metagRoot

F496772

General Info

Members	Datasets	Scaffolds	Average Seq Length
2394	848	2179	112

Family's Representative Sequence

Representative Sequence	3300005457\|Ga0070662_100019784\|Ga0070662_1000197845
Length	128
Sequence	MRWRVAASKRFEGIPTVPIIKILPHPEYCPKGATVEAPSGTSICEALLENDIPIEHACEMSCACTTCHVVVREGFNSLGEMDESEEDLLDRAWGLEPNSRLSCQAILSNQDVTIEIPKYSINHAKENH

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2501025501	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
3	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
4	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
5	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
6	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
7	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
8	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
9	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
10	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
11	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
12	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
13	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
14	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
15	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
16	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
17	2519103095	Burkholderia sp. KJ006	Isolate	Nodule
18	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
19	2547132103	Chromobacterium sp. C-61	Isolate	Rhizosphere
20	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
21	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
22	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
23	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
24	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
25	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
26	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
27	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
28	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
29	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
30	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
31	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
32	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
33	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
34	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
35	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
36	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
37	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
38	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
39	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
40	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
41	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
42	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
43	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
44	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
45	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
46	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
47	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
48	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
49	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
50	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
51	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
52	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
53	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
54	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
55	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
56	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
57	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
58	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
59	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
60	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
61	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
62	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
63	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
64	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
65	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
66	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
67	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
68	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
69	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
70	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
71	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
72	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
73	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
74	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
75	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
76	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
77	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
78	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
79	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
80	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
81	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
82	2643221658	Variovorax sp. Root411	Isolate	Unclassified
83	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
84	2643221672	Variovorax sp. Root434	Isolate	Unclassified
85	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
86	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
87	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
88	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
89	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
90	2721755763	Pandoraea thiooxydans ATSB16	Isolate	Rhizosphere
91	2734482258	Glomeribacter sp. phylotype 3	Isolate	Unclassified
92	2738541277	Variovorax sp. GV051	Isolate	Unclassified
93	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
94	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
95	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
96	2738541307	Variovorax sp. GV008	Isolate	Unclassified
97	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
98	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
99	2738543013	Variovorax sp. BT01	Isolate	Unclassified
100	2738543019	Variovorax sp. GV040	Isolate	Unclassified
101	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
102	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
103	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
104	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
105	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
106	2791354903	Mangrovibacter phragmitis MP23	Isolate	Unclassified
107	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
108	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
109	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
110	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
111	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
112	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
113	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
114	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
115	2818991446	Variovorax sp. 1180	Isolate	Unclassified
116	2818991450	Burkholderia sp. 604	Isolate	Unclassified
117	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
118	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
119	2831864461	Roseateles noduli HZ7	Isolate	Nodule
120	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
121	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
122	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
123	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
124	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
125	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
126	2843690924	Chromobacterium rhizoryzae JP2-74	Isolate	Rhizosphere
127	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
128	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
129	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
130	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
131	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
132	2858950400	Achromobacter sp. K91	Isolate	Unclassified
133	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
134	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
135	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
136	2881714928	Pseudidiomarina mangrovi ZQ330	Isolate	Rhizosphere
137	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
138	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
139	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
140	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
141	2885198086	Variovorax sp. 679	Isolate	Unclassified
142	2885211737	Variovorax sp. 553	Isolate	Unclassified
143	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
144	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
145	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
146	2899924645	Variovorax sp. 369	Isolate	Unclassified
147	2900051742	Pectobacterium zantedeschiae 2M	Isolate	Stem Tuber
148	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
149	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
150	2904434214	Robbsia andropogonis 1567	Isolate	Rhizosphere
151	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
152	2904456579	Variovorax sp. 2002	Isolate	Unclassified
153	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
154	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
155	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
156	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
157	2904564687	Burkholderia sp. 571	Isolate	Unclassified
158	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
159	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
160	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
161	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
162	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
163	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
164	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
165	2928037797	Variovorax sp. 1126	Isolate	Unclassified
166	2928044640	Variovorax sp. 1128	Isolate	Unclassified
167	2928051484	Variovorax sp. 1133	Isolate	Unclassified
168	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
169	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
170	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
171	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
172	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
173	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
174	2928170801	Burkholderia sp. 572	Isolate	Unclassified
175	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
176	2928536128	Burkholderia sola 565	Isolate	Unclassified
177	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
178	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
179	2935625433	Kosakonia sp. 1610	Isolate	Rhizosphere
180	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
181	2939617950	Kosakonia cowanii 2056	Isolate	Rhizosphere
182	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
183	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
184	2941479691
185	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
186	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
187	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
188	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
189	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
190	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
191	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
192	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
193	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
194	2974435778	Kosakonia cowanii SORGH_AS 304	Isolate	Unclassified
195	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
196	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
197	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
198	2998344455	Vogesella urethralis SLBN-145	Isolate	Rhizosphere
199	3000376612	Enterobacteriaceae bacterium 4M9	Isolate	Rhizosphere
200	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
201	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
202	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
203	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
204	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
205	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
206	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
207	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
208	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
209	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
210	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
211	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
212	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
213	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
214	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
215	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
216	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
217	3300003347	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM	Metagenome	Rhizosphere
218	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
219	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
220	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
221	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
222	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
223	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
224	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
225	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
226	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
227	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
228	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
229	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
230	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
231	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
232	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
233	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
234	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
