bacteria 256051
1128 Ga0207705_10008664 3300025909 Bacteria 7412
1129 Ga0207705_10009177 3300025909 Bacteria 7204
1130 Ga0207705_10013540 3300025909 Bacteria 5887
1131 Ga0207705_10015035 3300025909 Bacteria 5564
1132 Ga0207705_10051352 3300025909 Bacteria 2968
1133 Ga0207705_10077075 3300025909 Bacteria 2425
1134 Ga0207705_10108174 3300025909 Bacteria 2052
1135 Ga0207705_10132504 3300025909 Bacteria 1856
1136 Ga0207705_10193904 3300025909 Bacteria 1537
1137 Ga0207705_10464156 3300025909 Bacteria 982
1138 Ga0207705_10664506 3300025909 Bacteria 810
1139 Ga0207654_10000850 3300025911 Bacteria 16860
1140 Ga0207654_10001026 3300025911 Bacteria 15268
1141 Ga0207654_10002896 3300025911 Bacteria 8708
1142 Ga0207654_10003414 3300025911 Bacteria 8029
1143 Ga0207654_10037096 3300025911 Bacteria 2727
1144 Ga0207654_10146084 3300025911 Bacteria 1513
1145 Ga0207654_10147037 3300025911 Bacteria 1509
1146 Ga0207654_10154602 3300025911 Bacteria 1476
1147 Ga0207654_10164376 3300025911 Unclassified 1436
1148 Ga0207654_10180065 3300025911 Unclassified 1378
1149 Ga0207654_10485830 3300025911 Bacteria 870
1150 Ga0207707_10000879 3300025912 Bacteria 29399
1151 Ga0207707_10049330 3300025912 Bacteria 3667
1152 Ga0207707_10202850 3300025912 Bacteria 1729
1153 Ga0207707_10206618 3300025912 Bacteria 1711
1154 Ga0207707_10276086 3300025912 Bacteria 1456
1155 Ga0207707_10298897 3300025912 Bacteria 1392
1156 Ga0207707_10374858 3300025912 Bacteria 1224
1157 Ga0207695_10000078 3300025913 Bacteria 297378
1158 Ga0207695_10000135 3300025913 Bacteria 217822
1159 Ga0207695_10000142 3300025913 Bacteria 214715
1160 Ga0207695_10000702 3300025913 Bacteria 65628
1161 Ga0207695_10000894 3300025913 Bacteria 54057
1162 Ga0207695_10002580 3300025913 Bacteria 26577
1163 Ga0207695_10003021 3300025913 Bacteria 24157
1164 Ga0207695_10008758 3300025913 Bacteria 12617
1165 Ga0207695_10015835 3300025913 Bacteria 8858
1166 Ga0207695_10016392 3300025913 Bacteria 8669
1167 Ga0207695_10017291 3300025913 Bacteria 8397
1168 Ga0207695_10019165 3300025913 Bacteria 7883
1169 Ga0207695_10030088 3300025913 Bacteria 5984
1170 Ga0207695_10031899 3300025913 Bacteria 5771
1171 Ga0207695_10038683 3300025913 Bacteria 5133
1172 Ga0207695_10141539 3300025913 Bacteria 2353
1173 Ga0207695_10164678 3300025913 Bacteria 2146
1174 Ga0207695_10187438 3300025913 Bacteria 1987
1175 Ga0207695_10219486 3300025913 Bacteria 1809
1176 Ga0207695_10462956 3300025913 Unclassified 1151
1177 Ga0207695_10831905 3300025913 Bacteria 803
1178 Ga0207695_11115533 3300025913 Bacteria 669
1179 Ga0207671_10000067 3300025914 Bacteria 162184
1180 Ga0207671_10000110 3300025914 Bacteria 126480
1181 Ga0207671_10000721 3300025914 Bacteria 42150
1182 Ga0207671_10001102 3300025914 Bacteria 32573
1183 Ga0207671_10001959 3300025914 Bacteria 22712
1184 Ga0207671_10006160 3300025914 Bacteria 10778
1185 Ga0207671_10009045 3300025914 Bacteria 8377
1186 Ga0207671_10009636 3300025914 Bacteria 8051
1187 Ga0207671_10015774 3300025914 Bacteria 5899
1188 Ga0207671_10019924 3300025914 Bacteria 5117
1189 Ga0207671_10028650 3300025914 Bacteria 4160
1190 Ga0207671_10031595 3300025914 Bacteria 3945
1191 Ga0207671_10044954 3300025914 Bacteria 3264
1192 Ga0207671_10162420 3300025914 Bacteria 1730
1193 Ga0207671_10186939 3300025914 Bacteria 1614
1194 Ga0207671_10223615 3300025914 Unclassified 1475
1195 Ga0207671_10487522 3300025914 Bacteria 983
1196 Ga0207693_10034650 3300025915 Bacteria 3982
1197 Ga0207660_10004200 3300025917 Bacteria 9374
1198 Ga0207660_10005360 3300025917 Bacteria 8328
1199 Ga0207660_10174888 3300025917 Bacteria 1664
1200 Ga0207660_10196728 3300025917 Bacteria 1573
1201 Ga0207660_10268735 3300025917 Bacteria 1350
1202 Ga0207660_10543524 3300025917 Bacteria 944
1203 Ga0207662_10048920 3300025918 Bacteria 2507
1204 Ga0207662_10080480 3300025918 Bacteria 1987
1205 Ga0207662_10136673 3300025918 Bacteria 1550
1206 Ga0207662_10566888 3300025918 Bacteria 787
1207 Ga0207662_10658034 3300025918 Bacteria 732
1208 Ga0207657_10010634 3300025919 Bacteria 9166
1209 Ga0207657_10018065 3300025919 Bacteria 6746
1210 Ga0207657_10023154 3300025919 Bacteria 5790
1211 Ga0207657_10034772 3300025919 Bacteria 4526
1212 Ga0207657_10039312 3300025919 Bacteria 4206
1213 Ga0207657_10129800 3300025919 Bacteria 2066
1214 Ga0207657_10167769 3300025919 Bacteria 1780
1215 Ga0207657_10190195 3300025919 Bacteria 1656
1216 Ga0207657_10503594 3300025919 Bacteria 949
1217 Ga0207649_10024307 3300025920 Bacteria 3520
1218 Ga0207649_10040769 3300025920 Bacteria 2824
1219 Ga0207649_10049245 3300025920 Bacteria 2601
1220 Ga0207652_10000181 3300025921 Bacteria 66711
1221 Ga0207652_10000397 3300025921 Bacteria 45365
1222 Ga0207652_10002067 3300025921 Bacteria 17274
1223 Ga0207652_10002811 3300025921 Bacteria 14612
1224 Ga0207652_10003461 3300025921 Bacteria 13016
1225 Ga0207652_10008746 3300025921 Bacteria 8149
1226 Ga0207652_10015389 3300025921 Bacteria 6212
1227 Ga0207652_10052657 3300025921 Bacteria 3494
1228 Ga0207652_10099832 3300025921 Bacteria 2562
1229 Ga0207652_10449010 3300025921 Bacteria 1162
1230 Ga0207652_10560264 3300025921 Bacteria 1026
1231 Ga0207652_10741143 3300025921 Bacteria 875
1232 Ga0207646_10085644 3300025922 Bacteria 2819
1233 Ga0207681_10020294 3300025923 Bacteria 4208
1234 Ga0207681_10047416 3300025923 Bacteria 2895
1235 Ga0207681_10108946 3300025923 Unclassified 2011
1236 Ga0207681_10157910 3300025923 Bacteria 1706
1237 Ga0207681_10199047 3300025923 Bacteria 1537
1238 Ga0207694_10011225 3300025924 Bacteria 6764
1239 Ga0207694_10065929 3300025924 Bacteria 2824
1240 Ga0207694_10171107 3300025924 Bacteria 1759
1241 Ga0207694_10186252 3300025924 Bacteria 1685
1242 Ga0207694_10445191 3300025924 Bacteria 1081
1243 Ga0207650_10008768 3300025925 Bacteria 6910
1244 Ga0207650_10072256 3300025925 Bacteria 2597
1245 Ga0207650_10074652 3300025925 Bacteria 2557
1246 Ga0207650_10085074 3300025925 Bacteria 2405
1247 Ga0207650_10093330 3300025925 Bacteria 2304
1248 Ga0207650_10101892 3300025925 Bacteria 2211
1249 Ga0207650_10108768 3300025925 Unclassified 2143
1250 Ga0207650_10159852 3300025925 Bacteria 1784
1251 Ga0207650_10279677 3300025925 Bacteria 1359
1252 Ga0207650_10510486 3300025925 Bacteria 1005
1253 Ga0207650_10842335 3300025925 Bacteria 778
1254 Ga0207659_10042939 3300025926 Bacteria 3172
1255 Ga0207659_10048649 3300025926 Bacteria 3004
1256 Ga0207659_10062881 3300025926 Bacteria 2681
1257 Ga0207659_10131908 3300025926 Bacteria 1929
1258 Ga0207659_10294147 3300025926 Bacteria 1331
1259 Ga0207659_10298567 3300025926 Bacteria 1322
1260 Ga0207659_10707830 3300025926 Bacteria 862
1261 Ga0207659_11116045 3300025926 Bacteria 678
1262 Ga0207659_11233279 3300025926 Bacteria 643
1263 Ga0207687_10389886 3300025927 Bacteria 1143
1264 Ga0207687_10940333 3300025927 Bacteria 740
1265 Ga0207700_10082121 3300025928 Bacteria 2519
1266 Ga0207664_11118504 3300025929 Bacteria 704
1267 Ga0207644_10009845 3300025931 Bacteria 6287
1268 Ga0207644_10017994 3300025931 Bacteria 4778
1269 Ga0207644_10049472 3300025931 Bacteria 3010
1270 Ga0207644_10070387 3300025931 Bacteria 2557
1271 Ga0207644_10098316 3300025931 Bacteria 2193
1272 Ga0207644_10121467 3300025931 Bacteria 1989
1273 Ga0207644_10256548 3300025931 Bacteria 1397
1274 Ga0207644_10424540 3300025931 Bacteria 1090
1275 Ga0207644_10501755 3300025931 Bacteria 1001
1276 Ga0207690_10001688 3300025932 Bacteria 13606
1277 Ga0207690_10006502 3300025932 Bacteria 6930
1278 Ga0207690_10038252 3300025932 Bacteria 3121
1279 Ga0207690_10089208 3300025932 Bacteria 2174
1280 Ga0207690_10188108 3300025932 Bacteria 1560
1281 Ga0207690_10189087 3300025932 Bacteria 1556
1282 Ga0207690_10206963 3300025932 Bacteria 1494
1283 Ga0207690_10591956 3300025932 Bacteria 905
1284 Ga0207690_11035165 3300025932 Bacteria 683
1285 Ga0207706_10018580 3300025933 Bacteria 6256
1286 Ga0207706_10027832 3300025933 Bacteria 5053
1287 Ga0207706_10037500 3300025933 Bacteria 4303
1288 Ga0207706_10087182 3300025933 Unclassified 2744
1289 Ga0207706_10501880 3300025933 Bacteria 1047
1290 Ga0207686_10187801 3300025934 Bacteria 1471
1291 Ga0207686_10294381 3300025934 Bacteria 1203
1292 Ga0207686_10782168 3300025934 Bacteria 764
1293 Ga0207709_10000008 3300025935 Bacteria 713099
1294 Ga0207709_10000136 3300025935 Bacteria 106728
1295 Ga0207709_10044433 3300025935 Bacteria 2684
1296 Ga0207709_11027171 3300025935 Bacteria 675
1297 Ga0207670_10007051 3300025936 Bacteria 6257
1298 Ga0207670_10020760 3300025936 Bacteria 4041
1299 Ga0207670_10485475 3300025936 Bacteria 1001
1300 Ga0207669_10032794 3300025937 Bacteria 2922
1301 Ga0207669_10103478 3300025937 Bacteria 1889
1302 Ga0207669_10444379 3300025937 Bacteria 1026
1303 Ga0207669_10959928 3300025937 Bacteria 717
1304 Ga0207704_10000047 3300025938 Bacteria 84386
1305 Ga0207704_10074781 3300025938 Bacteria 2163
1306 Ga0207704_10218997 3300025938 Bacteria 1407
1307 Ga0207704_10287050 3300025938 Bacteria 1254
1308 Ga0207704_10291633 3300025938 Bacteria 1245
1309 Ga0207704_10309637 3300025938 Bacteria 1213
1310 Ga0207704_10670941 3300025938 Bacteria 855
1311 Ga0207704_10735758 3300025938 Bacteria 819
1312 Ga0207691_10010938 3300025940 Bacteria 8710
1313 Ga0207691_10018630 3300025940 Bacteria 6577
1314 Ga0207691_10019062 3300025940 Bacteria 6496
1315 Ga0207691_10041966 3300025940 Bacteria 4220
1316 Ga0207691_10061482 3300025940 Bacteria 3411
1317 Ga0207691_10116164 3300025940 Bacteria 2375
1318 Ga0207691_10128724 3300025940 Bacteria 2238
1319 Ga0207691_10287080 3300025940 Bacteria 1415
1320 Ga0207691_10557608 3300025940 Bacteria 971
1321 Ga0207689_10010987 3300025942 Bacteria 7784
1322 Ga0207689_10014120 3300025942 Bacteria 6798
1323 Ga0207689_10014125 3300025942 Bacteria 6796
1324 Ga0207689_10014516 3300025942 Bacteria 6700
1325 Ga0207689_10035124 3300025942 Bacteria 4164
1326 Ga0207689_10039979 3300025942 Bacteria 3882
1327 Ga0207689_10086976 3300025942 Bacteria 2568
1328 Ga0207689_10096893 3300025942 Bacteria 2423
1329 Ga0207689_10106993 3300025942 Bacteria 2298
1330 Ga0207689_10245832 3300025942 Bacteria 1479
1331 Ga0207689_11181039 3300025942 Bacteria 644
1332 Ga0207661_10005535 3300025944 Bacteria 8911
1333 Ga0207661_10015984 3300025944 Bacteria 5531
1334 Ga0207661_10049072 3300025944 Bacteria 3358
1335 Ga0207661_10062383 3300025944 Bacteria 3015
1336 Ga0207661_10244133 3300025944 Bacteria 1594
1337 Ga0207661_10249285 3300025944 Bacteria 1578
1338 Ga0207661_10336164 3300025944 Bacteria 1360
1339 Ga0207661_10452384 3300025944 Bacteria 1170
1340 Ga0207661_10627426 3300025944 Bacteria 987
1341 Ga0207679_10002952 3300025945 Bacteria 10540
1342 Ga0207679_10005671 3300025945 Bacteria 7828
1343 Ga0207679_10124436 3300025945 Unclassified 2059
1344 Ga0207679_10531693 3300025945 Bacteria 1053
1345 Ga0207679_10617915 3300025945 Bacteria 978
1346 Ga0207667_10000015 3300025949 Bacteria 417534
1347 Ga0207667_10000312 3300025949 Bacteria 67340
1348 Ga0207667_10010574 3300025949 Bacteria 10778
1349 Ga0207667_10015134 3300025949 Bacteria 8773
1350 Ga0207667_10019147 3300025949 Bacteria 7655
1351 Ga0207667_10021902 3300025949 Bacteria 7073
1352 Ga0207667_10022432 3300025949 Bacteria 6974
1353 Ga0207667_10028216 3300025949 Bacteria 6098
1354 Ga0207667_10031223 3300025949 Bacteria 5752
1355 Ga0207667_10059871 3300025949 Bacteria 3987
1356 Ga0207667_10070905 3300025949 Bacteria 3626
1357 Ga0207667_10114199 3300025949 Bacteria 2784
1358 Ga0207667_10119730 3300025949 Bacteria 2713
1359 Ga0207667_10124861 3300025949 Bacteria 2651
1360 Ga0207667_10127495 3300025949 Bacteria 2622
1361 Ga0207667_10169389 3300025949 Bacteria 2245
1362 Ga0207667_10247716 3300025949 Bacteria 1823
1363 Ga0207667_10262002 3300025949 Bacteria 1768
1364 Ga0207667_10272588 3300025949 Bacteria 1730
1365 Ga0207667_10341906 3300025949 Bacteria 1527
1366 Ga0207667_10389826 3300025949 Bacteria 1419
1367 Ga0207667_10455610 3300025949 Bacteria 1299
1368 Ga0207667_10739555 3300025949 Bacteria 984
1369 Ga0207667_10931131 3300025949 Bacteria 859
1370 Ga0207667_11151446 3300025949 Bacteria 757
1371 Ga0207651_10019600 3300025960 Bacteria 4059
1372 Ga0207651_10023116 3300025960 Bacteria 3816
1373 Ga0207651_10134162 3300025960 Bacteria 1901
1374 Ga0207651_10171772 3300025960 Bacteria 1710
1375 Ga0207651_10351648 3300025960 Bacteria 1241
1376 Ga0207651_10387206 3300025960 Bacteria 1186
1377 Ga0207651_10468386 3300025960 Bacteria 1084
1378 Ga0207651_10480403 3300025960 Bacteria 1071
1379 Ga0207651_10652923 3300025960 Unclassified 924
1380 Ga0207712_10002097 3300025961 Bacteria 13065
1381 Ga0207712_10007049 3300025961 Bacteria 7091
1382 Ga0207712_10007511 3300025961 Bacteria 6882
1383 Ga0207712_10017428 3300025961 Bacteria 4664
1384 Ga0207712_10045776 3300025961 Bacteria 3031
1385 Ga0207712_10052308 3300025961 Bacteria 2860
1386 Ga0207712_10124101 3300025961 Bacteria 1958
1387 Ga0207712_10199147 3300025961 Bacteria 1587
1388 Ga0207668_10043383 3300025972 Bacteria 3052
1389 Ga0207668_10046047 3300025972 Bacteria 2978
1390 Ga0207668_10227375 3300025972 Bacteria 1502
1391 Ga0207668_10372613 3300025972 Bacteria 1199
1392 Ga0207668_10757274 3300025972 Bacteria 857
1393 Ga0207668_11077348 3300025972 Bacteria 720
1394 Ga0207668_11382187 3300025972 Bacteria 634
1395 Ga0207640_10021676 3300025981 Bacteria 3833
1396 Ga0207640_10033730 3300025981 Bacteria 3188
1397 Ga0207640_10034811 3300025981 Bacteria 3146
1398 Ga0207640_10062503 3300025981 Bacteria 2471
1399 Ga0207640_10207922 3300025981 Bacteria 1488
1400 Ga0207640_10218215 3300025981 Bacteria 1458
1401 Ga0207640_10292470 3300025981 Bacteria 1285
1402 Ga0207640_10383117 3300025981 Bacteria 1140
1403 Ga0207640_10388209 3300025981 Bacteria 1133
1404 Ga0207640_11034883 3300025981 Bacteria 724
1405 Ga0207658_10009043 3300025986 Bacteria 6757
1406 Ga0207658_10012058 3300025986 Bacteria 5896
1407 Ga0207658_10047300 3300025986 Bacteria 3148
1408 Ga0207658_10059600 3300025986 Bacteria 2845
1409 Ga0207658_10068784 3300025986 Bacteria 2673
1410 Ga0207658_10435964 3300025986 Bacteria 1158
1411 Ga0207658_10463432 3300025986 Bacteria 1124
1412 Ga0207658_10851977 3300025986 Bacteria 829
1413 Ga0207658_11225580 3300025986 Bacteria 686
1414 Ga0207658_11357616 3300025986 Bacteria 650
1415 Ga0207677_10013878 3300026023 Bacteria 4683
1416 Ga0207677_10053788 3300026023 Bacteria 2743
1417 Ga0207677_10061158 3300026023 Bacteria 2607
1418 Ga0207677_10128401 3300026023 Bacteria 1920
1419 Ga0207677_10219753 3300026023 Bacteria 1523
1420 Ga0207703_10002553 3300026035 Bacteria 15723
1421 Ga0207703_10046724 3300026035 Bacteria 3488
1422 Ga0207703_10190881 3300026035 Bacteria 1814
1423 Ga0207703_10331857 3300026035 Bacteria 1395
1424 Ga0207703_10354126 3300026035 Bacteria 1352
1425 Ga0207639_10007826 3300026041 Bacteria 7298
1426 Ga0207639_10011425 3300026041 Bacteria 6166
1427 Ga0207639_10018365 3300026041 Bacteria 4968
1428 Ga0207639_10050655 3300026041 Bacteria 3154
1429 Ga0207639_10107927 3300026041 Unclassified 2262
1430 Ga0207639_10110545 3300026041 Bacteria 2239
1431 Ga0207639_10136871 3300026041 Bacteria 2035
1432 Ga0207639_10138781 3300026041 Bacteria 2023
1433 Ga0207639_10279104 3300026041 Bacteria 1468
1434 Ga0207639_10364924 3300026041 Bacteria 1293
1435 Ga0207639_10536296 3300026041 Bacteria 1073
1436 Ga0207639_10561488 3300026041 Bacteria 1049
1437 Ga0207639_10591482 3300026041 Bacteria 1022
1438 Ga0207639_10784444 3300026041 Bacteria 887
1439 Ga0207639_10837346 3300026041 Bacteria 858
1440 Ga0207678_10025688 3300026067 Bacteria 5141
1441 Ga0207678_10354464 3300026067 Bacteria 1266
1442 Ga0207678_10553281 3300026067 Bacteria 1006
1443 Ga0207678_10572888 3300026067 Bacteria 989
1444 Ga0207678_10727525 3300026067 Bacteria 874
1445 Ga0207708_10104264 3300026075 Bacteria 2197
1446 Ga0207708_10559217 3300026075 Bacteria 965
1447 Ga0207708_10736877 3300026075 Bacteria 845
1448 Ga0207708_10738123 3300026075 Bacteria 844
1449 Ga0207708_10759820 3300026075 Bacteria 832
1450 Ga0207702_10005403 3300026078 Bacteria 11189
1451 Ga0207702_10019319 3300026078 Bacteria 5638
1452 Ga0207702_10022970 3300026078 Bacteria 5174
1453 Ga0207702_10026748 3300026078 Bacteria 4790
1454 Ga0207702_10033741 3300026078 Bacteria 4276
1455 Ga0207702_10091404 3300026078 Bacteria 2665
1456 Ga0207702_10180424 3300026078 Bacteria 1944
1457 Ga0207702_11233290 3300026078 Bacteria 742
1458 Ga0207641_10000448 3300026088 Bacteria 47082
1459 Ga0207641_10001077 3300026088 Bacteria 27465
1460 Ga0207641_10005547 3300026088 Bacteria 10755
1461 Ga0207641_10123066 3300026088 Bacteria 2318
1462 Ga0207641_10749801 3300026088 Bacteria 964
1463 Ga0207641_10821035 3300026088 Bacteria 920
1464 Ga0207648_10003051 3300026089 Bacteria 17707
1465 Ga0207648_10004234 3300026089 Bacteria 14827
1466 Ga0207648_10007503 3300026089 Bacteria 10713
1467 Ga0207648_10007532 3300026089 Bacteria 10685
1468 Ga0207648_10043979 3300026089 Bacteria 3920
1469 Ga0207648_10081140 3300026089 Bacteria 2829
1470 Ga0207648_10105992 3300026089 Bacteria 2466
1471 Ga0207648_10120096 3300026089 Bacteria 2311
1472 Ga0207648_10182205 3300026089 Bacteria 1859
1473 Ga0207648_10453081 3300026089 Bacteria 1168
1474 Ga0207676_10005339 3300026095 Bacteria 9100
1475 Ga0207676_10083329 3300026095 Bacteria 2604
1476 Ga0207676_10166829 3300026095 Bacteria 1914
1477 Ga0207676_10289221 3300026095 Bacteria 1491
1478 Ga0207676_10333640 3300026095 Archaea 1397
1479 Ga0207676_10357183 3300026095 Bacteria 1353
1480 Ga0207676_10361292 3300026095 Bacteria 1346
1481 Ga0207676_10401709 3300026095 Bacteria 1281
1482 Ga0207676_10491131 3300026095 Bacteria 1164
1483 Ga0207676_10883467 3300026095 Bacteria 876
1484 Ga0207676_11166839 3300026095 Unclassified 763
1485 Ga0207674_10006765 3300026116 Bacteria 13455
1486 Ga0207674_10013334 3300026116 Bacteria 9127
1487 Ga0207674_10020241 3300026116 Bacteria 7194
1488 Ga0207674_10036449 3300026116 Bacteria 5125
1489 Ga0207674_10048553 3300026116 Bacteria 4344
1490 Ga0207674_10067944 3300026116 Unclassified 3587
1491 Ga0207674_10071251 3300026116 Bacteria 3493
1492 Ga0207674_10082252 3300026116 Bacteria 3221
1493 Ga0207674_10127056 3300026116 Bacteria 2515
1494 Ga0207674_10168314 3300026116 Unclassified 2145
1495 Ga0207674_10184414 3300026116 Bacteria 2037
1496 Ga0207674_10191592 3300026116 Bacteria 1994
1497 Ga0207674_10194101 3300026116 Bacteria 1980
1498 Ga0207674_10431105 3300026116 Bacteria 1274
1499 Ga0207674_11244785 3300026116 Bacteria 714
1500 Ga0207675_100006844 3300026118 Bacteria 10795
1501 Ga0207675_100007135 3300026118 Bacteria 10561
1502 Ga0207675_100007786 3300026118 Bacteria 10104
1503 Ga0207675_100037981 3300026118 Bacteria 4494
1504 Ga0207675_100105086 3300026118 Bacteria 2661
1505 Ga0207675_100181530 3300026118 Bacteria 2015
1506 Ga0207675_100269248 3300026118 Bacteria 1653
1507 Ga0207675_100407721 3300026118 Unclassified 1340
1508 Ga0207675_100841539 3300026118 Bacteria 932
1509 Ga0207683_10002182 3300026121 Bacteria 17194
1510 Ga0207683_10060090 3300026121 Bacteria 3340
1511 Ga0207683_10090981 3300026121 Bacteria 2718
1512 Ga0207683_10120674 3300026121 Bacteria 2353
1513 Ga0207683_10352687 3300026121 Bacteria 1350
1514 Ga0207683_10661454 3300026121 Bacteria 968
1515 Ga0207698_10002660 3300026142 Bacteria 10625
1516 Ga0207698_10006772 3300026142 Bacteria 7161
1517 Ga0207698_10007114 3300026142 Bacteria 7008
1518 Ga0207698_10008350 3300026142 Bacteria 6543
1519 Ga0207698_10048501 3300026142 Bacteria 3225
1520 Ga0207698_10057000 3300026142 Bacteria 3019
1521 Ga0207698_10123869 3300026142 Bacteria 2194
1522 Ga0207698_10137013 3300026142 Bacteria 2102
1523 Ga0207698_10141048 3300026142 Bacteria 2076
1524 Ga0207698_10216612 3300026142 Bacteria 1727
1525 Ga0207698_10348046 3300026142 Bacteria 1399
1526 Ga0207698_10348635 3300026142 Bacteria 1397
1527 Ga0207698_10383332 3300026142 Unclassified 1338
1528 Ga0207698_10450229 3300026142 Bacteria 1243
1529 Ga0207698_10591332 3300026142 Bacteria 1093
1530 Ga0209489_109555 3300027361 Bacteria 11911
1531 Ga0209995_1003974 3300027471 Bacteria 2361
1532 Ga0209968_1000701 3300027526 Bacteria 5161
1533 Ga0209968_1021851 3300027526 Bacteria 1040
1534 Ga0209282_1021554 3300027666 Bacteria 4071
1535 Ga0209974_10023112 3300027876 Bacteria 2058
1536 Ga0209974_10027014 3300027876 Bacteria 1899
1537 Ga0268266_10000057 3300028379 Bacteria 284777
1538 Ga0268266_10000121 3300028379 Bacteria 154995
1539 Ga0268266_10027021 3300028379 Bacteria 4883
1540 Ga0268266_10037873 3300028379 Bacteria 4106
1541 Ga0268265_10068066 3300028380 Bacteria 2759
1542 Ga0268265_10158848 3300028380 Bacteria 1917
1543 Ga0268265_10245844 3300028380 Unclassified 1581
1544 Ga0268265_10259976 3300028380 Bacteria 1543
1545 Ga0268265_10318486 3300028380 Bacteria 1407
1546 Ga0268265_11202859 3300028380 Bacteria 755
1547 Ga0268264_10000143 3300028381 Bacteria 170031
1548 Ga0268264_10024074 3300028381 Bacteria 4969
1549 Ga0268264_10039925 3300028381 Bacteria 3877
1550 Ga0268264_10041469 3300028381 Bacteria 3808
1551 Ga0268264_10054205 3300028381 Bacteria 3348
1552 Ga0268264_10132175 3300028381 Bacteria 2214
1553 Ga0268264_10215233 3300028381 Bacteria 1766
1554 Ga0268264_10356716 3300028381 Bacteria 1393
1555 Ga0268264_10444108 3300028381 Bacteria 1255
1556 Ga0268264_10446781 3300028381 Unclassified 1252
1557 Ga0265334_10011151 3300028573 Bacteria 3789
1558 Ga0265334_10035864 3300028573 Unclassified 1961
1559 Ga0307517_10000198 3300028786 Bacteria 102181
1560 Ga0307517_10175469 3300028786 Bacteria 1397
1561 Ga0307515_10000001 3300028794 Bacteria 4259510
1562 Ga0307515_10000003 3300028794 Bacteria 891317
1563 Ga0307515_10000455 3300028794 Bacteria 97670
1564 Ga0307515_10037978 3300028794 Bacteria 7722
1565 Ga0307515_10056048 3300028794 Bacteria 5739
1566 Ga0307515_10083712 3300028794 Bacteria 4109
1567 Ga0307515_10500020 3300028794 Bacteria 826
1568 Ga0265338_10102086 3300028800 Bacteria 2333
1569 Ga0265338_10533770 3300028800 Bacteria 823
1570 Ga0316177_1132756 3300030731 Bacteria 5466
1571 Ga0316176_1026201 3300030732 Bacteria 12822
1572 Ga0316183_1098725 3300030742 Bacteria 33143
1573 Ga0316181_1140650 3300030744 Bacteria 13241
1574 Ga0265328_10030464 3300031239 Bacteria 2010
1575 Ga0265331_10043710 3300031250 Bacteria 2168
1576 Ga0265331_10178352 3300031250 Bacteria 960
1577 Ga0265327_10000006 3300031251 Bacteria 693716
1578 Ga0265327_10000073 3300031251 Bacteria 214772
1579 Ga0265327_10000421 3300031251 Bacteria 77515
1580 Ga0265327_10006644 3300031251 Bacteria 9186
1581 Ga0265327_10041400 3300031251 Bacteria 2483
1582 Ga0265327_10045176 3300031251 Bacteria 2343
1583 Ga0265327_10050283 3300031251 Bacteria 2182
1584 Ga0265327_10169777 3300031251 Bacteria 1003
1585 Ga0265327_10202665 3300031251 Bacteria 898
1586 Ga0265327_10204609 3300031251 Bacteria 893
1587 Ga0265316_10428797 3300031344 Bacteria 950
1588 Ga0265316_10475320 3300031344 Bacteria 895
1589 Ga0307513_10027085 3300031456 Bacteria 6589
1590 Ga0307513_10031456 3300031456 Bacteria 6009
1591 Ga0307513_10068088 3300031456 Bacteria 3731
1592 Ga0307513_10123404 3300031456 Bacteria 2552
1593 Ga0307513_10180364 3300031456 Bacteria 1976
1594 Ga0307513_10272147 3300031456 Bacteria 1476
1595 Ga0307513_10298713 3300031456 Unclassified 1378
1596 Ga0307513_10637710 3300031456 Bacteria 773
1597 Ga0307509_10024880 3300031507 Bacteria 6696
1598 Ga0307509_10042071 3300031507 Bacteria 4953
1599 Ga0307509_10042258 3300031507 Bacteria 4942
1600 Ga0307509_10186329 3300031507 Bacteria 1933
1601 Ga0307509_10273900 3300031507 Bacteria 1453
1602 Ga0307509_10525587 3300031507 Bacteria 864
1603 Ga0307408_100000396 3300031548 Bacteria 39439
1604 Ga0307408_100000464 3300031548 Bacteria 35518
1605 Ga0307408_100000560 3300031548 Bacteria 32128
1606 Ga0307408_100001326 3300031548 Bacteria 18558
1607 Ga0307408_100033231 3300031548 Bacteria 3603
1608 Ga0307408_100246079 3300031548 Bacteria 1472
1609 Ga0265313_10185747 3300031595 Bacteria 871
1610 Ga0307508_10002437 3300031616 Bacteria 19616
1611 Ga0307508_10208287 3300031616 Bacteria 1556
1612 Ga0265314_10050019 3300031711 Bacteria 2922
1613 Ga0307516_10068016 3300031730 Bacteria 3431
1614 Ga0307516_10250469 3300031730 Bacteria 1466
1615 Ga0307516_10572907 3300031730 Bacteria 783
1616 Ga0307405_10000009 3300031731 Bacteria 259388
1617 Ga0307405_10038785 3300031731 Bacteria 2874
1618 Ga0307405_10158557 3300031731 Bacteria 1600
1619 Ga0307405_10299761 3300031731 Bacteria 1219
1620 Ga0307405_10587453 3300031731 Bacteria 907
1621 Ga0307413_10000050 3300031824 Bacteria 30598
1622 Ga0307413_10018591 3300031824 Bacteria 3652
1623 Ga0307413_10178925 3300031824 Bacteria 1510
1624 Ga0307518_10343903 3300031838 Bacteria 874
1625 Ga0307410_10248187 3300031852 Bacteria 1383
1626 Ga0307406_10032038 3300031901 Bacteria 3206
1627 Ga0307406_10123669 3300031901 Bacteria 1803
1628 Ga0307406_10242687 3300031901 Bacteria 1352
1629 Ga0307407_10000001 3300031903 Bacteria 570048
1630 Ga0307407_10058075 3300031903 Bacteria 2248
1631 Ga0307407_10702074 3300031903 Bacteria 762
1632 Ga0307407_10704824 3300031903 Bacteria 761
1633 Ga0307412_10000001 3300031911 Bacteria 822691
1634 Ga0307412_10000140 3300031911 Bacteria 52924
1635 Ga0307412_10001247 3300031911 Bacteria 14405
1636 Ga0307412_10006832 3300031911 Bacteria 6476
1637 Ga0307412_10008180 3300031911 Bacteria 5963
1638 Ga0307412_10019593 3300031911 Bacteria 4102
1639 Ga0307412_10204908 3300031911 Unclassified 1501
1640 Ga0307412_10534604 3300031911 Bacteria 982
1641 Ga0307409_100014576 3300031995 Bacteria 5121
1642 Ga0307409_100145114 3300031995 Bacteria 2051
1643 Ga0307416_100000008 3300032002 Bacteria 401343
1644 Ga0307416_100000020 3300032002 Bacteria 192862
1645 Ga0307416_100000280 3300032002 Bacteria 27014
1646 Ga0307416_100000457 3300032002 Bacteria 20948
1647 Ga0307416_100055210 3300032002 Bacteria 3197
1648 Ga0307416_100781977 3300032002 Bacteria 1049
1649 Ga0307416_100876690 3300032002 Unclassified 997
1650 Ga0307414_10000049 3300032004 Bacteria 130090
1651 Ga0307414_10000470 3300032004 Bacteria 21107
1652 Ga0307414_10002491 3300032004 Bacteria 9655
1653 Ga0307414_10009577 3300032004 Bacteria 5573
1654 Ga0307414_10011763 3300032004 Bacteria 5148
1655 Ga0307414_10011973 3300032004 Bacteria 5112
1656 Ga0307414_10012012 3300032004 Bacteria 5105
1657 Ga0307414_10032798 3300032004 Bacteria 3424
1658 Ga0307414_10033180 3300032004 Bacteria 3409
1659 Ga0307414_10038827 3300032004 Bacteria 3201
1660 Ga0307414_10045703 3300032004 Bacteria 3000
1661 Ga0307414_10055710 3300032004 Bacteria 2770
1662 Ga0307414_10061313 3300032004 Bacteria 2664
1663 Ga0307414_10069644 3300032004 Bacteria 2530
1664 Ga0307414_10107374 3300032004 Bacteria 2115
1665 Ga0307414_10135225 3300032004 Bacteria 1921
1666 Ga0307414_10196853 3300032004 Bacteria 1635
1667 Ga0307414_10224060 3300032004 Bacteria 1545
1668 Ga0307414_10246724 3300032004 Bacteria 1481
1669 Ga0307414_10249299 3300032004 Bacteria 1475
1670 Ga0307414_10265751 3300032004 Bacteria 1434
1671 Ga0307414_10686721 3300032004 Bacteria 926
1672 Ga0307414_10852471 3300032004 Bacteria 833
1673 Ga0307414_11517019 3300032004 Bacteria 624
1674 Ga0307411_10000003 3300032005 Bacteria 477556
1675 Ga0307411_10024891 3300032005 Bacteria 3576
1676 Ga0307411_10104661 3300032005 Bacteria 2010
1677 Ga0307411_10161032 3300032005 Bacteria 1681
1678 Ga0307411_10731211 3300032005 Bacteria 865
1679 Ga0307415_100006212 3300032126 Bacteria 6419
1680 Ga0307415_100304068 3300032126 Unclassified 1323
1681 Ga0307507_10324049 3300033179 Bacteria 925
1682 Ga0307510_10002841 3300033180 Bacteria 19891
1683 Ga0307510_10003113 3300033180 Bacteria 19200