235	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
236	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
237	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
238	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
239	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
240	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
241	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
242	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
243	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
244	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
245	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
246	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
247	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
248	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
249	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
250	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
251	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
252	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
253	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
254	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
255	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
256	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
257	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
258	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
259	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
260	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
261	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
262	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
263	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
264	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
265	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
266	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
267	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
268	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
269	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
270	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
271	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
272	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
273	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
274	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
275	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
276	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
277	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
278	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
279	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
280	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
281	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
282	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
283	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
284	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
285	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
286	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
287	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
288	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
289	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
290	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
291	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
292	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
293	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
294	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
295	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
296	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
297	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
298	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
299	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
300	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
301	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
302	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
303	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
304	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
305	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
306	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
307	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
308	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
309	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
310	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
311	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
312	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
313	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
314	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
315	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
316	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
317	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
318	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
319	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
320	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
321	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
322	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
323	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
324	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
325	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
326	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
327	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
328	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
329	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
330	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
331	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
332	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
333	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
334	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
335	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
336	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
337	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
338	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
339	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
340	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
341	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
342	3300012490	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610	Metagenome	Rhizosphere
343	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
344	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
345	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
346	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
347	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
348	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
349	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
350	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
351	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
352	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
353	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
354	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
355	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
356	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
357	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
358	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
359	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
360	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
361	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
362	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
363	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
364	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
365	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
366	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
367	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
368	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
369	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
370	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
371	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
372	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
373	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
374	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
375	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
376	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
377	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
378	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
379	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
380	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
381	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
382	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
383	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
384	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
385	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
386	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
387	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
388	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
389	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
390	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
391	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
392	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
393	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
394	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
395	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
396	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
397	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
398	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
399	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
400	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
401	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
411	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
418	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
419	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
420	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
427	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
428	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
431	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
432	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
433	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
434	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
435	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
436	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
437	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
438	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
439	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
440	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
441	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
442	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
443	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
444	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
445	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
446	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
447	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
448	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
449	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
450	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
451	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
452	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
453	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
454	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
455	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
456	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
457	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
458	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
459	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
460	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
461	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
462	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
463	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
464	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
465	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
466	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
467	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
468	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
469	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
470	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
471	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
472	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
473	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
474	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
475	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
476	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
477	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
478	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
479	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
480	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
481	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
482	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
483	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
484	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
485	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
486	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
487	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
488	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
489	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
490	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
491	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
492	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
493	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
494	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
495	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