1684 Ga0307510_10005580 3300033180 Bacteria 14995
1685 Ga0373923_0072096 3300035111 Bacteria 1485
1686 Ga0373941_0012741 3300035115 Bacteria 2206
1687 Ga0373953_0160218 3300035117 Bacteria 967
1688 Ga0373954_0060551 3300035118 Bacteria 1786
1689 Ga0373954_0128311 3300035118 Bacteria 1234
1690 Ga0373946_0392717 3300035171 Bacteria 699
1691 Ga0373955_0066138 3300035172 Bacteria 2009
1692 Ga0373935_0202636 3300035692 Bacteria 1372
1693 Ga0373927_0098455 3300035695 Bacteria 1901
1694 Ga0373933_0004359 3300035724 Bacteria 7771
1695 Ga0373937_0100426 3300036401 Bacteria 2685
1696 Ga0373937_0346542 3300036401 Bacteria 1407
1697 Ga0373937_0429953 3300036401 Bacteria 1253
1698 Ga0373925_0250934 3300037068 Unclassified 1419
1699 Ga0395899_0000024 3300037312 Bacteria 357402
1700 Ga0395899_0000027 3300037312 Bacteria 337387
1701 Ga0395899_0000811 3300037312 Bacteria 30415
1702 Ga0395899_0000959 3300037312 Bacteria 26821
1703 Ga0395899_0002874 3300037312 Bacteria 13842
1704 Ga0395899_0035979 3300037312 Bacteria 3715
1705 Ga0395899_0040296 3300037312 Bacteria 3494
1706 Ga0395899_0099015 3300037312 Bacteria 2106
1707 Ga0395899_0122872 3300037312 Bacteria 1858
1708 Ga0395899_0131394 3300037312 Bacteria 1787
1709 Ga0395899_0175620 3300037312 Bacteria 1506
1710 Ga0395900_0000275 3300037418 Bacteria 78207
1711 Ga0395900_0001518 3300037418 Bacteria 27559
1712 Ga0395900_0001963 3300037418 Bacteria 23228
1713 Ga0395900_0009605 3300037418 Bacteria 9919
1714 Ga0395900_0010124 3300037418 Bacteria 9643
1715 Ga0395900_0031957 3300037418 Bacteria 5410
1716 Ga0395900_0122148 3300037418 Bacteria 2672
1717 Ga0395900_0127621 3300037418 Bacteria 2608
1718 Ga0395900_0175353 3300037418 Bacteria 2180
1719 Ga0395900_0533557 3300037418 Bacteria 1120
1720 Ga0395900_0573438 3300037418 Bacteria 1071
1721 Ga0395898_0005476 3300037466 Bacteria 13714
1722 Ga0395898_0009566 3300037466 Bacteria 10183
1723 Ga0395898_0015148 3300037466 Bacteria 7915
1724 Ga0395898_0086762 3300037466 Unclassified 3015
1725 Ga0395898_0107010 3300037466 Bacteria 2682
1726 Ga0395898_0137284 3300037466 Bacteria 2341
1727 Ga0395898_1089676 3300037466 Bacteria 732
1728 Ga0395905_0000001 3300037471 Bacteria 2037079
1729 Ga0395905_0000051 3300037471 Bacteria 223416
1730 Ga0395905_0000248 3300037471 Bacteria 81042
1731 Ga0395905_0000327 3300037471 Bacteria 68334
1732 Ga0395905_0018039 3300037471 Bacteria 6700
1733 Ga0395905_0020199 3300037471 Bacteria 6310
1734 Ga0395905_0105583 3300037471 Bacteria 2645
1735 Ga0395905_0846367 3300037471 Bacteria 818
1736 Ga0395905_1561161 3300037471 Bacteria 565
1737 Ga0395901_0000595 3300038443 Bacteria 42132
1738 Ga0395901_0005557 3300038443 Bacteria 12756
1739 Ga0395901_0008911 3300038443 Bacteria 10162
1740 Ga0395901_0012588 3300038443 Bacteria 8585
1741 Ga0395901_0028117 3300038443 Bacteria 5783
1742 Ga0395901_0086288 3300038443 Bacteria 3282
1743 Ga0395901_0219105 3300038443 Bacteria 1990
1744 Ga0395901_0244845 3300038443 Bacteria 1869
1745 Ga0395901_0270817 3300038443 Bacteria 1766
1746 Ga0395901_0396845 3300038443 Bacteria 1417
1747 Ga0395901_0460781 3300038443 Bacteria 1299
1748 Ga0436365_1408525 3300039437 Bacteria 2175
1749 Ga0436365_1888183 3300039437 Bacteria 4960
1750 Ga0436361_1048734 3300039447 Bacteria 5617
1751 Ga0439436_0003095 3300041404 Bacteria 5042
1752 Ga0439436_0015280 3300041404 Bacteria 2310
1753 Ga0439439_0012158 3300041406 Bacteria 2079
1754 Ga0439439_0031309 3300041406 Bacteria 1355
1755 Ga0439439_0049064 3300041406 Bacteria 1105
1756 Ga0439447_000099 3300041407 Bacteria 30014
1757 Ga0439466_0026163 3300041411 Bacteria 2031
1758 Ga0439465_0000035 3300041413 Bacteria 27339
1759 Ga0439465_0027791 3300041413 Bacteria 1793
1760 Ga0439465_0120106 3300041413 Bacteria 921
1761 Ga0439465_0177782 3300041413 Bacteria 769
1762 Ga0451789_0478833 3300041443 Bacteria 749
1763 Ga0451791_1510331 3300041451 Bacteria 1318
1764 Ga0451800_0163675 3300041459 Bacteria 580
1765 Ga0451800_0346636 3300041459 Bacteria 783
1766 Ga0451800_0635678 3300041459 Bacteria 718
1767 Ga0451802_0057036 3300041460 Bacteria 719
1768 Ga0451805_003895 3300041461 Bacteria 824
1769 Ga0451804_0777315 3300041463 Bacteria 756
1770 Ga0451808_35622 3300041464 Bacteria 569
1771 Ga0451807_2642789 3300041486 Bacteria 618
1772 Ga0451847_0777468 3300041503 Unclassified 774
1773 Ga0451851_0859858 3300041507 Bacteria 1288
1774 Ga0451851_1082119 3300041507 Bacteria 1578
1775 Ga0451843_0885776 3300041509 Unclassified 1281
1776 Ga0451853_3794576 3300041512 Bacteria 1576
1777 Ga0439431_0000062 3300041997 Bacteria 16970
1778 Ga0439431_0043290 3300041997 Bacteria 1152
1779 Ga0439433_0066144 3300041999 Bacteria 867
1780 Ga0439445_0000094 3300042004 Bacteria 14134
1781 Ga0439445_0012949 3300042004 Bacteria 2012
1782 Ga0439445_0071309 3300042004 Bacteria 961
1783 Ga0439448_0099296 3300042005 Bacteria 988
1784 Ga0439449_0013804 3300042007 Bacteria 3038
1785 Ga0439449_0043790 3300042007 Bacteria 1661
1786 Ga0439449_0066164 3300042007 Bacteria 1333
1787 Ga0439449_0080444 3300042007 Bacteria 1201
1788 Ga0439449_0085494 3300042007 Bacteria 1164
1789 Ga0439455_0061805 3300042012 Bacteria 994
1790 Ga0439457_003882 3300042014 Bacteria 4002
1791 Ga0439457_009936 3300042014 Bacteria 2202
1792 Ga0439457_041414 3300042014 Bacteria 1026
1793 Ga0439462_0021320 3300042015 Bacteria 1692
1794 Ga0450923_005885 3300042125 Unclassified 2002
1795 Ga0450898_019644 3300042134 Bacteria 1179
1796 Ga0450905_019710 3300042142 Bacteria 989
1797 Ga0439434_0178898 3300042435 Bacteria 710
1798 Ga0451577_0000015 3300042876 Bacteria 538333
1799 Ga0451577_0000022 3300042876 Bacteria 437063
1800 Ga0451577_0000435 3300042876 Bacteria 74303
1801 Ga0451577_0040651 3300042876 Bacteria 4175
1802 Ga0451577_0053556 3300042876 Bacteria 3602
1803 Ga0451577_0060837 3300042876 Bacteria 3367
1804 Ga0451577_0066316 3300042876 Bacteria 3220
1805 Ga0451577_0125519 3300042876 Bacteria 2299
1806 Ga0451577_0128218 3300042876 Bacteria 2274
1807 Ga0451577_0179186 3300042876 Bacteria 1910
1808 Ga0451577_0192250 3300042876 Bacteria 1841
1809 Ga0451577_0200414 3300042876 Bacteria 1802
1810 Ga0451577_0411214 3300042876 Bacteria 1228
1811 Ga0451577_0721496 3300042876 Bacteria 902
1812 Ga0451577_1333008 3300042876 Unclassified 638
1813 Ga0466969_0000847 3300044656 Bacteria 16571
1814 Ga0466969_0013019 3300044656 Bacteria 4381
1815 Ga0466972_0000010 3300044658 Bacteria 256339
1816 Ga0466972_0000143 3300044658 Bacteria 58694
1817 Ga0466972_0001431 3300044658 Bacteria 11583
1818 Ga0466972_0003318 3300044658 Bacteria 7984
1819 Ga0466972_0093463 3300044658 Bacteria 1426
1820 Ga0466972_0118434 3300044658 Bacteria 1249
1821 Ga0453683_0000397 3300044673 Bacteria 51516
1822 Ga0453683_0021715 3300044673 Bacteria 4095
1823 Ga0453683_0039007 3300044673 Bacteria 2985
1824 Ga0453683_0051344 3300044673 Bacteria 2583
1825 Ga0453683_0203487 3300044673 Bacteria 1257
1826 Ga0453683_0232845 3300044673 Bacteria 1172
1827 Ga0453683_0326952 3300044673 Bacteria 983
1828 Ga0453683_0369500 3300044673 Unclassified 922
1829 Ga0453683_0510324 3300044673 Bacteria 780
1830 Ga0466965_0047350 3300044683 Bacteria 2129
1831 Ga0466966_0000176 3300044684 Bacteria 42093
1832 Ga0466966_0814272 3300044684 Bacteria 563
1833 Ga0466961_0024842 3300044693 Bacteria 3854
1834 Ga0466961_0040409 3300044693 Bacteria 2991
1835 Ga0466961_0417115 3300044693 Bacteria 814
1836 Ga0466961_0548213 3300044693 Bacteria 696
1837 Ga0466964_0023938 3300044706 Bacteria 2377
1838 Ga0466964_0144784 3300044706 Bacteria 1096
1839 Ga0453684_0000081 3300044712 Bacteria 402985
1840 Ga0453684_0000501 3300044712 Bacteria 153475
1841 Ga0453684_0001733 3300044712 Bacteria 58391
1842 Ga0453684_0012899 3300044712 Bacteria 13690
1843 Ga0453684_0014288 3300044712 Bacteria 12728
1844 Ga0453684_0020859 3300044712 Bacteria 9839
1845 Ga0453684_0026959 3300044712 Bacteria 8273
1846 Ga0453684_0027713 3300044712 Bacteria 8110
1847 Ga0453684_0043669 3300044712 Bacteria 6020
1848 Ga0453684_0047222 3300044712 Bacteria 5714
1849 Ga0453684_0070065 3300044712 Bacteria 4443
1850 Ga0453684_0082045 3300044712 Bacteria 4019
1851 Ga0453684_0083320 3300044712 Bacteria 3980
1852 Ga0453684_0094097 3300044712 Bacteria 3688
1853 Ga0453684_0184631 3300044712 Bacteria 2445
1854 Ga0453684_0243917 3300044712 Bacteria 2067
1855 Ga0453684_0247974 3300044712 Bacteria 2046
1856 Ga0453684_0287279 3300044712 Bacteria 1874
1857 Ga0453684_0306417 3300044712 Bacteria 1804
1858 Ga0453684_0347938 3300044712 Bacteria 1672
1859 Ga0453684_0554813 3300044712 Bacteria 1265
1860 Ga0453684_0609057 3300044712 Bacteria 1196
1861 Ga0453684_0640069 3300044712 Bacteria 1161
1862 Ga0453684_0640325 3300044712 Bacteria 1161
1863 Ga0453684_0933906 3300044712 Bacteria 927
1864 Ga0466971_0078790 3300044719 Bacteria 1501
1865 Ga0466968_0008474 3300044735 Bacteria 3939
1866 Ga0466968_0120461 3300044735 Bacteria 1187
1867 Ga0466970_0000471 3300044765 Bacteria 19964
1868 Ga0466970_0066556 3300044765 Bacteria 1934
1869 Ga0466970_0074960 3300044765 Bacteria 1822
1870 Ga0466970_0153571 3300044765 Bacteria 1272
1871 Ga0466970_0206243 3300044765 Bacteria 1094
1872 Ga0466957_0010181 3300044842 Bacteria 5383
1873 Ga0466957_0011877 3300044842 Bacteria 5034
1874 Ga0466957_0013600 3300044842 Bacteria 4724
1875 Ga0466957_0243929 3300044842 Bacteria 1193
1876 Ga0466957_0364999 3300044842 Bacteria 982
1877 Ga0466960_0088289 3300044901 Bacteria 1576
1878 Ga0466960_0122226 3300044901 Bacteria 1365
1879 Ga0466959_0000016 3300045049 Bacteria 144600
1880 Ga0466959_0031107 3300045049 Bacteria 3950
1881 Ga0466959_0059033 3300045049 Bacteria 2794
1882 Ga0466959_0062184 3300045049 Bacteria 2714
1883 Ga0451576_0000002 3300045051 Bacteria 1670975
1884 Ga0451576_0000044 3300045051 Bacteria 334467
1885 Ga0451576_0000294 3300045051 Bacteria 122276
1886 Ga0451576_0008161 3300045051 Bacteria 12328
1887 Ga0451576_0008374 3300045051 Bacteria 12143
1888 Ga0451576_0246205 3300045051 Bacteria 1868
1889 Ga0451576_0279893 3300045051 Bacteria 1744
1890 Ga0451576_0464039 3300045051 Bacteria 1330
1891 Ga0451576_0470256 3300045051 Bacteria 1320
1892 Ga0451576_0496355 3300045051 Bacteria 1282
1893 Ga0451576_1205851 3300045051 Bacteria 790
1894 Ga0451576_1370800 3300045051 Bacteria 736
1895 Ga0466967_0695477 3300045976 Bacteria 1007
1896 Ga0466967_0775127 3300045976 Bacteria 952
1897 Ga0495627_000029 3300046453 Bacteria 232349
1898 Ga0495627_008565 3300046453 Bacteria 3822
1899 Ga0495592_0054736 3300046454 Bacteria 2954
1900 Ga0495592_0075961 3300046454 Bacteria 2439
1901 Ga0495592_0641360 3300046454 Bacteria 644
1902 Ga0495590_0050540 3300046457 Bacteria 1451
1903 Ga0495629_0305531 3300046459 Bacteria 1089
1904 Ga0495629_0336064 3300046459 Unclassified 1032
1905 Ga0495638_0000026 3300046460 Bacteria 347061
1906 Ga0495638_0045407 3300046460 Bacteria 2764
1907 Ga0495638_0051750 3300046460 Bacteria 2561
1908 Ga0495638_0062938 3300046460 Bacteria 2289
1909 Ga0495638_0064462 3300046460 Bacteria 2257
1910 Ga0495638_0103801 3300046460 Bacteria 1696
1911 Ga0495638_0148914 3300046460 Bacteria 1359
1912 Ga0495638_0170306 3300046460 Bacteria 1250
1913 Ga0495638_0251172 3300046460 Bacteria 975
1914 Ga0495638_0461381 3300046460 Bacteria 647
1915 Ga0495651_0183223 3300046462 Bacteria 1481
1916 Ga0495651_0279316 3300046462 Bacteria 1129
1917 Ga0495653_0642132 3300046463 Bacteria 649
1918 Ga0495650_0000231 3300046471 Bacteria 113969
1919 Ga0495650_0015637 3300046471 Bacteria 3883
1920 Ga0495650_0017042 3300046471 Bacteria 3654
1921 Ga0495650_0064001 3300046471 Bacteria 1464
1922 Ga0495650_0151073 3300046471 Bacteria 834
1923 Ga0495650_0161457 3300046471 Bacteria 799
1924 Ga0495580_0076904 3300046472 Bacteria 2328
1925 Ga0495580_0185216 3300046472 Bacteria 1437
1926 Ga0495639_0059898 3300046475 Bacteria 1743
1927 Ga0495662_0118257 3300046476 Bacteria 1300
1928 Ga0495664_0097044 3300046477 Bacteria 1774
1929 Ga0495585_0000037 3300046492 Bacteria 133335
1930 Ga0495585_0001133 3300046492 Bacteria 21876
1931 Ga0495585_0129904 3300046492 Bacteria 1327
1932 Ga0495596_0000410 3300046500 Bacteria 27433
1933 Ga0495596_0131746 3300046500 Bacteria 970
1934 Ga0495607_0019400 3300046501 Bacteria 4321
1935 Ga0495606_0000060 3300046507 Bacteria 185907
1936 Ga0495606_0005310 3300046507 Bacteria 12405
1937 Ga0495606_0007870 3300046507 Bacteria 9409
1938 Ga0495606_0008278 3300046507 Bacteria 9073
1939 Ga0495606_0010821 3300046507 Bacteria 7517
1940 Ga0495606_0012435 3300046507 Bacteria 6824
1941 Ga0495606_0015097 3300046507 Bacteria 5976
1942 Ga0495606_0019551 3300046507 Bacteria 5033
1943 Ga0495606_0146448 3300046507 Bacteria 1390
1944 Ga0495606_0236465 3300046507 Bacteria 1021
1945 Ga0495606_0283612 3300046507 Bacteria 904
1946 Ga0495606_0305221 3300046507 Bacteria 861
1947 Ga0495606_0349118 3300046507 Bacteria 786
1948 Ga0495610_0000001 3300046512 Bacteria 1620061
1949 Ga0495610_0000129 3300046512 Bacteria 83051
1950 Ga0495610_0000751 3300046512 Bacteria 30621
1951 Ga0495610_0010933 3300046512 Bacteria 5595
1952 Ga0495610_0212732 3300046512 Bacteria 785
1953 Ga0495616_0002278 3300046513 Bacteria 12835
1954 Ga0495616_0015198 3300046513 Bacteria 4283
1955 Ga0495616_0048996 3300046513 Bacteria 2120
1956 Ga0495628_0036237 3300046516 Bacteria 3961
1957 Ga0495630_0009753 3300046517 Bacteria 6909
1958 Ga0495630_0271656 3300046517 Bacteria 1295
1959 Ga0495630_0525445 3300046517 Bacteria 907
1960 Ga0495631_0001037 3300046518 Bacteria 17230
1961 Ga0495632_0006333 3300046519 Bacteria 7635
1962 Ga0495632_0023088 3300046519 Bacteria 3326
1963 Ga0495637_0037979 3300046520 Bacteria 2087
1964 Ga0495637_0103205 3300046520 Bacteria 1112
1965 Ga0495643_0001228 3300046522 Bacteria 24728
1966 Ga0495643_0029852 3300046522 Bacteria 3048
1967 Ga0495643_0036553 3300046522 Bacteria 2697
1968 Ga0495643_0179942 3300046522 Bacteria 1028
1969 Ga0495644_0025559 3300046523 Bacteria 2241
1970 Ga0495648_0028735 3300046524 Bacteria 3699
1971 Ga0495648_0049191 3300046524 Bacteria 2587
1972 Ga0495648_0270039 3300046524 Bacteria 811
1973 Ga0495663_0022702 3300046525 Bacteria 1814
1974 Ga0495652_0082964 3300046529 Bacteria 2640
1975 Ga0495652_0135024 3300046529 Bacteria 1948
1976 Ga0495652_0393988 3300046529 Bacteria 982
1977 Ga0495652_0448466 3300046529 Bacteria 904
1978 Ga0495654_0000008 3300046530 Bacteria 398340
1979 Ga0495654_0038042 3300046530 Bacteria 2408
1980 Ga0495665_0063343 3300046531 Bacteria 1952
1981 Ga0495640_0509779 3300046533 Bacteria 732
1982 Ga0495586_0145714 3300046535 Bacteria 1331
1983 Ga0495587_0076902 3300046536 Bacteria 1938
1984 Ga0495587_0100675 3300046536 Bacteria 1665
1985 Ga0495609_0000010 3300046538 Bacteria 342605
1986 Ga0495609_0004430 3300046538 Bacteria 7680
1987 Ga0495609_0229356 3300046538 Bacteria 769
1988 Ga0495621_0005942 3300046539 Bacteria 3539
1989 Ga0495645_0159267 3300046543 Unclassified 1562
1990 Ga0495645_0175310 3300046543 Bacteria 1473
1991 Ga0495645_0222231 3300046543 Unclassified 1270
1992 Ga0495622_0235103 3300046557 Bacteria 809
1993 Ga0495633_0000015 3300046558 Bacteria 254484
1994 Ga0495633_0000022 3300046558 Bacteria 226582
1995 Ga0495633_0000048 3300046558 Bacteria 158166
1996 Ga0495633_0004451 3300046558 Bacteria 8910
1997 Ga0495633_0028326 3300046558 Bacteria 2731
1998 Ga0495633_0055623 3300046558 Bacteria 1860
1999 Ga0495667_0138005 3300046559 Bacteria 1572
2000 Ga0495668_0000041 3300046616 Bacteria 229462
2001 Ga0495668_0000450 3300046616 Bacteria 52543
2002 Ga0495668_0007476 3300046616 Bacteria 6979
2003 Ga0495634_0097952 3300046642 Bacteria 1898
2004 Ga0495611_0000081 3300046648 Bacteria 67738
2005 Ga0495625_0000191 3300046660 Bacteria 97363
2006 Ga0495625_0000658 3300046660 Bacteria 49342
2007 Ga0495625_0000663 3300046660 Bacteria 49012
2008 Ga0495625_0001074 3300046660 Bacteria 35469
2009 Ga0495625_0006807 3300046660 Bacteria 10099
2010 Ga0495625_0029048 3300046660 Bacteria 4139
2011 Ga0495625_0079686 3300046660 Bacteria 2282
2012 Ga0495625_0096985 3300046660 Bacteria 2030
2013 Ga0495625_0392327 3300046660 Bacteria 869
2014 Ga0495635_0103291 3300046663 Bacteria 1948
2015 Ga0495635_0104939 3300046663 Bacteria 1931
2016 Ga0495635_0338009 3300046663 Bacteria 1006
2017 Ga0495661_0002833 3300046665 Bacteria 13136
2018 Ga0495661_0033411 3300046665 Bacteria 3245
2019 Ga0495661_0037338 3300046665 Bacteria 3033
2020 Ga0495661_0127439 3300046665 Bacteria 1399
2021 Ga0495657_0198631 3300046675 Unclassified 1223
2022 Ga0495657_0309318 3300046675 Unclassified 941
2023 Ga0495599_0100263 3300046678 Bacteria 1805
2024 Ga0495599_0336117 3300046678 Bacteria 907
2025 Ga0495646_0275509 3300046680 Unclassified 895
2026 Ga0495647_0184799 3300046681 Bacteria 908
2027 Ga0495658_0043692 3300046683 Bacteria 2508
2028 Ga0495658_0686817 3300046683 Bacteria 656
2029 Ga0495613_0176951 3300046689 Bacteria 1512
2030 Ga0495670_0160267 3300046691 Bacteria 1182
2031 Ga0495671_0043742 3300046692 Bacteria 2248
2032 Ga0495671_0140426 3300046692 Bacteria 1177
2033 Ga0495649_0000061 3300046694 Bacteria 97338
2034 Ga0495649_0037573 3300046694 Bacteria 2658
2035 Ga0495600_0120542 3300046809 Bacteria 1706
2036 Ga0495600_0158095 3300046809 Bacteria 1466
2037 Ga0495600_0384766 3300046809 Bacteria 875
2038 Ga0495660_0079019 3300046810 Bacteria 1728
2039 Ga0495660_0208354 3300046810 Bacteria 929
2040 Ga0495581_0143346 3300047315 Bacteria 1394
2041 Ga0495604_0179769 3300047317 Bacteria 1480
2042 Ga0495636_0000120 3300047318 Bacteria 32516
2043 Ga0495674_0007992 3300047319 Bacteria 10097
2044 Ga0495674_1040074 3300047319 Bacteria 626
2045 Ga0495672_0062440 3300047320 Bacteria 2143
2046 Ga0495672_0070782 3300047320 Bacteria 1975
2047 Ga0495672_0092225 3300047320 Bacteria 1661
2048 Ga0495672_0175787 3300047320 Bacteria 1088
2049 Ga0495680_0548700 3300047322 Bacteria 779
2050 Ga0495683_0135397 3300047323 Bacteria 1158
2051 Ga0495687_000111 3300047443 Bacteria 124789
2052 Ga0495687_000570 3300047443 Bacteria 43484
2053 Ga0495687_076973 3300047443 Bacteria 1319
2054 Ga0495679_149270 3300047446 Bacteria 628
2055 Ga0495673_0127905 3300047469 Bacteria 1000
2056 Ga0495681_0079380 3300047470 Bacteria 1468
2057 Ga0495681_0085739 3300047470 Bacteria 1398
2058 Ga0495684_0216518 3300047471 Bacteria 1406
2059 Ga0495684_0232368 3300047471 Bacteria 1348
2060 Ga0495686_0000153 3300047472 Bacteria 133256
2061 Ga0495686_0000679 3300047472 Bacteria 46024
2062 Ga0495686_0000814 3300047472 Bacteria 40340
2063 Ga0495686_0001267 3300047472 Bacteria 28612
2064 Ga0495686_0002403 3300047472 Bacteria 17773
2065 Ga0495686_0004393 3300047472 Bacteria 11617
2066 Ga0495686_0010589 3300047472 Bacteria 6552
2067 Ga0495686_0039814 3300047472 Bacteria 3000
2068 Ga0495686_0063465 3300047472 Bacteria 2289
2069 Ga0495686_0067978 3300047472 Bacteria 2199
2070 Ga0495614_0041660 3300048089 Bacteria 1970
2071 Ga0496101_0122505 3300048904 Bacteria 1967
2072 Ga0496101_0140617 3300048904 Bacteria 1839
2073 Ga0496102_0208922 3300048905 Bacteria 1840
2074 Ga0496104_0336392 3300048907 Bacteria 1423
2075 Ga0496104_0469985 3300048907 Bacteria 1169
2076 Ga0496104_0894844 3300048907 Bacteria 793
2077 Ga0496105_0878551 3300048908 Bacteria 677
2078 Ga0496108_0188934 3300048911 Bacteria 1785
2079 Ga0496109_0081073 3300048912 Bacteria 2990
2080 Ga0496113_0042077 3300048916 Bacteria 3374
2081 Ga0496114_0284563 3300048917 Unclassified 1458
2082 Ga0496115_0017845 3300048918 Bacteria 5435
2083 Ga0496115_0069085 3300048918 Unclassified 2861
2084 Ga0496115_0090011 3300048918 Bacteria 2507
2085 Ga0496116_0000002 3300048919 Bacteria 920291
2086 Ga0496116_0000037 3300048919 Bacteria 374675
2087 Ga0496116_0003271 3300048919 Bacteria 16146
2088 Ga0496117_0000086 3300048920 Bacteria 212331
2089 Ga0496117_0016565 3300048920 Bacteria 6213
2090 Ga0496117_0019589 3300048920 Bacteria 5551
2091 Ga0496118_0000284 3300048921 Bacteria 88966
2092 Ga0496118_0015601 3300048921 Bacteria 7021
2093 Ga0496118_0062036 3300048921 Bacteria 2763
2094 Ga0496119_0000037 3300048922 Bacteria 210912
2095 Ga0496121_0000010 3300048924 Bacteria 793488
2096 Ga0496121_0059518 3300048924 Bacteria 3149
2097 Ga0496121_0173955 3300048924 Bacteria 1561
2098 Ga0496122_0000510 3300048925 Bacteria 80239
2099 Ga0496122_0000602 3300048925 Bacteria 73995
2100 Ga0496122_0003771 3300048925 Bacteria 19539
2101 Ga0496122_0007262 3300048925 Bacteria 12391
2102 Ga0496122_0010569 3300048925 Bacteria 9484
2103 Ga0496122_0010847 3300048925 Bacteria 9329
2104 Ga0496123_0000777 3300048926 Bacteria 51679
2105 Ga0496123_0012209 3300048926 Bacteria 7349
2106 Ga0496123_0015571 3300048926 Bacteria 6228
2107 Ga0496123_0111608 3300048926 Bacteria 1561
2108 Ga0496123_0217810 3300048926 Bacteria 965
2109 Ga0496124_0000555 3300048927 Bacteria 63173
2110 Ga0496124_0059442 3300048927 Bacteria 3211
2111 Ga0496124_0104665 3300048927 Bacteria 2288
2112 Ga0496124_0265281 3300048927 Bacteria 1261
2113 Ga0496125_0000007 3300048928 Bacteria 715355
2114 Ga0496125_0001191 3300048928 Bacteria 39316
2115 Ga0496125_0012355 3300048928 Bacteria 8484
2116 Ga0496125_0023772 3300048928 Bacteria 5650
2117 Ga0496126_0014044 3300048929 Bacteria 8116
2118 Ga0496126_0260108 3300048929 Bacteria 1443
2119 Ga0496126_0361089 3300048929 Bacteria 1186
2120 Ga0496126_0932411 3300048929 Bacteria 656
2121 Ga0496126_0979859 3300048929 Bacteria 636
2122 Ga0501306_016509 3300049127 Bacteria 993
2123 Ga0501306_060827 3300049127 Bacteria 622
2124 Ga0501310_000397 3300049130 Bacteria 3910
2125 Ga0501310_020575 3300049130 Bacteria 820
2126 Ga0495678_001603 3300049459 Bacteria 17329
2127 Ga0501293_006139 3300049516 Bacteria 975
2128 Ga0501296_004159 3300049519 Bacteria 1568
2129 Ga0501298_000566 3300049521 Bacteria 5052
2130 Ga0501312_016462 3300049528 Bacteria 1058
2131 Ga0501312_023742 3300049528 Bacteria 925
2132 Ga0501315_008253 3300049531 Unclassified 1207
2133 Ga0501315_028574 3300049531 Bacteria 792
2134 Ga0501318_009437 3300049534 Bacteria 1064
2135 Ga0501320_004484 3300049536 Bacteria 1234
2136 Ga0501323_000400 3300049539 Bacteria 3139
2137 Ga0501326_01091 3300049542 Bacteria 1213
2138 Ga0501334_00454 3300049550 Bacteria 1862
2139 Ga0501335_000402 3300049551 Bacteria 2698
2140 Ga0501031_0002327 3300049568 Bacteria 12029
2141 Ga0501031_0009099 3300049568 Bacteria 6459
2142 Ga0501031_0488940 3300049568 Bacteria 794
2143 Ga0501032_0014411 3300049569 Bacteria 5601
2144 Ga0501032_0048663 3300049569 Bacteria 2862
2145 Ga0501032_0056634 3300049569 Bacteria 2635
2146 Ga0501032_0236355 3300049569 Bacteria 1187
2147 Ga0501032_0281799 3300049569 Bacteria 1076
2148 Ga0501033_0000177 3300049570 Bacteria 60638
2149 Ga0501033_0103350 3300049570 Bacteria 2078
2150 Ga0501033_0124616 3300049570 Bacteria 1868
2151 Ga0501033_0216136 3300049570 Bacteria 1366
2152 Ga0501033_0273342 3300049570 Bacteria 1194
2153 Ga0501033_0377875 3300049570 Bacteria 990
2154 Ga0501033_0379602 3300049570 Bacteria 987
2155 Ga0501034_0001113 3300049571 Bacteria 37706
2156 Ga0501034_0005253 3300049571 Bacteria 14211
2157 Ga0501034_0013642 3300049571 Bacteria 8357
2158 Ga0501034_0015442 3300049571 Bacteria 7848
2159 Ga0501034_0020269 3300049571 Bacteria 6790
2160 Ga0501034_0027034 3300049571 Bacteria 5837
2161 Ga0501034_0060677 3300049571 Bacteria 3799
2162 Ga0501034_0061142 3300049571 Bacteria 3783
2163 Ga0501034_0061167 3300049571 Bacteria 3783
2164 Ga0501034_0099843 3300049571 Bacteria 2897
2165 Ga0501034_0531315 3300049571 Bacteria 1087
2166 Ga0501036_0006209 3300049572 Bacteria 9691
2167 Ga0501036_0016492 3300049572 Bacteria 6170
2168 Ga0501036_0097202 3300049572 Bacteria 2489
2169 Ga0501036_0120563 3300049572 Bacteria 2215
2170 Ga0501036_0399441 3300049572 Bacteria 1147
2171 Ga0501036_1086233 3300049572 Bacteria 654
2172 Ga0501037_0001831 3300049573 Bacteria 15439
2173 Ga0501037_0004853 3300049573 Bacteria 9785
2174 Ga0501037_0306977 3300049573 Bacteria 1101
2175 Ga0501037_0326900 3300049573 Bacteria 1061
2176 Ga0501037_0474374 3300049573 Bacteria 851
2177 Ga0501037_0598521 3300049573 Bacteria 740
2178 Ga0501038_0001009 3300049574 Bacteria 25368
2179 Ga0501038_0001508 3300049574 Bacteria 21425
2180 Ga0501038_0654700 3300049574 Bacteria 790
2181 Ga0501038_0731242 3300049574 Bacteria 739
2182 Ga0501038_0866201 3300049574 Bacteria 668
2183 Ga0501039_0005741 3300049575 Bacteria 9396
2184 Ga0501039_0035767 3300049575 Bacteria 3833
2185 Ga0501039_0178165 3300049575 Bacteria 1672
2186 Ga0501039_0260028 3300049575 Bacteria 1364
2187 Ga0501039_0595217 3300049575 Bacteria 867
2188 Ga0501040_0617597 3300049576 Bacteria 783
2189 Ga0501043_0009797 3300049579 Bacteria 7509
2190 Ga0501043_0024595 3300049579 Bacteria 4726
2191 Ga0501043_0028625 3300049579 Bacteria 4373
2192 Ga0501043_0061349 3300049579 Bacteria 2953
2193 Ga0501043_0172490 3300049579 Bacteria 1687
2194 Ga0501043_0264602 3300049579 Bacteria 1322
2195 Ga0501043_0350288 3300049579 Bacteria 1122
2196 Ga0501043_0405258 3300049579 Bacteria 1030
2197 Ga0501043_0564246 3300049579 Bacteria 844
2198 Ga0501046_0016440 3300049580 Bacteria 6197
2199 Ga0501046_0033598 3300049580 Bacteria 4143
2200 Ga0501046_0071196 3300049580 Bacteria 2702
2201 Ga0501047_0007339 3300049581 Bacteria 10367
2202 Ga0501047_0024945 3300049581 Bacteria 5742
2203 Ga0501047_0038433 3300049581 Bacteria 4631
2204 Ga0501047_0336590 3300049581 Bacteria 1347
2205 Ga0501047_0354548 3300049581 Bacteria 1303
2206 Ga0501047_0587808 3300049581 Bacteria 936
2207 Ga0501047_0659541 3300049581 Bacteria 865
2208 Ga0501048_0057429 3300049582 Bacteria 2760
2209 Ga0501048_0067880 3300049582 Bacteria 2520
2210 Ga0501067_0037965 3300049583 Bacteria 2675
2211 Ga0501068_0106012 3300049584 Bacteria 1745
2212 Ga0501069_0454030 3300049585 Bacteria 762
2213 Ga0501070_0006655 3300049586 Bacteria 9840
2214 Ga0501070_0092025 3300049586 Bacteria 2510
2215 Ga0501070_0566422 3300049586 Bacteria 908
2216 Ga0501071_0882190 3300049587 Bacteria 690
2217 Ga0501072_0135423 3300049588 Bacteria 1964
2218 Ga0501072_0389952 3300049588 Bacteria 1105
2219 Ga0501073_0012461 3300049589 Bacteria 6203
2220 Ga0501073_0023024 3300049589 Bacteria 4479
2221 Ga0501073_0537582 3300049589 Bacteria 808
2222 Ga0501074_0014422 3300049590 Bacteria 5750
2223 Ga0501074_0781221 3300049590 Bacteria 673
2224 Ga0501077_0060765 3300049593 Bacteria 2398
2225 Ga0501198_000191 3300049649 Bacteria 7998
2226 Ga0501199_015638 3300049650 Unclassified 850
2227 Ga0501201_000983 3300049651 Bacteria 2673
2228 Ga0501206_007136 3300049653 Bacteria 1463
2229 Ga0501207_000190 3300049654 Bacteria 5967
2230 Ga0501207_007355 3300049654 Bacteria 1569
2231 Ga0501216_034448 3300049660 Bacteria 948
2232 Ga0501217_000087 3300049661 Bacteria 11212
2233 Ga0501217_031297 3300049661 Bacteria 1310
2234 Ga0501217_090193 3300049661 Bacteria 860
2235 Ga0501217_124824 3300049661 Bacteria 750
2236 Ga0501222_000205 3300049662 Bacteria 10436
2237 Ga0501223_000686 3300049663 Bacteria 8085
2238 Ga0501224_000474 3300049664 Bacteria 4851
2239 Ga0501233_000952 3300049668 Bacteria 4913
2240 Ga0501235_000089 3300049669 Bacteria 14364
2241 Ga0501235_066447 3300049669 Bacteria 849
2242 Ga0501240_000271 3300049673 Unclassified 3952
2243 Ga0501242_001187 3300049674 Bacteria 2561
2244 Ga0501242_004651 3300049674 Bacteria 1528
2245 Ga0501242_004998 3300049674 Bacteria 1481
2246 Ga0501243_051497 3300049675 Bacteria 744
2247 Ga0501249_000002 3300049679 Bacteria 262756
2248 Ga0501249_046323 3300049679 Bacteria 994
2249 Ga0501251_000852 3300049681 Bacteria 2798
2250 Ga0501252_000130 3300049682 Bacteria 4451
2251 Ga0501253_031513 3300049683 Bacteria 1014
2252 Ga0501257_000642 3300049686 Bacteria 6950
2253 Ga0501257_003166 3300049686 Bacteria 3509
2254 Ga0501257_027388 3300049686 Bacteria 1364
2255 Ga0501259_000111 3300049688 Bacteria 11954
2256 Ga0501259_000789 3300049688 Bacteria 5179
2257 Ga0501259_029405 3300049688 Bacteria 1028
2258 Ga0501219_000023 3300049703 Bacteria 24183
2259 Ga0501221_000552 3300049704 Bacteria 5959
2260 Ga0501225_0000583 3300049705 Bacteria 11406
2261 Ga0501225_0007442 3300049705 Bacteria 3171
2262 Ga0501234_004154 3300049707 Bacteria 2272
2263 Ga0501234_043429 3300049707 Bacteria 739
2264 Ga0501245_000239 3300049708 Bacteria 6262
2265 Ga0501245_008558 3300049708 Bacteria 1459
2266 Ga0501079_0243970 3300049741 Bacteria 1404
2267 Ga0501079_0326028 3300049741 Bacteria 1202
2268 Ga0501080_0163066 3300049742 Bacteria 2058
2269 Ga0501080_0460096 3300049742 Bacteria 1140
2270 Ga0501083_0027046 3300049744 Bacteria 3960
2271 Ga0501083_0050340 3300049744 Bacteria 2804
2272 Ga0501232_002052 3300049757 Bacteria 1701
2273 Ga0501232_009287 3300049757 Bacteria 1083
2274 Ga0501241_000009 3300049758 Bacteria 128695
2275 Ga0501241_000352 3300049758 Bacteria 10089
2276 Ga0501241_001323 3300049758 Bacteria 5122
2277 Ga0501241_002356 3300049758 Bacteria 3657
2278 Ga0501264_000545 3300049761 Bacteria 5487
2279 Ga0501266_000003 3300049763 Bacteria 388836
2280 Ga0501266_009069 3300049763 Bacteria 1256
2281 Ga0501266_032317 3300049763 Bacteria 751
2282 Ga0501269_000025 3300049766 Bacteria 51990
2283 Ga0501271_027955 3300049768 Bacteria 684
2284 Ga0501274_008827 3300049771 Bacteria 910
2285 Ga0501279_000767 3300049775 Bacteria 4194
2286 Ga0501280_017092 3300049776 Unclassified 1052
2287 Ga0501035_0004426 3300049822 Bacteria 13337
2288 Ga0501035_0007199 3300049822 Bacteria 10413
2289 Ga0501035_0034824 3300049822 Bacteria 4574
2290 Ga0501035_0048821 3300049822 Bacteria 3794
2291 Ga0501035_0106460 3300049822 Bacteria 2459
2292 Ga0501035_0119752 3300049822 Bacteria 2302
2293 Ga0501035_0149328 3300049822 Bacteria 2029
2294 Ga0501035_0299844 3300049822 Unclassified 1354
2295 Ga0501035_0425936 3300049822 Bacteria 1101
2296 Ga0501035_0574427 3300049822 Bacteria 921
2297 Ga0501035_0617595 3300049822 Bacteria 882
2298 Ga0501035_0752170 3300049822 Bacteria 782
2299 Ga0501044_0000936 3300049823 Bacteria 35057
2300 Ga0501044_0001663 3300049823 Bacteria 26095
2301 Ga0501044_0014681 3300049823 Bacteria 8445
2302 Ga0501044_0058900 3300049823 Bacteria 3937
2303 Ga0501044_0091834 3300049823 Bacteria 3062
2304 Ga0501044_0138045 3300049823 Bacteria 2428
2305 Ga0501044_0175548 3300049823 Bacteria 2112
2306 Ga0501044_0183719 3300049823 Bacteria 2057
2307 Ga0501044_0219503 3300049823 Bacteria 1852
2308 Ga0501044_0359143 3300049823 Bacteria 1375
2309 Ga0501044_0993245 3300049823 Bacteria 711
2310 Ga0501045_0000546 3300049824 Bacteria 23550
2311 Ga0501212_006134 3300049851 Bacteria 1612
2312 Ga0501284_00005 3300050005 Bacteria 164758
2313 nmdc:mga0k408_111223_c1 3300050493 Bacteria 1619
2314 nmdc:mga0k408_130686_c1 3300050493 Bacteria 1491
2315 nmdc:mga0k408_16125_c1 3300050493 Bacteria 4141
2316 nmdc:mga0k408_162162_c1 3300050493 Bacteria 1332
2317 nmdc:mga0k408_224888_c1 3300050493 Bacteria 1120
2318 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
2319 nmdc:mga0k408_3587_c1 3300050493 Bacteria 4175
2320 nmdc:mga0k408_37276_c1 3300050493 Bacteria 2791
2321 nmdc:mga0k408_39970_c1 3300050493 Bacteria 2697
2322 nmdc:mga0k408_43630_c1 3300050493 Bacteria 2585
2323 nmdc:mga0k408_550371_c1 3300050493 Bacteria 682
2324 nmdc:mga0k408_99046_c1 3300050493 Bacteria 1718
2325 nmdc:mga07m45_255654_c1 3300050496 Bacteria 1019
2326 nmdc:mga07m45_334242_c1 3300050496 Bacteria 880
2327 nmdc:mga05p37_21235_c1 3300050507 Bacteria 7859
2328 nmdc:mga05p37_3495_c1 3300050507 Bacteria 6617
2329 nmdc:mga09592_22359_c1 3300050508 Bacteria 5217
2330 nmdc:mga09592_700781_c1 3300050508 Bacteria 862
2331 nmdc:mga09592_75040_c1 3300050508 Unclassified 2875
2332 nmdc:mga09592_8712_c1 3300050508 Bacteria 4176
2333 nmdc:mga0qj67_40177_c1 3300050509 Bacteria 3676
2334 nmdc:mga0qj67_60383_c1 3300050509 Bacteria 3009
2335 nmdc:mga0qj67_707869_c1 3300050509 Bacteria 801
2336 nmdc:mga06r32_104053_c1 3300050510 Unclassified 2788
2337 nmdc:mga06r32_2553_c1 3300050510 Bacteria 16294
2338 nmdc:mga08y16_17449_c1 3300050511 Bacteria 7560
2339 nmdc:mga08y16_859584_c1 3300050511 Bacteria 896
2340 nmdc:mga0rr50_1085048_c1 3300050513 Bacteria 681
2341 Ga0500635_0000960 3300053080 Bacteria 6937
2342 Ga0500578_0000296 3300053086 Bacteria 61614
2343 Ga0500578_0032528 3300053086 Bacteria 3352
2344 Ga0500578_0036797 3300053086 Bacteria 3143
2345 Ga0500644_0000078 3300053088 Bacteria 59447
2346 Ga0500644_0023826 3300053088 Bacteria 1864
2347 Ga0500644_0034365 3300053088 Bacteria 1635
2348 Ga0500644_0198449 3300053088 Bacteria 829
2349 Ga0500646_0003362 3300053090 Bacteria 4108
2350 Ga0500646_0004612 3300053090 Bacteria 3484
2351 Ga0500646_0022790 3300053090 Bacteria 1676
2352 Ga0500583_0000037 3300053092 Bacteria 92466
2353 Ga0500583_0007678 3300053092 Bacteria 3813
2354 Ga0500583_0023418 3300053092 Bacteria 2602
2355 Ga0500651_0000058 3300053093 Bacteria 72493
2356 Ga0500651_0453431 3300053093 Bacteria 713
2357 Ga0500641_0000004 3300053096 Bacteria 263911
2358 Ga0500641_0000938 3300053096 Bacteria 10414
2359 Ga0500641_0002627 3300053096 Bacteria 6343
2360 Ga0500641_0008564 3300053096 Bacteria 3654
2361 Ga0500556_0098588 3300053104 Bacteria 1123
2362 Ga0500562_000032 3300053108 Bacteria 89989
2363 Ga0500562_066068 3300053108 Bacteria 974
2364 Ga0500594_0002597 3300053118 Bacteria 3923
2365 Ga0500594_0028218 3300053118 Bacteria 1459
2366 Ga0500608_000440 3300053122 Bacteria 15676
2367 Ga0500608_008805 3300053122 Bacteria 4259
2368 Ga0500608_179524 3300053122 Bacteria 898
2369 Ga0500618_000016 3300053125 Bacteria 164049
2370 Ga0500618_003572 3300053125 Bacteria 5282
2371 Ga0500642_0037921 3300053130 Bacteria 2063
2372 Ga0500652_028632 3300053131 Bacteria 2166
2373 Ga0500652_240349 3300053131 Bacteria 721
2374 Ga0500658_0000001 3300053134 Bacteria 592738
2375 Ga0500559_0003696 3300053136 Bacteria 7461
2376 Ga0500559_0011550 3300053136 Bacteria 3772
2377 Ga0500559_0020330 3300053136 Bacteria 2807
2378 Ga0500559_0217904 3300053136 Bacteria 900
2379 Ga0500568_0000863 3300053139 Bacteria 21288
2380 Ga0500568_0014441 3300053139 Bacteria 3566
2381 Ga0500568_0067353 3300053139 Bacteria 1376
2382 Ga0500573_0046715 3300053140 Bacteria 2495
2383 Ga0500573_0148601 3300053140 Bacteria 1285
2384 Ga0500573_0205607 3300053140 Bacteria 1042
2385 Ga0500577_0002230 3300053142 Bacteria 4948
2386 Ga0500579_064005 3300053143 Bacteria 2165
2387 Ga0500589_036506 3300053147 Bacteria 2296
2388 Ga0500590_021799 3300053148 Bacteria 3324
2389 Ga0500604_0004030 3300053151 Bacteria 3916
2390 Ga0500604_0007966 3300053151 Bacteria 2811
2391 Ga0500616_0000043 3300053153 Bacteria 342930
2392 Ga0500616_0000626 3300053153 Bacteria 42914
2393 Ga0500616_0021217 3300053153 Bacteria 3645
2394 Ga0500616_0032837 3300053153 Bacteria 2836
2395 Ga0500616_0078234 3300053153 Bacteria 1668
2396 Ga0500616_0092920 3300053153 Bacteria 1490
2397 Ga0500616_0203952 3300053153 Unclassified 874
2398 Ga0500622_0000163 3300053156 Bacteria 70679
2399 Ga0500622_0000445 3300053156 Bacteria 39381
2400 Ga0500622_0000497 3300053156 Bacteria 36689
2401 Ga0500622_0000895 3300053156 Bacteria 25374
2402 Ga0500622_0002148 3300053156 Bacteria 14636
2403 Ga0500622_0003011 3300053156 Bacteria 11645
2404 Ga0500622_0010132 3300053156 Bacteria 5187
2405 Ga0500622_0027221 3300053156 Bacteria 3014
2406 Ga0500634_0035232 3300053161 Bacteria 2726
2407 Ga0500639_044139 3300053163 Bacteria 2335
2408 Ga0500584_086703 3300053726 Bacteria 1325
2409 Ga0500611_000010 3300053727 Bacteria 165151
2410 Ga0500611_015812 3300053727 Bacteria 1344
2411 Ga0500645_006207 3300053730 Bacteria 4291
2412 Ga0500645_062800 3300053730 Bacteria 1072
2413 Ga0500645_070193 3300053730 Bacteria 1006
2414 Ga0501084_0063164 3300054114 Bacteria 3100
2415 Ga0501084_0129485 3300054114 Bacteria 2124
2416 Ga0500661_012401 3300055283 Bacteria 1539
2417 Ga0590075_041606 3300059424 Bacteria 1175
2418 Ga0587070_008071 3300059491 Bacteria 1480
2419 Ga0587073_0031616 3300059492 Bacteria 1097
2420 Ga0587073_0048996 3300059492 Bacteria 951
2421 Ga0587077_009557 3300059493 Bacteria 1476
2422 Ga0587072_003871 3300059643 Bacteria 2135
2423 Ga0587072_107808 3300059643 Bacteria 632
2424 Ga0501082_0191797 3300060353 Bacteria 1777
2425 Ga0501082_0313107 3300060353 Bacteria 1367
2426 Ga0466962_0033835 3300061719 Bacteria 2446
2427 Ga0466962_0055092 3300061719 Bacteria 1900
2428 Ga0466962_0166310 3300061719 Bacteria 1073
2429 Ga0466962_0308030 3300061719 Bacteria 784

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10338490 Ga0207645_103384901 161
2 3300026095 Ga0207676_10333640 Ga0207676_103336402 163
3 3300026095 Ga0207676_11166839 Ga0207676_111668392 168
4 3300025926 Ga0207659_10294147 Ga0207659_102941472 169
5 3300035111 Ga0373923_0072096 Ga0373923_0072096_32_643 171
6 iso_pu_bacteria 2890804823 2890807092 171
7 3300003320 rootH2_10065769 rootH2_1006576912 172
8 3300025913 Ga0207695_10141539 Ga0207695_101415392 172
9 3300037471 Ga0395905_1561161 Ga0395905_1561161_16_534 172
10 3300044684 Ga0466966_0814272 Ga0466966_0814272_10_528 172
11 3300049572 Ga0501036_1086233 Ga0501036_1086233_118_636 172
12 3300049707 Ga0501234_043429 Ga0501234_043429_18_536 172
13 3300004800 Ga0058861_12064659 Ga0058861_120646591 175
14 3300005328 Ga0070676_10118050 Ga0070676_101180502 175
15 3300005329 Ga0070683_100004195 Ga0070683_10000419514 175
16 3300005331 Ga0070670_100032121 Ga0070670_1000321216 175
17 3300005334 Ga0068869_100003465 Ga0068869_1000034657 175
18 3300005336 Ga0070680_100003171 Ga0070680_1000031719 175
19 3300005337 Ga0070682_100002730 Ga0070682_10000273010 175
20 3300005340 Ga0070689_100018290 Ga0070689_1000182904 175
21 3300005354 Ga0070675_100020128 Ga0070675_1000201286 175
22 3300005365 Ga0070688_100011021 Ga0070688_1000110213 175
23 3300005366 Ga0070659_100128914 Ga0070659_1001289141 175
24 3300005530 Ga0070679_100003340 Ga0070679_10000334013 175
25 3300005539 Ga0068853_100090035 Ga0068853_1000900353 175
26 3300005547 Ga0070693_100002183 Ga0070693_1000021833 175
27 3300005563 Ga0068855_100008055 Ga0068855_1000080552 175
28 3300005578 Ga0068854_100278968 Ga0068854_1002789681 175
29 3300006195 Ga0075366_10174730 Ga0075366_101747302 175
30 3300013297 Ga0157378_10031841 Ga0157378_100318413 175
31 3300013297 Ga0157378_10082867 Ga0157378_100828674 175
32 3300025298 Ga0209050_1004236 Ga0209050_10042366 175
33 3300025911 Ga0207654_10003414 Ga0207654_100034145 175
34 3300025912 Ga0207707_10000879 Ga0207707_1000087911 175
35 3300025913 Ga0207695_10017291 Ga0207695_100172912 175
36 3300025917 Ga0207660_10004200 Ga0207660_100042008 175
37 3300025921 Ga0207652_10000397 Ga0207652_1000039726 175
38 3300025925 Ga0207650_10008768 Ga0207650_100087686 175
39 3300025932 Ga0207690_10591956 Ga0207690_105919562 175
40 3300025935 Ga0207709_10044433 Ga0207709_100444333 175
41 3300025940 Ga0207691_10019062 Ga0207691_100190624 175
42 3300025945 Ga0207679_10005671 Ga0207679_100056713 175
43 3300025949 Ga0207667_10031223 Ga0207667_100312233 175
44 3300025981 Ga0207640_10207922 Ga0207640_102079221 175
45 3300025981 Ga0207640_11034883 Ga0207640_110348832 175
46 3300026041 Ga0207639_10050655 Ga0207639_100506553 175
47 3300026041 Ga0207639_10138781 Ga0207639_101387813 175
48 3300026095 Ga0207676_10005339 Ga0207676_100053396 175
49 3300031456 Ga0307513_10027085 Ga0307513_100270852 175
50 3300031548 Ga0307408_100000396 Ga0307408_10000039628 175
51 3300041459 Ga0451800_0346636 Ga0451800_0346636_83_727 175
52 3300041486 Ga0451807_2642789 Ga0451807_2642789_46_573 175
53 3300044712 Ga0453684_0347938 Ga0453684_0347938_154_696 175
54 3300046454 Ga0495592_0641360 Ga0495592_0641360_52_579 175
55 3300046460 Ga0495638_0000026 Ga0495638_0000026_160652_161179 175
56 3300046475 Ga0495639_0059898 Ga0495639_0059898_1204_1731 175
57 3300046517 Ga0495630_0271656 Ga0495630_0271656_621_1148 175
58 3300046522 Ga0495643_0029852 Ga0495643_0029852_736_1263 175
59 3300046559 Ga0495667_0138005 Ga0495667_0138005_894_1421 175
60 3300046683 Ga0495658_0043692 Ga0495658_0043692_1790_2317 175
61 3300046689 Ga0495613_0176951 Ga0495613_0176951_18_545 175
62 3300046809 Ga0495600_0158095 Ga0495600_0158095_789_1316 175
63 3300047315 Ga0495581_0143346 Ga0495581_0143346_445_972 175
64 3300047319 Ga0495674_0007992 Ga0495674_0007992_8941_9468 175
65 3300047319 Ga0495674_1040074 Ga0495674_1040074_84_611 175
66 3300047472 Ga0495686_0000814 Ga0495686_0000814_4732_5262 175
67 3300048907 Ga0496104_0336392 Ga0496104_0336392_713_1240 175
68 3300048918 Ga0496115_0069085 Ga0496115_0069085_2278_2805 175
69 3300049127 Ga0501306_016509 Ga0501306_016509_301_828 175
70 3300049571 Ga0501034_0060677 Ga0501034_0060677_2391_2918 175
71 3300049573 Ga0501037_0474374 Ga0501037_0474374_298_825 175
72 3300049573 Ga0501037_0598521 Ga0501037_0598521_164_691 175
73 3300049574 Ga0501038_0866201 Ga0501038_0866201_88_615 175
74 3300049575 Ga0501039_0595217 Ga0501039_0595217_316_843 175
75 3300049742 Ga0501080_0163066 Ga0501080_0163066_18_545 175
76 3300049823 Ga0501044_0058900 Ga0501044_0058900_2213_2740 175
77 3300049823 Ga0501044_0091834 Ga0501044_0091834_567_1094 175
78 3300049823 Ga0501044_0183719 Ga0501044_0183719_1341_1868 175
79 3300053153 Ga0500616_0000043 Ga0500616_0000043_264028_264555 175
80 iso_pu_bacteria 2842903701 2842904800 175
81 3300013102 Ga0157371_10103661 Ga0157371_101036611 176
82 3300013307 Ga0157372_10075017 Ga0157372_100750172 176
83 3300025981 Ga0207640_10062503 Ga0207640_100625033 176
84 3300046471 Ga0495650_0015637 Ga0495650_0015637_694_1224 176
85 3300049758 Ga0501241_000352 Ga0501241_000352_6345_6914 176
86 iso_pu_bacteria 2522125168 2522549159 176
87 iso_pu_bacteria 2599185184 2599481426 176
88 iso_pu_bacteria 2721755487 2722731098 176
89 iso_pu_bacteria 2738541283 2738756033 176
90 iso_pu_bacteria 2738541284 2738763343 176
91 iso_pu_bacteria 2738543023 2739304125 176
92 iso_pu_bacteria 2775506987 2776616052 176
93 iso_pu_bacteria 2842722452 2842726577 176
94 iso_pu_bacteria 2842909656 2842911421 176
95 iso_pu_bacteria 2849281842 2849284233 176
96 iso_pu_bacteria 2852627209 2852630703 176
97 iso_pu_bacteria 2857627736 2857627838 176
98 iso_pu_bacteria 2890737413 2890738856 176
99 iso_pu_bacteria 2895498888 2895503148 176
100 iso_pu_bacteria 2896317667 2896320613 176
101 iso_pu_bacteria 2896344016 2896345414 176
102 iso_pu_bacteria 2898713307 2898714498 176
103 iso_pu_bacteria 2902048731 2902050051 176
104 iso_pu_bacteria 2904445276 2904449000 176
105 iso_pu_bacteria 2904780799 2904783372 176
106 iso_pu_bacteria 2910245624 2910246235 176
107 iso_pu_bacteria 2919177583 2919181238 176
108 iso_pu_bacteria 2919186247 2919190660 176
109 iso_pu_bacteria 2919437846 2919443053 176
110 iso_pu_bacteria 2928078545 2928083279 176
111 iso_pu_bacteria 2928147474 2928152741 176
112 iso_pu_bacteria 2932082852 2932088297 176
113 iso_pu_bacteria 2939664404 2939669130 176
114 iso_pu_bacteria 2945997725 2946003122 176
115 iso_pu_bacteria 2977232053 2977234020 176
116 iso_pu_bacteria 3003233435 3003235832 176
117 iso_pu_bacteria 8055588893 8055592067 176
118 3300003322 rootL2_10090698 rootL2_100906983 177
119 3300003781 Ga0055536_1001873 Ga0055536_10018737 177
120 3300005262 Ga0065165_1000176 Ga0065165_100017691 177
121 3300005333 Ga0070677_10261785 Ga0070677_102617852 177
122 3300005985 Ga0081539_10080981 Ga0081539_100809814 177
123 3300013100 Ga0157373_10346860 Ga0157373_103468602 177
124 3300013100 Ga0157373_10425790 Ga0157373_104257902 177
125 3300013104 Ga0157370_10133974 Ga0157370_101339742 177
126 3300013104 Ga0157370_10381385 Ga0157370_103813852 177
127 3300014326 Ga0157380_10000001 Ga0157380_1000000161 177
128 3300025292 Ga0209676_1000485 Ga0209676_100048563 177
129 3300025298 Ga0209050_1035857 Ga0209050_10358572 177
130 3300025960 Ga0207651_10134162 Ga0207651_101341623 177
131 3300031548 Ga0307408_100246079 Ga0307408_1002460792 177
132 3300031731 Ga0307405_10038785 Ga0307405_100387853 177
133 3300031911 Ga0307412_10019593 Ga0307412_100195934 177
134 3300032004 Ga0307414_10009577 Ga0307414_100095773 177
135 3300032004 Ga0307414_10686721 Ga0307414_106867211 177
136 3300042007 Ga0439449_0085494 Ga0439449_0085494_318_860 177
137 3300042876 Ga0451577_0053556 Ga0451577_0053556_1704_2258 177
138 3300042876 Ga0451577_0060837 Ga0451577_0060837_2422_2976 177
139 3300042876 Ga0451577_0066316 Ga0451577_0066316_1016_1570 177
140 3300042876 Ga0451577_0721496 Ga0451577_0721496_341_892 177
141 3300044673 Ga0453683_0326952 Ga0453683_0326952_113_667 177
142 3300044712 Ga0453684_0020859 Ga0453684_0020859_2273_2824 177
143 3300044712 Ga0453684_0027713 Ga0453684_0027713_2593_3147 177
144 3300044712 Ga0453684_0287279 Ga0453684_0287279_399_935 177
145 3300044712 Ga0453684_0554813 Ga0453684_0554813_489_1034 177
146 3300044712 Ga0453684_0933906 Ga0453684_0933906_133_669 177
147 3300045051 Ga0451576_1205851 Ga0451576_1205851_134_673 177
148 3300049528 Ga0501312_016462 Ga0501312_016462_464_1006 177
149 3300049534 Ga0501318_009437 Ga0501318_009437_128_670 177
150 3300049581 Ga0501047_0587808 Ga0501047_0587808_310_855 177
151 3300049661 Ga0501217_090193 Ga0501217_090193_71_613 177
152 3300050493 nmdc:mga0k408_550371_c1 nmdc:mga0k408_550371_c1_70_612 177
153 3300059493 Ga0587077_009557 Ga0587077_009557_233_775 177
154 3300059643 Ga0587072_107808 Ga0587072_107808_77_619 177
155 iso_pu_bacteria 2511231000 2511233959 177
156 iso_pu_bacteria 2513020052 2513235015 177
157 iso_pu_bacteria 2519899754 2520880647 177
158 iso_pu_bacteria 2523533629 2524005741 177
159 iso_pu_bacteria 2582581278 2585142437 177
160 iso_pu_bacteria 2582581281 2585156969 177
161 iso_pu_bacteria 2582581282 2585161488 177
162 iso_pu_bacteria 2582581873 2585426648 177
163 iso_pu_bacteria 2585428045 2587681192 177
164 iso_pu_bacteria 2585428061 2587753617 177
165 iso_pu_bacteria 2585428095 2587868472 177
166 iso_pu_bacteria 2585428115 2587942506 177
167 iso_pu_bacteria 2585428182 2588211763 177
168 iso_pu_bacteria 2585428183 2588216574 177
169 iso_pu_bacteria 2585428184 2588220650 177
170 iso_pu_bacteria 2585428185 2588225939 177
171 iso_pu_bacteria 2585428187 2588230998 177
172 iso_pu_bacteria 2588253712 2588447844 177
173 iso_pu_bacteria 2588254255 2590603596 177
174 iso_pu_bacteria 2588254257 2590610488 177
175 iso_pu_bacteria 2643221600 2644011948 177
176 iso_pu_bacteria 2643221667 2644371441 177
177 iso_pu_bacteria 2643221716 2644641228 177
178 iso_pu_bacteria 2643221725 2644682639 177
179 iso_pu_bacteria 2728369107 2729202474 177
180 iso_pu_bacteria 2738541279 2738733735 177
181 iso_pu_bacteria 2738541285 2738766308 177
182 iso_pu_bacteria 2738543007 2739215316 177
183 iso_pu_bacteria 2739367857 2740000184 177
184 iso_pu_bacteria 2739367858 2740005000 177
185 iso_pu_bacteria 2739367866 2740034235 177
186 iso_pu_bacteria 2739367874 2740060713 177
187 iso_pu_bacteria 2751185877 2753674960 177
188 iso_pu_bacteria 2765235839 2765575981 177
189 iso_pu_bacteria 2772190705 2772607405 177
190 iso_pu_bacteria 2775506739 2775674074 177
191 iso_pu_bacteria 2802428842 2802651418 177
192 iso_pu_bacteria 2816332188 2816875683 177
193 iso_pu_bacteria 2816332280 2817414292 177
194 iso_pu_bacteria 2818991442 2819571928 177
195 iso_pu_bacteria 2818991460 2819677700 177
196 iso_pu_bacteria 2821136567 2821141828 177
197 iso_pu_bacteria 2839989709 2839991747 177
198 iso_pu_bacteria 2842083920 2842087840 177
199 iso_pu_bacteria 2857618242 2857621559 177
200 iso_pu_bacteria 2871720351 2871724765 177
201 iso_pu_bacteria 2883068021 2883070479 177
202 iso_pu_bacteria 2884791551 2884797642 177
203 iso_pu_bacteria 2889290771 2889293527 177
204 iso_pu_bacteria 2896085136 2896087338 177
205 iso_pu_bacteria 2896109856 2896114665 177
206 iso_pu_bacteria 2903895155 2903895378 177
207 iso_pu_bacteria 2904419702 2904420208 177
208 iso_pu_bacteria 2904467357 2904469757 177
209 iso_pu_bacteria 2905999023 2906002084 177
210 iso_pu_bacteria 2911138879 2911139687 177
211 iso_pu_bacteria 2919097161 2919099970 177
212 iso_pu_bacteria 2919191525 2919192577 177
213 iso_pu_bacteria 2919399522 2919403487 177
214 iso_pu_bacteria 2919683626 2919684018 177
215 iso_pu_bacteria 2929150217 2929151453 177
216 iso_pu_bacteria 2929177148 2929183308 177
217 iso_pu_bacteria 2929239360 2929245425 177
218 iso_pu_bacteria 2945924605 2945928650 177
219 iso_pu_bacteria 2945977869 2945979268 177
220 iso_pu_bacteria 2946013367 2946014861 177
221 iso_pu_bacteria 2946019816 2946019909 177
222 iso_pu_bacteria 2958458903 2958459716 177
223 iso_pu_bacteria 2965320100 2965321468 177
224 iso_pu_bacteria 2977243572 2977247486 177
225 iso_pu_bacteria 2977268062 2977268157 177
226 iso_pu_bacteria 2984572630 2984574730 177
227 iso_pu_bacteria 2984606641 2984608181 177
228 iso_pu_bacteria 2993372514 2993374814 177
229 iso_pu_bacteria 2993480792 2993481671 177
230 iso_pu_bacteria 8036736890 8036739081 177
231 iso_pu_bacteria 8054307821 8054309325 177
232 iso_pu_bacteria 8056440228 8056444345 177
233 3300003323 rootH1_10285744 rootH1_102857443 178
234 3300005547 Ga0070693_100011221 Ga0070693_1000112212 178
235 3300005834 Ga0068851_10000057 Ga0068851_100000574 178
236 3300009093 Ga0105240_10034174 Ga0105240_100341747 178
237 3300009174 Ga0105241_10385563 Ga0105241_103855632 178
238 3300009553 Ga0105249_10917024 Ga0105249_109170242 178
239 3300020078 Ga0206352_10047560 Ga0206352_100475601 178
240 3300025321 Ga0207656_10000048 Ga0207656_1000004845 178
241 3300025913 Ga0207695_10019165 Ga0207695_100191653 178
242 3300028573 Ga0265334_10035864 Ga0265334_100358642 178
243 3300031251 Ga0265327_10204609 Ga0265327_102046092 178
244 3300035118 Ga0373954_0128311 Ga0373954_0128311_13_579 178
245 3300036401 Ga0373937_0429953 Ga0373937_0429953_425_991 178
246 3300041509 Ga0451843_0885776 Ga0451843_0885776_138_683 178
247 3300042876 Ga0451577_0000435 Ga0451577_0000435_66016_66567 178
248 3300044712 Ga0453684_0640325 Ga0453684_0640325_585_1136 178
249 3300046472 Ga0495580_0076904 Ga0495580_0076904_829_1395 178
250 3300046517 Ga0495630_0525445 Ga0495630_0525445_191_757 178
251 3300046529 Ga0495652_0082964 Ga0495652_0082964_160_726 178
252 3300046531 Ga0495665_0063343 Ga0495665_0063343_937_1503 178
253 3300046536 Ga0495587_0100675 Ga0495587_0100675_1058_1624 178
254 3300046543 Ga0495645_0222231 Ga0495645_0222231_591_1157 178
255 3300046642 Ga0495634_0097952 Ga0495634_0097952_93_659 178
256 3300046663 Ga0495635_0338009 Ga0495635_0338009_192_758 178
257 3300046675 Ga0495657_0198631 Ga0495657_0198631_82_648 178
258 3300046681 Ga0495647_0184799 Ga0495647_0184799_203_769 178
259 3300048918 Ga0496115_0017845 Ga0496115_0017845_4623_5183 178
260 iso_pu_bacteria 2738541278 2738726102 178
261 iso_pu_bacteria 2818991444 2819590373 178
262 iso_pu_bacteria 2881955468 2881956888 178
263 iso_pu_bacteria 2929154850 2929158430 178
264 2162886007 SwRhRL2b_contig_1903953 SwRhRL2b_0997.00005810 179
265 2162886007 SwRhRL2b_contig_3060273 SwRhRL2b_0339.00003170 179
266 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00002190 179
267 3300001915 JGI24741J21665_1002825 JGI24741J21665_10028255 179
268 3300002739 JGI25158J39367_1002825 JGI25158J39367_10028253 179
269 3300003316 rootH1_10103591 rootH1_101035914 179
270 3300003322 rootL2_10066925 rootL2_100669253 179
271 3300003322 rootL2_10080370 rootL2_100803705 179
272 3300003322 rootL2_10151186 rootL2_101511863 179
273 3300003323 rootH1_10073633 rootH1_1007363313 179
274 3300003354 JGI25160J50197_1015845 JGI25160J50197_10158453 179
275 3300003578 Ga0006562J51391_1020675 Ga0006562J51391_10206753 179
276 3300003761 Ga0055535_1002568 Ga0055535_10025685 179
277 3300003794 Ga0055531_10000132 Ga0055531_1000013272 179
278 3300005262 Ga0065165_1015200 Ga0065165_10152001 179
279 3300005288 Ga0065714_10064700 Ga0065714_1006470018 179
280 3300005289 Ga0065704_10002179 Ga0065704_100021797 179
281 3300005289 Ga0065704_10070133 Ga0065704_10070133270 179
282 3300005289 Ga0065704_10071020 Ga0065704_1007102013 179
283 3300005289 Ga0065704_10075908 Ga0065704_100759086 179
284 3300005289 Ga0065704_10076736 Ga0065704_100767365 179
285 3300005290 Ga0065712_10027666 Ga0065712_100276661 179
286 3300005293 Ga0065715_10023059 Ga0065715_100230592 179
287 3300005327 Ga0070658_10153214 Ga0070658_101532141 179
288 3300005327 Ga0070658_10705034 Ga0070658_107050342 179
289 3300005329 Ga0070683_100002523 Ga0070683_1000025235 179
290 3300005330 Ga0070690_100224632 Ga0070690_1002246321 179
291 3300005331 Ga0070670_100050803 Ga0070670_1000508033 179
292 3300005331 Ga0070670_101236346 Ga0070670_1012363461 179
293 3300005333 Ga0070677_10005742 Ga0070677_100057422 179
294 3300005334 Ga0068869_100078657 Ga0068869_1000786573 179
295 3300005335 Ga0070666_10000019 Ga0070666_10000019158 179
296 3300005335 Ga0070666_10145450 Ga0070666_101454502 179
297 3300005337 Ga0070682_100000095 Ga0070682_10000009560 179
298 3300005337 Ga0070682_100000129 Ga0070682_10000012919 179
299 3300005337 Ga0070682_100063227 Ga0070682_1000632273 179
300 3300005338 Ga0068868_100001431 Ga0068868_10000143111 179
301 3300005338 Ga0068868_100053298 Ga0068868_1000532983 179
302 3300005339 Ga0070660_100402992 Ga0070660_1004029921 179
303 3300005347 Ga0070668_100097190 Ga0070668_1000971903 179
304 3300005347 Ga0070668_100217507 Ga0070668_1002175072 179
305 3300005347 Ga0070668_101172613 Ga0070668_1011726131 179
306 3300005354 Ga0070675_100066778 Ga0070675_1000667783 179
307 3300005355 Ga0070671_100025759 Ga0070671_1000257595 179
308 3300005356 Ga0070674_100366262 Ga0070674_1003662622 179
309 3300005364 Ga0070673_100100579 Ga0070673_1001005792 179
310 3300005365 Ga0070688_100079543 Ga0070688_1000795432 179
311 3300005366 Ga0070659_100154497 Ga0070659_1001544973 179
312 3300005367 Ga0070667_100001113 Ga0070667_10000111316 179
313 3300005367 Ga0070667_100044905 Ga0070667_1000449053 179
314 3300005435 Ga0070714_100994029 Ga0070714_1009940292 179
315 3300005436 Ga0070713_100221337 Ga0070713_1002213372 179
316 3300005456 Ga0070678_101065528 Ga0070678_1010655281 179
317 3300005535 Ga0070684_100041511 Ga0070684_1000415114 179
318 3300005539 Ga0068853_100010281 Ga0068853_1000102812 179
319 3300005543 Ga0070672_100932625 Ga0070672_1009326251 179
320 3300005544 Ga0070686_100098075 Ga0070686_1000980752 179
321 3300005544 Ga0070686_100126760 Ga0070686_1001267603 179
322 3300005548 Ga0070665_100004249 Ga0070665_1000042495 179
323 3300005549 Ga0070704_100245233 Ga0070704_1002452332 179
324 3300005578 Ga0068854_100043813 Ga0068854_1000438133 179
325 3300005616 Ga0068852_100026817 Ga0068852_1000268173 179
326 3300005616 Ga0068852_100543670 Ga0068852_1005436702 179
327 3300005616 Ga0068852_100603445 Ga0068852_1006034452 179
328 3300005617 Ga0068859_100000013 Ga0068859_100000013193 179
329 3300005617 Ga0068859_100008566 Ga0068859_1000085669 179
330 3300005617 Ga0068859_100053516 Ga0068859_1000535163 179
331 3300005834 Ga0068851_10017757 Ga0068851_100177573 179
332 3300005840 Ga0068870_10140803 Ga0068870_101408032 179
333 3300005841 Ga0068863_100027191 Ga0068863_1000271911 179
334 3300005841 Ga0068863_100101854 Ga0068863_1001018543 179
335 3300005842 Ga0068858_100001874 Ga0068858_1000018748 179
336 3300005843 Ga0068860_100007595 Ga0068860_1000075955 179
337 3300005843 Ga0068860_100041513 Ga0068860_1000415133 179
338 3300006237 Ga0097621_100004099 Ga0097621_1000040993 179
339 3300006358 Ga0068871_100008389 Ga0068871_1000083898 179