496	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
497	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
498	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
499	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
500	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
501	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
502	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
503	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
504	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
505	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
506	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
507	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
508	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
509	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
510	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
511	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
512	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
513	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
514	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
515	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
516	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
517	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
518	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
519	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
520	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
521	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
522	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
523	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
524	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
525	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
526	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
527	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
528	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
529	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
530	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
531	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
532	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
533	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
534	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
535	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
536	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
537	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
538	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
539	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
540	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
541	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
542	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
543	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
544	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
545	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
546	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
547	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
548	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
549	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
550	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
551	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
552	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
553	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
554	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
555	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
556	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
557	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
558	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
559	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
560	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
561	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
562	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
563	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
564	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
565	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
566	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
567	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
568	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
569	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
570	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
571	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
572	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
573	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
574	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
575	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
576	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
577	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
578	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
579	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
580	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
581	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
582	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
583	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
584	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
585	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
586	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
587	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
588	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
589	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
590	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
591	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
592	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
593	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
594	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
595	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
596	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
597	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
598	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
599	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
600	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
601	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
602	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
603	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
604	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
605	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
606	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
607	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
608	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
609	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
610	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
611	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
612	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
613	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
614	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
615	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
616	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
617	3300044668	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2	Metagenome	Unclassified
618	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
619	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
620	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
621	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
622	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
623	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
624	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
625	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
626	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
627	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
628	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
629	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
630	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
631	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
632	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
633	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
634	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
635	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
636	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
637	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
638	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
639	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
640	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
641	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
642	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
643	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
644	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
645	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
646	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
647	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
648	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
649	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
650	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
651	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
652	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
653	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
654	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
655	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
656	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
657	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
658	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
659	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
660	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
661	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
662	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
663	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
664	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
665	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
666	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
667	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
668	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
669	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
670	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
671	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
672	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
673	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
674	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
675	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
676	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
677	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
678	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
679	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
680	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
681	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
682	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
683	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
684	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
685	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
686	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
687	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
688	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
689	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
690	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
691	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
692	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
693	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
694	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
695	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
696	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
697	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
698	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
699	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
700	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
701	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
702	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
703	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
704	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
705	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
706	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
707	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
708	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
709	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
710	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
711	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
712	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
713	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
714	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
715	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
716	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
717	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
718	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
719	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
720	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
721	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
722	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
723	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
724	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
725	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
726	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
727	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
728	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
729	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
730	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
731	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
732	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
733	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
734	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