340 3300006358 Ga0068871_100105404 Ga0068871_1001054043 179
341 3300006358 Ga0068871_100166398 Ga0068871_1001663982 179
342 3300006358 Ga0068871_100985295 Ga0068871_1009852952 179
343 3300006881 Ga0068865_100514893 Ga0068865_1005148932 179
344 3300006931 Ga0097620_100000013 Ga0097620_100000013193 179
345 3300006931 Ga0097620_100008566 Ga0097620_1000085669 179
346 3300006931 Ga0097620_100053513 Ga0097620_1000535133 179
347 3300009036 Ga0105244_10000018 Ga0105244_1000001884 179
348 3300009093 Ga0105240_10000066 Ga0105240_1000006617 179
349 3300009093 Ga0105240_10067640 Ga0105240_100676401 179
350 3300009101 Ga0105247_10011080 Ga0105247_100110802 179
351 3300009148 Ga0105243_10000291 Ga0105243_1000029148 179
352 3300009174 Ga0105241_10001659 Ga0105241_1000165918 179
353 3300009174 Ga0105241_10222885 Ga0105241_102228853 179
354 3300009176 Ga0105242_11419701 Ga0105242_114197011 179
355 3300009545 Ga0105237_10002029 Ga0105237_1000202916 179
356 3300009545 Ga0105237_10038111 Ga0105237_100381112 179
357 3300009553 Ga0105249_10000679 Ga0105249_1000067929 179
358 3300010375 Ga0105239_10005050 Ga0105239_100050506 179
359 3300010375 Ga0105239_10104571 Ga0105239_101045712 179
360 3300011119 Ga0105246_11153912 Ga0105246_111539121 179
361 3300013100 Ga0157373_10000006 Ga0157373_10000006181 179
362 3300013100 Ga0157373_10233057 Ga0157373_102330571 179
363 3300013102 Ga0157371_10000012 Ga0157371_1000001258 179
364 3300013104 Ga0157370_10005025 Ga0157370_100050256 179
365 3300013104 Ga0157370_10017086 Ga0157370_100170867 179
366 3300013104 Ga0157370_10033304 Ga0157370_100333043 179
367 3300013104 Ga0157370_10347811 Ga0157370_103478112 179
368 3300013104 Ga0157370_10399089 Ga0157370_103990892 179
369 3300013104 Ga0157370_10972975 Ga0157370_109729751 179
370 3300013105 Ga0157369_10011241 Ga0157369_100112419 179
371 3300013105 Ga0157369_10358771 Ga0157369_103587712 179
372 3300013296 Ga0157374_10660037 Ga0157374_106600371 179
373 3300013297 Ga0157378_10039720 Ga0157378_100397202 179
374 3300013297 Ga0157378_10113383 Ga0157378_101133833 179
375 3300013306 Ga0163162_10000595 Ga0163162_1000059529 179
376 3300013306 Ga0163162_10180794 Ga0163162_101807943 179
377 3300013307 Ga0157372_10246590 Ga0157372_102465902 179
378 3300013308 Ga0157375_10002275 Ga0157375_100022757 179
379 3300013308 Ga0157375_10031734 Ga0157375_100317343 179
380 3300013308 Ga0157375_10103606 Ga0157375_101036063 179
381 3300013308 Ga0157375_10586198 Ga0157375_105861981 179
382 3300014325 Ga0163163_10040541 Ga0163163_100405418 179
383 3300014326 Ga0157380_10182724 Ga0157380_101827243 179
384 3300014326 Ga0157380_10670829 Ga0157380_106708291 179
385 3300014497 Ga0182008_10000003 Ga0182008_10000003357 179
386 3300014968 Ga0157379_10041268 Ga0157379_100412682 179
387 3300014969 Ga0157376_10004780 Ga0157376_1000478010 179
388 3300015261 Ga0182006_1000079 Ga0182006_100007954 179
389 3300015262 Ga0182007_10044795 Ga0182007_100447952 179
390 3300017792 Ga0163161_10000620 Ga0163161_1000062022 179
391 3300017792 Ga0163161_10033557 Ga0163161_100335573 179
392 3300017792 Ga0163161_10167837 Ga0163161_101678372 179
393 3300017792 Ga0163161_10303103 Ga0163161_103031031 179
394 3300020070 Ga0206356_11317094 Ga0206356_113170941 179
395 3300025208 Ga0209436_101429 Ga0209436_1014295 179
396 3300025242 Ga0209258_100075 Ga0209258_10007580 179
397 3300025254 Ga0209148_1000085 Ga0209148_1000085149 179
398 3300025284 Ga0209130_1001019 Ga0209130_100101919 179
399 3300025291 Ga0209675_1000051 Ga0209675_1000051207 179
400 3300025297 Ga0209758_1054772 Ga0209758_10547722 179
401 3300025302 Ga0207426_1000057 Ga0207426_100005745 179
402 3300025304 Ga0209257_1000004 Ga0209257_10000041084 179
403 3300025315 Ga0207697_10037974 Ga0207697_100379742 179
404 3300025893 Ga0207682_10072351 Ga0207682_100723512 179
405 3300025893 Ga0207682_10195013 Ga0207682_101950132 179
406 3300025903 Ga0207680_10000586 Ga0207680_100005863 179
407 3300025904 Ga0207647_10004528 Ga0207647_100045283 179
408 3300025908 Ga0207643_10012600 Ga0207643_100126003 179
409 3300025909 Ga0207705_10077075 Ga0207705_100770753 179
410 3300025911 Ga0207654_10000850 Ga0207654_1000085010 179
411 3300025911 Ga0207654_10180065 Ga0207654_101800652 179
412 3300025913 Ga0207695_10000078 Ga0207695_10000078229 179
413 3300025913 Ga0207695_10003021 Ga0207695_1000302117 179
414 3300025914 Ga0207671_10000067 Ga0207671_1000006794 179
415 3300025914 Ga0207671_10000721 Ga0207671_1000072137 179
416 3300025918 Ga0207662_10658034 Ga0207662_106580341 179
417 3300025919 Ga0207657_10503594 Ga0207657_105035941 179
418 3300025925 Ga0207650_10159852 Ga0207650_101598521 179
419 3300025925 Ga0207650_10842335 Ga0207650_108423351 179
420 3300025926 Ga0207659_10042939 Ga0207659_100429393 179
421 3300025928 Ga0207700_10082121 Ga0207700_100821213 179
422 3300025929 Ga0207664_11118504 Ga0207664_111185041 179
423 3300025931 Ga0207644_10256548 Ga0207644_102565482 179
424 3300025931 Ga0207644_10424540 Ga0207644_104245402 179
425 3300025932 Ga0207690_11035165 Ga0207690_110351651 179
426 3300025935 Ga0207709_10000136 Ga0207709_100001362 179
427 3300025938 Ga0207704_10074781 Ga0207704_100747813 179
428 3300025940 Ga0207691_10041966 Ga0207691_100419666 179
429 3300025940 Ga0207691_10287080 Ga0207691_102870801 179
430 3300025942 Ga0207689_10010987 Ga0207689_100109873 179
431 3300025944 Ga0207661_10049072 Ga0207661_100490725 179
432 3300025960 Ga0207651_10019600 Ga0207651_100196003 179
433 3300025972 Ga0207668_10043383 Ga0207668_100433831 179
434 3300025972 Ga0207668_10046047 Ga0207668_100460473 179
435 3300025981 Ga0207640_10033730 Ga0207640_100337303 179
436 3300025986 Ga0207658_10012058 Ga0207658_100120582 179
437 3300025986 Ga0207658_10047300 Ga0207658_100473003 179
438 3300025986 Ga0207658_10463432 Ga0207658_104634322 179
439 3300025986 Ga0207658_11357616 Ga0207658_113576161 179
440 3300026023 Ga0207677_10013878 Ga0207677_100138782 179
441 3300026035 Ga0207703_10002553 Ga0207703_100025539 179
442 3300026041 Ga0207639_10536296 Ga0207639_105362962 179
443 3300026067 Ga0207678_10553281 Ga0207678_105532811 179
444 3300026088 Ga0207641_10001077 Ga0207641_1000107726 179
445 3300026088 Ga0207641_10123066 Ga0207641_101230662 179
446 3300026089 Ga0207648_10105992 Ga0207648_101059922 179
447 3300026089 Ga0207648_10120096 Ga0207648_101200963 179
448 3300026095 Ga0207676_10083329 Ga0207676_100833293 179
449 3300026121 Ga0207683_10090981 Ga0207683_100909814 179
450 3300026121 Ga0207683_10352687 Ga0207683_103526872 179
451 3300028379 Ga0268266_10037873 Ga0268266_100378732 179
452 3300028381 Ga0268264_10039925 Ga0268264_100399253 179
453 3300028381 Ga0268264_10041469 Ga0268264_100414692 179
454 3300028794 Ga0307515_10000001 Ga0307515_100000011398 179
455 3300028794 Ga0307515_10000455 Ga0307515_1000045513 179
456 3300028800 Ga0265338_10533770 Ga0265338_105337701 179
457 3300030731 Ga0316177_1132756 Ga0316177_11327566 179
458 3300030732 Ga0316176_1026201 Ga0316176_102620112 179
459 3300030742 Ga0316183_1098725 Ga0316183_10987252 179
460 3300030744 Ga0316181_1140650 Ga0316181_114065015 179
461 3300031239 Ga0265328_10030464 Ga0265328_100304642 179
462 3300031250 Ga0265331_10043710 Ga0265331_100437103 179
463 3300031251 Ga0265327_10000421 Ga0265327_1000042159 179
464 3300031251 Ga0265327_10006644 Ga0265327_100066444 179
465 3300031251 Ga0265327_10045176 Ga0265327_100451762 179
466 3300031251 Ga0265327_10050283 Ga0265327_100502832 179
467 3300031344 Ga0265316_10428797 Ga0265316_104287972 179
468 3300031344 Ga0265316_10475320 Ga0265316_104753202 179
469 3300031456 Ga0307513_10068088 Ga0307513_100680883 179
470 3300031456 Ga0307513_10180364 Ga0307513_101803642 179
471 3300031616 Ga0307508_10002437 Ga0307508_100024377 179
472 3300031616 Ga0307508_10208287 Ga0307508_102082873 179
473 3300031711 Ga0265314_10050019 Ga0265314_100500194 179
474 3300031730 Ga0307516_10572907 Ga0307516_105729071 179
475 3300031731 Ga0307405_10299761 Ga0307405_102997612 179
476 3300031838 Ga0307518_10343903 Ga0307518_103439032 179
477 3300031911 Ga0307412_10000140 Ga0307412_1000014019 179
478 3300031911 Ga0307412_10001247 Ga0307412_1000124715 179
479 3300031911 Ga0307412_10006832 Ga0307412_100068324 179
480 3300031911 Ga0307412_10204908 Ga0307412_102049083 179
481 3300032002 Ga0307416_100000020 Ga0307416_100000020124 179
482 3300032002 Ga0307416_100876690 Ga0307416_1008766902 179
483 3300032004 Ga0307414_10000049 Ga0307414_10000049113 179
484 3300032004 Ga0307414_10012012 Ga0307414_100120125 179
485 3300032004 Ga0307414_10038827 Ga0307414_100388272 179
486 3300032004 Ga0307414_10107374 Ga0307414_101073743 179
487 3300032004 Ga0307414_10135225 Ga0307414_101352253 179
488 3300032126 Ga0307415_100304068 Ga0307415_1003040681 179
489 3300033179 Ga0307507_10324049 Ga0307507_103240491 179
490 3300037471 Ga0395905_0000051 Ga0395905_0000051_170825_171388 179
491 3300037471 Ga0395905_0105583 Ga0395905_0105583_1866_2429 179
492 3300041404 Ga0439436_0015280 Ga0439436_0015280_504_1067 179
493 3300041413 Ga0439465_0000035 Ga0439465_0000035_22665_23225 179
494 3300041413 Ga0439465_0177782 Ga0439465_0177782_160_723 179
495 3300041507 Ga0451851_1082119 Ga0451851_1082119_101_661 179
496 3300041512 Ga0451853_3794576 Ga0451853_3794576_265_828 179
497 3300041997 Ga0439431_0000062 Ga0439431_0000062_6710_7273 179
498 3300042004 Ga0439445_0000094 Ga0439445_0000094_9719_10279 179
499 3300042004 Ga0439445_0071309 Ga0439445_0071309_96_659 179
500 3300042007 Ga0439449_0043790 Ga0439449_0043790_80_643 179
501 3300042142 Ga0450905_019710 Ga0450905_019710_328_888 179
502 3300042876 Ga0451577_0040651 Ga0451577_0040651_1852_2436 179
503 3300042876 Ga0451577_0179186 Ga0451577_0179186_170_751 179
504 3300044658 Ga0466972_0118434 Ga0466972_0118434_268_831 179
505 3300044673 Ga0453683_0369500 Ga0453683_0369500_86_649 179
506 3300044673 Ga0453683_0510324 Ga0453683_0510324_37_600 179
507 3300044842 Ga0466957_0011877 Ga0466957_0011877_3435_3998 179
508 3300044842 Ga0466957_0243929 Ga0466957_0243929_15_578 179
509 3300045049 Ga0466959_0062184 Ga0466959_0062184_705_1268 179
510 3300045051 Ga0451576_0008374 Ga0451576_0008374_2279_2842 179
511 3300045051 Ga0451576_1370800 Ga0451576_1370800_38_613 179
512 3300045976 Ga0466967_0775127 Ga0466967_0775127_340_903 179
513 3300046453 Ga0495627_000029 Ga0495627_000029_87042_87602 179
514 3300046453 Ga0495627_008565 Ga0495627_008565_1111_1674 179
515 3300046457 Ga0495590_0050540 Ga0495590_0050540_581_1141 179
516 3300046460 Ga0495638_0062938 Ga0495638_0062938_1329_1931 179
517 3300046460 Ga0495638_0148914 Ga0495638_0148914_351_911 179
518 3300046460 Ga0495638_0461381 Ga0495638_0461381_46_606 179
519 3300046471 Ga0495650_0064001 Ga0495650_0064001_736_1299 179
520 3300046471 Ga0495650_0161457 Ga0495650_0161457_163_744 179
521 3300046500 Ga0495596_0000410 Ga0495596_0000410_13717_14277 179
522 3300046507 Ga0495606_0008278 Ga0495606_0008278_7034_7636 179
523 3300046507 Ga0495606_0012435 Ga0495606_0012435_4977_5537 179
524 3300046512 Ga0495610_0000001 Ga0495610_0000001_71899_72459 179
525 3300046519 Ga0495632_0006333 Ga0495632_0006333_6968_7528 179
526 3300046522 Ga0495643_0036553 Ga0495643_0036553_1431_1991 179
527 3300046522 Ga0495643_0179942 Ga0495643_0179942_241_801 179
528 3300046525 Ga0495663_0022702 Ga0495663_0022702_431_1033 179
529 3300046530 Ga0495654_0000008 Ga0495654_0000008_310409_310969 179
530 3300046538 Ga0495609_0000010 Ga0495609_0000010_89696_90256 179
531 3300046558 Ga0495633_0000022 Ga0495633_0000022_77798_78361 179
532 3300046558 Ga0495633_0000048 Ga0495633_0000048_145567_146127 179
533 3300046558 Ga0495633_0028326 Ga0495633_0028326_1996_2556 179
534 3300046616 Ga0495668_0000450 Ga0495668_0000450_37533_38099 179
535 3300046660 Ga0495625_0000658 Ga0495625_0000658_38877_39437 179
536 3300046660 Ga0495625_0096985 Ga0495625_0096985_1414_1995 179
537 3300046809 Ga0495600_0384766 Ga0495600_0384766_127_690 179
538 3300047318 Ga0495636_0000120 Ga0495636_0000120_27515_28078 179
539 3300047320 Ga0495672_0062440 Ga0495672_0062440_1022_1585 179
540 3300047320 Ga0495672_0175787 Ga0495672_0175787_256_816 179
541 3300047472 Ga0495686_0000153 Ga0495686_0000153_78447_79007 179
542 3300047472 Ga0495686_0004393 Ga0495686_0004393_5767_6327 179
543 3300048904 Ga0496101_0122505 Ga0496101_0122505_648_1211 179
544 3300048905 Ga0496102_0208922 Ga0496102_0208922_1004_1564 179
545 3300048916 Ga0496113_0042077 Ga0496113_0042077_2079_2639 179
546 3300048919 Ga0496116_0000037 Ga0496116_0000037_74789_75349 179
547 3300048920 Ga0496117_0000086 Ga0496117_0000086_74675_75235 179
548 3300048921 Ga0496118_0000284 Ga0496118_0000284_13733_14293 179
549 3300048922 Ga0496119_0000037 Ga0496119_0000037_74724_75284 179
550 3300048924 Ga0496121_0000010 Ga0496121_0000010_181892_182455 179
551 3300048924 Ga0496121_0173955 Ga0496121_0173955_200_760 179
552 3300048925 Ga0496122_0000510 Ga0496122_0000510_69427_69987 179
553 3300048925 Ga0496122_0000602 Ga0496122_0000602_39372_39932 179
554 3300048925 Ga0496122_0003771 Ga0496122_0003771_11941_12501 179
555 3300048925 Ga0496122_0010847 Ga0496122_0010847_1089_1649 179
556 3300048926 Ga0496123_0012209 Ga0496123_0012209_1331_1891 179
557 3300048926 Ga0496123_0111608 Ga0496123_0111608_479_1039 179
558 3300048926 Ga0496123_0217810 Ga0496123_0217810_176_736 179
559 3300048927 Ga0496124_0000555 Ga0496124_0000555_33353_33913 179
560 3300048927 Ga0496124_0265281 Ga0496124_0265281_85_645 179
561 3300048928 Ga0496125_0001191 Ga0496125_0001191_20_580 179
562 3300048928 Ga0496125_0012355 Ga0496125_0012355_1089_1649 179
563 3300048928 Ga0496125_0023772 Ga0496125_0023772_503_1063 179
564 3300048929 Ga0496126_0014044 Ga0496126_0014044_1547_2110 179
565 3300049550 Ga0501334_00454 Ga0501334_00454_819_1379 179
566 3300049551 Ga0501335_000402 Ga0501335_000402_536_1096 179
567 3300049568 Ga0501031_0002327 Ga0501031_0002327_9505_10086 179
568 3300049569 Ga0501032_0236355 Ga0501032_0236355_164_745 179
569 3300049570 Ga0501033_0000177 Ga0501033_0000177_40297_40878 179
570 3300049571 Ga0501034_0001113 Ga0501034_0001113_33055_33636 179
571 3300049572 Ga0501036_0097202 Ga0501036_0097202_834_1415 179
572 3300049573 Ga0501037_0001831 Ga0501037_0001831_13568_14149 179
573 3300049574 Ga0501038_0001009 Ga0501038_0001009_20491_21072 179
574 3300049575 Ga0501039_0005741 Ga0501039_0005741_6851_7432 179
575 3300049579 Ga0501043_0028625 Ga0501043_0028625_100_681 179
576 3300049579 Ga0501043_0350288 Ga0501043_0350288_91_657 179
577 3300049586 Ga0501070_0566422 Ga0501070_0566422_194_775 179
578 3300049649 Ga0501198_000191 Ga0501198_000191_4076_4657 179
579 3300049758 Ga0501241_000009 Ga0501241_000009_69715_70275 179
580 3300049758 Ga0501241_001323 Ga0501241_001323_964_1527 179
581 3300049766 Ga0501269_000025 Ga0501269_000025_12929_13489 179
582 3300049822 Ga0501035_0048821 Ga0501035_0048821_1932_2513 179
583 3300049822 Ga0501035_0119752 Ga0501035_0119752_1618_2181 179
584 3300049822 Ga0501035_0617595 Ga0501035_0617595_261_827 179
585 3300049823 Ga0501044_0000936 Ga0501044_0000936_15407_15988 179
586 3300049824 Ga0501045_0000546 Ga0501045_0000546_7593_8174 179
587 3300053088 Ga0500644_0000078 Ga0500644_0000078_6706_7269 179
588 3300053090 Ga0500646_0003362 Ga0500646_0003362_602_1165 179
589 3300053090 Ga0500646_0022790 Ga0500646_0022790_401_982 179
590 3300053092 Ga0500583_0023418 Ga0500583_0023418_1626_2189 179
591 3300053093 Ga0500651_0453431 Ga0500651_0453431_19_582 179
592 3300053122 Ga0500608_179524 Ga0500608_179524_96_659 179
593 3300053136 Ga0500559_0003696 Ga0500559_0003696_1694_2257 179
594 3300053142 Ga0500577_0002230 Ga0500577_0002230_2676_3239 179
595 3300053147 Ga0500589_036506 Ga0500589_036506_913_1476 179
596 3300053148 Ga0500590_021799 Ga0500590_021799_693_1256 179
597 3300053153 Ga0500616_0078234 Ga0500616_0078234_690_1271 179
598 3300053156 Ga0500622_0000497 Ga0500622_0000497_26924_27487 179
599 3300053161 Ga0500634_0035232 Ga0500634_0035232_1583_2146 179
600 3300053730 Ga0500645_070193 Ga0500645_070193_163_726 179
601 2162886007 SwRhRL2b_contig_1257564 SwRhRL2b_0234.00007690 180
602 3300001904 JGI24736J21556_1004496 JGI24736J21556_10044963 180
603 3300001915 JGI24741J21665_1024405 JGI24741J21665_10244052 180
604 3300001979 JGI24740J21852_10012520 JGI24740J21852_100125203 180
605 3300001979 JGI24740J21852_10026629 JGI24740J21852_100266293 180
606 3300001979 JGI24740J21852_10078365 JGI24740J21852_100783651 180
607 3300001989 JGI24739J22299_10031539 JGI24739J22299_100315393 180
608 3300001990 JGI24737J22298_10000060 JGI24737J22298_1000006012 180
609 3300001990 JGI24737J22298_10009666 JGI24737J22298_100096664 180
610 3300001990 JGI24737J22298_10012518 JGI24737J22298_100125183 180
611 3300001991 JGI24743J22301_10019000 JGI24743J22301_100190002 180
612 3300002067 JGI24735J21928_10000032 JGI24735J21928_1000003240 180
613 3300002077 JGI24744J21845_10003750 JGI24744J21845_100037503 180
614 3300002077 JGI24744J21845_10027116 JGI24744J21845_100271162 180
615 3300002459 JGI24751J29686_10003202 JGI24751J29686_100032024 180
616 3300002737 JGI25162J39368_1000162 JGI25162J39368_10001626 180
617 3300002737 JGI25162J39368_1001606 JGI25162J39368_10016066 180
618 3300002741 JGI25157J39369_1010610 JGI25157J39369_10106101 180
619 3300002741 JGI25157J39369_1012391 JGI25157J39369_10123911 180
620 3300002773 JGI25152J39213_1000064 JGI25152J39213_100006443 180
621 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004116 180
622 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002509 180
623 3300003214 JGI25165J46597_1000742 JGI25165J46597_10007426 180
624 3300003215 JGI25153J46596_10000037 JGI25153J46596_10000037119 180
625 3300003316 rootH1_10004943 rootH1_100049439 180
626 3300003316 rootH1_10006747 rootH1_100067471 180
627 3300003316 rootH1_10010867 rootH1_100108674 180
628 3300003316 rootH1_10069796 rootH1_100697966 180
629 3300003316 rootH1_10165346 rootH1_101653461 180
630 3300003320 rootH2_10000933 rootH2_1000093339 180
631 3300003320 rootH2_10009361 rootH2_1000936112 180
632 3300003320 rootH2_10012714 rootH2_1001271436 180
633 3300003320 rootH2_10079618 rootH2_100796182 180
634 3300003320 rootH2_10160238 rootH2_101602381 180
635 3300003320 rootH2_10219384 rootH2_102193842 180
636 3300003320 rootH2_10268171 rootH2_102681712 180
637 3300003322 rootL2_10015405 rootL2_100154052 180
638 3300003322 rootL2_10103511 rootL2_101035113 180
639 3300003322 rootL2_10145978 rootL2_101459783 180
640 3300003322 rootL2_10160394 rootL2_101603947 180
641 3300003322 rootL2_10185688 rootL2_101856882 180
642 3300003323 rootH1_10006156 rootH1_100061562 180
643 3300003323 rootH1_10016727 rootH1_100167273 180
644 3300003323 rootH1_10023472 rootH1_1002347210 180
645 3300003323 rootH1_10027403 rootH1_1002740325 180
646 3300003323 rootH1_10031034 rootH1_100310342 180
647 3300003323 rootH1_10037602 rootH1_100376023 180
648 3300003323 rootH1_10043337 rootH1_100433372 180
649 3300003323 rootH1_10071186 rootH1_100711864 180
650 3300003323 rootH1_10128965 rootH1_101289653 180
651 3300003354 JGI25160J50197_1015521 JGI25160J50197_10155213 180
652 3300003578 Ga0006562J51391_1000057 Ga0006562J51391_10000573 180
653 3300003781 Ga0055536_1000006 Ga0055536_100000680 180
654 3300003791 Ga0055530_10002618 Ga0055530_100026185 180
655 3300004799 Ga0058863_10008894 Ga0058863_100088942 180
656 3300004799 Ga0058863_11905458 Ga0058863_119054583 180
657 3300004800 Ga0058861_11827112 Ga0058861_118271121 180
658 3300004803 Ga0058862_10143705 Ga0058862_101437052 180
659 3300005276 Ga0065717_1003280 Ga0065717_10032803 180
660 3300005288 Ga0065714_10003515 Ga0065714_100035154 180
661 3300005288 Ga0065714_10004799 Ga0065714_100047993 180
662 3300005288 Ga0065714_10005806 Ga0065714_100058065 180
663 3300005288 Ga0065714_10065068 Ga0065714_1006506813 180
664 3300005288 Ga0065714_10065706 Ga0065714_100657067 180
665 3300005288 Ga0065714_10082406 Ga0065714_100824062 180
666 3300005288 Ga0065714_10120004 Ga0065714_101200042 180
667 3300005288 Ga0065714_10214748 Ga0065714_102147481 180
668 3300005289 Ga0065704_10000273 Ga0065704_1000027327 180
669 3300005289 Ga0065704_10072328 Ga0065704_1007232810 180
670 3300005289 Ga0065704_10088760 Ga0065704_100887604 180
671 3300005289 Ga0065704_10173502 Ga0065704_101735022 180
672 3300005289 Ga0065704_10223722 Ga0065704_102237222 180
673 3300005289 Ga0065704_10359680 Ga0065704_103596801 180
674 3300005290 Ga0065712_10001291 Ga0065712_100012914 180
675 3300005290 Ga0065712_10019199 Ga0065712_100191991 180
676 3300005290 Ga0065712_10024964 Ga0065712_100249642 180
677 3300005290 Ga0065712_10193002 Ga0065712_101930021 180
678 3300005290 Ga0065712_10305783 Ga0065712_103057831 180
679 3300005290 Ga0065712_10492629 Ga0065712_104926291 180
680 3300005293 Ga0065715_10227464 Ga0065715_102274641 180
681 3300005293 Ga0065715_10730468 Ga0065715_107304681 180
682 3300005295 Ga0065707_10315368 Ga0065707_103153681 180
683 3300005295 Ga0065707_10487592 Ga0065707_104875921 180
684 3300005327 Ga0070658_10000008 Ga0070658_10000008190 180
685 3300005327 Ga0070658_10009840 Ga0070658_100098402 180
686 3300005327 Ga0070658_10011839 Ga0070658_100118398 180
687 3300005327 Ga0070658_10020757 Ga0070658_100207576 180
688 3300005327 Ga0070658_10029799 Ga0070658_100297993 180
689 3300005327 Ga0070658_10071156 Ga0070658_100711563 180
690 3300005327 Ga0070658_10167994 Ga0070658_101679942 180
691 3300005327 Ga0070658_10177945 Ga0070658_101779452 180
692 3300005327 Ga0070658_10360944 Ga0070658_103609441 180
693 3300005327 Ga0070658_10469365 Ga0070658_104693651 180
694 3300005327 Ga0070658_10747131 Ga0070658_107471311 180
695 3300005327 Ga0070658_11440536 Ga0070658_114405361 180
696 3300005328 Ga0070676_10000113 Ga0070676_1000011319 180
697 3300005328 Ga0070676_10022983 Ga0070676_100229833 180
698 3300005328 Ga0070676_10341084 Ga0070676_103410841 180
699 3300005329 Ga0070683_100010084 Ga0070683_1000100847 180
700 3300005329 Ga0070683_100012101 Ga0070683_10001210110 180
701 3300005329 Ga0070683_100020627 Ga0070683_1000206275 180
702 3300005329 Ga0070683_100049343 Ga0070683_1000493434 180
703 3300005329 Ga0070683_100397444 Ga0070683_1003974442 180
704 3300005329 Ga0070683_100514269 Ga0070683_1005142692 180
705 3300005329 Ga0070683_100555586 Ga0070683_1005555861 180
706 3300005330 Ga0070690_100091134 Ga0070690_1000911342 180
707 3300005331 Ga0070670_100014049 Ga0070670_1000140493 180
708 3300005331 Ga0070670_100067359 Ga0070670_1000673593 180
709 3300005331 Ga0070670_100118749 Ga0070670_1001187491 180
710 3300005331 Ga0070670_100186490 Ga0070670_1001864902 180
711 3300005331 Ga0070670_100198202 Ga0070670_1001982022 180
712 3300005331 Ga0070670_100317224 Ga0070670_1003172242 180
713 3300005331 Ga0070670_100365392 Ga0070670_1003653922 180
714 3300005331 Ga0070670_100417801 Ga0070670_1004178012 180
715 3300005331 Ga0070670_100648887 Ga0070670_1006488871 180
716 3300005331 Ga0070670_100986116 Ga0070670_1009861161 180
717 3300005333 Ga0070677_10006768 Ga0070677_100067684 180
718 3300005333 Ga0070677_10015956 Ga0070677_100159563 180
719 3300005334 Ga0068869_100010132 Ga0068869_1000101323 180
720 3300005334 Ga0068869_100032351 Ga0068869_1000323514 180
721 3300005334 Ga0068869_100039690 Ga0068869_1000396903 180
722 3300005334 Ga0068869_100069457 Ga0068869_1000694573 180
723 3300005334 Ga0068869_100092495 Ga0068869_1000924953 180
724 3300005334 Ga0068869_100149038 Ga0068869_1001490383 180
725 3300005334 Ga0068869_100281411 Ga0068869_1002814111 180
726 3300005334 Ga0068869_100585767 Ga0068869_1005857672 180
727 3300005334 Ga0068869_100705845 Ga0068869_1007058452 180
728 3300005335 Ga0070666_10003803 Ga0070666_100038035 180
729 3300005335 Ga0070666_10052869 Ga0070666_100528693 180
730 3300005335 Ga0070666_10080550 Ga0070666_100805502 180
731 3300005335 Ga0070666_10116028 Ga0070666_101160282 180
732 3300005335 Ga0070666_10178962 Ga0070666_101789622 180
733 3300005335 Ga0070666_10181889 Ga0070666_101818892 180
734 3300005336 Ga0070680_100043596 Ga0070680_1000435962 180
735 3300005336 Ga0070680_100100682 Ga0070680_1001006821 180
736 3300005336 Ga0070680_100114181 Ga0070680_1001141811 180
737 3300005336 Ga0070680_100133367 Ga0070680_1001333671 180
738 3300005336 Ga0070680_100574014 Ga0070680_1005740142 180
739 3300005336 Ga0070680_100751855 Ga0070680_1007518551 180
740 3300005337 Ga0070682_100016072 Ga0070682_1000160724 180
741 3300005337 Ga0070682_100291711 Ga0070682_1002917111 180
742 3300005337 Ga0070682_100823296 Ga0070682_1008232962 180
743 3300005338 Ga0068868_100002147 Ga0068868_10000214714 180
744 3300005338 Ga0068868_100070080 Ga0068868_1000700803 180
745 3300005338 Ga0068868_100104392 Ga0068868_1001043923 180
746 3300005338 Ga0068868_100137570 Ga0068868_1001375702 180
747 3300005338 Ga0068868_100190989 Ga0068868_1001909893 180
748 3300005338 Ga0068868_100239983 Ga0068868_1002399832 180
749 3300005339 Ga0070660_100001175 Ga0070660_1000011753 180
750 3300005339 Ga0070660_100004582 Ga0070660_1000045827 180
751 3300005339 Ga0070660_100018658 Ga0070660_1000186583 180
752 3300005339 Ga0070660_100019439 Ga0070660_1000194392 180
753 3300005339 Ga0070660_100045102 Ga0070660_1000451023 180
754 3300005339 Ga0070660_100077601 Ga0070660_1000776013 180
755 3300005339 Ga0070660_100132009 Ga0070660_1001320091 180
756 3300005339 Ga0070660_100176293 Ga0070660_1001762932 180
757 3300005339 Ga0070660_100186743 Ga0070660_1001867432 180
758 3300005340 Ga0070689_100016917 Ga0070689_1000169175 180
759 3300005340 Ga0070689_100339995 Ga0070689_1003399951 180
760 3300005340 Ga0070689_100381138 Ga0070689_1003811382 180
761 3300005340 Ga0070689_101444142 Ga0070689_1014441421 180
762 3300005341 Ga0070691_10000858 Ga0070691_100008583 180
763 3300005343 Ga0070687_100006837 Ga0070687_1000068373 180
764 3300005343 Ga0070687_100125734 Ga0070687_1001257342 180
765 3300005343 Ga0070687_100145842 Ga0070687_1001458422 180
766 3300005344 Ga0070661_100016255 Ga0070661_10001625510 180
767 3300005344 Ga0070661_100142574 Ga0070661_1001425742 180
768 3300005344 Ga0070661_100199639 Ga0070661_1001996392 180
769 3300005344 Ga0070661_100226284 Ga0070661_1002262842 180
770 3300005347 Ga0070668_100021514 Ga0070668_1000215141 180
771 3300005347 Ga0070668_100084280 Ga0070668_1000842803 180
772 3300005347 Ga0070668_100096705 Ga0070668_1000967052 180
773 3300005347 Ga0070668_100227278 Ga0070668_1002272782 180
774 3300005347 Ga0070668_100231196 Ga0070668_1002311962 180
775 3300005347 Ga0070668_100246320 Ga0070668_1002463202 180
776 3300005347 Ga0070668_100269848 Ga0070668_1002698482 180
777 3300005347 Ga0070668_100695473 Ga0070668_1006954732 180
778 3300005347 Ga0070668_100877013 Ga0070668_1008770131 180
779 3300005347 Ga0070668_100972031 Ga0070668_1009720311 180
780 3300005353 Ga0070669_100081941 Ga0070669_1000819412 180
781 3300005353 Ga0070669_100289171 Ga0070669_1002891712 180
782 3300005353 Ga0070669_100558594 Ga0070669_1005585942 180
783 3300005353 Ga0070669_100622949 Ga0070669_1006229491 180
784 3300005353 Ga0070669_100746761 Ga0070669_1007467612 180
785 3300005354 Ga0070675_100010608 Ga0070675_1000106083 180
786 3300005354 Ga0070675_100016051 Ga0070675_1000160517 180
787 3300005354 Ga0070675_100307702 Ga0070675_1003077022 180
788 3300005354 Ga0070675_100479496 Ga0070675_1004794961 180
789 3300005354 Ga0070675_100791966 Ga0070675_1007919662 180
790 3300005355 Ga0070671_100012313 Ga0070671_1000123134 180
791 3300005355 Ga0070671_100021137 Ga0070671_1000211373 180
792 3300005355 Ga0070671_100040709 Ga0070671_1000407097 180
793 3300005355 Ga0070671_100096203 Ga0070671_1000962033 180
794 3300005355 Ga0070671_100147690 Ga0070671_1001476901 180