735	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
736	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
737	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
738	3300049524	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control	Metagenome	Rhizosphere
739	3300049526	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control	Metagenome	Rhizosphere
740	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
741	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
742	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
743	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
744	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
745	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
746	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
747	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
748	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
749	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
750	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
751	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
752	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
753	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
754	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
755	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
756	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
757	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
758	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
759	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
760	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
761	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
762	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
763	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
764	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
765	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
766	3300049762	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control	Metagenome	Rhizosphere
767	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
768	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
769	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
770	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
771	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
772	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
773	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
774	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
775	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
776	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
777	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
778	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
779	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
780	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
781	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
782	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
783	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
784	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
785	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
786	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
787	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
788	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
789	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
790	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
791	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
792	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
793	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
794	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
795	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
796	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
797	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
798	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
799	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
800	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
801	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
802	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
803	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
804	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
805	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
806	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
807	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
808	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
809	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
810	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
811	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
812	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
813	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
814	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
815	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
816	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
817	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
818	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
819	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
820	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
821	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
822	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
823	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
824	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
825	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
826	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
827	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
828	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
829	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
830	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
831	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
832	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
833	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
834	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
835	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
836	8019504834	Atlantibacter hermannii 1903	Isolate	Rhizosphere
837	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
838	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
839	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
840	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
841	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
842	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
843	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
844	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere
845	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere
846	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
847	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule
848	8055693939	Hafnia alvei A23BA	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.56
Metatranscriptomes	0.42
Isolates	9.02

Biome Distribution

Category	Percentage (%)
Aerial Root	0.08
Bulb	0
Endosphere	19.05
Nodule	1
Rhizoplane	5.1
Rhizosphere	63.58
Stem	0
Stem Tuber	0.08
Unclassified	11.11

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1415115	2162886007	Bacteria	1282
2	JGI24740J21852_10005200	3300001979	Bacteria	5524
3	JGI24739J22299_10033552	3300001989	Bacteria	1755
4	JGI24739J22299_10040520	3300001989	Bacteria	1554
5	JGI24737J22298_10022183	3300001990	Bacteria	2017
6	JGI24735J21928_10043643	3300002067	Bacteria	1303
7	JGI24744J21845_10047460	3300002077	Bacteria	795
8	JGI25156J39149_1000200	3300002705	Bacteria	41286
9	JGI25156J39149_1001430	3300002705	Bacteria	10139
10	JGI25156J39149_1004572	3300002705	Bacteria	4182
11	JGI25156J39149_1007679	3300002705	Bacteria	2799
12	JGI25156J39149_1020932	3300002705	Bacteria	1139
13	JGI25154J39366_1000288	3300002738	Bacteria	30264
14	JGI25154J39366_1000649	3300002738	Bacteria	16270
15	JGI25157J39369_1000095	3300002741	Bacteria	74770
16	JGI25152J39213_1001922	3300002773	Bacteria	8286
17	JGI25152J39213_1004308	3300002773	Bacteria	4530
18	JGI25150J39212_1027828	3300002774	Bacteria	806
19	JGI25159J45721_1010035	3300002987	Bacteria	2447
20	JGI25159J45721_1010105	3300002987	Bacteria	2433
21	JGI25151J46595_10000262	3300003187	Bacteria	61170
22	JGI25151J46595_10001813	3300003187	Bacteria	13787
23	JGI25151J46595_10023911	3300003187	Bacteria	2508
24	JGI25151J46595_10030757	3300003187	Bacteria	2107
25	JGI25153J46596_10001361	3300003215	Bacteria	14627
26	JGI25153J46596_10020746	3300003215	Bacteria	2474
27	rootH1_10061749	3300003316	Bacteria	1861
28	rootH2_10002329	3300003320	Bacteria	1251
29	rootH2_10166799	3300003320	Bacteria	1243
30	rootL2_10000441	3300003322	Bacteria	16020
31	rootL2_10237090	3300003322	Bacteria	2024
32	rootH1_10049462	3300003316	Bacteria	3729
33	rootH1_10049462	3300003323	Bacteria	1783
34	rootH1_10068787	3300003323	Bacteria	2523
35	JGI26128J50194_1001209	3300003347	Bacteria	1609
36	Ga0006562J51391_1061692	3300003578	Bacteria	950
37	Ga0055538_1004535	3300003751	Bacteria	1562
38	Ga0055539_1000688	3300003752	Bacteria	8766
39	Ga0055539_1001465	3300003752	Bacteria	4360
40	Ga0055539_1014267	3300003752	Bacteria	970
41	Ga0055533_1000100	3300003756	Bacteria	111692
42	Ga0055533_1006422	3300003756	Bacteria	1735
43	Ga0055532_1002241	3300003758	Bacteria	4232
44	Ga0055532_1003811	3300003758	Bacteria	2445
45	Ga0055525_1000011	3300003759	Bacteria	503124
46	Ga0055525_1001558	3300003759	Bacteria	3787
47	Ga0055535_1001571	3300003761	Bacteria	11046
48	Ga0055535_1001668	3300003761	Bacteria	10206
49	Ga0055542_1000027	3300003762	Bacteria	254819
50	Ga0055542_1002307	3300003762	Bacteria	6568
51	Ga0055529_1001099	3300003763	Bacteria	12159
52	Ga0055529_1001608	3300003763	Bacteria	6106
53	Ga0055526_1005479	3300003771	Bacteria	7286
54	Ga0055526_1013218	3300003771	Bacteria	3512
55	Ga0055537_1000193	3300003773	Bacteria	45640
56	Ga0055524_1002870	3300003775	Bacteria	8638
57	Ga0055524_1015745	3300003775	Bacteria	2744
58	Ga0055536_1000726	3300003781	Bacteria	22133
59	Ga0055536_1003097	3300003781	Bacteria	9048
60	Ga0055536_1007352	3300003781	Bacteria	4949
61	Ga0055536_1015208	3300003781	Bacteria	2648
62	Ga0055536_1048677	3300003781	Bacteria	946
63	Ga0055534_1000186	3300003784	Bacteria	45640
64	Ga0055534_1002158	3300003784	Bacteria	7033
65	Ga0055534_1023929	3300003784	Bacteria	995
66	Ga0055528_1073688	3300003790	Bacteria	612
67	Ga0055530_10000754	3300003791	Bacteria	26927
68	Ga0055530_10008221	3300003791	Bacteria	4219
69	Ga0055530_10030912	3300003791	Bacteria	1412
70	Ga0055530_10073206	3300003791	Bacteria	734
71	Ga0055540_1002266	3300003792	Bacteria	10370
72	Ga0055540_1002894	3300003792	Bacteria	8695
73	Ga0055540_1004211	3300003792	Bacteria	6608
74	Ga0055540_1005185	3300003792	Bacteria	5590
75	Ga0055540_1010868	3300003792	Bacteria	2993
76	Ga0055531_10000985	3300003794	Bacteria	22675
77	Ga0055531_10002017	3300003794	Bacteria	14071
78	Ga0055531_10013088	3300003794	Bacteria	3851
79	Ga0055531_10054307	3300003794	Bacteria	1028
80	Ga0055531_10065267	3300003794	Bacteria	866
81	Ga0055541_1000908	3300003841	Bacteria	7082
82	Ga0065165_1000613	3300005262	Bacteria	51836
83	Ga0065165_1055167	3300005262	Bacteria	1110
84	Ga0065714_10078829	3300005288	Bacteria	2558
85	Ga0065714_10187930	3300005288	Bacteria	930
86	Ga0065704_10079876	3300005289	Bacteria	4051
87	Ga0065704_10094721	3300005289	Bacteria	2528
88	Ga0065704_10315903	3300005289	Bacteria	861
89	Ga0065712_10111357	3300005290	Bacteria	1819
90	Ga0065715_10214645	3300005293	Bacteria	1298
91	Ga0065715_10427078	3300005293	Bacteria	851
92	Ga0065715_10978353	3300005293	Bacteria	551
93	Ga0065707_10081939	3300005295	Bacteria	28637
94	Ga0070658_10028554	3300005327	Bacteria	4480
95	Ga0070658_10607777	3300005327	Bacteria	948
96	Ga0070658_11588604	3300005327	Bacteria	567
97	Ga0070676_10023135	3300005328	Bacteria	3491
98	Ga0070676_10024406	3300005328	Bacteria	3406
99	Ga0070676_10062029	3300005328	Bacteria	2223
100	Ga0070676_10137992	3300005328	Bacteria	1549
101	Ga0070676_10199487	3300005328	Bacteria	1311
102	Ga0070676_11612860	3300005328	Bacteria	502
103	Ga0070683_100007089	3300005329	Bacteria	9442
104	Ga0070683_100161279	3300005329	Bacteria	2127
105	Ga0070690_100558986	3300005330	Bacteria	863
106	Ga0070690_101013982	3300005330	Bacteria	654
107	Ga0070690_101151193	3300005330	Bacteria	617
108	Ga0070670_100001125	3300005331	Bacteria	21269
109	Ga0070670_100046529	3300005331	Bacteria	3731
110	Ga0070670_100096992	3300005331	Bacteria	2536
111	Ga0070670_100454984	3300005331	Bacteria	1135
112	Ga0070670_100472434	3300005331	Bacteria	1113
113	Ga0070677_10004970	3300005333	Bacteria	4368
114	Ga0070677_10053445	3300005333	Bacteria	1642
115	Ga0070677_10106704	3300005333	Bacteria	1244
116	Ga0070677_10469173	3300005333	Bacteria	677
117	Ga0068869_100001634	3300005334	Bacteria	13365
118	Ga0068869_100011402	3300005334	Bacteria	5828
119	Ga0068869_100186279	3300005334	Bacteria	1630
120	Ga0068869_100186727	3300005334	Bacteria	1628
121	Ga0070666_10027432	3300005335	Bacteria	3730
122	Ga0070666_10385928	3300005335	Bacteria	1006
123	Ga0070680_100096787	3300005336	Bacteria	2447
124	Ga0070680_100200062	3300005336	Bacteria	1685
125	Ga0070682_100287160	3300005337	Bacteria	1202
126	Ga0070682_100362998	3300005337	Bacteria	1084
127	Ga0068868_100006467	3300005338	Bacteria	8293
128	Ga0068868_100007731	3300005338	Bacteria	7671
129	Ga0068868_100025309	3300005338	Bacteria	4513
130	Ga0068868_100065185	3300005338	Bacteria	2893
131	Ga0068868_100118510	3300005338	Bacteria	2158
132	Ga0068868_101187791	3300005338	Bacteria	705
133	Ga0068868_101773706	3300005338	Bacteria	583
134	Ga0070660_100057666	3300005339	Bacteria	3009
135	Ga0070660_100060030	3300005339	Bacteria	2950
136	Ga0070660_100064464	3300005339	Bacteria	2850
137	Ga0070660_100084433	3300005339	Bacteria	2496
138	Ga0070660_100100400	3300005339	Bacteria	2292
139	Ga0070660_100421144	3300005339	Bacteria	1106
140	Ga0070660_100487769	3300005339	Bacteria	1024
141	Ga0070689_100051808	3300005340	Bacteria	3173
142	Ga0070689_101720046	3300005340	Bacteria	571