795 3300005355 Ga0070671_100163464 Ga0070671_1001634642 180
796 3300005356 Ga0070674_100043751 Ga0070674_1000437512 180
797 3300005356 Ga0070674_100166966 Ga0070674_1001669662 180
798 3300005356 Ga0070674_100505825 Ga0070674_1005058252 180
799 3300005364 Ga0070673_100015990 Ga0070673_1000159902 180
800 3300005364 Ga0070673_100021179 Ga0070673_1000211793 180
801 3300005364 Ga0070673_100024565 Ga0070673_1000245657 180
802 3300005364 Ga0070673_100031579 Ga0070673_1000315794 180
803 3300005364 Ga0070673_100048611 Ga0070673_1000486113 180
804 3300005364 Ga0070673_100050664 Ga0070673_1000506643 180
805 3300005364 Ga0070673_100068025 Ga0070673_1000680253 180
806 3300005364 Ga0070673_100090256 Ga0070673_1000902562 180
807 3300005364 Ga0070673_100138403 Ga0070673_1001384032 180
808 3300005364 Ga0070673_100625436 Ga0070673_1006254362 180
809 3300005365 Ga0070688_100177577 Ga0070688_1001775772 180
810 3300005365 Ga0070688_100300563 Ga0070688_1003005632 180
811 3300005365 Ga0070688_100579283 Ga0070688_1005792832 180
812 3300005366 Ga0070659_100001588 Ga0070659_10000158816 180
813 3300005366 Ga0070659_100001887 Ga0070659_1000018875 180
814 3300005366 Ga0070659_100007352 Ga0070659_1000073525 180
815 3300005366 Ga0070659_100014518 Ga0070659_1000145185 180
816 3300005366 Ga0070659_100020782 Ga0070659_1000207823 180
817 3300005366 Ga0070659_100266422 Ga0070659_1002664222 180
818 3300005366 Ga0070659_100815586 Ga0070659_1008155861 180
819 3300005367 Ga0070667_100008643 Ga0070667_1000086438 180
820 3300005367 Ga0070667_100028980 Ga0070667_1000289805 180
821 3300005367 Ga0070667_100089179 Ga0070667_1000891793 180
822 3300005367 Ga0070667_100442337 Ga0070667_1004423371 180
823 3300005367 Ga0070667_100547520 Ga0070667_1005475201 180
824 3300005367 Ga0070667_101162088 Ga0070667_1011620881 180
825 3300005435 Ga0070714_100213716 Ga0070714_1002137163 180
826 3300005438 Ga0070701_10260746 Ga0070701_102607462 180
827 3300005441 Ga0070700_100205201 Ga0070700_1002052012 180
828 3300005441 Ga0070700_100292407 Ga0070700_1002924072 180
829 3300005441 Ga0070700_100385034 Ga0070700_1003850342 180
830 3300005441 Ga0070700_100653679 Ga0070700_1006536791 180
831 3300005455 Ga0070663_100034247 Ga0070663_1000342471 180
832 3300005455 Ga0070663_100102270 Ga0070663_1001022703 180
833 3300005455 Ga0070663_100290414 Ga0070663_1002904142 180
834 3300005455 Ga0070663_100318360 Ga0070663_1003183602 180
835 3300005455 Ga0070663_101062607 Ga0070663_1010626071 180
836 3300005456 Ga0070678_100041229 Ga0070678_1000412293 180
837 3300005456 Ga0070678_100093082 Ga0070678_1000930823 180
838 3300005456 Ga0070678_100133304 Ga0070678_1001333042 180
839 3300005456 Ga0070678_100145428 Ga0070678_1001454283 180
840 3300005456 Ga0070678_100207846 Ga0070678_1002078462 180
841 3300005457 Ga0070662_100000090 Ga0070662_10000009044 180
842 3300005457 Ga0070662_100013761 Ga0070662_10001376110 180
843 3300005457 Ga0070662_100020595 Ga0070662_1000205952 180
844 3300005457 Ga0070662_100044845 Ga0070662_1000448453 180
845 3300005457 Ga0070662_100469869 Ga0070662_1004698691 180
846 3300005457 Ga0070662_101206930 Ga0070662_1012069301 180
847 3300005458 Ga0070681_10003733 Ga0070681_1000373313 180
848 3300005458 Ga0070681_10262735 Ga0070681_102627351 180
849 3300005458 Ga0070681_10303247 Ga0070681_103032472 180
850 3300005458 Ga0070681_10348262 Ga0070681_103482622 180
851 3300005458 Ga0070681_10360094 Ga0070681_103600942 180
852 3300005458 Ga0070681_10374827 Ga0070681_103748272 180
853 3300005458 Ga0070681_10438147 Ga0070681_104381472 180
854 3300005459 Ga0068867_100003787 Ga0068867_1000037875 180
855 3300005459 Ga0068867_100003995 Ga0068867_10000399510 180
856 3300005459 Ga0068867_100095660 Ga0068867_1000956603 180
857 3300005459 Ga0068867_100122969 Ga0068867_1001229692 180
858 3300005459 Ga0068867_100166696 Ga0068867_1001666962 180
859 3300005459 Ga0068867_100269765 Ga0068867_1002697652 180
860 3300005466 Ga0070685_10009878 Ga0070685_100098785 180
861 3300005466 Ga0070685_10017611 Ga0070685_100176113 180
862 3300005466 Ga0070685_10043331 Ga0070685_100433313 180
863 3300005466 Ga0070685_10101051 Ga0070685_101010511 180
864 3300005466 Ga0070685_10121805 Ga0070685_101218053 180
865 3300005466 Ga0070685_10217088 Ga0070685_102170881 180
866 3300005468 Ga0070707_100094122 Ga0070707_1000941222 180
867 3300005471 Ga0070698_100003913 Ga0070698_10000391314 180
868 3300005471 Ga0070698_100009186 Ga0070698_10000918611 180
869 3300005471 Ga0070698_100018931 Ga0070698_1000189313 180
870 3300005471 Ga0070698_100920352 Ga0070698_1009203521 180
871 3300005518 Ga0070699_100115456 Ga0070699_1001154561 180
872 3300005530 Ga0070679_100001926 Ga0070679_10000192618 180
873 3300005530 Ga0070679_100007785 Ga0070679_10000778511 180
874 3300005530 Ga0070679_100017541 Ga0070679_1000175412 180
875 3300005530 Ga0070679_100019798 Ga0070679_1000197983 180
876 3300005530 Ga0070679_100021230 Ga0070679_1000212304 180
877 3300005530 Ga0070679_100028157 Ga0070679_1000281571 180
878 3300005530 Ga0070679_100075404 Ga0070679_1000754044 180
879 3300005530 Ga0070679_100097806 Ga0070679_1000978064 180
880 3300005530 Ga0070679_100105858 Ga0070679_1001058583 180
881 3300005530 Ga0070679_100318520 Ga0070679_1003185202 180
882 3300005535 Ga0070684_100011020 Ga0070684_1000110209 180
883 3300005535 Ga0070684_100013770 Ga0070684_10001377010 180
884 3300005535 Ga0070684_100068792 Ga0070684_1000687921 180
885 3300005535 Ga0070684_100069096 Ga0070684_1000690963 180
886 3300005535 Ga0070684_100505230 Ga0070684_1005052301 180
887 3300005535 Ga0070684_100768528 Ga0070684_1007685281 180
888 3300005535 Ga0070684_100872473 Ga0070684_1008724731 180
889 3300005539 Ga0068853_100009960 Ga0068853_1000099607 180
890 3300005539 Ga0068853_100015446 Ga0068853_1000154463 180
891 3300005539 Ga0068853_100088553 Ga0068853_1000885533 180
892 3300005539 Ga0068853_100119055 Ga0068853_1001190552 180
893 3300005539 Ga0068853_100137181 Ga0068853_1001371812 180
894 3300005539 Ga0068853_100179102 Ga0068853_1001791022 180
895 3300005539 Ga0068853_100204056 Ga0068853_1002040562 180
896 3300005539 Ga0068853_100338480 Ga0068853_1003384802 180
897 3300005539 Ga0068853_100593340 Ga0068853_1005933401 180
898 3300005543 Ga0070672_100073382 Ga0070672_1000733823 180
899 3300005543 Ga0070672_100082408 Ga0070672_1000824083 180
900 3300005543 Ga0070672_100096604 Ga0070672_1000966043 180
901 3300005543 Ga0070672_100109252 Ga0070672_1001092523 180
902 3300005543 Ga0070672_100276326 Ga0070672_1002763262 180
903 3300005544 Ga0070686_100576897 Ga0070686_1005768971 180
904 3300005547 Ga0070693_100759407 Ga0070693_1007594071 180
905 3300005548 Ga0070665_100000094 Ga0070665_100000094123 180
906 3300005548 Ga0070665_100000118 Ga0070665_100000118102 180
907 3300005548 Ga0070665_100001841 Ga0070665_1000018414 180
908 3300005548 Ga0070665_100005115 Ga0070665_10000511515 180
909 3300005549 Ga0070704_100543283 Ga0070704_1005432832 180
910 3300005563 Ga0068855_100000049 Ga0068855_100000049139 180
911 3300005563 Ga0068855_100000155 Ga0068855_10000015581 180
912 3300005563 Ga0068855_100000399 Ga0068855_10000039937 180
913 3300005563 Ga0068855_100009093 Ga0068855_1000090937 180
914 3300005563 Ga0068855_100032317 Ga0068855_1000323172 180
915 3300005563 Ga0068855_100033231 Ga0068855_1000332317 180
916 3300005563 Ga0068855_100036378 Ga0068855_1000363782 180
917 3300005563 Ga0068855_100036486 Ga0068855_1000364866 180
918 3300005563 Ga0068855_100042488 Ga0068855_1000424883 180
919 3300005563 Ga0068855_100093079 Ga0068855_1000930793 180
920 3300005563 Ga0068855_100095021 Ga0068855_1000950213 180
921 3300005563 Ga0068855_100108103 Ga0068855_1001081033 180
922 3300005563 Ga0068855_100108837 Ga0068855_1001088374 180
923 3300005563 Ga0068855_100148740 Ga0068855_1001487404 180
924 3300005563 Ga0068855_100221428 Ga0068855_1002214283 180
925 3300005563 Ga0068855_100286965 Ga0068855_1002869653 180
926 3300005563 Ga0068855_100525032 Ga0068855_1005250322 180
927 3300005563 Ga0068855_100525660 Ga0068855_1005256602 180
928 3300005563 Ga0068855_100612950 Ga0068855_1006129502 180
929 3300005563 Ga0068855_100643795 Ga0068855_1006437951 180
930 3300005563 Ga0068855_100842384 Ga0068855_1008423842 180
931 3300005563 Ga0068855_100949806 Ga0068855_1009498062 180
932 3300005563 Ga0068855_100965016 Ga0068855_1009650162 180
933 3300005563 Ga0068855_101025487 Ga0068855_1010254872 180
934 3300005563 Ga0068855_101090681 Ga0068855_1010906812 180
935 3300005564 Ga0070664_100001338 Ga0070664_10000133816 180
936 3300005564 Ga0070664_100621700 Ga0070664_1006217002 180
937 3300005564 Ga0070664_100855937 Ga0070664_1008559372 180
938 3300005564 Ga0070664_101124003 Ga0070664_1011240031 180
939 3300005577 Ga0068857_100011099 Ga0068857_1000110994 180
940 3300005577 Ga0068857_100056356 Ga0068857_1000563563 180
941 3300005577 Ga0068857_100069111 Ga0068857_1000691113 180
942 3300005577 Ga0068857_100267425 Ga0068857_1002674252 180
943 3300005577 Ga0068857_100271087 Ga0068857_1002710872 180
944 3300005577 Ga0068857_100440395 Ga0068857_1004403952 180
945 3300005577 Ga0068857_100584212 Ga0068857_1005842122 180
946 3300005577 Ga0068857_100747251 Ga0068857_1007472512 180
947 3300005577 Ga0068857_101162725 Ga0068857_1011627252 180
948 3300005577 Ga0068857_101179859 Ga0068857_1011798591 180
949 3300005578 Ga0068854_100007104 Ga0068854_1000071049 180
950 3300005578 Ga0068854_100042253 Ga0068854_1000422533 180
951 3300005578 Ga0068854_100046812 Ga0068854_1000468123 180
952 3300005578 Ga0068854_100057687 Ga0068854_1000576874 180
953 3300005578 Ga0068854_100369011 Ga0068854_1003690112 180
954 3300005578 Ga0068854_100817929 Ga0068854_1008179291 180
955 3300005578 Ga0068854_101203733 Ga0068854_1012037331 180
956 3300005614 Ga0068856_100006224 Ga0068856_1000062247 180
957 3300005614 Ga0068856_100007465 Ga0068856_1000074657 180
958 3300005614 Ga0068856_100007533 Ga0068856_1000075334 180
959 3300005614 Ga0068856_100009814 Ga0068856_10000981410 180
960 3300005614 Ga0068856_100022984 Ga0068856_1000229849 180
961 3300005614 Ga0068856_100024339 Ga0068856_1000243396 180
962 3300005614 Ga0068856_100287983 Ga0068856_1002879832 180
963 3300005614 Ga0068856_101102393 Ga0068856_1011023932 180
964 3300005615 Ga0070702_100005680 Ga0070702_1000056803 180
965 3300005616 Ga0068852_100001228 Ga0068852_10000122812 180
966 3300005616 Ga0068852_100026284 Ga0068852_1000262842 180
967 3300005616 Ga0068852_100053121 Ga0068852_1000531213 180
968 3300005616 Ga0068852_100057586 Ga0068852_1000575864 180
969 3300005616 Ga0068852_100063330 Ga0068852_1000633302 180
970 3300005616 Ga0068852_100084257 Ga0068852_1000842573 180
971 3300005616 Ga0068852_100116575 Ga0068852_1001165753 180
972 3300005616 Ga0068852_100120650 Ga0068852_1001206503 180
973 3300005616 Ga0068852_100128300 Ga0068852_1001283003 180
974 3300005616 Ga0068852_100132292 Ga0068852_1001322923 180
975 3300005616 Ga0068852_100143114 Ga0068852_1001431143 180
976 3300005616 Ga0068852_100158164 Ga0068852_1001581643 180
977 3300005616 Ga0068852_100176840 Ga0068852_1001768402 180
978 3300005616 Ga0068852_100195518 Ga0068852_1001955183 180
979 3300005616 Ga0068852_100216076 Ga0068852_1002160763 180
980 3300005616 Ga0068852_100309005 Ga0068852_1003090052 180
981 3300005616 Ga0068852_100387014 Ga0068852_1003870141 180
982 3300005616 Ga0068852_100574136 Ga0068852_1005741362 180
983 3300005616 Ga0068852_100604696 Ga0068852_1006046961 180
984 3300005617 Ga0068859_100080265 Ga0068859_1000802654 180
985 3300005617 Ga0068859_100196328 Ga0068859_1001963282 180
986 3300005617 Ga0068859_100214832 Ga0068859_1002148323 180
987 3300005617 Ga0068859_100223524 Ga0068859_1002235243 180
988 3300005617 Ga0068859_100257979 Ga0068859_1002579793 180
989 3300005617 Ga0068859_100276395 Ga0068859_1002763953 180
990 3300005617 Ga0068859_100449695 Ga0068859_1004496952 180
991 3300005617 Ga0068859_100701084 Ga0068859_1007010842 180
992 3300005618 Ga0068864_100011731 Ga0068864_1000117316 180
993 3300005618 Ga0068864_100023442 Ga0068864_1000234424 180
994 3300005618 Ga0068864_100041174 Ga0068864_1000411744 180
995 3300005618 Ga0068864_100086772 Ga0068864_1000867722 180
996 3300005618 Ga0068864_100192173 Ga0068864_1001921733 180
997 3300005618 Ga0068864_100311469 Ga0068864_1003114692 180
998 3300005618 Ga0068864_100387375 Ga0068864_1003873753 180
999 3300005618 Ga0068864_100450567 Ga0068864_1004505672 180
1000 3300005618 Ga0068864_100470739 Ga0068864_1004707392 180
1001 3300005618 Ga0068864_100507264 Ga0068864_1005072642 180
1002 3300005618 Ga0068864_100624195 Ga0068864_1006241952 180
1003 3300005718 Ga0068866_10075801 Ga0068866_100758013 180
1004 3300005718 Ga0068866_10109318 Ga0068866_101093182 180
1005 3300005718 Ga0068866_10651621 Ga0068866_106516211 180
1006 3300005718 Ga0068866_10691838 Ga0068866_106918381 180
1007 3300005719 Ga0068861_100000312 Ga0068861_10000031219 180
1008 3300005719 Ga0068861_100014267 Ga0068861_1000142674 180
1009 3300005719 Ga0068861_100015944 Ga0068861_1000159445 180
1010 3300005719 Ga0068861_100050333 Ga0068861_1000503334 180
1011 3300005719 Ga0068861_100331551 Ga0068861_1003315511 180
1012 3300005834 Ga0068851_10048887 Ga0068851_100488871 180
1013 3300005834 Ga0068851_10074681 Ga0068851_100746813 180
1014 3300005834 Ga0068851_10092462 Ga0068851_100924622 180
1015 3300005834 Ga0068851_10215870 Ga0068851_102158702 180
1016 3300005834 Ga0068851_10226410 Ga0068851_102264101 180
1017 3300005840 Ga0068870_10032860 Ga0068870_100328602 180
1018 3300005840 Ga0068870_10058060 Ga0068870_100580601 180
1019 3300005840 Ga0068870_10078974 Ga0068870_100789742 180
1020 3300005840 Ga0068870_10183555 Ga0068870_101835551 180
1021 3300005840 Ga0068870_10232698 Ga0068870_102326982 180
1022 3300005841 Ga0068863_100030176 Ga0068863_1000301762 180
1023 3300005841 Ga0068863_100033391 Ga0068863_1000333913 180
1024 3300005841 Ga0068863_100053348 Ga0068863_1000533483 180
1025 3300005841 Ga0068863_100102300 Ga0068863_1001023003 180
1026 3300005841 Ga0068863_100167403 Ga0068863_1001674033 180
1027 3300005841 Ga0068863_100372752 Ga0068863_1003727523 180
1028 3300005841 Ga0068863_101067213 Ga0068863_1010672132 180
1029 3300005842 Ga0068858_100221212 Ga0068858_1002212122 180
1030 3300005842 Ga0068858_100241951 Ga0068858_1002419512 180
1031 3300005842 Ga0068858_100331868 Ga0068858_1003318682 180
1032 3300005842 Ga0068858_100435782 Ga0068858_1004357822 180
1033 3300005842 Ga0068858_100506481 Ga0068858_1005064811 180
1034 3300005842 Ga0068858_100867053 Ga0068858_1008670531 180
1035 3300005842 Ga0068858_101236965 Ga0068858_1012369652 180
1036 3300005843 Ga0068860_100000052 Ga0068860_100000052125 180
1037 3300005843 Ga0068860_100009555 Ga0068860_1000095559 180
1038 3300005843 Ga0068860_100015974 Ga0068860_1000159744 180
1039 3300005843 Ga0068860_100023223 Ga0068860_1000232234 180
1040 3300005843 Ga0068860_100031592 Ga0068860_1000315922 180
1041 3300005843 Ga0068860_100048720 Ga0068860_1000487205 180
1042 3300005843 Ga0068860_100049434 Ga0068860_1000494344 180
1043 3300005843 Ga0068860_100140662 Ga0068860_1001406623 180
1044 3300005843 Ga0068860_100857331 Ga0068860_1008573311 180
1045 3300005844 Ga0068862_100004828 Ga0068862_1000048283 180
1046 3300005844 Ga0068862_100253485 Ga0068862_1002534851 180
1047 3300005844 Ga0068862_100272348 Ga0068862_1002723482 180
1048 3300005844 Ga0068862_100867156 Ga0068862_1008671562 180
1049 3300005844 Ga0068862_101461507 Ga0068862_1014615071 180
1050 3300005983 Ga0081540_1014543 Ga0081540_10145435 180
1051 3300005985 Ga0081539_10000418 Ga0081539_1000041855 180
1052 3300006163 Ga0070715_10237450 Ga0070715_102374502 180
1053 3300006186 Ga0075369_10151915 Ga0075369_101519152 180
1054 3300006195 Ga0075366_10000135 Ga0075366_1000013513 180
1055 3300006195 Ga0075366_10001547 Ga0075366_100015472 180
1056 3300006195 Ga0075366_10017062 Ga0075366_100170625 180
1057 3300006195 Ga0075366_10031577 Ga0075366_100315774 180
1058 3300006195 Ga0075366_10077708 Ga0075366_100777082 180
1059 3300006195 Ga0075366_10127451 Ga0075366_101274512 180
1060 3300006195 Ga0075366_10132526 Ga0075366_101325263 180
1061 3300006195 Ga0075366_10246697 Ga0075366_102466972 180
1062 3300006195 Ga0075366_10257016 Ga0075366_102570162 180
1063 3300006237 Ga0097621_100000015 Ga0097621_10000001589 180
1064 3300006237 Ga0097621_100000611 Ga0097621_10000061114 180
1065 3300006237 Ga0097621_100019267 Ga0097621_1000192676 180
1066 3300006237 Ga0097621_100053067 Ga0097621_1000530673 180
1067 3300006237 Ga0097621_100057100 Ga0097621_1000571005 180
1068 3300006237 Ga0097621_100338996 Ga0097621_1003389962 180
1069 3300006237 Ga0097621_100347785 Ga0097621_1003477851 180
1070 3300006237 Ga0097621_100422768 Ga0097621_1004227682 180
1071 3300006237 Ga0097621_100861017 Ga0097621_1008610172 180
1072 3300006237 Ga0097621_100871773 Ga0097621_1008717731 180
1073 3300006237 Ga0097621_101097882 Ga0097621_1010978821 180
1074 3300006237 Ga0097621_101484787 Ga0097621_1014847871 180
1075 3300006237 Ga0097621_101487659 Ga0097621_1014876591 180
1076 3300006353 Ga0075370_10277191 Ga0075370_102771911 180
1077 3300006358 Ga0068871_100000060 Ga0068871_10000006063 180
1078 3300006358 Ga0068871_100002459 Ga0068871_1000024592 180
1079 3300006358 Ga0068871_100002800 Ga0068871_1000028007 180
1080 3300006358 Ga0068871_100004774 Ga0068871_10000477410 180
1081 3300006358 Ga0068871_100059631 Ga0068871_1000596313 180
1082 3300006358 Ga0068871_100083376 Ga0068871_1000833763 180
1083 3300006358 Ga0068871_100234821 Ga0068871_1002348212 180
1084 3300006358 Ga0068871_100408968 Ga0068871_1004089682 180
1085 3300006358 Ga0068871_101117415 Ga0068871_1011174151 180
1086 3300006844 Ga0075428_100005379 Ga0075428_1000053796 180
1087 3300006844 Ga0075428_100069423 Ga0075428_1000694233 180
1088 3300006844 Ga0075428_100088136 Ga0075428_1000881362 180
1089 3300006844 Ga0075428_100183101 Ga0075428_1001831012 180
1090 3300006844 Ga0075428_101009966 Ga0075428_1010099661 180
1091 3300006846 Ga0075430_100030102 Ga0075430_1000301022 180
1092 3300006846 Ga0075430_100046804 Ga0075430_1000468043 180
1093 3300006846 Ga0075430_100699277 Ga0075430_1006992772 180
1094 3300006847 Ga0075431_100016396 Ga0075431_1000163963 180
1095 3300006847 Ga0075431_100044443 Ga0075431_1000444435 180
1096 3300006880 Ga0075429_100001571 Ga0075429_10000157114 180
1097 3300006880 Ga0075429_100017528 Ga0075429_1000175283 180
1098 3300006880 Ga0075429_100032711 Ga0075429_1000327113 180
1099 3300006880 Ga0075429_100850543 Ga0075429_1008505431 180
1100 3300006881 Ga0068865_100000345 Ga0068865_1000003453 180
1101 3300006881 Ga0068865_100007984 Ga0068865_1000079844 180
1102 3300006881 Ga0068865_100019485 Ga0068865_1000194852 180
1103 3300006881 Ga0068865_100193554 Ga0068865_1001935541 180
1104 3300006881 Ga0068865_100351127 Ga0068865_1003511272 180
1105 3300006931 Ga0097620_100080272 Ga0097620_1000802724 180
1106 3300006931 Ga0097620_100196335 Ga0097620_1001963352 180
1107 3300006931 Ga0097620_100214838 Ga0097620_1002148383 180
1108 3300006931 Ga0097620_100223516 Ga0097620_1002235161 180
1109 3300006931 Ga0097620_100257997 Ga0097620_1002579971 180
1110 3300006931 Ga0097620_100276406 Ga0097620_1002764063 180
1111 3300006931 Ga0097620_100449684 Ga0097620_1004496842 180
1112 3300006931 Ga0097620_100701020 Ga0097620_1007010202 180
1113 3300006942 Ga0099824_1000074 Ga0099824_100007439 180
1114 3300006948 Ga0099826_10000420 Ga0099826_100004207 180
1115 3300009036 Ga0105244_10000065 Ga0105244_1000006512 180
1116 3300009092 Ga0105250_10031124 Ga0105250_100311242 180
1117 3300009093 Ga0105240_10000731 Ga0105240_1000073116 180
1118 3300009093 Ga0105240_10002021 Ga0105240_100020211 180
1119 3300009093 Ga0105240_10004400 Ga0105240_100044004 180
1120 3300009093 Ga0105240_10006482 Ga0105240_1000648214 180
1121 3300009093 Ga0105240_10010451 Ga0105240_100104517 180
1122 3300009093 Ga0105240_10017229 Ga0105240_100172299 180
1123 3300009093 Ga0105240_10017470 Ga0105240_1001747010 180
1124 3300009093 Ga0105240_10054425 Ga0105240_100544252 180
1125 3300009093 Ga0105240_10077048 Ga0105240_100770482 180
1126 3300009093 Ga0105240_10081011 Ga0105240_100810111 180
1127 3300009093 Ga0105240_10090249 Ga0105240_100902494 180
1128 3300009093 Ga0105240_10257149 Ga0105240_102571492 180
1129 3300009093 Ga0105240_10272468 Ga0105240_102724683 180
1130 3300009093 Ga0105240_10315134 Ga0105240_103151342 180
1131 3300009093 Ga0105240_10324341 Ga0105240_103243413 180
1132 3300009093 Ga0105240_10338956 Ga0105240_103389563 180
1133 3300009093 Ga0105240_10570047 Ga0105240_105700472 180
1134 3300009093 Ga0105240_10597481 Ga0105240_105974812 180
1135 3300009093 Ga0105240_10692617 Ga0105240_106926172 180
1136 3300009093 Ga0105240_11067978 Ga0105240_110679782 180
1137 3300009093 Ga0105240_11795189 Ga0105240_117951892 180
1138 3300009094 Ga0111539_10003295 Ga0111539_100032959 180
1139 3300009094 Ga0111539_10020316 Ga0111539_100203168 180
1140 3300009094 Ga0111539_10272631 Ga0111539_102726312 180
1141 3300009094 Ga0111539_10808484 Ga0111539_108084842 180
1142 3300009094 Ga0111539_11339606 Ga0111539_113396062 180
1143 3300009094 Ga0111539_11374491 Ga0111539_113744911 180
1144 3300009094 Ga0111539_11466694 Ga0111539_114666942 180
1145 3300009098 Ga0105245_10046928 Ga0105245_100469284 180
1146 3300009101 Ga0105247_10002997 Ga0105247_100029973 180
1147 3300009147 Ga0114129_10021024 Ga0114129_100210247 180
1148 3300009148 Ga0105243_10000003 Ga0105243_1000000354 180
1149 3300009148 Ga0105243_10168906 Ga0105243_101689063 180
1150 3300009148 Ga0105243_10373090 Ga0105243_103730902 180
1151 3300009174 Ga0105241_10000804 Ga0105241_1000080422 180
1152 3300009174 Ga0105241_10001316 Ga0105241_1000131617 180
1153 3300009174 Ga0105241_10006366 Ga0105241_100063667 180
1154 3300009174 Ga0105241_10012491 Ga0105241_100124913 180
1155 3300009174 Ga0105241_10055756 Ga0105241_100557563 180
1156 3300009174 Ga0105241_10072874 Ga0105241_100728743 180
1157 3300009174 Ga0105241_10086415 Ga0105241_100864154 180
1158 3300009174 Ga0105241_10101556 Ga0105241_101015562 180
1159 3300009174 Ga0105241_10134118 Ga0105241_101341183 180
1160 3300009174 Ga0105241_10384155 Ga0105241_103841551 180
1161 3300009174 Ga0105241_10473048 Ga0105241_104730482 180
1162 3300009174 Ga0105241_10682991 Ga0105241_106829912 180
1163 3300009176 Ga0105242_10062549 Ga0105242_100625493 180
1164 3300009176 Ga0105242_10077863 Ga0105242_100778633 180
1165 3300009176 Ga0105242_10089844 Ga0105242_100898443 180
1166 3300009176 Ga0105242_10210650 Ga0105242_102106501 180
1167 3300009176 Ga0105242_10359334 Ga0105242_103593341 180
1168 3300009176 Ga0105242_11017486 Ga0105242_110174862 180
1169 3300009176 Ga0105242_11073424 Ga0105242_110734241 180
1170 3300009545 Ga0105237_10000474 Ga0105237_1000047414 180
1171 3300009545 Ga0105237_10001504 Ga0105237_1000150414 180
1172 3300009545 Ga0105237_10002057 Ga0105237_100020573 180
1173 3300009545 Ga0105237_10003766 Ga0105237_1000376614 180
1174 3300009545 Ga0105237_10010052 Ga0105237_100100524 180
1175 3300009545 Ga0105237_10012190 Ga0105237_1001219010 180
1176 3300009545 Ga0105237_10015969 Ga0105237_100159695 180
1177 3300009545 Ga0105237_10019537 Ga0105237_100195377 180
1178 3300009545 Ga0105237_10041796 Ga0105237_100417963 180
1179 3300009545 Ga0105237_10073253 Ga0105237_100732533 180
1180 3300009545 Ga0105237_10167750 Ga0105237_101677503 180
1181 3300009545 Ga0105237_10220014 Ga0105237_102200142 180
1182 3300009545 Ga0105237_10244496 Ga0105237_102444962 180
1183 3300009545 Ga0105237_10348135 Ga0105237_103481353 180
1184 3300009545 Ga0105237_10968470 Ga0105237_109684702 180
1185 3300009551 Ga0105238_10014065 Ga0105238_100140654 180
1186 3300009551 Ga0105238_10029887 Ga0105238_100298873 180
1187 3300009551 Ga0105238_10030013 Ga0105238_100300133 180
1188 3300009551 Ga0105238_10040227 Ga0105238_100402277 180
1189 3300009551 Ga0105238_10040372 Ga0105238_100403723 180
1190 3300009551 Ga0105238_10149040 Ga0105238_101490403 180
1191 3300009551 Ga0105238_10169733 Ga0105238_101697333 180
1192 3300009553 Ga0105249_10001656 Ga0105249_100016564 180
1193 3300009553 Ga0105249_10005626 Ga0105249_100056267 180
1194 3300009553 Ga0105249_10029604 Ga0105249_100296043 180
1195 3300009553 Ga0105249_10035162 Ga0105249_100351625 180
1196 3300009553 Ga0105249_10036735 Ga0105249_100367353 180
1197 3300009553 Ga0105249_10045160 Ga0105249_100451604 180
1198 3300009553 Ga0105249_10056561 Ga0105249_100565614 180
1199 3300009553 Ga0105249_10065277 Ga0105249_100652772 180
1200 3300009553 Ga0105249_10131397 Ga0105249_101313972 180
1201 3300009553 Ga0105249_10214253 Ga0105249_102142533 180
1202 3300009553 Ga0105249_10558113 Ga0105249_105581131 180
1203 3300009553 Ga0105249_11719512 Ga0105249_117195121 180
1204 3300010375 Ga0105239_10000049 Ga0105239_10000049156 180
1205 3300010375 Ga0105239_10000166 Ga0105239_1000016633 180
1206 3300010375 Ga0105239_10000935 Ga0105239_1000093531 180
1207 3300010375 Ga0105239_10002278 Ga0105239_100022788 180
1208 3300010375 Ga0105239_10002482 Ga0105239_100024824 180
1209 3300010375 Ga0105239_10004572 Ga0105239_100045729 180
1210 3300010375 Ga0105239_10020118 Ga0105239_100201188 180
1211 3300010375 Ga0105239_10022831 Ga0105239_100228313 180
1212 3300010375 Ga0105239_10024293 Ga0105239_100242936 180
1213 3300010375 Ga0105239_10033176 Ga0105239_100331763 180
1214 3300010375 Ga0105239_10078163 Ga0105239_100781633 180
1215 3300010375 Ga0105239_10081056 Ga0105239_100810563 180
1216 3300010375 Ga0105239_10086451 Ga0105239_100864511 180
1217 3300010375 Ga0105239_10205849 Ga0105239_102058493 180
1218 3300010375 Ga0105239_10247292 Ga0105239_102472922 180
1219 3300010375 Ga0105239_10328499 Ga0105239_103284992 180
1220 3300010375 Ga0105239_10389192 Ga0105239_103891923 180
1221 3300010375 Ga0105239_10402430 Ga0105239_104024302 180
1222 3300010375 Ga0105239_10445997 Ga0105239_104459972 180
1223 3300010375 Ga0105239_10824775 Ga0105239_108247751 180
1224 3300010375 Ga0105239_11206106 Ga0105239_112061062 180
1225 3300011119 Ga0105246_10036156 Ga0105246_100361563 180
1226 3300011119 Ga0105246_10284795 Ga0105246_102847952 180
1227 3300011119 Ga0105246_11032579 Ga0105246_110325792 180
1228 3300013100 Ga0157373_10000003 Ga0157373_1000000398 180
1229 3300013100 Ga0157373_10000086 Ga0157373_1000008634 180
1230 3300013100 Ga0157373_10000678 Ga0157373_1000067821 180
1231 3300013100 Ga0157373_10001842 Ga0157373_1000184210 180
1232 3300013100 Ga0157373_10008022 Ga0157373_100080224 180
1233 3300013100 Ga0157373_10008768 Ga0157373_100087686 180
1234 3300013100 Ga0157373_10022246 Ga0157373_100222464 180
1235 3300013100 Ga0157373_10022495 Ga0157373_100224955 180
1236 3300013100 Ga0157373_10034330 Ga0157373_100343303 180
1237 3300013100 Ga0157373_10394794 Ga0157373_103947942 180
1238 3300013100 Ga0157373_10510669 Ga0157373_105106692 180
1239 3300013102 Ga0157371_10000027 Ga0157371_100000275 180
1240 3300013102 Ga0157371_10000107 Ga0157371_1000010740 180
1241 3300013102 Ga0157371_10000168 Ga0157371_1000016839 180
1242 3300013102 Ga0157371_10000265 Ga0157371_100002653 180
1243 3300013102 Ga0157371_10001167 Ga0157371_1000116729 180
1244 3300013102 Ga0157371_10001199 Ga0157371_1000119919 180
1245 3300013102 Ga0157371_10001473 Ga0157371_1000147317 180
1246 3300013102 Ga0157371_10001579 Ga0157371_1000157915 180
1247 3300013102 Ga0157371_10004990 Ga0157371_100049907 180
1248 3300013102 Ga0157371_10007301 Ga0157371_100073013 180
1249 3300013102 Ga0157371_10015463 Ga0157371_100154635 180
1250 3300013102 Ga0157371_10018764 Ga0157371_100187644 180
1251 3300013102 Ga0157371_10019868 Ga0157371_100198682 180
1252 3300013102 Ga0157371_10021760 Ga0157371_100217603 180
1253 3300013102 Ga0157371_10034869 Ga0157371_100348694 180
1254 3300013102 Ga0157371_10040023 Ga0157371_100400233 180
1255 3300013102 Ga0157371_10040031 Ga0157371_100400313 180
1256 3300013102 Ga0157371_10061420 Ga0157371_100614203 180
1257 3300013102 Ga0157371_10077151 Ga0157371_100771513 180
1258 3300013102 Ga0157371_10103211 Ga0157371_101032111 180
1259 3300013102 Ga0157371_10382580 Ga0157371_103825802 180
1260 3300013102 Ga0157371_10608867 Ga0157371_106088671 180
1261 3300013104 Ga0157370_10000631 Ga0157370_100006313 180
1262 3300013104 Ga0157370_10000817 Ga0157370_1000081722 180
1263 3300013104 Ga0157370_10001929 Ga0157370_1000192915 180
1264 3300013104 Ga0157370_10002773 Ga0157370_1000277320 180
1265 3300013104 Ga0157370_10003542 Ga0157370_1000354215 180
1266 3300013104 Ga0157370_10003748 Ga0157370_100037489 180
1267 3300013104 Ga0157370_10005694 Ga0157370_1000569410 180
1268 3300013104 Ga0157370_10009760 Ga0157370_100097604 180
1269 3300013104 Ga0157370_10012593 Ga0157370_100125933 180
1270 3300013104 Ga0157370_10029007 Ga0157370_100290073 180
1271 3300013104 Ga0157370_10037709 Ga0157370_100377094 180
1272 3300013104 Ga0157370_10037715 Ga0157370_100377151 180
1273 3300013104 Ga0157370_10040970 Ga0157370_100409705 180
1274 3300013104 Ga0157370_10045382 Ga0157370_100453824 180
1275 3300013104 Ga0157370_10045913 Ga0157370_100459131 180
1276 3300013104 Ga0157370_10049125 Ga0157370_100491254 180
1277 3300013104 Ga0157370_10060180 Ga0157370_100601804 180
1278 3300013104 Ga0157370_10110728 Ga0157370_101107283 180
1279 3300013104 Ga0157370_10121242 Ga0157370_101212422 180
1280 3300013104 Ga0157370_10122095 Ga0157370_101220953 180
1281 3300013104 Ga0157370_10165907 Ga0157370_101659073 180
1282 3300013104 Ga0157370_10183188 Ga0157370_101831883 180
1283 3300013104 Ga0157370_10194380 Ga0157370_101943802 180
1284 3300013104 Ga0157370_10195211 Ga0157370_101952112 180
1285 3300013104 Ga0157370_10213359 Ga0157370_102133592 180
1286 3300013104 Ga0157370_10246774 Ga0157370_102467742 180
1287 3300013104 Ga0157370_10269730 Ga0157370_102697302 180
1288 3300013104 Ga0157370_10269735 Ga0157370_102697353 180
1289 3300013104 Ga0157370_10526600 Ga0157370_105266002 180
1290 3300013104 Ga0157370_10631413 Ga0157370_106314132 180
1291 3300013104 Ga0157370_10780039 Ga0157370_107800391 180
1292 3300013104 Ga0157370_10782558 Ga0157370_107825581 180
1293 3300013104 Ga0157370_10946595 Ga0157370_109465952 180
1294 3300013105 Ga0157369_10000053 Ga0157369_10000053154 180
1295 3300013105 Ga0157369_10000684 Ga0157369_1000068428 180
1296 3300013105 Ga0157369_10003605 Ga0157369_100036052 180
1297 3300013105 Ga0157369_10008517 Ga0157369_1000851712 180
1298 3300013105 Ga0157369_10020179 Ga0157369_100201792 180
1299 3300013105 Ga0157369_10029467 Ga0157369_100294674 180
1300 3300013105 Ga0157369_10033448 Ga0157369_100334483 180
1301 3300013105 Ga0157369_10045126 Ga0157369_100451264 180
1302 3300013105 Ga0157369_10064840 Ga0157369_100648407 180
1303 3300013105 Ga0157369_10071707 Ga0157369_100717074 180
1304 3300013105 Ga0157369_10217511 Ga0157369_102175112 180
1305 3300013105 Ga0157369_10291646 Ga0157369_102916462 180
1306 3300013105 Ga0157369_10328820 Ga0157369_103288202 180
1307 3300013105 Ga0157369_10375601 Ga0157369_103756012 180
1308 3300013105 Ga0157369_10524447 Ga0157369_105244472 180
1309 3300013105 Ga0157369_10537839 Ga0157369_105378391 180
1310 3300013296 Ga0157374_10000024 Ga0157374_10000024154 180
1311 3300013296 Ga0157374_10000301 Ga0157374_1000030130 180
1312 3300013296 Ga0157374_10001665 Ga0157374_100016653 180
1313 3300013296 Ga0157374_10003768 Ga0157374_100037682 180
1314 3300013296 Ga0157374_10009941 Ga0157374_100099415 180
1315 3300013296 Ga0157374_10020930 Ga0157374_100209304 180
1316 3300013296 Ga0157374_10054881 Ga0157374_100548815 180
1317 3300013296 Ga0157374_10075443 Ga0157374_100754433 180
1318 3300013296 Ga0157374_10119312 Ga0157374_101193123 180
1319 3300013296 Ga0157374_10165615 Ga0157374_101656154 180
1320 3300013296 Ga0157374_10180519 Ga0157374_101805193 180
1321 3300013296 Ga0157374_10234710 Ga0157374_102347102 180
1322 3300013296 Ga0157374_10476756 Ga0157374_104767561 180
1323 3300013296 Ga0157374_10996802 Ga0157374_109968022 180
1324 3300013297 Ga0157378_10007954 Ga0157378_100079544 180
1325 3300013297 Ga0157378_10011916 Ga0157378_100119165 180
1326 3300013297 Ga0157378_10051819 Ga0157378_100518193 180
1327 3300013297 Ga0157378_10104341 Ga0157378_101043413 180
1328 3300013297 Ga0157378_10184793 Ga0157378_101847933 180
1329 3300013297 Ga0157378_10589238 Ga0157378_105892382 180
1330 3300013297 Ga0157378_10602072 Ga0157378_106020722 180
1331 3300013297 Ga0157378_10625587 Ga0157378_106255872 180
1332 3300013297 Ga0157378_10924517 Ga0157378_109245172 180
1333 3300013306 Ga0163162_10000012 Ga0163162_10000012114 180
1334 3300013306 Ga0163162_10000078 Ga0163162_1000007847 180
1335 3300013306 Ga0163162_10001403 Ga0163162_1000140316 180
1336 3300013306 Ga0163162_10001696 Ga0163162_1000169622 180
1337 3300013306 Ga0163162_10001704 Ga0163162_1000170416 180
1338 3300013306 Ga0163162_10002066 Ga0163162_1000206610 180
1339 3300013306 Ga0163162_10003815 Ga0163162_1000381513 180
1340 3300013306 Ga0163162_10010491 Ga0163162_100104917 180
1341 3300013306 Ga0163162_10017517 Ga0163162_100175174 180
1342 3300013306 Ga0163162_10017686 Ga0163162_100176868 180
1343 3300013306 Ga0163162_10024693 Ga0163162_100246933 180
1344 3300013306 Ga0163162_10035073 Ga0163162_100350735 180
1345 3300013306 Ga0163162_10084028 Ga0163162_100840281 180
1346 3300013306 Ga0163162_10134450 Ga0163162_101344503 180
1347 3300013306 Ga0163162_10326168 Ga0163162_103261682 180
1348 3300013306 Ga0163162_10985073 Ga0163162_109850732 180
1349 3300013306 Ga0163162_11180418 Ga0163162_111804181 180
1350 3300013306 Ga0163162_11252291 Ga0163162_112522912 180
1351 3300013306 Ga0163162_11329679 Ga0163162_113296791 180
1352 3300013306 Ga0163162_11400101 Ga0163162_114001011 180
1353 3300013306 Ga0163162_11487050 Ga0163162_114870501 180
1354 3300013306 Ga0163162_11920664 Ga0163162_119206641 180
1355 3300013307 Ga0157372_10000039 Ga0157372_1000003928 180
1356 3300013307 Ga0157372_10000238 Ga0157372_1000023828 180
1357 3300013307 Ga0157372_10002381 Ga0157372_1000238113 180
1358 3300013307 Ga0157372_10004730 Ga0157372_100047305 180
1359 3300013307 Ga0157372_10006195 Ga0157372_1000619510 180
1360 3300013307 Ga0157372_10010343 Ga0157372_100103433 180
1361 3300013307 Ga0157372_10010761 Ga0157372_100107612 180
1362 3300013307 Ga0157372_10021427 Ga0157372_100214274 180
1363 3300013307 Ga0157372_10022049 Ga0157372_100220497 180
1364 3300013307 Ga0157372_10025063 Ga0157372_100250637 180
1365 3300013307 Ga0157372_10025844 Ga0157372_100258448 180
1366 3300013307 Ga0157372_10029794 Ga0157372_100297946 180
1367 3300013307 Ga0157372_10031839 Ga0157372_100318396 180
1368 3300013307 Ga0157372_10041124 Ga0157372_100411242 180
1369 3300013307 Ga0157372_10043901 Ga0157372_100439013 180
1370 3300013307 Ga0157372_10060545 Ga0157372_100605455 180
1371 3300013307 Ga0157372_10064528 Ga0157372_100645286 180
1372 3300013307 Ga0157372_10080242 Ga0157372_100802424 180
1373 3300013307 Ga0157372_10088747 Ga0157372_100887473 180
1374 3300013307 Ga0157372_10118231 Ga0157372_101182314 180
1375 3300013307 Ga0157372_10128640 Ga0157372_101286402 180
1376 3300013307 Ga0157372_10162065 Ga0157372_101620653 180
1377 3300013307 Ga0157372_10205288 Ga0157372_102052883 180
1378 3300013307 Ga0157372_10233388 Ga0157372_102333883 180
1379 3300013307 Ga0157372_10362245 Ga0157372_103622452 180
1380 3300013307 Ga0157372_10409058 Ga0157372_104090583 180
1381 3300013307 Ga0157372_10416642 Ga0157372_104166422 180
1382 3300013307 Ga0157372_10422907 Ga0157372_104229072 180
1383 3300013307 Ga0157372_10423270 Ga0157372_104232702 180
1384 3300013307 Ga0157372_10494883 Ga0157372_104948832 180
1385 3300013307 Ga0157372_10682583 Ga0157372_106825832 180
1386 3300013307 Ga0157372_10725417 Ga0157372_107254172 180
1387 3300013307 Ga0157372_11118481 Ga0157372_111184812 180
1388 3300013307 Ga0157372_11342893 Ga0157372_113428931 180
1389 3300013307 Ga0157372_11357522 Ga0157372_113575221 180
1390 3300013307 Ga0157372_11380798 Ga0157372_113807981 180
1391 3300013307 Ga0157372_11501904 Ga0157372_115019041 180
1392 3300013308 Ga0157375_10000614 Ga0157375_1000061412 180
1393 3300013308 Ga0157375_10030368 Ga0157375_100303685 180
1394 3300013308 Ga0157375_10038007 Ga0157375_100380076 180
1395 3300013308 Ga0157375_10046085 Ga0157375_100460851 180
1396 3300013308 Ga0157375_10097674 Ga0157375_100976741 180
1397 3300013308 Ga0157375_10103859 Ga0157375_101038593 180
1398 3300013308 Ga0157375_10194045 Ga0157375_101940453 180
1399 3300013308 Ga0157375_10213188 Ga0157375_102131882 180
1400 3300013308 Ga0157375_10246878 Ga0157375_102468783 180
1401 3300013308 Ga0157375_10272471 Ga0157375_102724713 180
1402 3300013308 Ga0157375_10305241 Ga0157375_103052412 180
1403 3300013308 Ga0157375_10481728 Ga0157375_104817281 180
1404 3300013308 Ga0157375_10677124 Ga0157375_106771241 180
1405 3300013308 Ga0157375_10718957 Ga0157375_107189572 180
1406 3300014325 Ga0163163_10000352 Ga0163163_1000035237 180
1407 3300014325 Ga0163163_10117758 Ga0163163_101177582 180
1408 3300014325 Ga0163163_10215022 Ga0163163_102150223 180
1409 3300014325 Ga0163163_12047592 Ga0163163_120475921 180
1410 3300014326 Ga0157380_10000314 Ga0157380_100003145 180
1411 3300014326 Ga0157380_10007323 Ga0157380_100073238 180
1412 3300014326 Ga0157380_10012856 Ga0157380_100128563 180
1413 3300014326 Ga0157380_10124649 Ga0157380_101246492 180
1414 3300014326 Ga0157380_10155217 Ga0157380_101552173 180
1415 3300014326 Ga0157380_10266483 Ga0157380_102664832 180
1416 3300014326 Ga0157380_10320367 Ga0157380_103203672 180
1417 3300014326 Ga0157380_10526127 Ga0157380_105261272 180
1418 3300014497 Ga0182008_10000020 Ga0182008_10000020100 180
1419 3300014497 Ga0182008_10000053 Ga0182008_1000005341 180
1420 3300014497 Ga0182008_10000336 Ga0182008_100003368 180
1421 3300014497 Ga0182008_10030219 Ga0182008_100302193 180
1422 3300014497 Ga0182008_10063237 Ga0182008_100632373 180
1423 3300014497 Ga0182008_10063474 Ga0182008_100634742 180
1424 3300014745 Ga0157377_10000354 Ga0157377_1000035420 180
1425 3300014745 Ga0157377_10026187 Ga0157377_100261873 180
1426 3300014745 Ga0157377_10034156 Ga0157377_100341563 180
1427 3300014745 Ga0157377_10080083 Ga0157377_100800832 180
1428 3300014745 Ga0157377_10124350 Ga0157377_101243502 180
1429 3300014745 Ga0157377_10239338 Ga0157377_102393382 180
1430 3300014968 Ga0157379_10009114 Ga0157379_100091143 180
1431 3300014968 Ga0157379_10014153 Ga0157379_100141538 180
1432 3300014968 Ga0157379_10028879 Ga0157379_100288794 180
1433 3300014968 Ga0157379_10118530 Ga0157379_101185302 180
1434 3300014968 Ga0157379_10364494 Ga0157379_103644942 180
1435 3300014969 Ga0157376_10016249 Ga0157376_100162497 180
1436 3300014969 Ga0157376_10016871 Ga0157376_100168712 180
1437 3300014969 Ga0157376_10035644 Ga0157376_100356443 180
1438 3300014969 Ga0157376_10224421 Ga0157376_102244212 180
1439 3300014969 Ga0157376_10361723 Ga0157376_103617233 180
1440 3300014969 Ga0157376_10506107 Ga0157376_105061071 180
1441 3300014969 Ga0157376_10517395 Ga0157376_105173951 180
1442 3300014969 Ga0157376_10924676 Ga0157376_109246761 180
1443 3300015261 Ga0182006_1001480 Ga0182006_10014803 180
1444 3300015261 Ga0182006_1001934 Ga0182006_10019349 180
1445 3300015261 Ga0182006_1002073 Ga0182006_10020737 180
1446 3300015261 Ga0182006_1002254 Ga0182006_100225410 180
1447 3300015261 Ga0182006_1005760 Ga0182006_10057606 180
1448 3300015261 Ga0182006_1007004 Ga0182006_10070041 180
1449 3300015261 Ga0182006_1011176 Ga0182006_10111763 180
1450 3300015261 Ga0182006_1044064 Ga0182006_10440642 180
1451 3300015261 Ga0182006_1066184 Ga0182006_10661843 180
1452 3300015262 Ga0182007_10000005 Ga0182007_10000005261 180
1453 3300015262 Ga0182007_10018865 Ga0182007_100188651 180
1454 3300015262 Ga0182007_10042119 Ga0182007_100421192 180
1455 3300015682 Ga0183373_1007 Ga0183373_1007216 180
1456 3300017792 Ga0163161_10000033 Ga0163161_1000003375 180
1457 3300017792 Ga0163161_10000968 Ga0163161_1000096818 180
1458 3300017792 Ga0163161_10004348 Ga0163161_100043485 180
1459 3300017792 Ga0163161_10009442 Ga0163161_100094428 180
1460 3300017792 Ga0163161_10025972 Ga0163161_100259724 180
1461 3300017792 Ga0163161_10036261 Ga0163161_100362612 180
1462 3300017792 Ga0163161_10046581 Ga0163161_100465813 180
1463 3300017792 Ga0163161_10084779 Ga0163161_100847792 180
1464 3300017792 Ga0163161_10103045 Ga0163161_101030453 180
1465 3300017792 Ga0163161_10109733 Ga0163161_101097333 180
1466 3300017792 Ga0163161_10128484 Ga0163161_101284843 180
1467 3300017792 Ga0163161_10233663 Ga0163161_102336632 180
1468 3300017792 Ga0163161_10340856 Ga0163161_103408561 180
1469 3300017792 Ga0163161_11055249 Ga0163161_110552491 180
1470 3300020069 Ga0197907_10029441 Ga0197907_100294411 180
1471 3300020069 Ga0197907_10046094 Ga0197907_100460942 180
1472 3300020077 Ga0206351_10513209 Ga0206351_105132092 180
1473 3300020077 Ga0206351_10892710 Ga0206351_108927105 180
1474 3300020078 Ga0206352_10699063 Ga0206352_106990632 180
1475 3300020610 Ga0154015_1051922 Ga0154015_10519222 180
1476 3300021361 Ga0213872_10047605 Ga0213872_100476053 180
1477 3300021384 Ga0213876_10004817 Ga0213876_100048179 180
1478 3300021384 Ga0213876_10056846 Ga0213876_100568462 180
1479 3300022467 Ga0224712_10039980 Ga0224712_100399802 180
1480 3300022467 Ga0224712_10060786 Ga0224712_100607861 180
1481 3300022467 Ga0224712_10153072 Ga0224712_101530722 180
1482 3300025231 Ga0207427_100122 Ga0207427_10012245 180
1483 3300025233 Ga0209437_100048 Ga0209437_100048251 180
1484 3300025233 Ga0209437_100102 Ga0209437_100102154 180
1485 3300025245 Ga0207425_1000003 Ga0207425_1000003337 180
1486 3300025246 Ga0209646_1001140 Ga0209646_10011409 180
1487 3300025250 Ga0209026_1000852 Ga0209026_100085216 180
1488 3300025250 Ga0209026_1001432 Ga0209026_10014328 180
1489 3300025250 Ga0209026_1003805 Ga0209026_10038051 180
1490 3300025258 Ga0209129_1000022 Ga0209129_1000022337 180
1491 3300025261 Ga0209233_1000029 Ga0209233_1000029125 180
1492 3300025261 Ga0209233_1007045 Ga0209233_10070453 180
1493 3300025261 Ga0209233_1024411 Ga0209233_10244113 180
1494 3300025272 Ga0209455_1005502 Ga0209455_10055026 180
1495 3300025292 Ga0209676_1000039 Ga0209676_1000039175 180
1496 3300025294 Ga0209025_1000007 Ga0209025_1000007336 180
1497 3300025297 Ga0209758_1000012 Ga0209758_1000012337 180
1498 3300025298 Ga0209050_1000033 Ga0209050_1000033274 180
1499 3300025302 Ga0207426_1000059 Ga0207426_1000059289 180
1500 3300025304 Ga0209257_1000006 Ga0209257_1000006711 180
1501 3300025315 Ga0207697_10011359 Ga0207697_100113595 180
1502 3300025315 Ga0207697_10015975 Ga0207697_100159752 180
1503 3300025315 Ga0207697_10066549 Ga0207697_100665492 180
1504 3300025321 Ga0207656_10149680 Ga0207656_101496802 180
1505 3300025321 Ga0207656_10151218 Ga0207656_101512182 180
1506 3300025321 Ga0207656_10210692 Ga0207656_102106922 180
1507 3300025728 Ga0207655_1000003 Ga0207655_1000003428 180
1508 3300025728 Ga0207655_1066535 Ga0207655_10665352 180
1509 3300025893 Ga0207682_10157835 Ga0207682_101578352 180
1510 3300025893 Ga0207682_10340183 Ga0207682_103401831 180
1511 3300025899 Ga0207642_10072621 Ga0207642_100726212 180
1512 3300025899 Ga0207642_10091750 Ga0207642_100917502 180
1513 3300025900 Ga0207710_10001252 Ga0207710_1000125214 180
1514 3300025901 Ga0207688_10022146 Ga0207688_100221463 180
1515 3300025901 Ga0207688_10108817 Ga0207688_101088172 180
1516 3300025903 Ga0207680_10016753 Ga0207680_100167535 180
1517 3300025903 Ga0207680_10033658 Ga0207680_100336583 180
1518 3300025903 Ga0207680_10149582 Ga0207680_101495822 180
1519 3300025903 Ga0207680_10153352 Ga0207680_101533522 180
1520 3300025903 Ga0207680_10167191 Ga0207680_101671912 180
1521 3300025904 Ga0207647_10000018 Ga0207647_10000018100 180
1522 3300025904 Ga0207647_10000061 Ga0207647_1000006121 180
1523 3300025904 Ga0207647_10000071 Ga0207647_1000007142 180
1524 3300025904 Ga0207647_10014834 Ga0207647_100148343 180
1525 3300025904 Ga0207647_10113830 Ga0207647_101138303 180
1526 3300025904 Ga0207647_10145048 Ga0207647_101450482 180
1527 3300025905 Ga0207685_10331613 Ga0207685_103316131 180
1528 3300025907 Ga0207645_10000229 Ga0207645_1000022926 180
1529 3300025907 Ga0207645_10000847 Ga0207645_100008476 180
1530 3300025907 Ga0207645_10002256 Ga0207645_1000225616 180
1531 3300025907 Ga0207645_10024082 Ga0207645_100240824 180
1532 3300025907 Ga0207645_10314957 Ga0207645_103149572 180
1533 3300025908 Ga0207643_10015082 Ga0207643_100150824 180
1534 3300025908 Ga0207643_10022947 Ga0207643_100229473 180
1535 3300025908 Ga0207643_10103323 Ga0207643_101033231 180
1536 3300025908 Ga0207643_10113723 Ga0207643_101137231 180
1537 3300025909 Ga0207705_10000026 Ga0207705_10000026191 180
1538 3300025909 Ga0207705_10008664 Ga0207705_100086649 180
1539 3300025909 Ga0207705_10009177 Ga0207705_100091772 180
1540 3300025909 Ga0207705_10013540 Ga0207705_100135406 180
1541 3300025909 Ga0207705_10015035 Ga0207705_100150353 180
1542 3300025909 Ga0207705_10051352 Ga0207705_100513525 180
1543 3300025909 Ga0207705_10108174 Ga0207705_101081743 180
1544 3300025909 Ga0207705_10132504 Ga0207705_101325042 180
1545 3300025909 Ga0207705_10193904 Ga0207705_101939042 180
1546 3300025909 Ga0207705_10464156 Ga0207705_104641562 180
1547 3300025909 Ga0207705_10664506 Ga0207705_106645062 180
1548 3300025911 Ga0207654_10001026 Ga0207654_1000102618 180
1549 3300025911 Ga0207654_10002896 Ga0207654_100028963 180
1550 3300025911 Ga0207654_10037096 Ga0207654_100370962 180
1551 3300025911 Ga0207654_10146084 Ga0207654_101460841 180
1552 3300025911 Ga0207654_10147037 Ga0207654_101470372 180
1553 3300025911 Ga0207654_10154602 Ga0207654_101546021 180
1554 3300025911 Ga0207654_10164376 Ga0207654_101643761 180
1555 3300025911 Ga0207654_10485830 Ga0207654_104858301 180
1556 3300025912 Ga0207707_10049330 Ga0207707_100493304 180
1557 3300025912 Ga0207707_10202850 Ga0207707_102028501 180
1558 3300025912 Ga0207707_10206618 Ga0207707_102066182 180
1559 3300025912 Ga0207707_10276086 Ga0207707_102760862 180
1560 3300025912 Ga0207707_10298897 Ga0207707_102988972 180
1561 3300025912 Ga0207707_10374858 Ga0207707_103748582 180
1562 3300025913 Ga0207695_10000135 Ga0207695_10000135153 180
1563 3300025913 Ga0207695_10000142 Ga0207695_1000014282 180
1564 3300025913 Ga0207695_10000702 Ga0207695_1000070216 180
1565 3300025913 Ga0207695_10000894 Ga0207695_1000089411 180
1566 3300025913 Ga0207695_10002580 Ga0207695_1000258023 180
1567 3300025913 Ga0207695_10008758 Ga0207695_100087587 180
1568 3300025913 Ga0207695_10015835 Ga0207695_100158355 180
1569 3300025913 Ga0207695_10016392 Ga0207695_1001639210 180
1570 3300025913 Ga0207695_10030088 Ga0207695_100300882 180
1571 3300025913 Ga0207695_10031899 Ga0207695_100318994 180
1572 3300025913 Ga0207695_10038683 Ga0207695_100386832 180
1573 3300025913 Ga0207695_10164678 Ga0207695_101646783 180
1574 3300025913 Ga0207695_10187438 Ga0207695_101874383 180
1575 3300025913 Ga0207695_10219486 Ga0207695_102194862 180
1576 3300025913 Ga0207695_10462956 Ga0207695_104629562 180
1577 3300025913 Ga0207695_10831905 Ga0207695_108319051 180
1578 3300025913 Ga0207695_11115533 Ga0207695_111155331 180
1579 3300025914 Ga0207671_10000110 Ga0207671_1000011062 180
1580 3300025914 Ga0207671_10001102 Ga0207671_100011029 180
1581 3300025914 Ga0207671_10001959 Ga0207671_1000195916 180
1582 3300025914 Ga0207671_10006160 Ga0207671_1000616010 180
1583 3300025914 Ga0207671_10009045 Ga0207671_100090457 180
1584 3300025914 Ga0207671_10009636 Ga0207671_100096366 180
1585 3300025914 Ga0207671_10015774 Ga0207671_100157743 180
1586 3300025914 Ga0207671_10019924 Ga0207671_100199248 180
1587 3300025914 Ga0207671_10028650 Ga0207671_100286505 180
1588 3300025914 Ga0207671_10031595 Ga0207671_100315956 180
1589 3300025914 Ga0207671_10044954 Ga0207671_100449543 180
1590 3300025914 Ga0207671_10162420 Ga0207671_101624203 180
1591 3300025914 Ga0207671_10186939 Ga0207671_101869392 180
1592 3300025914 Ga0207671_10223615 Ga0207671_102236152 180
1593 3300025914 Ga0207671_10487522 Ga0207671_104875222 180
1594 3300025915 Ga0207693_10034650 Ga0207693_100346505 180
1595 3300025917 Ga0207660_10005360 Ga0207660_100053609 180
1596 3300025917 Ga0207660_10174888 Ga0207660_101748882 180
1597 3300025917 Ga0207660_10196728 Ga0207660_101967282 180
1598 3300025917 Ga0207660_10268735 Ga0207660_102687351 180
1599 3300025917 Ga0207660_10543524 Ga0207660_105435242 180
1600 3300025918 Ga0207662_10048920 Ga0207662_100489203 180
1601 3300025918 Ga0207662_10080480 Ga0207662_100804803 180
1602 3300025918 Ga0207662_10136673 Ga0207662_101366733 180
1603 3300025918 Ga0207662_10566888 Ga0207662_105668881 180
1604 3300025919 Ga0207657_10010634 Ga0207657_100106347 180
1605 3300025919 Ga0207657_10018065 Ga0207657_100180656 180
1606 3300025919 Ga0207657_10023154 Ga0207657_100231542 180
1607 3300025919 Ga0207657_10034772 Ga0207657_100347723 180
1608 3300025919 Ga0207657_10039312 Ga0207657_100393125 180
1609 3300025919 Ga0207657_10129800 Ga0207657_101298002 180
1610 3300025919 Ga0207657_10167769 Ga0207657_101677692 180
1611 3300025919 Ga0207657_10190195 Ga0207657_101901953 180
1612 3300025920 Ga0207649_10024307 Ga0207649_100243072 180
1613 3300025920 Ga0207649_10040769 Ga0207649_100407693 180
1614 3300025920 Ga0207649_10049245 Ga0207649_100492453 180
1615 3300025921 Ga0207652_10000181 Ga0207652_1000018111 180
1616 3300025921 Ga0207652_10002067 Ga0207652_1000206711 180
1617 3300025921 Ga0207652_10002811 Ga0207652_1000281116 180
1618 3300025921 Ga0207652_10003461 Ga0207652_100034611 180
1619 3300025921 Ga0207652_10008746 Ga0207652_100087466 180
1620 3300025921 Ga0207652_10015389 Ga0207652_100153896 180
1621 3300025921 Ga0207652_10052657 Ga0207652_100526573 180
1622 3300025921 Ga0207652_10099832 Ga0207652_100998323 180
1623 3300025921 Ga0207652_10449010 Ga0207652_104490102 180
1624 3300025921 Ga0207652_10560264 Ga0207652_105602642 180
1625 3300025921 Ga0207652_10741143 Ga0207652_107411431 180
1626 3300025922 Ga0207646_10085644 Ga0207646_100856443 180
1627 3300025923 Ga0207681_10020294 Ga0207681_100202944 180
1628 3300025923 Ga0207681_10047416 Ga0207681_100474163 180
1629 3300025923 Ga0207681_10108946 Ga0207681_101089462 180
1630 3300025923 Ga0207681_10157910 Ga0207681_101579101 180
1631 3300025923 Ga0207681_10199047 Ga0207681_101990473 180
1632 3300025924 Ga0207694_10011225 Ga0207694_100112257 180
1633 3300025924 Ga0207694_10065929 Ga0207694_100659293 180
1634 3300025924 Ga0207694_10171107 Ga0207694_101711073 180
1635 3300025924 Ga0207694_10186252 Ga0207694_101862522 180
1636 3300025924 Ga0207694_10445191 Ga0207694_104451912 180
1637 3300025925 Ga0207650_10072256 Ga0207650_100722563 180
1638 3300025925 Ga0207650_10074652 Ga0207650_100746523 180
1639 3300025925 Ga0207650_10085074 Ga0207650_100850742 180
1640 3300025925 Ga0207650_10093330 Ga0207650_100933303 180
1641 3300025925 Ga0207650_10101892 Ga0207650_101018923 180
1642 3300025925 Ga0207650_10108768 Ga0207650_101087683 180
1643 3300025925 Ga0207650_10279677 Ga0207650_102796772 180
1644 3300025925 Ga0207650_10510486 Ga0207650_105104861 180
1645 3300025926 Ga0207659_10048649 Ga0207659_100486493 180
1646 3300025926 Ga0207659_10062881 Ga0207659_100628813 180
1647 3300025926 Ga0207659_10131908 Ga0207659_101319082 180
1648 3300025926 Ga0207659_10298567 Ga0207659_102985672 180
1649 3300025926 Ga0207659_10707830 Ga0207659_107078301 180
1650 3300025926 Ga0207659_11116045 Ga0207659_111160451 180
1651 3300025926 Ga0207659_11233279 Ga0207659_112332791 180
1652 3300025927 Ga0207687_10389886 Ga0207687_103898862 180
1653 3300025927 Ga0207687_10940333 Ga0207687_109403331 180
1654 3300025931 Ga0207644_10009845 Ga0207644_100098452 180
1655 3300025931 Ga0207644_10017994 Ga0207644_100179945 180
1656 3300025931 Ga0207644_10049472 Ga0207644_100494723 180
1657 3300025931 Ga0207644_10070387 Ga0207644_100703872 180
1658 3300025931 Ga0207644_10098316 Ga0207644_100983162 180
1659 3300025931 Ga0207644_10121467 Ga0207644_101214672 180
1660 3300025931 Ga0207644_10501755 Ga0207644_105017551 180
1661 3300025932 Ga0207690_10001688 Ga0207690_100016884 180
1662 3300025932 Ga0207690_10006502 Ga0207690_100065026 180
1663 3300025932 Ga0207690_10038252 Ga0207690_100382523 180
1664 3300025932 Ga0207690_10089208 Ga0207690_100892083 180
1665 3300025932 Ga0207690_10188108 Ga0207690_101881082 180
1666 3300025932 Ga0207690_10189087 Ga0207690_101890872 180
1667 3300025932 Ga0207690_10206963 Ga0207690_102069632 180
1668 3300025933 Ga0207706_10018580 Ga0207706_100185802 180
1669 3300025933 Ga0207706_10027832 Ga0207706_100278324 180
1670 3300025933 Ga0207706_10037500 Ga0207706_100375003 180
1671 3300025933 Ga0207706_10087182 Ga0207706_100871822 180
1672 3300025933 Ga0207706_10501880 Ga0207706_105018802 180
1673 3300025934 Ga0207686_10187801 Ga0207686_101878013 180
1674 3300025934 Ga0207686_10294381 Ga0207686_102943812 180
1675 3300025934 Ga0207686_10782168 Ga0207686_107821681 180
1676 3300025935 Ga0207709_10000008 Ga0207709_10000008520 180
1677 3300025935 Ga0207709_11027171 Ga0207709_110271711 180
1678 3300025936 Ga0207670_10007051 Ga0207670_100070517 180
1679 3300025936 Ga0207670_10020760 Ga0207670_100207601 180
1680 3300025936 Ga0207670_10485475 Ga0207670_104854752 180
1681 3300025937 Ga0207669_10032794 Ga0207669_100327943 180
1682 3300025937 Ga0207669_10103478 Ga0207669_101034783 180
1683 3300025937 Ga0207669_10444379 Ga0207669_104443792 180
1684 3300025937 Ga0207669_10959928 Ga0207669_109599281 180
1685 3300025938 Ga0207704_10000047 Ga0207704_1000004748 180
1686 3300025938 Ga0207704_10218997 Ga0207704_102189973 180
1687 3300025938 Ga0207704_10287050 Ga0207704_102870501 180
1688 3300025938 Ga0207704_10291633 Ga0207704_102916332 180
1689 3300025938 Ga0207704_10309637 Ga0207704_103096371 180
1690 3300025938 Ga0207704_10670941 Ga0207704_106709411 180
1691 3300025938 Ga0207704_10735758 Ga0207704_107357582 180
1692 3300025940 Ga0207691_10010938 Ga0207691_100109386 180
1693 3300025940 Ga0207691_10018630 Ga0207691_100186307 180
1694 3300025940 Ga0207691_10061482 Ga0207691_100614823 180
1695 3300025940 Ga0207691_10116164 Ga0207691_101161642 180
1696 3300025940 Ga0207691_10128724 Ga0207691_101287243 180
1697 3300025940 Ga0207691_10557608 Ga0207691_105576082 180
1698 3300025942 Ga0207689_10014120 Ga0207689_100141202 180
1699 3300025942 Ga0207689_10014125 Ga0207689_100141257 180
1700 3300025942 Ga0207689_10014516 Ga0207689_100145167 180
1701 3300025942 Ga0207689_10035124 Ga0207689_100351243 180
1702 3300025942 Ga0207689_10039979 Ga0207689_100399793 180
1703 3300025942 Ga0207689_10086976 Ga0207689_100869763 180
1704 3300025942 Ga0207689_10096893 Ga0207689_100968932 180
1705 3300025942 Ga0207689_10106993 Ga0207689_101069933 180
1706 3300025942 Ga0207689_10245832 Ga0207689_102458322 180
1707 3300025942 Ga0207689_11181039 Ga0207689_111810391 180
1708 3300025944 Ga0207661_10005535 Ga0207661_100055357 180
1709 3300025944 Ga0207661_10015984 Ga0207661_100159842 180
1710 3300025944 Ga0207661_10062383 Ga0207661_100623833 180
1711 3300025944 Ga0207661_10244133 Ga0207661_102441331 180
1712 3300025944 Ga0207661_10249285 Ga0207661_102492852 180
1713 3300025944 Ga0207661_10336164 Ga0207661_103361642 180
1714 3300025944 Ga0207661_10452384 Ga0207661_104523842 180
1715 3300025944 Ga0207661_10627426 Ga0207661_106274262 180