143	Ga0070691_10511035	3300005341	Bacteria	696
144	Ga0070691_10702540	3300005341	Bacteria	607
145	Ga0070687_100030647	3300005343	Bacteria	2631
146	Ga0070687_100101179	3300005343	Bacteria	1614
147	Ga0070661_100006518	3300005344	Bacteria	8054
148	Ga0070661_100048491	3300005344	Bacteria	3109
149	Ga0070661_100171509	3300005344	Bacteria	1647
150	Ga0070668_100181696	3300005347	Bacteria	1718
151	Ga0070668_100317949	3300005347	Bacteria	1310
152	Ga0070668_100685438	3300005347	Bacteria	903
153	Ga0070668_100787852	3300005347	Bacteria	844
154	Ga0070669_100021660	3300005353	Bacteria	4593
155	Ga0070669_100094234	3300005353	Bacteria	2250
156	Ga0070669_100160968	3300005353	Bacteria	1744
157	Ga0070669_100256084	3300005353	Bacteria	1395
158	Ga0070669_100256428	3300005353	Bacteria	1394
159	Ga0070669_100521925	3300005353	Bacteria	987
160	Ga0070669_100936393	3300005353	Bacteria	741
161	Ga0070669_101719900	3300005353	Bacteria	547
162	Ga0070675_100000735	3300005354	Bacteria	22835
163	Ga0070675_100004598	3300005354	Bacteria	10540
164	Ga0070675_100015112	3300005354	Bacteria	6098
165	Ga0070675_100207836	3300005354	Bacteria	1701
166	Ga0070675_100693446	3300005354	Bacteria	927
167	Ga0070671_100001944	3300005355	Bacteria	15849
168	Ga0070671_100005456	3300005355	Bacteria	10154
169	Ga0070671_100022352	3300005355	Bacteria	5165
170	Ga0070671_100046866	3300005355	Bacteria	3595
171	Ga0070671_100081043	3300005355	Bacteria	2714
172	Ga0070671_100161322	3300005355	Bacteria	1895
173	Ga0070671_100195282	3300005355	Bacteria	1716
174	Ga0070671_100511880	3300005355	Bacteria	1033
175	Ga0070671_100848462	3300005355	Bacteria	797
176	Ga0070674_100013900	3300005356	Bacteria	4990
177	Ga0070674_100236533	3300005356	Bacteria	1428
178	Ga0070674_100393943	3300005356	Bacteria	1130
179	Ga0070674_100558089	3300005356	Bacteria	962
180	Ga0070674_100572738	3300005356	Bacteria	950
181	Ga0070674_101435039	3300005356	Bacteria	619
182	Ga0070673_100023482	3300005364	Bacteria	4506
183	Ga0070673_100066105	3300005364	Bacteria	2887
184	Ga0070673_100071444	3300005364	Bacteria	2789
185	Ga0070673_100132605	3300005364	Bacteria	2093
186	Ga0070673_100167182	3300005364	Bacteria	1875
187	Ga0070673_101028246	3300005364	Bacteria	768
188	Ga0070673_101089811	3300005364	Bacteria	746
189	Ga0070673_101167683	3300005364	Bacteria	721
190	Ga0070673_101976188	3300005364	Bacteria	553
191	Ga0070688_101394628	3300005365	Bacteria	568
192	Ga0070659_100003967	3300005366	Bacteria	10534
193	Ga0070659_100008273	3300005366	Bacteria	7595
194	Ga0070659_100025101	3300005366	Bacteria	4575
195	Ga0070659_100063404	3300005366	Bacteria	2924
196	Ga0070659_100227135	3300005366	Bacteria	1542
197	Ga0070659_100239306	3300005366	Bacteria	1501
198	Ga0070659_100776578	3300005366	Bacteria	832
199	Ga0070659_100897242	3300005366	Bacteria	774
200	Ga0070659_101989550	3300005366	Bacteria	522
201	Ga0070667_100006642	3300005367	Bacteria	9617
202	Ga0070667_100021358	3300005367	Bacteria	5376
203	Ga0070667_100032736	3300005367	Bacteria	4337
204	Ga0070667_100065683	3300005367	Bacteria	3081
205	Ga0070667_100157606	3300005367	Bacteria	1998
206	Ga0070667_100177885	3300005367	Bacteria	1880
207	Ga0070667_100358733	3300005367	Bacteria	1321
208	Ga0070667_100500355	3300005367	Bacteria	1114
209	Ga0070711_101059401	3300005439	Bacteria	697
210	Ga0070705_101672577	3300005440	Bacteria	537
211	Ga0070700_100009387	3300005441	Bacteria	5367
212	Ga0070694_101409094	3300005444	Bacteria	588
213	Ga0070708_100234856	3300005445	Bacteria	1721
214	Ga0070663_100037434	3300005455	Bacteria	3378
215	Ga0070663_100087596	3300005455	Bacteria	2302
216	Ga0070678_100024742	3300005456	Bacteria	4026
217	Ga0070678_100035395	3300005456	Bacteria	3485
218	Ga0070678_100077032	3300005456	Bacteria	2514
219	Ga0070678_100309688	3300005456	Bacteria	1345
220	Ga0070678_100343197	3300005456	Bacteria	1282
221	Ga0070678_100580319	3300005456	Bacteria	999
222	Ga0070678_101064826	3300005456	Bacteria	745
223	Ga0070678_101213316	3300005456	Bacteria	700
224	Ga0070678_101541364	3300005456	Bacteria	623
225	Ga0070662_100009726	3300005457	Bacteria	6293
226	Ga0070662_100011762	3300005457	Bacteria	5781
227	Ga0070662_100019784	3300005457	Bacteria	4577
228	Ga0070662_100320690	3300005457	Bacteria	1263
229	Ga0070662_100597588	3300005457	Bacteria	928
230	Ga0070662_100649418	3300005457	Bacteria	890
231	Ga0070681_10680870	3300005458	Bacteria	944
232	Ga0070681_11479174	3300005458	Bacteria	604
233	Ga0068867_100000085	3300005459	Bacteria	58473
234	Ga0068867_100004130	3300005459	Bacteria	10199
235	Ga0068867_100008539	3300005459	Bacteria	7229
236	Ga0068867_100013868	3300005459	Bacteria	5705
237	Ga0068867_100105705	3300005459	Bacteria	2155
238	Ga0068867_100115384	3300005459	Bacteria	2068
239	Ga0068867_100197479	3300005459	Bacteria	1609
240	Ga0068867_100322526	3300005459	Bacteria	1280
241	Ga0068867_100575423	3300005459	Bacteria	979
242	Ga0068867_100597927	3300005459	Bacteria	962
243	Ga0070685_10597373	3300005466	Bacteria	794
244	Ga0070706_100000822	3300005467	Bacteria	34270
245	Ga0070706_100156252	3300005467	Bacteria	2129
246	Ga0070707_100631562	3300005468	Bacteria	1034
247	Ga0070707_100926753	3300005468	Bacteria	836
248	Ga0070699_101304060	3300005518	Bacteria	666
249	Ga0070684_100002981	3300005535	Bacteria	12599
250	Ga0070684_100170273	3300005535	Bacteria	1978
251	Ga0070684_100300695	3300005535	Bacteria	1472
252	Ga0068853_100057775	3300005539	Bacteria	3349
253	Ga0068853_100149756	3300005539	Bacteria	2100
254	Ga0068853_100157572	3300005539	Bacteria	2046
255	Ga0068853_100222162	3300005539	Bacteria	1726
256	Ga0068853_100375749	3300005539	Bacteria	1326
257	Ga0070672_100000244	3300005543	Bacteria	30475
258	Ga0070672_100005577	3300005543	Bacteria	8364
259	Ga0070672_100008576	3300005543	Bacteria	7001
260	Ga0070672_100010686	3300005543	Bacteria	6377
261	Ga0070672_100125840	3300005543	Bacteria	2102
262	Ga0070672_100350090	3300005543	Bacteria	1259
263	Ga0070672_100377133	3300005543	Bacteria	1213
264	Ga0070672_100592457	3300005543	Bacteria	965
265	Ga0070686_100295769	3300005544	Bacteria	1199
266	Ga0070695_100421502	3300005545	Bacteria	1016
267	Ga0070693_100355385	3300005547	Bacteria	1004
268	Ga0070693_100570766	3300005547	Bacteria	813
269	Ga0070665_100006131	3300005548	Bacteria	12289
270	Ga0070665_100107301	3300005548	Bacteria	2795
271	Ga0070665_100225136	3300005548	Bacteria	1876
272	Ga0070665_100573091	3300005548	Bacteria	1142
273	Ga0070665_102492028	3300005548	Bacteria	519
274	Ga0068855_100030205	3300005563	Bacteria	6482
275	Ga0068855_100125071	3300005563	Bacteria	2941
276	Ga0068855_100166273	3300005563	Bacteria	2500
277	Ga0068855_100176007	3300005563	Bacteria	2421
278	Ga0068855_100191710	3300005563	Bacteria	2305
279	Ga0068855_100395419	3300005563	Bacteria	1516
280	Ga0068855_101423419	3300005563	Bacteria	714
281	Ga0068855_101437348	3300005563	Bacteria	710
282	Ga0070664_100021750	3300005564	Bacteria	5289
283	Ga0070664_100037096	3300005564	Bacteria	4096
284	Ga0070664_100050836	3300005564	Bacteria	3509
285	Ga0070664_100179981	3300005564	Bacteria	1879
286	Ga0070664_100319026	3300005564	Bacteria	1407
287	Ga0070664_100451978	3300005564	Bacteria	1180
288	Ga0070664_100552726	3300005564	Bacteria	1064
289	Ga0068857_100018728	3300005577	Bacteria	6076
290	Ga0068857_100045340	3300005577	Bacteria	3900
291	Ga0068857_100115387	3300005577	Bacteria	2415
292	Ga0068857_100426752	3300005577	Bacteria	1237
293	Ga0068857_100600050	3300005577	Bacteria	1041
294	Ga0068857_100787047	3300005577	Bacteria	908
295	Ga0068857_100845678	3300005577	Bacteria	875
296	Ga0068857_101495090	3300005577	Bacteria	658
297	Ga0068854_100002508	3300005578	Bacteria	11387
298	Ga0068854_100006996	3300005578	Bacteria	7195
299	Ga0068854_100080379	3300005578	Bacteria	2405
300	Ga0068854_100096393	3300005578	Bacteria	2210
301	Ga0068854_100130539	3300005578	Bacteria	1918
302	Ga0068854_100375269	3300005578	Bacteria	1170
303	Ga0068854_100384051	3300005578	Bacteria	1158
304	Ga0068854_100527821	3300005578	Bacteria	998
305	Ga0068854_100754653	3300005578	Bacteria	844
306	Ga0068856_100013314	3300005614	Bacteria	7966
307	Ga0068856_100022023	3300005614	Bacteria	6197
308	Ga0068856_100043233	3300005614	Bacteria	4433
309	Ga0068856_100098167	3300005614	Bacteria	2919
310	Ga0068856_100521922	3300005614	Bacteria	1209
311	Ga0068856_100707698	3300005614	Bacteria	1028
312	Ga0070702_100122681	3300005615	Bacteria	1629
313	Ga0068852_100008757	3300005616	Bacteria	7484
314	Ga0068852_100076296	3300005616	Bacteria	2959
315	Ga0068852_100109246	3300005616	Bacteria	2511
316	Ga0068852_100126238	3300005616	Bacteria	2350
317	Ga0068852_100162554	3300005616	Bacteria	2086
318	Ga0068852_100177678	3300005616	Bacteria	2000
319	Ga0068852_100206166	3300005616	Bacteria	1863
320	Ga0068852_100252479	3300005616	Bacteria	1690
321	Ga0068852_100295609	3300005616	Bacteria	1566
322	Ga0068852_101055902	3300005616	Bacteria	832
323	Ga0068852_102076170	3300005616	Bacteria	590
324	Ga0068859_100032096	3300005617	Bacteria	5275
325	Ga0068859_100222130	3300005617	Bacteria	1977
326	Ga0068859_100437590	3300005617	Bacteria	1404
327	Ga0068859_100539851	3300005617	Bacteria	1261
328	Ga0068859_100586895	3300005617	Bacteria	1208
329	Ga0068859_101977742	3300005617	Bacteria	644
330	Ga0068864_100011590	3300005618	Bacteria	7281
331	Ga0068864_100015868	3300005618	Bacteria	6268
332	Ga0068864_100032380	3300005618	Bacteria	4442
333	Ga0068864_100078599	3300005618	Bacteria	2887
334	Ga0068866_10035274	3300005718	Bacteria	2442
335	Ga0068866_10245943	3300005718	Bacteria	1092
336	Ga0068861_100000582	3300005719	Bacteria	21639
337	Ga0068861_100000677	3300005719	Bacteria	20324
338	Ga0068861_100119213	3300005719	Bacteria	2126
339	Ga0068851_10005711	3300005834	Bacteria	5657
340	Ga0068851_10079563	3300005834	Bacteria	1710
341	Ga0068851_10086935	3300005834	Bacteria	1641
342	Ga0068851_10112479	3300005834	Bacteria	1455
343	Ga0068851_10405114	3300005834	Bacteria	803
344	Ga0068851_10606699	3300005834	Bacteria	667
345	Ga0068870_10205411	3300005840	Bacteria	1197
346	Ga0068870_10257640	3300005840	Bacteria	1084
347	Ga0068870_10540408	3300005840	Bacteria	783
348	Ga0068870_10725988	3300005840	Bacteria	688
349	Ga0068870_11226770	3300005840	Bacteria	544
350	Ga0068863_100004173	3300005841	Bacteria	14266
351	Ga0068863_100082398	3300005841	Bacteria	3049
352	Ga0068863_100093622	3300005841	Bacteria	2851
353	Ga0068863_100357715	3300005841	Bacteria	1423
354	Ga0068858_100000560	3300005842	Bacteria	38798
355	Ga0068858_100037529	3300005842	Bacteria	4494
356	Ga0068858_100057084	3300005842	Bacteria	3608
357	Ga0068858_100397457	3300005842	Bacteria	1324
358	Ga0068858_100780252	3300005842	Bacteria	932
359	Ga0068858_101140323	3300005842	Bacteria	766
360	Ga0068860_100002632	3300005843	Bacteria	18674
361	Ga0068860_100061216	3300005843	Bacteria	3577
362	Ga0068860_100240537	3300005843	Bacteria	1761
363	Ga0068860_100341603	3300005843	Bacteria	1472
364	Ga0068860_101736591	3300005843	Bacteria	646
365	Ga0068862_100010198	3300005844	Bacteria	7752
366	Ga0068862_100070096	3300005844	Bacteria	3026
367	Ga0068862_100823561	3300005844	Bacteria	908
368	Ga0068862_101997397	3300005844	Bacteria	590
369	Ga0081455_10232278	3300005937	Bacteria	1360
370	Ga0075365_10004297	3300006038	Bacteria	7518
371	Ga0075365_10029244	3300006038	Bacteria	3520
372	Ga0075368_10015003	3300006042	Bacteria	2868
373	Ga0075368_10025640	3300006042	Bacteria	2262
374	Ga0075368_10089158	3300006042	Bacteria	1261
375	Ga0075368_10110095	3300006042	Bacteria	1135
376	Ga0075368_10120838	3300006042	Bacteria	1085
377	Ga0075368_10127894	3300006042	Bacteria	1055
378	Ga0075368_10233661	3300006042	Bacteria	783
379	Ga0075368_10483754	3300006042	Bacteria	551
380	Ga0075363_100001372	3300006048	Bacteria	9171
381	Ga0075363_100011135	3300006048	Bacteria	4299
382	Ga0075363_100036596	3300006048	Bacteria	2575
383	Ga0075363_100083784	3300006048	Bacteria	1747
384	Ga0075363_100083793	3300006048	Bacteria	1747
385	Ga0075363_100135138	3300006048	Bacteria	1385
386	Ga0075363_100145033	3300006048	Bacteria	1338
387	Ga0075363_100245793	3300006048	Bacteria	1029
388	Ga0075363_100532557	3300006048	Bacteria	700
389	Ga0075363_100642870	3300006048	Bacteria	638
390	Ga0075364_10012528	3300006051	Bacteria	5191
391	Ga0075364_10016278	3300006051	Bacteria	4625
392	Ga0075364_10085088	3300006051	Bacteria	2094
393	Ga0075364_10100218	3300006051	Bacteria	1928
394	Ga0075364_10393356	3300006051	Bacteria	946
395	Ga0075364_10433501	3300006051	Bacteria	898
396	Ga0075364_10457758	3300006051	Bacteria	872
397	Ga0075364_10624434	3300006051	Bacteria	736
398	Ga0075364_10754383	3300006051	Bacteria	664
399	Ga0075432_10150260	3300006058	Bacteria	894
400	Ga0075362_10005070	3300006177	Bacteria	4788
401	Ga0075362_10006907	3300006177	Bacteria	4255
402	Ga0075362_10006970	3300006177	Bacteria	4243
403	Ga0075362_10018421	3300006177	Bacteria	2888
404	Ga0075362_10024484	3300006177	Bacteria	2561
405	Ga0075362_10114760	3300006177	Bacteria	1271
406	Ga0075362_10125632	3300006177	Bacteria	1217
407	Ga0075362_10135822	3300006177	Bacteria	1173
408	Ga0075362_10150654	3300006177	Bacteria	1116
409	Ga0075362_10288997	3300006177	Bacteria	812
410	Ga0075362_10299394	3300006177	Bacteria	798
411	Ga0075362_10536063	3300006177	Bacteria	601
412	Ga0075362_10589544	3300006177	Bacteria	574
413	Ga0075367_10005547	3300006178	Bacteria	6284
414	Ga0075367_10012600	3300006178	Bacteria	4517
415	Ga0075367_10026352	3300006178	Bacteria	3297
416	Ga0075367_10036496	3300006178	Bacteria	2851
417	Ga0075367_10037500	3300006178	Bacteria	2817
418	Ga0075367_10062713	3300006178	Bacteria	2221
419	Ga0075367_10069417	3300006178	Bacteria	2116
420	Ga0075367_10111626	3300006178	Bacteria	1678
421	Ga0075367_10574567	3300006178	Bacteria	716
422	Ga0075367_10846119	3300006178	Bacteria	583
423	Ga0075369_10001852	3300006186	Bacteria	7383
424	Ga0075369_10095160	3300006186	Bacteria	1332
425	Ga0075369_10097573	3300006186	Bacteria	1316
426	Ga0075369_10136040	3300006186	Bacteria	1119
427	Ga0075366_10001677	3300006195	Bacteria	11115
428	Ga0075366_10002935	3300006195	Bacteria	8866
429	Ga0075366_10003541	3300006195	Bacteria	8255
430	Ga0075366_10004492	3300006195	Bacteria	7483
431	Ga0075366_10005743	3300006195	Bacteria	6734
432	Ga0075366_10009910	3300006195	Bacteria	5332
433	Ga0075366_10010575	3300006195	Bacteria	5180
434	Ga0075366_10011468	3300006195	Bacteria	5006
435	Ga0075366_10013487	3300006195	Bacteria	4654
436	Ga0075366_10033053	3300006195	Bacteria	3046
437	Ga0075366_10034984	3300006195	Bacteria	2961
438	Ga0075366_10043108	3300006195	Bacteria	2672
439	Ga0075366_10048738	3300006195	Bacteria	2513
440	Ga0075366_10051847	3300006195	Bacteria	2438
441	Ga0075366_10052964	3300006195	Bacteria	2411
442	Ga0075366_10091551	3300006195	Bacteria	1822
443	Ga0075366_10096603	3300006195	Bacteria	1771
444	Ga0075366_10101808	3300006195	Bacteria	1724
445	Ga0075366_10106830	3300006195	Bacteria	1683
446	Ga0075366_10148761	3300006195	Bacteria	1418
447	Ga0075366_10155628	3300006195	Bacteria	1384
448	Ga0075366_10196689	3300006195	Bacteria	1226
449	Ga0075366_10201532	3300006195	Bacteria	1211
450	Ga0075366_10219966	3300006195	Bacteria	1157
451	Ga0075366_10257032	3300006195	Bacteria	1066
452	Ga0075366_10278101	3300006195	Bacteria	1023
453	Ga0075366_10284664	3300006195	Bacteria	1010
454	Ga0075366_10307972	3300006195	Bacteria	969
455	Ga0075366_10319902	3300006195	Bacteria	950
456	Ga0075366_10389133	3300006195	Bacteria	858
457	Ga0075366_10441189	3300006195	Bacteria	803
458	Ga0075366_10879797	3300006195	Bacteria	558
459	Ga0075366_11018047	3300006195	Bacteria	517
460	Ga0097621_100011918	3300006237	Bacteria	6430
461	Ga0097621_100040679	3300006237	Bacteria	3738
462	Ga0097621_100064071	3300006237	Bacteria	3022
463	Ga0097621_100107140	3300006237	Bacteria	2358
464	Ga0097621_100134827	3300006237	Bacteria	2105
465	Ga0097621_100137354	3300006237	Bacteria	2086
466	Ga0097621_100498620	3300006237	Bacteria	1103
467	Ga0097621_101343929	3300006237	Bacteria	676
468	Ga0075370_10000124	3300006353	Bacteria	25565
469	Ga0075370_10000159	3300006353	Bacteria	22949
470	Ga0075370_10001473	3300006353	Bacteria	10252
471	Ga0075370_10003561	3300006353	Bacteria	7444
472	Ga0075370_10004375	3300006353	Bacteria	6848
473	Ga0075370_10008986	3300006353	Bacteria	5167
474	Ga0075370_10011875	3300006353	Bacteria	4586
475	Ga0075370_10012982	3300006353	Bacteria	4418
476	Ga0075370_10018684	3300006353	Bacteria	3762
477	Ga0075370_10024332	3300006353	Bacteria	3344
478	Ga0075370_10031609	3300006353	Bacteria	2955
479	Ga0075370_10041223	3300006353	Bacteria	2606
480	Ga0075370_10044762	3300006353	Bacteria	2502
481	Ga0075370_10049244	3300006353	Bacteria	2388
482	Ga0075370_10081886	3300006353	Bacteria	1855
483	Ga0075370_10083339	3300006353	Bacteria	1839
484	Ga0075370_10103526	3300006353	Bacteria	1649
485	Ga0075370_10150489	3300006353	Bacteria	1364
486	Ga0075370_10170120	3300006353	Bacteria	1281
487	Ga0075370_10539614	3300006353	Bacteria	705
488	Ga0075370_10877565	3300006353	Bacteria	548
489	Ga0068871_100044806	3300006358	Bacteria	3559
490	Ga0068871_100108518	3300006358	Bacteria	2333
491	Ga0068871_100526870	3300006358	Bacteria	1068
492	Ga0075429_101499775	3300006880	Bacteria	587
493	Ga0068865_100040309	3300006881	Bacteria	3172
494	Ga0068865_100058476	3300006881	Bacteria	2693
495	Ga0068865_100168495	3300006881	Bacteria	1677
496	Ga0068865_100459002	3300006881	Bacteria	1055
497	Ga0068865_100749447	3300006881	Bacteria	839
498	Ga0097620_100032096	3300006931	Bacteria	5275
499	Ga0097620_100222131	3300006931	Bacteria	1977
500	Ga0097620_100437573	3300006931	Bacteria	1404
501	Ga0097620_100539782	3300006931	Bacteria	1261
502	Ga0097620_100586914	3300006931	Bacteria	1208
503	Ga0097620_101977887	3300006931	Bacteria	644
504	Ga0099823_1058477	3300006944	Bacteria	2082
505	Ga0099826_10029080	3300006948	Bacteria	4032
506	Ga0099826_10131993	3300006948	Bacteria	1455
507	Ga0075435_100640821	3300007076	Bacteria	922
508	Ga0105251_10002173	3300009011	Bacteria	15740
509	Ga0105251_10017441	3300009011	Bacteria	3847
510	Ga0105251_10058772	3300009011	Bacteria	1815
511	Ga0105244_10000329	3300009036	Bacteria	45045
512	Ga0105244_10001834	3300009036	Bacteria	16612
513	Ga0105244_10024925	3300009036	Bacteria	3258
514	Ga0105244_10037053	3300009036	Bacteria	2551
515	Ga0105244_10368012	3300009036	Bacteria	662
516	Ga0105250_10000105	3300009092	Bacteria	75608
517	Ga0105250_10129259	3300009092	Bacteria	1042
518	Ga0105240_10017700	3300009093	Bacteria	9595
519	Ga0105240_10020431	3300009093	Bacteria	8833
520	Ga0105240_10022278	3300009093	Bacteria	8403
521	Ga0105240_10336480	3300009093	Bacteria	1716
522	Ga0105240_11672081	3300009093	Bacteria	665
523	Ga0111539_11096507	3300009094	Bacteria	925
524	Ga0111539_11532128	3300009094	Bacteria	773
525	Ga0111539_12951320	3300009094	Bacteria	550
526	Ga0105245_10150078	3300009098	Bacteria	2203
527	Ga0105245_10172687	3300009098	Bacteria	2059
528	Ga0105245_10245508	3300009098	Bacteria	1738
529	Ga0105245_10485053	3300009098	Bacteria	1250
530	Ga0105245_10669374	3300009098	Bacteria	1069
531	Ga0105245_11204771	3300009098	Bacteria	805
532	Ga0105245_11594832	3300009098	Bacteria	704
533	Ga0105247_10441827	3300009101	Bacteria	936
534	Ga0105247_11257926	3300009101	Bacteria	592
535	Ga0114129_10051750	3300009147	Bacteria	5765
536	Ga0105243_10000486	3300009148	Bacteria	40508
537	Ga0105243_10003231	3300009148	Bacteria	13312
538	Ga0105243_10003279	3300009148	Bacteria	13149
539	Ga0105243_10021379	3300009148	Bacteria	4910
540	Ga0105243_10105356	3300009148	Bacteria	2349
541	Ga0105243_10120855	3300009148	Bacteria	2208
542	Ga0105243_10335147	3300009148	Bacteria	1383
543	Ga0105243_10415518	3300009148	Bacteria	1253
544	Ga0105243_11059092	3300009148	Bacteria	817
545	Ga0105243_11142834	3300009148	Bacteria	789
546	Ga0105243_12170737	3300009148	Bacteria	592
547	Ga0105241_10003239	3300009174	Bacteria	12103
548	Ga0105241_10401883	3300009174	Bacteria	1202
549	Ga0105241_10724360	3300009174	Bacteria	910
550	Ga0105241_10935623	3300009174	Bacteria	807
551	Ga0105241_11873201	3300009174	Bacteria	587
552	Ga0105241_12604394	3300009174	Bacteria	508
553	Ga0105242_10961652	3300009176	Bacteria	859
554	Ga0105242_11425078	3300009176	Bacteria	721
555	Ga0105248_10000445	3300009177	Bacteria	46980
556	Ga0105248_10017866	3300009177	Bacteria	7827
557	Ga0105248_10025421	3300009177	Bacteria	6583
558	Ga0105248_10046075	3300009177	Bacteria	4887
559	Ga0105248_10409042	3300009177	Bacteria	1528
560	Ga0105248_10728412	3300009177	Bacteria	1119
561	Ga0105248_11419170	3300009177	Bacteria	786
562	Ga0105248_11874896	3300009177	Bacteria	680
563	Ga0105248_12224160	3300009177	Bacteria	624
564	Ga0105237_10000548	3300009545	Bacteria	52739
565	Ga0105237_10015839	3300009545	Bacteria	7841
566	Ga0105237_10182787	3300009545	Bacteria	2097
567	Ga0105237_10231058	3300009545	Bacteria	1851
568	Ga0105237_10341422	3300009545	Bacteria	1502
569	Ga0105237_10445838	3300009545	Bacteria	1300
570	Ga0105237_10738902	3300009545	Bacteria	990
571	Ga0105237_10923354	3300009545	Bacteria	880
572	Ga0105238_10020973	3300009551	Bacteria	6657
573	Ga0105238_10136657	3300009551	Bacteria	2429
574	Ga0105238_10161939	3300009551	Bacteria	2213
575	Ga0105238_10650503	3300009551	Bacteria	1064
576	Ga0105249_10038755	3300009553	Bacteria	4325
577	Ga0105249_10052334	3300009553	Bacteria	3728
578	Ga0105249_10177219	3300009553	Bacteria	2071
579	Ga0105249_10318349	3300009553	Bacteria	1566
580	Ga0105249_10336225	3300009553	Bacteria	1525
581	Ga0105249_13095095	3300009553	Bacteria	534
582	Ga0105239_10001569	3300010375	Bacteria	30171
583	Ga0105239_10052411	3300010375	Bacteria	4474
584	Ga0105239_10174209	3300010375	Bacteria	2406
585	Ga0105239_10274852	3300010375	Bacteria	1895
586	Ga0105239_10280880	3300010375	Bacteria	1874
587	Ga0105239_10777111	3300010375	Bacteria	1097
588	Ga0105239_13137326	3300010375	Bacteria	538
589	Ga0105246_10007754	3300011119	Bacteria	6590
590	Ga0105246_10200957	3300011119	Bacteria	1549
591	Ga0105246_10375419	3300011119	Bacteria	1173
592	Ga0105246_11159263	3300011119	Bacteria	709
593	Ga0105246_11783863	3300011119	Bacteria	587
594	Ga0157322_1021901	3300012490	Bacteria	622
595	Ga0157319_1000006	3300012497	Bacteria	361506
596	Ga0157347_1003675	3300012502	Bacteria	1389
597	Ga0157339_1024310	3300012505	Bacteria	667
598	Ga0157342_1018967	3300012507	Bacteria	784
599	Ga0157327_1046646	3300012512	Bacteria	602
600	Ga0157373_10004477	3300013100	Bacteria	10519
601	Ga0157373_10005848	3300013100	Bacteria	9205
602	Ga0157373_10037609	3300013100	Bacteria	3469
603	Ga0157373_10103380	3300013100	Bacteria	2004
604	Ga0157373_10115188	3300013100	Bacteria	1890
605	Ga0157373_10151556	3300013100	Bacteria	1631
606	Ga0157371_10099143	3300013102	Bacteria	2066
607	Ga0157371_10255462	3300013102	Bacteria	1262
608	Ga0157371_10616305	3300013102	Bacteria	808
609	Ga0157371_10722570	3300013102	Bacteria	747
610	Ga0157371_11100124	3300013102	Bacteria	609
611	Ga0157370_10001046	3300013104	Bacteria	34825
612	Ga0157370_10014128	3300013104	Bacteria	8189
613	Ga0157370_10217371	3300013104	Bacteria	1771
614	Ga0157370_10312903	3300013104	Bacteria	1449
615	Ga0157370_10353690	3300013104	Bacteria	1354
616	Ga0157370_10923045	3300013104	Bacteria	792
617	Ga0157369_10000981	3300013105	Bacteria	36190
618	Ga0157369_10014051	3300013105	Bacteria	9045
619	Ga0157369_10017535	3300013105	Bacteria	8045
620	Ga0157369_10019561	3300013105	Bacteria	7576
621	Ga0157369_10374804	3300013105	Bacteria	1477
622	Ga0157369_10397815	3300013105	Bacteria	1429
623	Ga0157369_11428250	3300013105	Bacteria	704
624	Ga0157374_10000032	3300013296	Bacteria	202485
625	Ga0157374_10005865	3300013296	Bacteria	10372
626	Ga0157374_10014186	3300013296	Bacteria	6967
627	Ga0157374_10145876	3300013296	Bacteria	2299
628	Ga0157374_10277004	3300013296	Bacteria	1655
629	Ga0157374_10380304	3300013296	Bacteria	1406
630	Ga0157374_10419587	3300013296	Bacteria	1337
631	Ga0157378_10000558	3300013297	Bacteria	35454
632	Ga0157378_10481027	3300013297	Bacteria	1237
633	Ga0157378_10511813	3300013297	Bacteria	1201
634	Ga0157378_10831066	3300013297	Bacteria	951
635	Ga0157378_10835110	3300013297	Bacteria	949
636	Ga0157378_11412386	3300013297	Bacteria	739
637	Ga0157378_11729265	3300013297	Bacteria	673
638	Ga0157378_11757097	3300013297	Bacteria	668
639	Ga0157378_12632226	3300013297	Bacteria	555
640	Ga0157378_12638068	3300013297	Bacteria	555
641	Ga0163162_10005747	3300013306	Bacteria	11998
642	Ga0163162_10045656	3300013306	Bacteria	4389
643	Ga0163162_10109110	3300013306	Bacteria	2864
644	Ga0163162_10223961	3300013306	Bacteria	2010
645	Ga0163162_10232252	3300013306	Bacteria	1975
646	Ga0163162_10609804	3300013306	Bacteria	1217
647	Ga0163162_11187961	3300013306	Bacteria	865
648	Ga0157372_10019251	3300013307	Bacteria	7351
649	Ga0157372_10188302	3300013307	Bacteria	2390
650	Ga0157372_10276126	3300013307	Bacteria	1953
651	Ga0157372_10372342	3300013307	Bacteria	1664
652	Ga0157372_10388386	3300013307	Bacteria	1626
653	Ga0157372_10712918	3300013307	Bacteria	1167
654	Ga0157372_11133255	3300013307	Bacteria	905
655	Ga0157372_11258917	3300013307	Bacteria	854
656	Ga0157375_10013127	3300013308	Bacteria	7361
657	Ga0157375_10031297	3300013308	Bacteria	5027
658	Ga0157375_10059867	3300013308	Bacteria	3774
659	Ga0157375_10068447	3300013308	Bacteria	3552
660	Ga0157375_10106464	3300013308	Bacteria	2896
661	Ga0157375_10119991	3300013308	Bacteria	2738
662	Ga0157375_10187002	3300013308	Bacteria	2225
663	Ga0157375_10325666	3300013308	Bacteria	1701
664	Ga0157375_10548459	3300013308	Bacteria	1318
665	Ga0157375_10723557	3300013308	Bacteria	1148
666	Ga0157375_11604339	3300013308	Bacteria	769
667	Ga0163163_10129383	3300014325	Bacteria	2565
668	Ga0163163_10272395	3300014325	Bacteria	1744
669	Ga0163163_10817455	3300014325	Bacteria	995
670	Ga0163163_11322412	3300014325	Bacteria	783
671	Ga0157380_10053803	3300014326	Bacteria	3192
672	Ga0157380_10228832	3300014326	Bacteria	1668
673	Ga0157380_10320589	3300014326	Bacteria	1436
674	Ga0157380_10571025	3300014326	Bacteria	1113
675	Ga0157380_11716265	3300014326	Bacteria	686
676	Ga0157380_12956872	3300014326	Bacteria	541
677	Ga0182008_10001960	3300014497	Bacteria	13217
678	Ga0182008_10009359	3300014497	Bacteria	5292
679	Ga0182008_10116948	3300014497	Bacteria	1323
680	Ga0182008_10431370	3300014497	Bacteria	713
681	Ga0182008_10983333	3300014497	Bacteria	502
682	Ga0157377_10000028	3300014745	Bacteria	134810
683	Ga0157377_10077811	3300014745	Bacteria	1932
684	Ga0157379_10035995	3300014968	Bacteria	4414
685	Ga0157379_10043963	3300014968	Bacteria	3989
686	Ga0157379_10051052	3300014968	Bacteria	3694
687	Ga0157379_10107677	3300014968	Bacteria	2502
688	Ga0157379_10142242	3300014968	Bacteria	2163
689	Ga0157379_10181011	3300014968	Bacteria	1904
690	Ga0157379_10242497	3300014968	Bacteria	1635
691	Ga0157379_10290484	3300014968	Bacteria	1489
692	Ga0157379_11078161	3300014968	Bacteria	769
693	Ga0157376_10009600	3300014969	Bacteria	7037
694	Ga0157376_10048381	3300014969	Bacteria	3516
695	Ga0157376_10092691	3300014969	Bacteria	2620
696	Ga0157376_10187310	3300014969	Bacteria	1895
697	Ga0157376_10576089	3300014969	Bacteria	1117
698	Ga0157376_10671608	3300014969	Bacteria	1039
699	Ga0157376_11200374	3300014969	Bacteria	787
700	Ga0157376_11914755	3300014969	Bacteria	630
701	Ga0182006_1001354	3300015261	Bacteria	14997
702	Ga0182006_1010741	3300015261	Bacteria	4056
703	Ga0182006_1011055	3300015261	Bacteria	3985
704	Ga0182006_1030375	3300015261	Bacteria	2184
705	Ga0182006_1071057	3300015261	Bacteria	1291
706	Ga0182007_10001767	3300015262	Bacteria	11326
707	Ga0182007_10021863	3300015262	Bacteria	2265
708	Ga0182007_10111558	3300015262	Bacteria	910
709	Ga0182007_10270552	3300015262	Bacteria	615
710	Ga0182005_1029694	3300015265	Bacteria	1491
711	Ga0182005_1091376	3300015265	Bacteria	847
712	Ga0182005_1297163	3300015265	Bacteria	509
713	Ga0163161_10001250	3300017792	Bacteria	19010
714	Ga0163161_10023133	3300017792	Bacteria	4380
715	Ga0163161_10048400	3300017792	Bacteria	3070
716	Ga0163161_10196275	3300017792	Bacteria	1554
717	Ga0163161_10216770	3300017792	Bacteria	1481