1716 3300025945 Ga0207679_10002952 Ga0207679_100029528 180
1717 3300025945 Ga0207679_10124436 Ga0207679_101244363 180
1718 3300025945 Ga0207679_10531693 Ga0207679_105316932 180
1719 3300025945 Ga0207679_10617915 Ga0207679_106179152 180
1720 3300025949 Ga0207667_10000015 Ga0207667_10000015388 180
1721 3300025949 Ga0207667_10000312 Ga0207667_1000031253 180
1722 3300025949 Ga0207667_10010574 Ga0207667_100105745 180
1723 3300025949 Ga0207667_10015134 Ga0207667_1001513411 180
1724 3300025949 Ga0207667_10019147 Ga0207667_100191475 180
1725 3300025949 Ga0207667_10021902 Ga0207667_100219026 180
1726 3300025949 Ga0207667_10022432 Ga0207667_100224322 180
1727 3300025949 Ga0207667_10028216 Ga0207667_100282162 180
1728 3300025949 Ga0207667_10059871 Ga0207667_100598713 180
1729 3300025949 Ga0207667_10070905 Ga0207667_100709051 180
1730 3300025949 Ga0207667_10114199 Ga0207667_101141992 180
1731 3300025949 Ga0207667_10119730 Ga0207667_101197303 180
1732 3300025949 Ga0207667_10124861 Ga0207667_101248612 180
1733 3300025949 Ga0207667_10127495 Ga0207667_101274953 180
1734 3300025949 Ga0207667_10169389 Ga0207667_101693892 180
1735 3300025949 Ga0207667_10247716 Ga0207667_102477162 180
1736 3300025949 Ga0207667_10262002 Ga0207667_102620023 180
1737 3300025949 Ga0207667_10272588 Ga0207667_102725884 180
1738 3300025949 Ga0207667_10341906 Ga0207667_103419062 180
1739 3300025949 Ga0207667_10389826 Ga0207667_103898262 180
1740 3300025949 Ga0207667_10455610 Ga0207667_104556102 180
1741 3300025949 Ga0207667_10739555 Ga0207667_107395552 180
1742 3300025949 Ga0207667_10931131 Ga0207667_109311312 180
1743 3300025949 Ga0207667_11151446 Ga0207667_111514461 180
1744 3300025960 Ga0207651_10023116 Ga0207651_100231164 180
1745 3300025960 Ga0207651_10171772 Ga0207651_101717723 180
1746 3300025960 Ga0207651_10351648 Ga0207651_103516482 180
1747 3300025960 Ga0207651_10387206 Ga0207651_103872062 180
1748 3300025960 Ga0207651_10468386 Ga0207651_104683862 180
1749 3300025960 Ga0207651_10480403 Ga0207651_104804031 180
1750 3300025960 Ga0207651_10652923 Ga0207651_106529231 180
1751 3300025961 Ga0207712_10002097 Ga0207712_1000209710 180
1752 3300025961 Ga0207712_10007049 Ga0207712_100070493 180
1753 3300025961 Ga0207712_10007511 Ga0207712_100075114 180
1754 3300025961 Ga0207712_10017428 Ga0207712_100174285 180
1755 3300025961 Ga0207712_10045776 Ga0207712_100457763 180
1756 3300025961 Ga0207712_10052308 Ga0207712_100523084 180
1757 3300025961 Ga0207712_10124101 Ga0207712_101241012 180
1758 3300025961 Ga0207712_10199147 Ga0207712_101991473 180
1759 3300025972 Ga0207668_10227375 Ga0207668_102273752 180
1760 3300025972 Ga0207668_10372613 Ga0207668_103726132 180
1761 3300025972 Ga0207668_10757274 Ga0207668_107572742 180
1762 3300025972 Ga0207668_11077348 Ga0207668_110773481 180
1763 3300025972 Ga0207668_11382187 Ga0207668_113821871 180
1764 3300025981 Ga0207640_10021676 Ga0207640_100216763 180
1765 3300025981 Ga0207640_10034811 Ga0207640_100348112 180
1766 3300025981 Ga0207640_10218215 Ga0207640_102182151 180
1767 3300025981 Ga0207640_10292470 Ga0207640_102924701 180
1768 3300025981 Ga0207640_10383117 Ga0207640_103831172 180
1769 3300025981 Ga0207640_10388209 Ga0207640_103882091 180
1770 3300025986 Ga0207658_10009043 Ga0207658_100090439 180
1771 3300025986 Ga0207658_10059600 Ga0207658_100596003 180
1772 3300025986 Ga0207658_10068784 Ga0207658_100687842 180
1773 3300025986 Ga0207658_10435964 Ga0207658_104359642 180
1774 3300025986 Ga0207658_10851977 Ga0207658_108519771 180
1775 3300025986 Ga0207658_11225580 Ga0207658_112255801 180
1776 3300026023 Ga0207677_10053788 Ga0207677_100537882 180
1777 3300026023 Ga0207677_10061158 Ga0207677_100611584 180
1778 3300026023 Ga0207677_10128401 Ga0207677_101284013 180
1779 3300026023 Ga0207677_10219753 Ga0207677_102197532 180
1780 3300026035 Ga0207703_10046724 Ga0207703_100467243 180
1781 3300026035 Ga0207703_10190881 Ga0207703_101908812 180
1782 3300026035 Ga0207703_10331857 Ga0207703_103318572 180
1783 3300026035 Ga0207703_10354126 Ga0207703_103541263 180
1784 3300026041 Ga0207639_10007826 Ga0207639_100078264 180
1785 3300026041 Ga0207639_10011425 Ga0207639_100114256 180
1786 3300026041 Ga0207639_10018365 Ga0207639_100183657 180
1787 3300026041 Ga0207639_10107927 Ga0207639_101079272 180
1788 3300026041 Ga0207639_10110545 Ga0207639_101105453 180
1789 3300026041 Ga0207639_10136871 Ga0207639_101368712 180
1790 3300026041 Ga0207639_10279104 Ga0207639_102791042 180
1791 3300026041 Ga0207639_10364924 Ga0207639_103649242 180
1792 3300026041 Ga0207639_10561488 Ga0207639_105614882 180
1793 3300026041 Ga0207639_10591482 Ga0207639_105914822 180
1794 3300026041 Ga0207639_10784444 Ga0207639_107844442 180
1795 3300026041 Ga0207639_10837346 Ga0207639_108373462 180
1796 3300026067 Ga0207678_10025688 Ga0207678_100256886 180
1797 3300026067 Ga0207678_10354464 Ga0207678_103544642 180
1798 3300026067 Ga0207678_10572888 Ga0207678_105728882 180
1799 3300026067 Ga0207678_10727525 Ga0207678_107275251 180
1800 3300026075 Ga0207708_10104264 Ga0207708_101042642 180
1801 3300026075 Ga0207708_10559217 Ga0207708_105592172 180
1802 3300026075 Ga0207708_10736877 Ga0207708_107368771 180
1803 3300026075 Ga0207708_10738123 Ga0207708_107381232 180
1804 3300026075 Ga0207708_10759820 Ga0207708_107598201 180
1805 3300026078 Ga0207702_10005403 Ga0207702_1000540310 180
1806 3300026078 Ga0207702_10019319 Ga0207702_100193197 180
1807 3300026078 Ga0207702_10022970 Ga0207702_100229702 180
1808 3300026078 Ga0207702_10026748 Ga0207702_100267483 180
1809 3300026078 Ga0207702_10033741 Ga0207702_100337414 180
1810 3300026078 Ga0207702_10091404 Ga0207702_100914043 180
1811 3300026078 Ga0207702_10180424 Ga0207702_101804242 180
1812 3300026078 Ga0207702_11233290 Ga0207702_112332902 180
1813 3300026088 Ga0207641_10000448 Ga0207641_1000044829 180
1814 3300026088 Ga0207641_10005547 Ga0207641_100055477 180
1815 3300026088 Ga0207641_10749801 Ga0207641_107498012 180
1816 3300026088 Ga0207641_10821035 Ga0207641_108210352 180
1817 3300026089 Ga0207648_10003051 Ga0207648_1000305116 180
1818 3300026089 Ga0207648_10004234 Ga0207648_100042343 180
1819 3300026089 Ga0207648_10007503 Ga0207648_100075035 180
1820 3300026089 Ga0207648_10007532 Ga0207648_100075323 180
1821 3300026089 Ga0207648_10043979 Ga0207648_100439793 180
1822 3300026089 Ga0207648_10081140 Ga0207648_100811403 180
1823 3300026089 Ga0207648_10182205 Ga0207648_101822052 180
1824 3300026089 Ga0207648_10453081 Ga0207648_104530812 180
1825 3300026095 Ga0207676_10166829 Ga0207676_101668292 180
1826 3300026095 Ga0207676_10289221 Ga0207676_102892212 180
1827 3300026095 Ga0207676_10357183 Ga0207676_103571832 180
1828 3300026095 Ga0207676_10361292 Ga0207676_103612922 180
1829 3300026095 Ga0207676_10401709 Ga0207676_104017093 180
1830 3300026095 Ga0207676_10491131 Ga0207676_104911312 180
1831 3300026095 Ga0207676_10883467 Ga0207676_108834671 180
1832 3300026116 Ga0207674_10006765 Ga0207674_100067652 180
1833 3300026116 Ga0207674_10013334 Ga0207674_100133345 180
1834 3300026116 Ga0207674_10020241 Ga0207674_100202416 180
1835 3300026116 Ga0207674_10036449 Ga0207674_100364492 180
1836 3300026116 Ga0207674_10048553 Ga0207674_100485532 180
1837 3300026116 Ga0207674_10067944 Ga0207674_100679442 180
1838 3300026116 Ga0207674_10071251 Ga0207674_100712513 180
1839 3300026116 Ga0207674_10082252 Ga0207674_100822523 180
1840 3300026116 Ga0207674_10127056 Ga0207674_101270561 180
1841 3300026116 Ga0207674_10168314 Ga0207674_101683141 180
1842 3300026116 Ga0207674_10184414 Ga0207674_101844142 180
1843 3300026116 Ga0207674_10191592 Ga0207674_101915923 180
1844 3300026116 Ga0207674_10194101 Ga0207674_101941013 180
1845 3300026116 Ga0207674_10431105 Ga0207674_104311052 180
1846 3300026116 Ga0207674_11244785 Ga0207674_112447851 180
1847 3300026118 Ga0207675_100006844 Ga0207675_1000068448 180
1848 3300026118 Ga0207675_100007135 Ga0207675_1000071355 180
1849 3300026118 Ga0207675_100007786 Ga0207675_10000778611 180
1850 3300026118 Ga0207675_100037981 Ga0207675_1000379814 180
1851 3300026118 Ga0207675_100105086 Ga0207675_1001050862 180
1852 3300026118 Ga0207675_100181530 Ga0207675_1001815302 180
1853 3300026118 Ga0207675_100269248 Ga0207675_1002692482 180
1854 3300026118 Ga0207675_100407721 Ga0207675_1004077211 180
1855 3300026118 Ga0207675_100841539 Ga0207675_1008415391 180
1856 3300026121 Ga0207683_10002182 Ga0207683_100021823 180
1857 3300026121 Ga0207683_10060090 Ga0207683_100600903 180
1858 3300026121 Ga0207683_10120674 Ga0207683_101206743 180
1859 3300026121 Ga0207683_10661454 Ga0207683_106614542 180
1860 3300026142 Ga0207698_10002660 Ga0207698_100026606 180
1861 3300026142 Ga0207698_10006772 Ga0207698_100067728 180
1862 3300026142 Ga0207698_10007114 Ga0207698_100071143 180
1863 3300026142 Ga0207698_10008350 Ga0207698_100083508 180
1864 3300026142 Ga0207698_10048501 Ga0207698_100485012 180
1865 3300026142 Ga0207698_10057000 Ga0207698_100570005 180
1866 3300026142 Ga0207698_10123869 Ga0207698_101238692 180
1867 3300026142 Ga0207698_10137013 Ga0207698_101370132 180
1868 3300026142 Ga0207698_10141048 Ga0207698_101410483 180
1869 3300026142 Ga0207698_10216612 Ga0207698_102166123 180
1870 3300026142 Ga0207698_10348046 Ga0207698_103480462 180
1871 3300026142 Ga0207698_10348635 Ga0207698_103486352 180
1872 3300026142 Ga0207698_10383332 Ga0207698_103833322 180
1873 3300026142 Ga0207698_10450229 Ga0207698_104502292 180
1874 3300026142 Ga0207698_10591332 Ga0207698_105913322 180
1875 3300027361 Ga0209489_109555 Ga0209489_1095555 180
1876 3300027471 Ga0209995_1003974 Ga0209995_10039741 180
1877 3300027526 Ga0209968_1000701 Ga0209968_10007015 180
1878 3300027526 Ga0209968_1021851 Ga0209968_10218512 180
1879 3300027666 Ga0209282_1021554 Ga0209282_10215542 180
1880 3300027876 Ga0209974_10023112 Ga0209974_100231123 180
1881 3300027876 Ga0209974_10027014 Ga0209974_100270142 180
1882 3300028379 Ga0268266_10000057 Ga0268266_1000005740 180
1883 3300028379 Ga0268266_10000121 Ga0268266_1000012154 180
1884 3300028379 Ga0268266_10027021 Ga0268266_100270217 180
1885 3300028380 Ga0268265_10068066 Ga0268265_100680663 180
1886 3300028380 Ga0268265_10158848 Ga0268265_101588483 180
1887 3300028380 Ga0268265_10245844 Ga0268265_102458441 180
1888 3300028380 Ga0268265_10259976 Ga0268265_102599763 180
1889 3300028380 Ga0268265_10318486 Ga0268265_103184862 180
1890 3300028380 Ga0268265_11202859 Ga0268265_112028591 180
1891 3300028381 Ga0268264_10000143 Ga0268264_1000014352 180
1892 3300028381 Ga0268264_10024074 Ga0268264_100240742 180
1893 3300028381 Ga0268264_10054205 Ga0268264_100542054 180
1894 3300028381 Ga0268264_10132175 Ga0268264_101321752 180
1895 3300028381 Ga0268264_10215233 Ga0268264_102152331 180
1896 3300028381 Ga0268264_10356716 Ga0268264_103567162 180
1897 3300028381 Ga0268264_10444108 Ga0268264_104441082 180
1898 3300028381 Ga0268264_10446781 Ga0268264_104467812 180
1899 3300028573 Ga0265334_10011151 Ga0265334_100111512 180
1900 3300028786 Ga0307517_10000198 Ga0307517_1000019850 180
1901 3300028786 Ga0307517_10175469 Ga0307517_101754692 180
1902 3300028794 Ga0307515_10000003 Ga0307515_10000003705 180
1903 3300028794 Ga0307515_10037978 Ga0307515_100379788 180
1904 3300028794 Ga0307515_10056048 Ga0307515_100560487 180
1905 3300028794 Ga0307515_10083712 Ga0307515_100837124 180
1906 3300028794 Ga0307515_10500020 Ga0307515_105000201 180
1907 3300028800 Ga0265338_10102086 Ga0265338_101020862 180
1908 3300031250 Ga0265331_10178352 Ga0265331_101783522 180
1909 3300031251 Ga0265327_10000006 Ga0265327_10000006383 180
1910 3300031251 Ga0265327_10000073 Ga0265327_1000007338 180
1911 3300031251 Ga0265327_10041400 Ga0265327_100414002 180
1912 3300031251 Ga0265327_10169777 Ga0265327_101697771 180
1913 3300031251 Ga0265327_10202665 Ga0265327_102026652 180
1914 3300031456 Ga0307513_10031456 Ga0307513_100314564 180
1915 3300031456 Ga0307513_10123404 Ga0307513_101234046 180
1916 3300031456 Ga0307513_10272147 Ga0307513_102721472 180
1917 3300031456 Ga0307513_10298713 Ga0307513_102987132 180
1918 3300031456 Ga0307513_10637710 Ga0307513_106377102 180
1919 3300031507 Ga0307509_10024880 Ga0307509_100248803 180
1920 3300031507 Ga0307509_10042071 Ga0307509_100420714 180
1921 3300031507 Ga0307509_10042258 Ga0307509_100422584 180
1922 3300031507 Ga0307509_10186329 Ga0307509_101863292 180
1923 3300031507 Ga0307509_10273900 Ga0307509_102739002 180
1924 3300031507 Ga0307509_10525587 Ga0307509_105255872 180
1925 3300031548 Ga0307408_100000464 Ga0307408_10000046419 180
1926 3300031548 Ga0307408_100000560 Ga0307408_10000056011 180
1927 3300031548 Ga0307408_100001326 Ga0307408_1000013267 180
1928 3300031548 Ga0307408_100033231 Ga0307408_1000332314 180
1929 3300031595 Ga0265313_10185747 Ga0265313_101857471 180
1930 3300031730 Ga0307516_10068016 Ga0307516_100680164 180
1931 3300031730 Ga0307516_10250469 Ga0307516_102504692 180
1932 3300031731 Ga0307405_10000009 Ga0307405_1000000925 180
1933 3300031731 Ga0307405_10158557 Ga0307405_101585571 180
1934 3300031731 Ga0307405_10587453 Ga0307405_105874531 180
1935 3300031824 Ga0307413_10000050 Ga0307413_100000506 180
1936 3300031824 Ga0307413_10018591 Ga0307413_100185915 180
1937 3300031824 Ga0307413_10178925 Ga0307413_101789251 180
1938 3300031852 Ga0307410_10248187 Ga0307410_102481873 180
1939 3300031901 Ga0307406_10032038 Ga0307406_100320383 180
1940 3300031901 Ga0307406_10123669 Ga0307406_101236693 180
1941 3300031901 Ga0307406_10242687 Ga0307406_102426872 180
1942 3300031903 Ga0307407_10000001 Ga0307407_10000001206 180
1943 3300031903 Ga0307407_10058075 Ga0307407_100580752 180
1944 3300031903 Ga0307407_10702074 Ga0307407_107020742 180
1945 3300031903 Ga0307407_10704824 Ga0307407_107048241 180
1946 3300031911 Ga0307412_10000001 Ga0307412_10000001300 180
1947 3300031911 Ga0307412_10008180 Ga0307412_100081804 180
1948 3300031911 Ga0307412_10534604 Ga0307412_105346042 180
1949 3300031995 Ga0307409_100014576 Ga0307409_1000145764 180
1950 3300031995 Ga0307409_100145114 Ga0307409_1001451144 180
1951 3300032002 Ga0307416_100000008 Ga0307416_100000008183 180
1952 3300032002 Ga0307416_100000280 Ga0307416_10000028015 180
1953 3300032002 Ga0307416_100000457 Ga0307416_1000004574 180
1954 3300032002 Ga0307416_100055210 Ga0307416_1000552103 180
1955 3300032002 Ga0307416_100781977 Ga0307416_1007819772 180
1956 3300032004 Ga0307414_10000470 Ga0307414_1000047020 180
1957 3300032004 Ga0307414_10002491 Ga0307414_100024919 180
1958 3300032004 Ga0307414_10011763 Ga0307414_100117636 180
1959 3300032004 Ga0307414_10011973 Ga0307414_100119734 180
1960 3300032004 Ga0307414_10032798 Ga0307414_100327985 180
1961 3300032004 Ga0307414_10033180 Ga0307414_100331803 180
1962 3300032004 Ga0307414_10045703 Ga0307414_100457034 180
1963 3300032004 Ga0307414_10055710 Ga0307414_100557103 180
1964 3300032004 Ga0307414_10061313 Ga0307414_100613134 180
1965 3300032004 Ga0307414_10069644 Ga0307414_100696442 180
1966 3300032004 Ga0307414_10196853 Ga0307414_101968532 180
1967 3300032004 Ga0307414_10224060 Ga0307414_102240603 180
1968 3300032004 Ga0307414_10246724 Ga0307414_102467242 180
1969 3300032004 Ga0307414_10249299 Ga0307414_102492993 180
1970 3300032004 Ga0307414_10265751 Ga0307414_102657512 180
1971 3300032004 Ga0307414_10852471 Ga0307414_108524711 180
1972 3300032004 Ga0307414_11517019 Ga0307414_115170191 180
1973 3300032005 Ga0307411_10000003 Ga0307411_10000003110 180
1974 3300032005 Ga0307411_10024891 Ga0307411_100248913 180
1975 3300032005 Ga0307411_10104661 Ga0307411_101046612 180
1976 3300032005 Ga0307411_10161032 Ga0307411_101610323 180
1977 3300032005 Ga0307411_10731211 Ga0307411_107312112 180
1978 3300032126 Ga0307415_100006212 Ga0307415_1000062124 180
1979 3300033180 Ga0307510_10002841 Ga0307510_100028415 180
1980 3300033180 Ga0307510_10003113 Ga0307510_1000311314 180
1981 3300033180 Ga0307510_10005580 Ga0307510_100055809 180
1982 3300035115 Ga0373941_0012741 Ga0373941_0012741_731_1273 180
1983 3300035117 Ga0373953_0160218 Ga0373953_0160218_369_953 180
1984 3300035118 Ga0373954_0060551 Ga0373954_0060551_1181_1765 180
1985 3300035171 Ga0373946_0392717 Ga0373946_0392717_56_640 180
1986 3300035172 Ga0373955_0066138 Ga0373955_0066138_207_845 180
1987 3300035692 Ga0373935_0202636 Ga0373935_0202636_112_702 180
1988 3300035695 Ga0373927_0098455 Ga0373927_0098455_97_675 180
1989 3300035724 Ga0373933_0004359 Ga0373933_0004359_2151_2789 180
1990 3300036401 Ga0373937_0100426 Ga0373937_0100426_1296_1934 180
1991 3300036401 Ga0373937_0346542 Ga0373937_0346542_606_1196 180
1992 3300037068 Ga0373925_0250934 Ga0373925_0250934_691_1329 180
1993 3300037312 Ga0395899_0000024 Ga0395899_0000024_319613_320155 180
1994 3300037312 Ga0395899_0000027 Ga0395899_0000027_116497_117039 180
1995 3300037312 Ga0395899_0000811 Ga0395899_0000811_17768_18310 180
1996 3300037312 Ga0395899_0000959 Ga0395899_0000959_5795_6379 180
1997 3300037312 Ga0395899_0002874 Ga0395899_0002874_12104_12688 180
1998 3300037312 Ga0395899_0035979 Ga0395899_0035979_2786_3397 180
1999 3300037312 Ga0395899_0040296 Ga0395899_0040296_595_1137 180
2000 3300037312 Ga0395899_0099015 Ga0395899_0099015_1325_1909 180
2001 3300037312 Ga0395899_0122872 Ga0395899_0122872_751_1335 180
2002 3300037312 Ga0395899_0131394 Ga0395899_0131394_335_919 180
2003 3300037312 Ga0395899_0175620 Ga0395899_0175620_655_1239 180
2004 3300037418 Ga0395900_0000275 Ga0395900_0000275_30963_31505 180
2005 3300037418 Ga0395900_0001518 Ga0395900_0001518_14032_14574 180
2006 3300037418 Ga0395900_0001963 Ga0395900_0001963_21618_22202 180
2007 3300037418 Ga0395900_0009605 Ga0395900_0009605_8861_9445 180
2008 3300037418 Ga0395900_0010124 Ga0395900_0010124_2601_3143 180
2009 3300037418 Ga0395900_0031957 Ga0395900_0031957_843_1454 180
2010 3300037418 Ga0395900_0122148 Ga0395900_0122148_490_1074 180
2011 3300037418 Ga0395900_0127621 Ga0395900_0127621_493_1035 180
2012 3300037418 Ga0395900_0175353 Ga0395900_0175353_569_1153 180
2013 3300037418 Ga0395900_0533557 Ga0395900_0533557_339_923 180
2014 3300037418 Ga0395900_0573438 Ga0395900_0573438_415_957 180
2015 3300037466 Ga0395898_0005476 Ga0395898_0005476_1027_1611 180
2016 3300037466 Ga0395898_0009566 Ga0395898_0009566_4417_4959 180
2017 3300037466 Ga0395898_0015148 Ga0395898_0015148_5199_5810 180
2018 3300037466 Ga0395898_0086762 Ga0395898_0086762_2379_2963 180
2019 3300037466 Ga0395898_0107010 Ga0395898_0107010_1571_2155 180
2020 3300037466 Ga0395898_0137284 Ga0395898_0137284_569_1153 180
2021 3300037466 Ga0395898_1089676 Ga0395898_1089676_74_658 180
2022 3300037471 Ga0395905_0000001 Ga0395905_0000001_1586544_1587104 180
2023 3300037471 Ga0395905_0000248 Ga0395905_0000248_18404_18946 180
2024 3300037471 Ga0395905_0000327 Ga0395905_0000327_19095_19637 180
2025 3300037471 Ga0395905_0018039 Ga0395905_0018039_2619_3203 180
2026 3300037471 Ga0395905_0020199 Ga0395905_0020199_1671_2255 180
2027 3300037471 Ga0395905_0846367 Ga0395905_0846367_63_653 180
2028 3300038443 Ga0395901_0000595 Ga0395901_0000595_10528_11070 180
2029 3300038443 Ga0395901_0005557 Ga0395901_0005557_10555_11139 180
2030 3300038443 Ga0395901_0008911 Ga0395901_0008911_6300_6842 180
2031 3300038443 Ga0395901_0012588 Ga0395901_0012588_140_724 180
2032 3300038443 Ga0395901_0028117 Ga0395901_0028117_103_714 180
2033 3300038443 Ga0395901_0086288 Ga0395901_0086288_1851_2393 180
2034 3300038443 Ga0395901_0219105 Ga0395901_0219105_813_1397 180
2035 3300038443 Ga0395901_0244845 Ga0395901_0244845_525_1136 180
2036 3300038443 Ga0395901_0270817 Ga0395901_0270817_127_711 180
2037 3300038443 Ga0395901_0396845 Ga0395901_0396845_823_1407 180
2038 3300038443 Ga0395901_0460781 Ga0395901_0460781_328_912 180
2039 3300039437 Ga0436365_1408525 Ga0436365_1408525_455_1045 180
2040 3300039437 Ga0436365_1888183 Ga0436365_1888183_4098_4688 180
2041 3300039447 Ga0436361_1048734 Ga0436361_1048734_1076_1618 180
2042 3300041404 Ga0439436_0003095 Ga0439436_0003095_673_1251 180
2043 3300041406 Ga0439439_0012158 Ga0439439_0012158_1022_1600 180
2044 3300041406 Ga0439439_0031309 Ga0439439_0031309_648_1226 180
2045 3300041406 Ga0439439_0049064 Ga0439439_0049064_475_1053 180
2046 3300041407 Ga0439447_000099 Ga0439447_000099_10340_10888 180
2047 3300041411 Ga0439466_0026163 Ga0439466_0026163_1167_1715 180
2048 3300041413 Ga0439465_0027791 Ga0439465_0027791_637_1221 180
2049 3300041413 Ga0439465_0120106 Ga0439465_0120106_106_684 180
2050 3300041443 Ga0451789_0478833 Ga0451789_0478833_40_624 180
2051 3300041451 Ga0451791_1510331 Ga0451791_1510331_410_958 180
2052 3300041459 Ga0451800_0163675 Ga0451800_0163675_25_570 180
2053 3300041459 Ga0451800_0635678 Ga0451800_0635678_17_574 180
2054 3300041460 Ga0451802_0057036 Ga0451802_0057036_85_645 180
2055 3300041461 Ga0451805_003895 Ga0451805_003895_24_566 180
2056 3300041463 Ga0451804_0777315 Ga0451804_0777315_37_621 180
2057 3300041464 Ga0451808_35622 Ga0451808_35622_17_559 180
2058 3300041503 Ga0451847_0777468 Ga0451847_0777468_17_604 180
2059 3300041507 Ga0451851_0859858 Ga0451851_0859858_530_1108 180
2060 3300041997 Ga0439431_0043290 Ga0439431_0043290_456_1040 180
2061 3300041999 Ga0439433_0066144 Ga0439433_0066144_121_705 180
2062 3300042004 Ga0439445_0012949 Ga0439445_0012949_1025_1573 180
2063 3300042005 Ga0439448_0099296 Ga0439448_0099296_242_784 180
2064 3300042007 Ga0439449_0013804 Ga0439449_0013804_628_1242 180
2065 3300042007 Ga0439449_0066164 Ga0439449_0066164_84_668 180
2066 3300042007 Ga0439449_0080444 Ga0439449_0080444_516_1094 180
2067 3300042012 Ga0439455_0061805 Ga0439455_0061805_311_853 180
2068 3300042014 Ga0439457_003882 Ga0439457_003882_1598_2212 180
2069 3300042014 Ga0439457_009936 Ga0439457_009936_1284_1868 180
2070 3300042014 Ga0439457_041414 Ga0439457_041414_262_822 180
2071 3300042015 Ga0439462_0021320 Ga0439462_0021320_411_1025 180
2072 3300042125 Ga0450923_005885 Ga0450923_005885_539_1123 180
2073 3300042134 Ga0450898_019644 Ga0450898_019644_545_1129 180
2074 3300042435 Ga0439434_0178898 Ga0439434_0178898_59_643 180
2075 3300042876 Ga0451577_0000015 Ga0451577_0000015_517879_518421 180
2076 3300042876 Ga0451577_0000022 Ga0451577_0000022_275301_275849 180
2077 3300042876 Ga0451577_0125519 Ga0451577_0125519_1441_1983 180
2078 3300042876 Ga0451577_0128218 Ga0451577_0128218_1096_1653 180
2079 3300042876 Ga0451577_0192250 Ga0451577_0192250_1014_1562 180
2080 3300042876 Ga0451577_0200414 Ga0451577_0200414_26_589 180
2081 3300042876 Ga0451577_0411214 Ga0451577_0411214_28_570 180
2082 3300042876 Ga0451577_1333008 Ga0451577_1333008_16_597 180
2083 3300044656 Ga0466969_0000847 Ga0466969_0000847_6575_7153 180
2084 3300044656 Ga0466969_0013019 Ga0466969_0013019_3618_4160 180
2085 3300044658 Ga0466972_0000010 Ga0466972_0000010_86764_87354 180
2086 3300044658 Ga0466972_0000143 Ga0466972_0000143_49346_49924 180
2087 3300044658 Ga0466972_0001431 Ga0466972_0001431_5965_6555 180
2088 3300044658 Ga0466972_0003318 Ga0466972_0003318_34_612 180
2089 3300044658 Ga0466972_0093463 Ga0466972_0093463_576_1154 180
2090 3300044673 Ga0453683_0000397 Ga0453683_0000397_33990_34538 180
2091 3300044673 Ga0453683_0021715 Ga0453683_0021715_2724_3281 180
2092 3300044673 Ga0453683_0039007 Ga0453683_0039007_1620_2162 180
2093 3300044673 Ga0453683_0051344 Ga0453683_0051344_1293_1835 180
2094 3300044673 Ga0453683_0203487 Ga0453683_0203487_434_991 180
2095 3300044673 Ga0453683_0232845 Ga0453683_0232845_532_1089 180
2096 3300044683 Ga0466965_0047350 Ga0466965_0047350_383_961 180
2097 3300044684 Ga0466966_0000176 Ga0466966_0000176_25191_25769 180
2098 3300044693 Ga0466961_0024842 Ga0466961_0024842_2163_2705 180
2099 3300044693 Ga0466961_0040409 Ga0466961_0040409_722_1312 180
2100 3300044693 Ga0466961_0417115 Ga0466961_0417115_159_743 180
2101 3300044693 Ga0466961_0548213 Ga0466961_0548213_88_666 180
2102 3300044706 Ga0466964_0023938 Ga0466964_0023938_1622_2212 180
2103 3300044706 Ga0466964_0144784 Ga0466964_0144784_493_1071 180
2104 3300044712 Ga0453684_0000081 Ga0453684_0000081_335373_335915 180
2105 3300044712 Ga0453684_0000501 Ga0453684_0000501_112348_112896 180
2106 3300044712 Ga0453684_0001733 Ga0453684_0001733_34815_35372 180
2107 3300044712 Ga0453684_0012899 Ga0453684_0012899_11705_12259 180
2108 3300044712 Ga0453684_0014288 Ga0453684_0014288_12000_12557 180
2109 3300044712 Ga0453684_0026959 Ga0453684_0026959_1479_2045 180
2110 3300044712 Ga0453684_0043669 Ga0453684_0043669_4132_4695 180
2111 3300044712 Ga0453684_0047222 Ga0453684_0047222_1216_1776 180
2112 3300044712 Ga0453684_0070065 Ga0453684_0070065_3638_4195 180
2113 3300044712 Ga0453684_0082045 Ga0453684_0082045_2208_2771 180
2114 3300044712 Ga0453684_0083320 Ga0453684_0083320_172_729 180
2115 3300044712 Ga0453684_0094097 Ga0453684_0094097_962_1504 180
2116 3300044712 Ga0453684_0184631 Ga0453684_0184631_372_929 180
2117 3300044712 Ga0453684_0243917 Ga0453684_0243917_304_888 180
2118 3300044712 Ga0453684_0247974 Ga0453684_0247974_714_1271 180
2119 3300044712 Ga0453684_0306417 Ga0453684_0306417_666_1229 180
2120 3300044712 Ga0453684_0609057 Ga0453684_0609057_208_771 180
2121 3300044712 Ga0453684_0640069 Ga0453684_0640069_555_1097 180
2122 3300044719 Ga0466971_0078790 Ga0466971_0078790_465_1055 180
2123 3300044735 Ga0466968_0008474 Ga0466968_0008474_2186_2764 180
2124 3300044735 Ga0466968_0120461 Ga0466968_0120461_191_781 180
2125 3300044765 Ga0466970_0000471 Ga0466970_0000471_7370_7960 180
2126 3300044765 Ga0466970_0066556 Ga0466970_0066556_340_930 180
2127 3300044765 Ga0466970_0074960 Ga0466970_0074960_805_1374 180
2128 3300044765 Ga0466970_0153571 Ga0466970_0153571_543_1127 180
2129 3300044765 Ga0466970_0206243 Ga0466970_0206243_216_806 180
2130 3300044842 Ga0466957_0010181 Ga0466957_0010181_4589_5167 180
2131 3300044842 Ga0466957_0013600 Ga0466957_0013600_1175_1753 180
2132 3300044842 Ga0466957_0364999 Ga0466957_0364999_181_771 180
2133 3300044901 Ga0466960_0088289 Ga0466960_0088289_840_1415 180
2134 3300044901 Ga0466960_0122226 Ga0466960_0122226_90_680 180
2135 3300045049 Ga0466959_0000016 Ga0466959_0000016_73694_74272 180
2136 3300045049 Ga0466959_0031107 Ga0466959_0031107_2911_3501 180
2137 3300045049 Ga0466959_0059033 Ga0466959_0059033_73_615 180
2138 3300045051 Ga0451576_0000002 Ga0451576_0000002_72070_72633 180
2139 3300045051 Ga0451576_0000044 Ga0451576_0000044_172705_173253 180
2140 3300045051 Ga0451576_0000294 Ga0451576_0000294_69067_69609 180
2141 3300045051 Ga0451576_0008161 Ga0451576_0008161_10887_11450 180
2142 3300045051 Ga0451576_0246205 Ga0451576_0246205_1241_1804 180
2143 3300045051 Ga0451576_0279893 Ga0451576_0279893_451_993 180
2144 3300045051 Ga0451576_0464039 Ga0451576_0464039_546_1130 180
2145 3300045051 Ga0451576_0470256 Ga0451576_0470256_729_1283 180
2146 3300045051 Ga0451576_0496355 Ga0451576_0496355_165_731 180
2147 3300045976 Ga0466967_0695477 Ga0466967_0695477_374_964 180
2148 3300046454 Ga0495592_0054736 Ga0495592_0054736_1677_2234 180
2149 3300046454 Ga0495592_0075961 Ga0495592_0075961_458_1012 180
2150 3300046459 Ga0495629_0305531 Ga0495629_0305531_249_791 180
2151 3300046459 Ga0495629_0336064 Ga0495629_0336064_280_864 180
2152 3300046460 Ga0495638_0045407 Ga0495638_0045407_88_678 180
2153 3300046460 Ga0495638_0051750 Ga0495638_0051750_171_713 180
2154 3300046460 Ga0495638_0064462 Ga0495638_0064462_480_1064 180
2155 3300046460 Ga0495638_0103801 Ga0495638_0103801_120_698 180
2156 3300046460 Ga0495638_0170306 Ga0495638_0170306_333_923 180
2157 3300046460 Ga0495638_0251172 Ga0495638_0251172_17_559 180
2158 3300046462 Ga0495651_0183223 Ga0495651_0183223_95_685 180
2159 3300046462 Ga0495651_0279316 Ga0495651_0279316_72_614 180