718	Ga0163161_10669334	3300017792	Bacteria	862
719	Ga0163161_10675892	3300017792	Bacteria	858
720	Ga0206355_1269035	3300020076	Bacteria	762
721	Ga0206352_10797362	3300020078	Bacteria	510
722	Ga0213872_10000011	3300021361	Bacteria	194139
723	Ga0213872_10000043	3300021361	Bacteria	117678
724	Ga0213872_10000272	3300021361	Bacteria	44319
725	Ga0213872_10040543	3300021361	Bacteria	2126
726	Ga0213872_10060109	3300021361	Bacteria	1719
727	Ga0213872_10074479	3300021361	Bacteria	1528
728	Ga0213872_10075054	3300021361	Bacteria	1522
729	Ga0213872_10227793	3300021361	Bacteria	791
730	Ga0213876_10287255	3300021384	Bacteria	874
731	Ga0209435_125931	3300025206	Bacteria	545
732	Ga0209436_101446	3300025208	Bacteria	8293
733	Ga0209784_100938	3300025224	Bacteria	5660
734	Ga0209566_100561	3300025225	Bacteria	24375
735	Ga0209674_100003	3300025226	Bacteria	2196646
736	Ga0209674_100122	3300025226	Bacteria	131720
737	Ga0209672_100191	3300025228	Bacteria	49747
738	Ga0209672_100222	3300025228	Bacteria	44005
739	Ga0209147_100435	3300025229	Bacteria	26860
740	Ga0209563_100005	3300025230	Bacteria	1774893
741	Ga0209563_100017	3300025230	Bacteria	796449
742	Ga0209563_103222	3300025230	Bacteria	3436
743	Ga0209258_100048	3300025242	Bacteria	365881
744	Ga0209258_100559	3300025242	Bacteria	32575
745	Ga0209258_102813	3300025242	Bacteria	4173
746	Ga0207425_1000786	3300025245	Bacteria	16194
747	Ga0207425_1003597	3300025245	Bacteria	4906
748	Ga0209646_1000022	3300025246	Bacteria	446621
749	Ga0209646_1000271	3300025246	Bacteria	47713
750	Ga0209026_1000085	3300025250	Bacteria	185778
751	Ga0209026_1004183	3300025250	Bacteria	4407
752	Ga0209677_101546	3300025253	Bacteria	9813
753	Ga0209677_101615	3300025253	Bacteria	9505
754	Ga0209677_103383	3300025253	Bacteria	5220
755	Ga0209148_1000021	3300025254	Bacteria	714645
756	Ga0209148_1000040	3300025254	Bacteria	473531
757	Ga0209148_1012316	3300025254	Bacteria	1567
758	Ga0209759_1000068	3300025256	Bacteria	183479
759	Ga0209759_1001746	3300025256	Bacteria	11158
760	Ga0209759_1001796	3300025256	Bacteria	10868
761	Ga0209759_1002047	3300025256	Bacteria	9476
762	Ga0209759_1021973	3300025256	Bacteria	1437
763	Ga0209759_1031313	3300025256	Bacteria	1037
764	Ga0209129_1000007	3300025258	Bacteria	771325
765	Ga0209129_1000369	3300025258	Bacteria	36698
766	Ga0209129_1001205	3300025258	Bacteria	14869
767	Ga0209129_1024238	3300025258	Bacteria	1070
768	Ga0209565_1000153	3300025263	Bacteria	92909
769	Ga0209565_1001390	3300025263	Bacteria	10816
770	Ga0209565_1003425	3300025263	Bacteria	5136
771	Ga0209565_1078898	3300025263	Bacteria	544
772	Ga0209455_1000643	3300025272	Bacteria	21407
773	Ga0209455_1001880	3300025272	Bacteria	8751
774	Ga0209673_1000423	3300025273	Bacteria	73682
775	Ga0209673_1000566	3300025273	Bacteria	59095
776	Ga0209673_1000801	3300025273	Bacteria	41669
777	Ga0209673_1006937	3300025273	Bacteria	5353
778	Ga0209673_1013020	3300025273	Bacteria	3309
779	Ga0209673_1013271	3300025273	Bacteria	3261
780	Ga0209673_1013645	3300025273	Bacteria	3195
781	Ga0209673_1046556	3300025273	Bacteria	1183
782	Ga0209130_1000953	3300025284	Bacteria	22898
783	Ga0209130_1001018	3300025284	Bacteria	21612
784	Ga0209130_1001734	3300025284	Bacteria	13039
785	Ga0209675_1000150	3300025291	Bacteria	92909
786	Ga0209675_1001481	3300025291	Bacteria	13497
787	Ga0209675_1001635	3300025291	Bacteria	12545
788	Ga0209675_1002237	3300025291	Bacteria	10110
789	Ga0209675_1002884	3300025291	Bacteria	8522
790	Ga0209676_1000004	3300025292	Bacteria	1138360
791	Ga0209676_1000735	3300025292	Bacteria	44818
792	Ga0209676_1001743	3300025292	Bacteria	18592
793	Ga0209676_1002326	3300025292	Bacteria	13761
794	Ga0209676_1004231	3300025292	Bacteria	8115
795	Ga0209676_1007213	3300025292	Bacteria	5289
796	Ga0209676_1030459	3300025292	Bacteria	1649
797	Ga0209025_1000057	3300025294	Bacteria	314601
798	Ga0209025_1000217	3300025294	Bacteria	137909
799	Ga0209025_1000278	3300025294	Bacteria	117718
800	Ga0209025_1001179	3300025294	Bacteria	36980
801	Ga0209025_1010012	3300025294	Bacteria	6495
802	Ga0209025_1018495	3300025294	Bacteria	3941
803	Ga0209025_1124121	3300025294	Bacteria	764
804	Ga0209564_1000003	3300025295	Bacteria	1585848
805	Ga0209564_1000046	3300025295	Bacteria	373787
806	Ga0209564_1000915	3300025295	Bacteria	38566
807	Ga0209564_1001044	3300025295	Bacteria	33893
808	Ga0209564_1015210	3300025295	Bacteria	3147
809	Ga0209564_1077190	3300025295	Bacteria	665
810	Ga0209758_1000025	3300025297	Bacteria	586687
811	Ga0209758_1000709	3300025297	Bacteria	49238
812	Ga0209758_1002316	3300025297	Bacteria	19694
813	Ga0209758_1020934	3300025297	Bacteria	3070
814	Ga0209050_1000002	3300025298	Bacteria	1792849
815	Ga0209050_1000861	3300025298	Bacteria	41048
816	Ga0209050_1001823	3300025298	Bacteria	20745
817	Ga0209050_1002866	3300025298	Bacteria	13651
818	Ga0209050_1002874	3300025298	Bacteria	13626
819	Ga0209050_1003318	3300025298	Bacteria	12018
820	Ga0209050_1035133	3300025298	Bacteria	1487
821	Ga0209050_1037278	3300025298	Bacteria	1405
822	Ga0209050_1097324	3300025298	Bacteria	589
823	Ga0209256_1000067	3300025299	Bacteria	246812
824	Ga0209256_1000366	3300025299	Bacteria	72685
825	Ga0209256_1005597	3300025299	Bacteria	7138
826	Ga0209256_1008454	3300025299	Bacteria	4769
827	Ga0209256_1041041	3300025299	Bacteria	1178
828	Ga0209256_1042846	3300025299	Bacteria	1140
829	Ga0209256_1094527	3300025299	Bacteria	629
830	Ga0207426_1000001	3300025302	Bacteria	1341301
831	Ga0207426_1000028	3300025302	Bacteria	483955
832	Ga0207426_1020977	3300025302	Bacteria	2263
833	Ga0209051_1000002	3300025303	Bacteria	1631846
834	Ga0209051_1000049	3300025303	Bacteria	287483
835	Ga0209051_1000096	3300025303	Bacteria	167399
836	Ga0209051_1000532	3300025303	Bacteria	47250
837	Ga0209051_1000913	3300025303	Bacteria	29387
838	Ga0209051_1004959	3300025303	Bacteria	7955
839	Ga0209051_1007617	3300025303	Bacteria	5892
840	Ga0209051_1010944	3300025303	Bacteria	4527
841	Ga0209051_1013466	3300025303	Bacteria	3892
842	Ga0209051_1035263	3300025303	Bacteria	1864
843	Ga0209051_1107638	3300025303	Bacteria	734
844	Ga0209257_1000002	3300025304	Bacteria	1767052
845	Ga0209257_1000072	3300025304	Bacteria	332791
846	Ga0209257_1005501	3300025304	Bacteria	8849
847	Ga0209257_1005948	3300025304	Bacteria	8192
848	Ga0209257_1012640	3300025304	Bacteria	3871
849	Ga0209257_1013234	3300025304	Bacteria	3698
850	Ga0209257_1021343	3300025304	Bacteria	2356
851	Ga0207697_10054088	3300025315	Bacteria	1663
852	Ga0207697_10101513	3300025315	Bacteria	1226
853	Ga0207697_10455412	3300025315	Bacteria	567
854	Ga0207656_10012183	3300025321	Bacteria	3265
855	Ga0207656_10029824	3300025321	Bacteria	2250
856	Ga0207656_10071677	3300025321	Bacteria	1541
857	Ga0207656_10111356	3300025321	Bacteria	1265
858	Ga0207656_10111360	3300025321	Bacteria	1265
859	Ga0207696_1000131	3300025711	Bacteria	132958
860	Ga0207655_1000004	3300025728	Bacteria	1021221
861	Ga0207655_1003340	3300025728	Bacteria	12017
862	Ga0207655_1029730	3300025728	Bacteria	2552
863	Ga0207655_1118431	3300025728	Bacteria	882
864	Ga0207655_1236898	3300025728	Bacteria	524
865	Ga0207713_1000052	3300025735	Bacteria	222663
866	Ga0207713_1000084	3300025735	Bacteria	160822
867	Ga0207713_1043333	3300025735	Bacteria	1860
868	Ga0207682_10006629	3300025893	Bacteria	4655
869	Ga0207682_10022477	3300025893	Bacteria	2485
870	Ga0207682_10067253	3300025893	Bacteria	1512
871	Ga0207682_10071200	3300025893	Bacteria	1474
872	Ga0207682_10532095	3300025893	Bacteria	556
873	Ga0207642_10037663	3300025899	Bacteria	2086
874	Ga0207642_10743245	3300025899	Bacteria	621
875	Ga0207688_10036837	3300025901	Bacteria	2712
876	Ga0207688_10167683	3300025901	Bacteria	1305
877	Ga0207688_10248005	3300025901	Bacteria	1078
878	Ga0207680_10216266	3300025903	Bacteria	1312
879	Ga0207647_10046340	3300025904	Bacteria	2710
880	Ga0207647_10052312	3300025904	Bacteria	2521
881	Ga0207685_10596594	3300025905	Bacteria	592
882	Ga0207645_10003439	3300025907	Bacteria	12030
883	Ga0207645_10015692	3300025907	Bacteria	5025
884	Ga0207645_10030847	3300025907	Bacteria	3454
885	Ga0207645_10066499	3300025907	Bacteria	2304
886	Ga0207645_10205138	3300025907	Bacteria	1297
887	Ga0207645_11133322	3300025907	Bacteria	527
888	Ga0207643_10244189	3300025908	Bacteria	1104
889	Ga0207705_10026548	3300025909	Bacteria	4130
890	Ga0207705_10102916	3300025909	Bacteria	2103
891	Ga0207705_10165193	3300025909	Bacteria	1664
892	Ga0207705_10236422	3300025909	Bacteria	1391
893	Ga0207705_10347626	3300025909	Bacteria	1142
894	Ga0207705_10378081	3300025909	Bacteria	1094
895	Ga0207705_11014738	3300025909	Bacteria	641
896	Ga0207705_11017966	3300025909	Bacteria	640
897	Ga0207684_10002530	3300025910	Bacteria	18373
898	Ga0207684_10136233	3300025910	Bacteria	2109
899	Ga0207684_10401714	3300025910	Bacteria	1178
900	Ga0207654_10197100	3300025911	Bacteria	1324
901	Ga0207654_10639853	3300025911	Bacteria	761
902	Ga0207707_10024701	3300025912	Bacteria	5257
903	Ga0207707_11140491	3300025912	Bacteria	634
904	Ga0207707_11289473	3300025912	Bacteria	587
905	Ga0207695_10030367	3300025913	Bacteria	5949
906	Ga0207695_10177375	3300025913	Bacteria	2053
907	Ga0207695_10204007	3300025913	Bacteria	1890
908	Ga0207695_10267148	3300025913	Bacteria	1607
909	Ga0207695_10430581	3300025913	Bacteria	1203
910	Ga0207671_10010913	3300025914	Bacteria	7444
911	Ga0207671_10134750	3300025914	Bacteria	1898
912	Ga0207671_10143413	3300025914	Bacteria	1842
913	Ga0207671_10356571	3300025914	Bacteria	1160
914	Ga0207671_10883563	3300025914	Bacteria	707
915	Ga0207663_10737599	3300025916	Bacteria	782
916	Ga0207660_10491418	3300025917	Bacteria	995
917	Ga0207662_10594733	3300025918	Bacteria	769
918	Ga0207657_10000539	3300025919	Bacteria	40381
919	Ga0207657_10016351	3300025919	Bacteria	7158
920	Ga0207657_10063967	3300025919	Bacteria	3142
921	Ga0207657_10095194	3300025919	Bacteria	2478
922	Ga0207657_10154007	3300025919	Bacteria	1870
923	Ga0207657_10160330	3300025919	Bacteria	1827
924	Ga0207657_10342010	3300025919	Bacteria	1181
925	Ga0207657_10951572	3300025919	Bacteria	660
926	Ga0207649_10027765	3300025920	Bacteria	3326
927	Ga0207649_10065254	3300025920	Bacteria	2304
928	Ga0207649_10859077	3300025920	Bacteria	710
929	Ga0207652_10164160	3300025921	Bacteria	1991
930	Ga0207652_10273281	3300025921	Bacteria	1524
931	Ga0207652_11186502	3300025921	Bacteria	665
932	Ga0207646_10149795	3300025922	Bacteria	2104
933	Ga0207681_10010347	3300025923	Bacteria	5708
934	Ga0207681_10015245	3300025923	Bacteria	4792
935	Ga0207681_10065307	3300025923	Bacteria	2515
936	Ga0207681_10136055	3300025923	Bacteria	1823
937	Ga0207681_11262814	3300025923	Bacteria	620
938	Ga0207694_10065085	3300025924	Bacteria	2842
939	Ga0207694_10110900	3300025924	Bacteria	2182
940	Ga0207694_10147805	3300025924	Bacteria	1892
941	Ga0207694_10323332	3300025924	Bacteria	1273
942	Ga0207694_10663995	3300025924	Bacteria	879
943	Ga0207694_11171087	3300025924	Bacteria	650
944	Ga0207650_10001071	3300025925	Bacteria	20336
945	Ga0207650_10033566	3300025925	Bacteria	3718
946	Ga0207650_10208534	3300025925	Bacteria	1568
947	Ga0207650_10233262	3300025925	Bacteria	1485
948	Ga0207650_10457365	3300025925	Bacteria	1063
949	Ga0207650_10596088	3300025925	Bacteria	929
950	Ga0207650_10628582	3300025925	Bacteria	904
951	Ga0207650_10865198	3300025925	Bacteria	767
952	Ga0207659_10002589	3300025926	Bacteria	10770
953	Ga0207659_10010915	3300025926	Bacteria	5721
954	Ga0207659_10013311	3300025926	Bacteria	5263
955	Ga0207659_10127689	3300025926	Bacteria	1958
956	Ga0207659_10371230	3300025926	Bacteria	1191
957	Ga0207659_10538064	3300025926	Bacteria	992
958	Ga0207659_10721579	3300025926	Bacteria	854
959	Ga0207687_10055314	3300025927	Bacteria	2780
960	Ga0207687_10066030	3300025927	Bacteria	2570
961	Ga0207687_10225398	3300025927	Bacteria	1478
962	Ga0207687_10291600	3300025927	Bacteria	1311
963	Ga0207687_11043346	3300025927	Bacteria	701
964	Ga0207664_10020035	3300025929	Bacteria	4951
965	Ga0207644_10002293	3300025931	Bacteria	12414
966	Ga0207644_10005830	3300025931	Bacteria	8024
967	Ga0207644_10008258	3300025931	Bacteria	6821
968	Ga0207644_10033013	3300025931	Bacteria	3614
969	Ga0207644_10066865	3300025931	Bacteria	2618
970	Ga0207644_10181125	3300025931	Bacteria	1651
971	Ga0207644_10451985	3300025931	Bacteria	1055
972	Ga0207644_10582408	3300025931	Bacteria	928
973	Ga0207644_10919969	3300025931	Bacteria	733
974	Ga0207644_10967293	3300025931	Bacteria	714
975	Ga0207690_10009822	3300025932	Bacteria	5686
976	Ga0207690_10047094	3300025932	Bacteria	2859
977	Ga0207690_10051966	3300025932	Bacteria	2743
978	Ga0207690_10075669	3300025932	Bacteria	2335
979	Ga0207690_10161082	3300025932	Bacteria	1672
980	Ga0207690_10195198	3300025932	Bacteria	1534
981	Ga0207690_10387241	3300025932	Bacteria	1112
982	Ga0207690_10397108	3300025932	Bacteria	1099
983	Ga0207706_10001856	3300025933	Bacteria	20689
984	Ga0207706_10005010	3300025933	Bacteria	12370
985	Ga0207706_10023334	3300025933	Bacteria	5557
986	Ga0207706_10050415	3300025933	Bacteria	3678
987	Ga0207706_10127657	3300025933	Bacteria	2236
988	Ga0207706_10278780	3300025933	Bacteria	1458
989	Ga0207706_10396119	3300025933	Bacteria	1197
990	Ga0207706_10666473	3300025933	Bacteria	890
991	Ga0207706_11275413	3300025933	Bacteria	608
992	Ga0207686_10562429	3300025934	Bacteria	893
993	Ga0207686_10687661	3300025934	Bacteria	812
994	Ga0207709_10000348	3300025935	Bacteria	47582
995	Ga0207709_10000556	3300025935	Bacteria	31885
996	Ga0207709_10005637	3300025935	Bacteria	7077
997	Ga0207709_10006258	3300025935	Bacteria	6689
998	Ga0207709_10007492	3300025935	Bacteria	6075
999	Ga0207709_10193284	3300025935	Bacteria	1447
1000	Ga0207709_10803082	3300025935	Bacteria	759
1001	Ga0207670_10036922	3300025936	Bacteria	3182
1002	Ga0207669_10002735	3300025937	Bacteria	7556
1003	Ga0207669_10163716	3300025937	Bacteria	1574
1004	Ga0207669_10198881	3300025937	Bacteria	1453
1005	Ga0207669_10549955	3300025937	Bacteria	931
1006	Ga0207704_10061644	3300025938	Bacteria	2328
1007	Ga0207704_10351102	3300025938	Bacteria	1148
1008	Ga0207704_10439315	3300025938	Bacteria	1039