2160 3300046463 Ga0495653_0642132 Ga0495653_0642132_17_607 180
2161 3300046471 Ga0495650_0000231 Ga0495650_0000231_42685_43227 180
2162 3300046471 Ga0495650_0017042 Ga0495650_0017042_2020_2562 180
2163 3300046471 Ga0495650_0151073 Ga0495650_0151073_264_815 180
2164 3300046472 Ga0495580_0185216 Ga0495580_0185216_556_1146 180
2165 3300046476 Ga0495662_0118257 Ga0495662_0118257_672_1229 180
2166 3300046477 Ga0495664_0097044 Ga0495664_0097044_465_1055 180
2167 3300046492 Ga0495585_0000037 Ga0495585_0000037_47159_47701 180
2168 3300046492 Ga0495585_0001133 Ga0495585_0001133_7232_7774 180
2169 3300046492 Ga0495585_0129904 Ga0495585_0129904_26_568 180
2170 3300046500 Ga0495596_0131746 Ga0495596_0131746_168_710 180
2171 3300046501 Ga0495607_0019400 Ga0495607_0019400_3080_3631 180
2172 3300046507 Ga0495606_0000060 Ga0495606_0000060_57122_57694 180
2173 3300046507 Ga0495606_0005310 Ga0495606_0005310_2797_3348 180
2174 3300046507 Ga0495606_0007870 Ga0495606_0007870_7464_8054 180
2175 3300046507 Ga0495606_0010821 Ga0495606_0010821_100_642 180
2176 3300046507 Ga0495606_0015097 Ga0495606_0015097_607_1149 180
2177 3300046507 Ga0495606_0019551 Ga0495606_0019551_2369_2911 180
2178 3300046507 Ga0495606_0146448 Ga0495606_0146448_109_651 180
2179 3300046507 Ga0495606_0236465 Ga0495606_0236465_440_991 180
2180 3300046507 Ga0495606_0283612 Ga0495606_0283612_71_613 180
2181 3300046507 Ga0495606_0305221 Ga0495606_0305221_224_766 180
2182 3300046507 Ga0495606_0349118 Ga0495606_0349118_126_668 180
2183 3300046512 Ga0495610_0000129 Ga0495610_0000129_78764_79306 180
2184 3300046512 Ga0495610_0000751 Ga0495610_0000751_25903_26445 180
2185 3300046512 Ga0495610_0010933 Ga0495610_0010933_3621_4208 180
2186 3300046512 Ga0495610_0212732 Ga0495610_0212732_75_623 180
2187 3300046513 Ga0495616_0002278 Ga0495616_0002278_5524_6066 180
2188 3300046513 Ga0495616_0015198 Ga0495616_0015198_150_701 180
2189 3300046513 Ga0495616_0048996 Ga0495616_0048996_231_773 180
2190 3300046516 Ga0495628_0036237 Ga0495628_0036237_1300_1938 180
2191 3300046517 Ga0495630_0009753 Ga0495630_0009753_4906_5544 180
2192 3300046518 Ga0495631_0001037 Ga0495631_0001037_4239_4781 180
2193 3300046519 Ga0495632_0023088 Ga0495632_0023088_267_809 180
2194 3300046520 Ga0495637_0037979 Ga0495637_0037979_821_1363 180
2195 3300046520 Ga0495637_0103205 Ga0495637_0103205_223_765 180
2196 3300046522 Ga0495643_0001228 Ga0495643_0001228_21396_21947 180
2197 3300046523 Ga0495644_0025559 Ga0495644_0025559_1485_2027 180
2198 3300046524 Ga0495648_0028735 Ga0495648_0028735_2770_3312 180
2199 3300046524 Ga0495648_0049191 Ga0495648_0049191_32_622 180
2200 3300046524 Ga0495648_0270039 Ga0495648_0270039_190_732 180
2201 3300046529 Ga0495652_0135024 Ga0495652_0135024_47_604 180
2202 3300046529 Ga0495652_0393988 Ga0495652_0393988_76_618 180
2203 3300046529 Ga0495652_0448466 Ga0495652_0448466_19_561 180
2204 3300046530 Ga0495654_0038042 Ga0495654_0038042_159_701 180
2205 3300046533 Ga0495640_0509779 Ga0495640_0509779_11_568 180
2206 3300046535 Ga0495586_0145714 Ga0495586_0145714_208_762 180
2207 3300046536 Ga0495587_0076902 Ga0495587_0076902_400_984 180
2208 3300046538 Ga0495609_0004430 Ga0495609_0004430_3839_4381 180
2209 3300046538 Ga0495609_0229356 Ga0495609_0229356_155_697 180
2210 3300046539 Ga0495621_0005942 Ga0495621_0005942_1255_1839 180
2211 3300046543 Ga0495645_0159267 Ga0495645_0159267_372_929 180
2212 3300046543 Ga0495645_0175310 Ga0495645_0175310_293_883 180
2213 3300046557 Ga0495622_0235103 Ga0495622_0235103_121_663 180
2214 3300046558 Ga0495633_0000015 Ga0495633_0000015_119741_120283 180
2215 3300046558 Ga0495633_0004451 Ga0495633_0004451_4091_4633 180
2216 3300046558 Ga0495633_0055623 Ga0495633_0055623_1004_1546 180
2217 3300046616 Ga0495668_0000041 Ga0495668_0000041_56311_56853 180
2218 3300046616 Ga0495668_0007476 Ga0495668_0007476_2427_3005 180
2219 3300046648 Ga0495611_0000081 Ga0495611_0000081_59526_60116 180
2220 3300046660 Ga0495625_0000191 Ga0495625_0000191_51296_51838 180
2221 3300046660 Ga0495625_0000663 Ga0495625_0000663_47612_48154 180
2222 3300046660 Ga0495625_0001074 Ga0495625_0001074_12680_13222 180
2223 3300046660 Ga0495625_0006807 Ga0495625_0006807_8164_8706 180
2224 3300046660 Ga0495625_0029048 Ga0495625_0029048_2851_3402 180
2225 3300046660 Ga0495625_0079686 Ga0495625_0079686_498_1040 180
2226 3300046660 Ga0495625_0392327 Ga0495625_0392327_42_584 180
2227 3300046663 Ga0495635_0103291 Ga0495635_0103291_520_1158 180
2228 3300046663 Ga0495635_0104939 Ga0495635_0104939_1308_1898 180
2229 3300046665 Ga0495661_0002833 Ga0495661_0002833_6762_7304 180
2230 3300046665 Ga0495661_0033411 Ga0495661_0033411_163_705 180
2231 3300046665 Ga0495661_0037338 Ga0495661_0037338_690_1232 180
2232 3300046665 Ga0495661_0127439 Ga0495661_0127439_466_1020 180
2233 3300046675 Ga0495657_0309318 Ga0495657_0309318_178_816 180
2234 3300046678 Ga0495599_0100263 Ga0495599_0100263_697_1335 180
2235 3300046678 Ga0495599_0336117 Ga0495599_0336117_211_768 180
2236 3300046680 Ga0495646_0275509 Ga0495646_0275509_185_823 180
2237 3300046683 Ga0495658_0686817 Ga0495658_0686817_31_615 180
2238 3300046691 Ga0495670_0160267 Ga0495670_0160267_122_664 180
2239 3300046692 Ga0495671_0043742 Ga0495671_0043742_393_941 180
2240 3300046692 Ga0495671_0140426 Ga0495671_0140426_567_1109 180
2241 3300046694 Ga0495649_0000061 Ga0495649_0000061_45526_46068 180
2242 3300046694 Ga0495649_0037573 Ga0495649_0037573_1045_1587 180
2243 3300046809 Ga0495600_0120542 Ga0495600_0120542_673_1311 180
2244 3300046810 Ga0495660_0079019 Ga0495660_0079019_764_1306 180
2245 3300046810 Ga0495660_0208354 Ga0495660_0208354_268_810 180
2246 3300047317 Ga0495604_0179769 Ga0495604_0179769_305_889 180
2247 3300047320 Ga0495672_0070782 Ga0495672_0070782_807_1391 180
2248 3300047320 Ga0495672_0092225 Ga0495672_0092225_202_792 180
2249 3300047322 Ga0495680_0548700 Ga0495680_0548700_45_683 180
2250 3300047323 Ga0495683_0135397 Ga0495683_0135397_242_784 180
2251 3300047443 Ga0495687_000111 Ga0495687_000111_22729_23319 180
2252 3300047443 Ga0495687_000570 Ga0495687_000570_30982_31524 180
2253 3300047443 Ga0495687_076973 Ga0495687_076973_117_659 180
2254 3300047446 Ga0495679_149270 Ga0495679_149270_20_562 180
2255 3300047469 Ga0495673_0127905 Ga0495673_0127905_245_787 180
2256 3300047470 Ga0495681_0079380 Ga0495681_0079380_772_1323 180
2257 3300047470 Ga0495681_0085739 Ga0495681_0085739_740_1291 180
2258 3300047471 Ga0495684_0216518 Ga0495684_0216518_157_714 180
2259 3300047471 Ga0495684_0232368 Ga0495684_0232368_170_760 180
2260 3300047472 Ga0495686_0000679 Ga0495686_0000679_35556_36098 180
2261 3300047472 Ga0495686_0001267 Ga0495686_0001267_23996_24586 180
2262 3300047472 Ga0495686_0002403 Ga0495686_0002403_3824_4366 180
2263 3300047472 Ga0495686_0010589 Ga0495686_0010589_4118_4702 180
2264 3300047472 Ga0495686_0039814 Ga0495686_0039814_934_1476 180
2265 3300047472 Ga0495686_0063465 Ga0495686_0063465_435_1091 180
2266 3300047472 Ga0495686_0067978 Ga0495686_0067978_576_1118 180
2267 3300048089 Ga0495614_0041660 Ga0495614_0041660_824_1366 180
2268 3300048904 Ga0496101_0140617 Ga0496101_0140617_885_1457 180
2269 3300048907 Ga0496104_0469985 Ga0496104_0469985_411_1001 180
2270 3300048907 Ga0496104_0894844 Ga0496104_0894844_48_635 180
2271 3300048908 Ga0496105_0878551 Ga0496105_0878551_96_638 180
2272 3300048911 Ga0496108_0188934 Ga0496108_0188934_778_1368 180
2273 3300048912 Ga0496109_0081073 Ga0496109_0081073_666_1256 180
2274 3300048917 Ga0496114_0284563 Ga0496114_0284563_499_1089 180
2275 3300048918 Ga0496115_0090011 Ga0496115_0090011_171_713 180
2276 3300048919 Ga0496116_0000002 Ga0496116_0000002_657229_657777 180
2277 3300048919 Ga0496116_0003271 Ga0496116_0003271_7444_7995 180
2278 3300048920 Ga0496117_0016565 Ga0496117_0016565_5033_5581 180
2279 3300048920 Ga0496117_0019589 Ga0496117_0019589_819_1370 180
2280 3300048921 Ga0496118_0015601 Ga0496118_0015601_4849_5397 180
2281 3300048921 Ga0496118_0062036 Ga0496118_0062036_2048_2599 180
2282 3300048924 Ga0496121_0059518 Ga0496121_0059518_842_1390 180
2283 3300048925 Ga0496122_0007262 Ga0496122_0007262_7279_7830 180
2284 3300048925 Ga0496122_0010569 Ga0496122_0010569_6721_7263 180
2285 3300048926 Ga0496123_0000777 Ga0496123_0000777_2433_2975 180
2286 3300048926 Ga0496123_0015571 Ga0496123_0015571_3227_3778 180
2287 3300048927 Ga0496124_0059442 Ga0496124_0059442_2057_2605 180
2288 3300048927 Ga0496124_0104665 Ga0496124_0104665_1519_2109 180
2289 3300048928 Ga0496125_0000007 Ga0496125_0000007_655393_655941 180
2290 3300048929 Ga0496126_0260108 Ga0496126_0260108_160_708 180
2291 3300048929 Ga0496126_0361089 Ga0496126_0361089_162_710 180
2292 3300048929 Ga0496126_0932411 Ga0496126_0932411_77_619 180
2293 3300048929 Ga0496126_0979859 Ga0496126_0979859_32_622 180
2294 3300049127 Ga0501306_060827 Ga0501306_060827_47_589 180
2295 3300049130 Ga0501310_000397 Ga0501310_000397_621_1169 180
2296 3300049130 Ga0501310_020575 Ga0501310_020575_259_801 180
2297 3300049459 Ga0495678_001603 Ga0495678_001603_15563_16105 180
2298 3300049516 Ga0501293_006139 Ga0501293_006139_127_711 180
2299 3300049519 Ga0501296_004159 Ga0501296_004159_37_600 180
2300 3300049521 Ga0501298_000566 Ga0501298_000566_3893_4477 180
2301 3300049528 Ga0501312_023742 Ga0501312_023742_125_703 180
2302 3300049531 Ga0501315_008253 Ga0501315_008253_309_899 180
2303 3300049531 Ga0501315_028574 Ga0501315_028574_48_632 180
2304 3300049536 Ga0501320_004484 Ga0501320_004484_124_672 180
2305 3300049539 Ga0501323_000400 Ga0501323_000400_2152_2712 180
2306 3300049542 Ga0501326_01091 Ga0501326_01091_336_884 180
2307 3300049568 Ga0501031_0009099 Ga0501031_0009099_2315_2899 180
2308 3300049568 Ga0501031_0488940 Ga0501031_0488940_154_732 180
2309 3300049569 Ga0501032_0014411 Ga0501032_0014411_908_1492 180
2310 3300049569 Ga0501032_0048663 Ga0501032_0048663_925_1509 180
2311 3300049569 Ga0501032_0056634 Ga0501032_0056634_1144_1722 180
2312 3300049569 Ga0501032_0281799 Ga0501032_0281799_110_694 180
2313 3300049570 Ga0501033_0103350 Ga0501033_0103350_1458_2042 180
2314 3300049570 Ga0501033_0124616 Ga0501033_0124616_1046_1636 180
2315 3300049570 Ga0501033_0216136 Ga0501033_0216136_208_792 180
2316 3300049570 Ga0501033_0273342 Ga0501033_0273342_583_1125 180
2317 3300049570 Ga0501033_0377875 Ga0501033_0377875_82_672 180
2318 3300049570 Ga0501033_0379602 Ga0501033_0379602_119_697 180
2319 3300049571 Ga0501034_0005253 Ga0501034_0005253_3248_3838 180
2320 3300049571 Ga0501034_0013642 Ga0501034_0013642_3038_3628 180
2321 3300049571 Ga0501034_0015442 Ga0501034_0015442_714_1298 180
2322 3300049571 Ga0501034_0020269 Ga0501034_0020269_1086_1664 180
2323 3300049571 Ga0501034_0027034 Ga0501034_0027034_3033_3617 180
2324 3300049571 Ga0501034_0061142 Ga0501034_0061142_2306_2896 180
2325 3300049571 Ga0501034_0061167 Ga0501034_0061167_298_882 180
2326 3300049571 Ga0501034_0099843 Ga0501034_0099843_745_1335 180
2327 3300049571 Ga0501034_0531315 Ga0501034_0531315_79_663 180
2328 3300049572 Ga0501036_0006209 Ga0501036_0006209_399_983 180
2329 3300049572 Ga0501036_0016492 Ga0501036_0016492_1126_1710 180
2330 3300049572 Ga0501036_0120563 Ga0501036_0120563_1360_1914 180
2331 3300049572 Ga0501036_0399441 Ga0501036_0399441_136_726 180
2332 3300049573 Ga0501037_0004853 Ga0501037_0004853_9139_9717 180
2333 3300049573 Ga0501037_0306977 Ga0501037_0306977_35_625 180
2334 3300049573 Ga0501037_0326900 Ga0501037_0326900_294_878 180
2335 3300049574 Ga0501038_0001508 Ga0501038_0001508_8023_8607 180
2336 3300049574 Ga0501038_0654700 Ga0501038_0654700_22_606 180
2337 3300049574 Ga0501038_0731242 Ga0501038_0731242_18_572 180
2338 3300049575 Ga0501039_0035767 Ga0501039_0035767_2303_2887 180
2339 3300049575 Ga0501039_0178165 Ga0501039_0178165_110_688 180
2340 3300049575 Ga0501039_0260028 Ga0501039_0260028_315_899 180
2341 3300049576 Ga0501040_0617597 Ga0501040_0617597_85_669 180
2342 3300049579 Ga0501043_0009797 Ga0501043_0009797_2424_3008 180
2343 3300049579 Ga0501043_0024595 Ga0501043_0024595_2320_2898 180
2344 3300049579 Ga0501043_0061349 Ga0501043_0061349_700_1278 180
2345 3300049579 Ga0501043_0172490 Ga0501043_0172490_387_971 180
2346 3300049579 Ga0501043_0264602 Ga0501043_0264602_443_1033 180
2347 3300049579 Ga0501043_0405258 Ga0501043_0405258_384_974 180
2348 3300049579 Ga0501043_0564246 Ga0501043_0564246_245_823 180
2349 3300049580 Ga0501046_0016440 Ga0501046_0016440_619_1203 180
2350 3300049580 Ga0501046_0033598 Ga0501046_0033598_3361_3945 180
2351 3300049580 Ga0501046_0071196 Ga0501046_0071196_1354_1944 180
2352 3300049581 Ga0501047_0007339 Ga0501047_0007339_3900_4478 180
2353 3300049581 Ga0501047_0024945 Ga0501047_0024945_1099_1683 180
2354 3300049581 Ga0501047_0038433 Ga0501047_0038433_1255_1833 180
2355 3300049581 Ga0501047_0336590 Ga0501047_0336590_254_832 180
2356 3300049581 Ga0501047_0354548 Ga0501047_0354548_563_1117 180
2357 3300049581 Ga0501047_0659541 Ga0501047_0659541_182_766 180
2358 3300049582 Ga0501048_0057429 Ga0501048_0057429_565_1149 180
2359 3300049582 Ga0501048_0067880 Ga0501048_0067880_1399_1989 180
2360 3300049583 Ga0501067_0037965 Ga0501067_0037965_1148_1738 180
2361 3300049584 Ga0501068_0106012 Ga0501068_0106012_548_1138 180
2362 3300049585 Ga0501069_0454030 Ga0501069_0454030_30_620 180
2363 3300049586 Ga0501070_0006655 Ga0501070_0006655_7253_7843 180
2364 3300049586 Ga0501070_0092025 Ga0501070_0092025_562_1146 180
2365 3300049587 Ga0501071_0882190 Ga0501071_0882190_92_670 180
2366 3300049588 Ga0501072_0135423 Ga0501072_0135423_183_767 180
2367 3300049588 Ga0501072_0389952 Ga0501072_0389952_136_726 180
2368 3300049589 Ga0501073_0012461 Ga0501073_0012461_4060_4644 180
2369 3300049589 Ga0501073_0023024 Ga0501073_0023024_3510_4100 180
2370 3300049589 Ga0501073_0537582 Ga0501073_0537582_126_710 180
2371 3300049590 Ga0501074_0014422 Ga0501074_0014422_4628_5212 180
2372 3300049590 Ga0501074_0781221 Ga0501074_0781221_44_634 180
2373 3300049593 Ga0501077_0060765 Ga0501077_0060765_1764_2348 180
2374 3300049650 Ga0501199_015638 Ga0501199_015638_159_722 180
2375 3300049651 Ga0501201_000983 Ga0501201_000983_1850_2434 180
2376 3300049653 Ga0501206_007136 Ga0501206_007136_553_1110 180
2377 3300049654 Ga0501207_000190 Ga0501207_000190_560_1144 180
2378 3300049654 Ga0501207_007355 Ga0501207_007355_317_874 180
2379 3300049660 Ga0501216_034448 Ga0501216_034448_195_779 180
2380 3300049661 Ga0501217_000087 Ga0501217_000087_4642_5226 180
2381 3300049661 Ga0501217_031297 Ga0501217_031297_701_1261 180
2382 3300049661 Ga0501217_124824 Ga0501217_124824_154_738 180
2383 3300049662 Ga0501222_000205 Ga0501222_000205_1390_1974 180
2384 3300049663 Ga0501223_000686 Ga0501223_000686_6185_6775 180
2385 3300049664 Ga0501224_000474 Ga0501224_000474_3882_4466 180
2386 3300049668 Ga0501233_000952 Ga0501233_000952_3719_4303 180
2387 3300049669 Ga0501235_000089 Ga0501235_000089_4751_5335 180
2388 3300049669 Ga0501235_066447 Ga0501235_066447_81_665 180
2389 3300049673 Ga0501240_000271 Ga0501240_000271_51_593 180
2390 3300049674 Ga0501242_001187 Ga0501242_001187_735_1319 180
2391 3300049674 Ga0501242_004651 Ga0501242_004651_235_792 180
2392 3300049674 Ga0501242_004998 Ga0501242_004998_136_720 180
2393 3300049675 Ga0501243_051497 Ga0501243_051497_52_636 180
2394 3300049679 Ga0501249_000002 Ga0501249_000002_207063_207611 180
2395 3300049679 Ga0501249_046323 Ga0501249_046323_325_909 180
2396 3300049681 Ga0501251_000852 Ga0501251_000852_1679_2263 180
2397 3300049682 Ga0501252_000130 Ga0501252_000130_2185_2769 180
2398 3300049683 Ga0501253_031513 Ga0501253_031513_289_873 180
2399 3300049686 Ga0501257_000642 Ga0501257_000642_1529_2086 180
2400 3300049686 Ga0501257_003166 Ga0501257_003166_2939_3499 180
2401 3300049686 Ga0501257_027388 Ga0501257_027388_637_1209 180
2402 3300049688 Ga0501259_000111 Ga0501259_000111_9987_10571 180
2403 3300049688 Ga0501259_000789 Ga0501259_000789_76_660 180
2404 3300049688 Ga0501259_029405 Ga0501259_029405_131_715 180
2405 3300049703 Ga0501219_000023 Ga0501219_000023_13945_14520 180
2406 3300049704 Ga0501221_000552 Ga0501221_000552_1801_2385 180
2407 3300049705 Ga0501225_0000583 Ga0501225_0000583_5987_6571 180
2408 3300049705 Ga0501225_0007442 Ga0501225_0007442_1074_1652 180
2409 3300049707 Ga0501234_004154 Ga0501234_004154_1676_2260 180
2410 3300049708 Ga0501245_000239 Ga0501245_000239_4877_5461 180
2411 3300049708 Ga0501245_008558 Ga0501245_008558_843_1427 180
2412 3300049741 Ga0501079_0243970 Ga0501079_0243970_737_1321 180
2413 3300049741 Ga0501079_0326028 Ga0501079_0326028_137_727 180
2414 3300049742 Ga0501080_0460096 Ga0501080_0460096_95_685 180
2415 3300049744 Ga0501083_0027046 Ga0501083_0027046_976_1566 180
2416 3300049744 Ga0501083_0050340 Ga0501083_0050340_1586_2170 180
2417 3300049757 Ga0501232_002052 Ga0501232_002052_170_754 180
2418 3300049757 Ga0501232_009287 Ga0501232_009287_204_788 180
2419 3300049758 Ga0501241_002356 Ga0501241_002356_1736_2278 180
2420 3300049761 Ga0501264_000545 Ga0501264_000545_1399_1959 180
2421 3300049763 Ga0501266_000003 Ga0501266_000003_1461_2009 180
2422 3300049763 Ga0501266_009069 Ga0501266_009069_140_724 180
2423 3300049763 Ga0501266_032317 Ga0501266_032317_130_714 180
2424 3300049768 Ga0501271_027955 Ga0501271_027955_64_624 180
2425 3300049771 Ga0501274_008827 Ga0501274_008827_55_639 180
2426 3300049775 Ga0501279_000767 Ga0501279_000767_1889_2473 180
2427 3300049776 Ga0501280_017092 Ga0501280_017092_289_909 180
2428 3300049822 Ga0501035_0004426 Ga0501035_0004426_2227_2811 180
2429 3300049822 Ga0501035_0007199 Ga0501035_0007199_7771_8325 180
2430 3300049822 Ga0501035_0034824 Ga0501035_0034824_86_670 180
2431 3300049822 Ga0501035_0106460 Ga0501035_0106460_1315_1899 180
2432 3300049822 Ga0501035_0149328 Ga0501035_0149328_275_865 180
2433 3300049822 Ga0501035_0299844 Ga0501035_0299844_160_744 180
2434 3300049822 Ga0501035_0425936 Ga0501035_0425936_282_860 180
2435 3300049822 Ga0501035_0574427 Ga0501035_0574427_235_813 180
2436 3300049822 Ga0501035_0752170 Ga0501035_0752170_126_668 180
2437 3300049823 Ga0501044_0001663 Ga0501044_0001663_5030_5614 180
2438 3300049823 Ga0501044_0014681 Ga0501044_0014681_172_750 180
2439 3300049823 Ga0501044_0138045 Ga0501044_0138045_1379_1963 180
2440 3300049823 Ga0501044_0175548 Ga0501044_0175548_1190_1774 180
2441 3300049823 Ga0501044_0219503 Ga0501044_0219503_237_827 180
2442 3300049823 Ga0501044_0359143 Ga0501044_0359143_238_816 180
2443 3300049823 Ga0501044_0993245 Ga0501044_0993245_107_697 180
2444 3300049851 Ga0501212_006134 Ga0501212_006134_762_1346 180
2445 3300050005 Ga0501284_00005 Ga0501284_00005_132668_133243 180
2446 3300050493 nmdc:mga0k408_111223_c1 nmdc:mga0k408_111223_c1_589_1173 180
2447 3300050493 nmdc:mga0k408_130686_c1 nmdc:mga0k408_130686_c1_225_767 180
2448 3300050493 nmdc:mga0k408_16125_c1 nmdc:mga0k408_16125_c1_801_1385 180
2449 3300050493 nmdc:mga0k408_162162_c1 nmdc:mga0k408_162162_c1_321_863 180
2450 3300050493 nmdc:mga0k408_224888_c1 nmdc:mga0k408_224888_c1_380_946 180
2451 3300050493 nmdc:mga0k408_31_c1 nmdc:mga0k408_31_c1_54916_55458 180
2452 3300050493 nmdc:mga0k408_3587_c1 nmdc:mga0k408_3587_c1_197_739 180
2453 3300050493 nmdc:mga0k408_37276_c1 nmdc:mga0k408_37276_c1_1854_2432 180
2454 3300050493 nmdc:mga0k408_39970_c1 nmdc:mga0k408_39970_c1_1934_2512 180
2455 3300050493 nmdc:mga0k408_43630_c1 nmdc:mga0k408_43630_c1_1492_2076 180
2456 3300050493 nmdc:mga0k408_99046_c1 nmdc:mga0k408_99046_c1_137_727 180
2457 3300050496 nmdc:mga07m45_255654_c1 nmdc:mga07m45_255654_c1_141_683 180
2458 3300050496 nmdc:mga07m45_334242_c1 nmdc:mga07m45_334242_c1_94_678 180
2459 3300050507 nmdc:mga05p37_21235_c1 nmdc:mga05p37_21235_c1_2117_2701 180
2460 3300050507 nmdc:mga05p37_3495_c1 nmdc:mga05p37_3495_c1_5713_6291 180
2461 3300050508 nmdc:mga09592_22359_c1 nmdc:mga09592_22359_c1_1840_2418 180
2462 3300050508 nmdc:mga09592_700781_c1 nmdc:mga09592_700781_c1_223_807 180
2463 3300050508 nmdc:mga09592_75040_c1 nmdc:mga09592_75040_c1_75_659 180
2464 3300050508 nmdc:mga09592_8712_c1 nmdc:mga09592_8712_c1_919_1503 180
2465 3300050509 nmdc:mga0qj67_40177_c1 nmdc:mga0qj67_40177_c1_367_951 180
2466 3300050509 nmdc:mga0qj67_60383_c1 nmdc:mga0qj67_60383_c1_1976_2560 180
2467 3300050509 nmdc:mga0qj67_707869_c1 nmdc:mga0qj67_707869_c1_192_746 180
2468 3300050510 nmdc:mga06r32_104053_c1 nmdc:mga06r32_104053_c1_255_839 180
2469 3300050510 nmdc:mga06r32_2553_c1 nmdc:mga06r32_2553_c1_14000_14578 180
2470 3300050511 nmdc:mga08y16_17449_c1 nmdc:mga08y16_17449_c1_2757_3311 180
2471 3300050511 nmdc:mga08y16_859584_c1 nmdc:mga08y16_859584_c1_213_797 180
2472 3300050513 nmdc:mga0rr50_1085048_c1 nmdc:mga0rr50_1085048_c1_29_607 180
2473 3300053080 Ga0500635_0000960 Ga0500635_0000960_6369_6911 180
2474 3300053086 Ga0500578_0000296 Ga0500578_0000296_24195_24773 180
2475 3300053086 Ga0500578_0032528 Ga0500578_0032528_31_609 180
2476 3300053086 Ga0500578_0036797 Ga0500578_0036797_195_773 180
2477 3300053088 Ga0500644_0023826 Ga0500644_0023826_933_1511 180
2478 3300053088 Ga0500644_0034365 Ga0500644_0034365_581_1171 180
2479 3300053088 Ga0500644_0198449 Ga0500644_0198449_164_712 180
2480 3300053090 Ga0500646_0004612 Ga0500646_0004612_2290_2838 180
2481 3300053092 Ga0500583_0000037 Ga0500583_0000037_59224_59871 180
2482 3300053092 Ga0500583_0007678 Ga0500583_0007678_1862_2452 180
2483 3300053093 Ga0500651_0000058 Ga0500651_0000058_32252_32794 180
2484 3300053096 Ga0500641_0000004 Ga0500641_0000004_185886_186434 180
2485 3300053096 Ga0500641_0000938 Ga0500641_0000938_6331_6882 180
2486 3300053096 Ga0500641_0002627 Ga0500641_0002627_3696_4280 180
2487 3300053096 Ga0500641_0008564 Ga0500641_0008564_2429_2977 180
2488 3300053104 Ga0500556_0098588 Ga0500556_0098588_365_943 180
2489 3300053108 Ga0500562_000032 Ga0500562_000032_9650_10240 180
2490 3300053108 Ga0500562_066068 Ga0500562_066068_296_853 180
2491 3300053118 Ga0500594_0002597 Ga0500594_0002597_332_880 180
2492 3300053118 Ga0500594_0028218 Ga0500594_0028218_334_924 180
2493 3300053122 Ga0500608_000440 Ga0500608_000440_6293_6835 180
2494 3300053122 Ga0500608_008805 Ga0500608_008805_3000_3542 180
2495 3300053125 Ga0500618_000016 Ga0500618_000016_10158_10700 180
2496 3300053125 Ga0500618_003572 Ga0500618_003572_4167_4724 180
2497 3300053130 Ga0500642_0037921 Ga0500642_0037921_346_936 180
2498 3300053131 Ga0500652_028632 Ga0500652_028632_1240_1875 180
2499 3300053131 Ga0500652_240349 Ga0500652_240349_85_627 180
2500 3300053134 Ga0500658_0000001 Ga0500658_0000001_506328_506876 180
2501 3300053136 Ga0500559_0011550 Ga0500559_0011550_2285_2833 180
2502 3300053136 Ga0500559_0020330 Ga0500559_0020330_2044_2622 180
2503 3300053136 Ga0500559_0217904 Ga0500559_0217904_48_590 180
2504 3300053139 Ga0500568_0000863 Ga0500568_0000863_9660_10244 180
2505 3300053139 Ga0500568_0014441 Ga0500568_0014441_1374_1964 180
2506 3300053139 Ga0500568_0067353 Ga0500568_0067353_126_668 180
2507 3300053140 Ga0500573_0046715 Ga0500573_0046715_1500_2156 180
2508 3300053140 Ga0500573_0148601 Ga0500573_0148601_609_1151 180
2509 3300053140 Ga0500573_0205607 Ga0500573_0205607_239_787 180
2510 3300053143 Ga0500579_064005 Ga0500579_064005_1431_2066 180
2511 3300053151 Ga0500604_0004030 Ga0500604_0004030_1897_2454 180
2512 3300053151 Ga0500604_0007966 Ga0500604_0007966_1283_1861 180
2513 3300053153 Ga0500616_0000626 Ga0500616_0000626_39731_40300 180
2514 3300053153 Ga0500616_0021217 Ga0500616_0021217_893_1450 180
2515 3300053153 Ga0500616_0032837 Ga0500616_0032837_494_1084 180
2516 3300053153 Ga0500616_0092920 Ga0500616_0092920_412_996 180
2517 3300053153 Ga0500616_0203952 Ga0500616_0203952_16_582 180
2518 3300053156 Ga0500622_0000163 Ga0500622_0000163_11886_12443 180
2519 3300053156 Ga0500622_0000445 Ga0500622_0000445_19873_20463 180
2520 3300053156 Ga0500622_0000895 Ga0500622_0000895_13118_13675 180
2521 3300053156 Ga0500622_0002148 Ga0500622_0002148_1354_1944 180
2522 3300053156 Ga0500622_0003011 Ga0500622_0003011_938_1495 180
2523 3300053156 Ga0500622_0010132 Ga0500622_0010132_4005_4595 180
2524 3300053156 Ga0500622_0027221 Ga0500622_0027221_889_1467 180
2525 3300053163 Ga0500639_044139 Ga0500639_044139_121_777 180
2526 3300053726 Ga0500584_086703 Ga0500584_086703_718_1266 180
2527 3300053727 Ga0500611_000010 Ga0500611_000010_133106_133690 180
2528 3300053727 Ga0500611_015812 Ga0500611_015812_60_638 180
2529 3300053730 Ga0500645_006207 Ga0500645_006207_2044_2622 180
2530 3300053730 Ga0500645_062800 Ga0500645_062800_139_729 180
2531 3300054114 Ga0501084_0063164 Ga0501084_0063164_1697_2281 180
2532 3300054114 Ga0501084_0129485 Ga0501084_0129485_1181_1771 180
2533 3300055283 Ga0500661_012401 Ga0500661_012401_412_1002 180
2534 3300059424 Ga0590075_041606 Ga0590075_041606_51_608 180
2535 3300059491 Ga0587070_008071 Ga0587070_008071_597_1151 180
2536 3300059492 Ga0587073_0031616 Ga0587073_0031616_362_904 180
2537 3300059492 Ga0587073_0048996 Ga0587073_0048996_324_866 180
2538 3300059643 Ga0587072_003871 Ga0587072_003871_1069_1623 180
2539 3300060353 Ga0501082_0191797 Ga0501082_0191797_1047_1637 180
2540 3300060353 Ga0501082_0313107 Ga0501082_0313107_747_1331 180
2541 3300061719 Ga0466962_0033835 Ga0466962_0033835_1655_2233 180
2542 3300061719 Ga0466962_0055092 Ga0466962_0055092_31_621 180
2543 3300061719 Ga0466962_0166310 Ga0466962_0166310_472_1050 180
2544 3300061719 Ga0466962_0308030 Ga0466962_0308030_43_627 180
2545 iso_pu_bacteria 2585427687 2586206988 180
2546 iso_pu_bacteria 2738541302 2738854588 180
2547 iso_pu_bacteria 2739367651 2739587099 180
2548 iso_pu_bacteria 2739367656 2739615197 180
2549 iso_pu_bacteria 2739367663 2739645677 180
2550 iso_pu_bacteria 2818991437 2819547564 180
2551 iso_pu_bacteria 2954016120 2954019981 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

57

166

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gpn-assembly1.cif.gz_a architecture of mammalian respirasome 0.886 21 160
8e73-assembly1.cif.gz_S7 vigna radiata supercomplex i+iii2 (full bridge) 0.8846 21 162
6x89-assembly1.cif.gz_S7 vigna radiata mitochondrial complex i* 0.8846 21 162
7ard-assembly1.cif.gz_B cryo-em structure of polytomella complex-i (complete composition) 0.884 22 161
8bee-assembly1.cif.gz_B cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci peripheral core) 0.8807 21 161
ID Description Score Start End Superfamily
af_P9WJH1_2_170_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8331 14 176 3.40.50.12280
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.828 33 155 3.40.50.12280
af_Q5ADP7_59_222_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8091 10 163 3.40.50.12280
af_P0AFC7_20_188_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8007 9 169 3.40.50.12280
3iasF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7914 14 167 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A3R7R0M4-F1-model_v4 NADH-quinone oxidoreductase subunit B 0.9015 21 161 GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0046872
GO:0048038
GO:0051539
AF-A0A2V2D7I9-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.9013 21 161 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A3M1H0E6-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.901 21 160 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A7C3SG56-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.9007 21 160 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A1Y1REN1-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.9007 21 161 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539

Feature Viewer

pLDDT pTM Quality
76.99 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map