1009	Ga0207691_10004533	3300025940	Bacteria	13439
1010	Ga0207691_10005312	3300025940	Bacteria	12435
1011	Ga0207691_10007653	3300025940	Bacteria	10396
1012	Ga0207691_10057377	3300025940	Bacteria	3544
1013	Ga0207691_10174786	3300025940	Bacteria	1879
1014	Ga0207691_10327127	3300025940	Bacteria	1314
1015	Ga0207691_10618110	3300025940	Bacteria	917
1016	Ga0207691_10733465	3300025940	Bacteria	832
1017	Ga0207691_11369505	3300025940	Bacteria	582
1018	Ga0207711_10007461	3300025941	Bacteria	9150
1019	Ga0207711_10013057	3300025941	Bacteria	6900
1020	Ga0207711_10015303	3300025941	Bacteria	6367
1021	Ga0207711_10078718	3300025941	Bacteria	2876
1022	Ga0207711_10245986	3300025941	Bacteria	1641
1023	Ga0207711_10375692	3300025941	Bacteria	1318
1024	Ga0207711_11205800	3300025941	Bacteria	698
1025	Ga0207711_11233896	3300025941	Bacteria	689
1026	Ga0207711_11868024	3300025941	Bacteria	544
1027	Ga0207689_10004291	3300025942	Bacteria	12973
1028	Ga0207689_10018167	3300025942	Bacteria	5937
1029	Ga0207689_10022168	3300025942	Bacteria	5341
1030	Ga0207689_10051486	3300025942	Bacteria	3394
1031	Ga0207689_10282689	3300025942	Bacteria	1374
1032	Ga0207689_10371595	3300025942	Bacteria	1190
1033	Ga0207689_10460278	3300025942	Bacteria	1064
1034	Ga0207689_11056852	3300025942	Bacteria	685
1035	Ga0207661_10069956	3300025944	Bacteria	2863
1036	Ga0207661_10152654	3300025944	Bacteria	1997
1037	Ga0207679_10037286	3300025945	Bacteria	3454
1038	Ga0207679_10046527	3300025945	Bacteria	3146
1039	Ga0207679_10151674	3300025945	Bacteria	1887
1040	Ga0207679_10185328	3300025945	Bacteria	1725
1041	Ga0207679_10322897	3300025945	Bacteria	1337
1042	Ga0207679_10483534	3300025945	Bacteria	1103
1043	Ga0207679_10684044	3300025945	Bacteria	930
1044	Ga0207667_10016870	3300025949	Bacteria	8237
1045	Ga0207667_10053981	3300025949	Bacteria	4227
1046	Ga0207667_10080136	3300025949	Bacteria	3383
1047	Ga0207667_10108428	3300025949	Bacteria	2865
1048	Ga0207667_10116858	3300025949	Bacteria	2749
1049	Ga0207667_10271910	3300025949	Bacteria	1732
1050	Ga0207667_10836318	3300025949	Bacteria	915
1051	Ga0207667_11999714	3300025949	Bacteria	540
1052	Ga0207651_10003468	3300025960	Bacteria	7746
1053	Ga0207651_10032840	3300025960	Bacteria	3339
1054	Ga0207651_10041449	3300025960	Bacteria	3056
1055	Ga0207651_10074451	3300025960	Bacteria	2418
1056	Ga0207651_10078352	3300025960	Bacteria	2370
1057	Ga0207651_10278866	3300025960	Bacteria	1380
1058	Ga0207651_10336242	3300025960	Bacteria	1267
1059	Ga0207651_10380602	3300025960	Bacteria	1196
1060	Ga0207651_10989381	3300025960	Bacteria	751
1061	Ga0207651_11035467	3300025960	Bacteria	734
1062	Ga0207651_11180812	3300025960	Bacteria	687
1063	Ga0207712_10016113	3300025961	Bacteria	4833
1064	Ga0207712_10162453	3300025961	Bacteria	1737
1065	Ga0207712_10485853	3300025961	Bacteria	1053
1066	Ga0207712_11132805	3300025961	Bacteria	697
1067	Ga0207668_10160980	3300025972	Bacteria	1749
1068	Ga0207668_10185382	3300025972	Bacteria	1645
1069	Ga0207668_10284338	3300025972	Bacteria	1358
1070	Ga0207668_10564733	3300025972	Bacteria	987
1071	Ga0207668_11103147	3300025972	Bacteria	711
1072	Ga0207668_11177387	3300025972	Bacteria	688
1073	Ga0207668_11208167	3300025972	Bacteria	679
1074	Ga0207640_10001781	3300025981	Bacteria	11576
1075	Ga0207640_10114521	3300025981	Bacteria	1919
1076	Ga0207640_10276907	3300025981	Bacteria	1316
1077	Ga0207640_10502366	3300025981	Bacteria	1010
1078	Ga0207640_11005044	3300025981	Bacteria	734
1079	Ga0207640_11475505	3300025981	Bacteria	611
1080	Ga0207658_10005312	3300025986	Bacteria	8859
1081	Ga0207658_10035630	3300025986	Bacteria	3565
1082	Ga0207658_10069435	3300025986	Bacteria	2662
1083	Ga0207658_10117580	3300025986	Bacteria	2113
1084	Ga0207658_10134850	3300025986	Bacteria	1989
1085	Ga0207658_10268119	3300025986	Bacteria	1458
1086	Ga0207658_10278531	3300025986	Bacteria	1433
1087	Ga0207658_11076938	3300025986	Bacteria	734
1088	Ga0207677_10000972	3300026023	Bacteria	15863
1089	Ga0207677_10001461	3300026023	Bacteria	12514
1090	Ga0207677_10006577	3300026023	Bacteria	6377
1091	Ga0207677_10568710	3300026023	Bacteria	991
1092	Ga0207677_10695636	3300026023	Bacteria	902
1093	Ga0207677_11868105	3300026023	Bacteria	558
1094	Ga0207703_10012389	3300026035	Bacteria	6646
1095	Ga0207703_10082733	3300026035	Bacteria	2680
1096	Ga0207703_10621142	3300026035	Bacteria	1023
1097	Ga0207703_10831053	3300026035	Bacteria	883
1098	Ga0207703_11080904	3300026035	Bacteria	770
1099	Ga0207639_10004119	3300026041	Bacteria	9804
1100	Ga0207639_10032894	3300026041	Bacteria	3822
1101	Ga0207639_10067958	3300026041	Bacteria	2775
1102	Ga0207639_10215624	3300026041	Bacteria	1655
1103	Ga0207639_10898220	3300026041	Bacteria	828
1104	Ga0207639_10988179	3300026041	Bacteria	788
1105	Ga0207678_10018317	3300026067	Bacteria	6150
1106	Ga0207678_10073350	3300026067	Bacteria	2933
1107	Ga0207678_10649783	3300026067	Bacteria	926
1108	Ga0207678_10864781	3300026067	Bacteria	799
1109	Ga0207678_11010811	3300026067	Bacteria	736
1110	Ga0207678_11168927	3300026067	Bacteria	681
1111	Ga0207678_11196387	3300026067	Bacteria	673
1112	Ga0207678_11362173	3300026067	Bacteria	627
1113	Ga0207678_11499097	3300026067	Bacteria	595
1114	Ga0207708_10222353	3300026075	Bacteria	1513
1115	Ga0207702_10000698	3300026078	Bacteria	36205
1116	Ga0207702_10000732	3300026078	Bacteria	35124
1117	Ga0207702_10001319	3300026078	Bacteria	24844
1118	Ga0207702_10184699	3300026078	Bacteria	1922
1119	Ga0207702_10277540	3300026078	Bacteria	1583
1120	Ga0207702_10553839	3300026078	Bacteria	1125
1121	Ga0207702_10797152	3300026078	Bacteria	934
1122	Ga0207702_11018288	3300026078	Bacteria	822
1123	Ga0207641_10003025	3300026088	Bacteria	15148
1124	Ga0207641_10082621	3300026088	Bacteria	2791
1125	Ga0207641_10096599	3300026088	Bacteria	2595
1126	Ga0207641_10354578	3300026088	Bacteria	1399
1127	Ga0207648_10000146	3300026089	Bacteria	70573
1128	Ga0207648_10001822	3300026089	Bacteria	23296
1129	Ga0207648_10003244	3300026089	Bacteria	17114
1130	Ga0207648_10011303	3300026089	Bacteria	8416
1131	Ga0207648_10013115	3300026089	Bacteria	7728
1132	Ga0207648_10193560	3300026089	Bacteria	1803
1133	Ga0207648_10265695	3300026089	Bacteria	1532
1134	Ga0207648_10280515	3300026089	Bacteria	1490
1135	Ga0207648_10309354	3300026089	Bacteria	1418
1136	Ga0207648_10316866	3300026089	Bacteria	1401
1137	Ga0207648_10525420	3300026089	Bacteria	1085
1138	Ga0207648_10627607	3300026089	Bacteria	992
1139	Ga0207648_11413271	3300026089	Bacteria	654
1140	Ga0207676_10001000	3300026095	Bacteria	21763
1141	Ga0207676_10007652	3300026095	Bacteria	7669
1142	Ga0207676_10014293	3300026095	Bacteria	5708
1143	Ga0207676_10214855	3300026095	Bacteria	1709
1144	Ga0207676_10307788	3300026095	Bacteria	1449
1145	Ga0207676_10592142	3300026095	Bacteria	1064
1146	Ga0207676_11598846	3300026095	Bacteria	650
1147	Ga0207676_11608865	3300026095	Bacteria	647
1148	Ga0207674_10005362	3300026116	Bacteria	15251
1149	Ga0207674_10012070	3300026116	Bacteria	9676
1150	Ga0207674_10020685	3300026116	Bacteria	7102
1151	Ga0207674_10083208	3300026116	Bacteria	3200
1152	Ga0207674_10126264	3300026116	Bacteria	2524
1153	Ga0207674_10203057	3300026116	Bacteria	1931
1154	Ga0207674_10323642	3300026116	Bacteria	1491
1155	Ga0207674_10340698	3300026116	Bacteria	1450
1156	Ga0207674_10637731	3300026116	Bacteria	1029
1157	Ga0207674_10929873	3300026116	Bacteria	838
1158	Ga0207674_10956645	3300026116	Bacteria	825
1159	Ga0207674_11239762	3300026116	Bacteria	715
1160	Ga0207674_11559830	3300026116	Bacteria	629
1161	Ga0207675_100000857	3300026118	Bacteria	30347
1162	Ga0207675_100007272	3300026118	Bacteria	10465
1163	Ga0207675_100048118	3300026118	Bacteria	3980
1164	Ga0207675_101542020	3300026118	Bacteria	685
1165	Ga0207675_101706059	3300026118	Bacteria	650
1166	Ga0207675_102439470	3300026118	Bacteria	535
1167	Ga0207683_10003588	3300026121	Bacteria	13534
1168	Ga0207683_10025072	3300026121	Bacteria	5142
1169	Ga0207683_10100629	3300026121	Bacteria	2580
1170	Ga0207683_10237104	3300026121	Bacteria	1664
1171	Ga0207683_10296833	3300026121	Bacteria	1478
1172	Ga0207683_10389095	3300026121	Bacteria	1282
1173	Ga0207683_11136446	3300026121	Bacteria	724
1174	Ga0207683_11149581	3300026121	Bacteria	720
1175	Ga0207698_10048848	3300026142	Bacteria	3215
1176	Ga0207698_10059821	3300026142	Bacteria	2960
1177	Ga0207698_10109749	3300026142	Bacteria	2309
1178	Ga0207698_10112411	3300026142	Bacteria	2286
1179	Ga0207698_10113315	3300026142	Bacteria	2278
1180	Ga0207698_10130132	3300026142	Bacteria	2149
1181	Ga0207698_10140855	3300026142	Bacteria	2078
1182	Ga0207698_10319705	3300026142	Bacteria	1453
1183	Ga0207698_10388622	3300026142	Bacteria	1330
1184	Ga0207698_10457285	3300026142	Bacteria	1234
1185	Ga0207698_10651216	3300026142	Bacteria	1043
1186	Ga0207698_10777828	3300026142	Bacteria	958
1187	Ga0207698_10994646	3300026142	Bacteria	849
1188	Ga0207698_11196478	3300026142	Bacteria	774
1189	Ga0207698_11490572	3300026142	Bacteria	692
1190	Ga0207698_12714087	3300026142	Bacteria	504
1191	Ga0209389_1067513	3300027296	Bacteria	2042
1192	Ga0209371_1000218	3300027312	Bacteria	77448
1193	Ga0209371_1009244	3300027312	Bacteria	3150
1194	Ga0209981_1009284	3300027378	Bacteria	1344
1195	Ga0209981_1046705	3300027378	Bacteria	652
1196	Ga0209996_1001204	3300027395	Bacteria	3121
1197	Ga0209995_1003268	3300027471	Bacteria	2582
1198	Ga0209968_1000123	3300027526	Bacteria	13790
1199	Ga0209999_1009109	3300027543	Bacteria	1794
1200	Ga0209282_1002929	3300027666	Bacteria	10032
1201	Ga0209966_1000001	3300027695	Bacteria	139125
1202	Ga0209998_10020024	3300027717	Bacteria	1429
1203	Ga0209998_10043006	3300027717	Bacteria	1030
1204	Ga0209813_10018067	3300027866	Bacteria	1944
1205	Ga0209813_10045904	3300027866	Bacteria	1347
1206	Ga0209813_10144705	3300027866	Bacteria	847
1207	Ga0209813_10227928	3300027866	Bacteria	700
1208	Ga0209813_10335095	3300027866	Bacteria	595
1209	Ga0209813_10356493	3300027866	Bacteria	580
1210	Ga0209974_10001570	3300027876	Bacteria	8281
1211	Ga0209974_10039516	3300027876	Bacteria	1569
1212	Ga0209974_10133454	3300027876	Bacteria	887
1213	Ga0207428_10775357	3300027907	Bacteria	682
1214	Ga0268266_10081508	3300028379	Bacteria	2822
1215	Ga0268266_10327068	3300028379	Bacteria	1436
1216	Ga0268266_10466277	3300028379	Bacteria	1202
1217	Ga0268266_10562082	3300028379	Bacteria	1094
1218	Ga0268266_11245677	3300028379	Bacteria	719
1219	Ga0268265_10008049	3300028380	Bacteria	7120
1220	Ga0268265_10094734	3300028380	Bacteria	2395
1221	Ga0268265_10395518	3300028380	Bacteria	1276
1222	Ga0268264_10009130	3300028381	Bacteria	8221
1223	Ga0268264_10073483	3300028381	Bacteria	2902
1224	Ga0268264_10245697	3300028381	Bacteria	1660
1225	Ga0268264_10264306	3300028381	Bacteria	1605
1226	Ga0268264_10549097	3300028381	Bacteria	1133
1227	Ga0268264_10757437	3300028381	Bacteria	968
1228	Ga0265334_10122037	3300028573	Bacteria	931
1229	Ga0265323_10040942	3300028653	Bacteria	1683
1230	Ga0307517_10000805	3300028786	Bacteria	53822
1231	Ga0307517_10077388	3300028786	Bacteria	2891
1232	Ga0307517_10183915	3300028786	Bacteria	1342
1233	Ga0307517_10195603	3300028786	Bacteria	1274
1234	Ga0307517_10346790	3300028786	Bacteria	808
1235	Ga0307517_10407601	3300028786	Bacteria	717
1236	Ga0307515_10000020	3300028794	Bacteria	411735
1237	Ga0307515_10000053	3300028794	Bacteria	266512
1238	Ga0307515_10001032	3300028794	Bacteria	63662
1239	Ga0307515_10002612	3300028794	Bacteria	38796
1240	Ga0307515_10005265	3300028794	Bacteria	26299
1241	Ga0307515_10014672	3300028794	Bacteria	14505
1242	Ga0307515_10037926	3300028794	Bacteria	7729
1243	Ga0307515_10045683	3300028794	Bacteria	6719
1244	Ga0307515_10048358	3300028794	Bacteria	6432
1245	Ga0307515_10084485	3300028794	Bacteria	4076
1246	Ga0307515_10112003	3300028794	Bacteria	3178
1247	Ga0307515_10413000	3300028794	Bacteria	972
1248	Ga0307515_10588117	3300028794	Bacteria	723
1249	Ga0265324_10227390	3300029957	Bacteria	633
1250	Ga0268256_1000174	3300030500	Bacteria	77446
1251	Ga0268256_1016030	3300030500	Bacteria	2162
1252	Ga0268256_1021508	3300030500	Bacteria	1714
1253	Ga0307512_10035617	3300030522	Bacteria	4237
1254	Ga0307512_10044313	3300030522	Bacteria	3659
1255	Ga0307512_10233285	3300030522	Bacteria	942
1256	Ga0316177_1178071	3300030731	Bacteria	1134
1257	Ga0316176_1020296	3300030732	Bacteria	2826
1258	Ga0314311_1266168	3300030733	Bacteria	1423
1259	Ga0316179_1063983	3300030734	Bacteria	1196
1260	Ga0316178_1148277	3300030735	Bacteria	2926
1261	Ga0316183_1017320	3300030742	Bacteria	4162
1262	Ga0316181_1020992	3300030744	Bacteria	2041
1263	Ga0316182_1299692	3300030745	Bacteria	2275
1264	Ga0265327_10000158	3300031251	Bacteria	145905
1265	Ga0265327_10000640	3300031251	Bacteria	56812
1266	Ga0265327_10023188	3300031251	Bacteria	3682
1267	Ga0265327_10227028	3300031251	Bacteria	838
1268	Ga0265327_10316668	3300031251	Bacteria	685
1269	Ga0265316_10236963	3300031344	Bacteria	1342
1270	Ga0265316_11282330	3300031344	Bacteria	506
1271	Ga0307513_10014068	3300031456	Bacteria	9795
1272	Ga0307513_10119699	3300031456	Bacteria	2604
1273	Ga0307513_10135699	3300031456	Bacteria	2396
1274	Ga0307513_10158438	3300031456	Bacteria	2160
1275	Ga0307513_10242399	3300031456	Bacteria	1606
1276	Ga0307513_10323194	3300031456	Bacteria	1300
1277	Ga0307513_10476072	3300031456	Bacteria	969
1278	Ga0307513_10693839	3300031456	Bacteria	724
1279	Ga0307509_10001946	3300031507	Bacteria	34096
1280	Ga0307509_10002654	3300031507	Bacteria	28588
1281	Ga0307509_10008897	3300031507	Bacteria	12664
1282	Ga0307509_10140975	3300031507	Bacteria	2346
1283	Ga0307509_10143796	3300031507	Bacteria	2315
1284	Ga0307509_10202426	3300031507	Bacteria	1820
1285	Ga0307509_10291208	3300031507	Bacteria	1387
1286	Ga0307509_11005609	3300031507	Bacteria	501
1287	Ga0307408_100008062	3300031548	Bacteria	6962
1288	Ga0307408_100008200	3300031548	Bacteria	6899
1289	Ga0307408_100047567	3300031548	Bacteria	3073
1290	Ga0307408_100065038	3300031548	Bacteria	2673
1291	Ga0307408_100076502	3300031548	Bacteria	2490
1292	Ga0307408_100154143	3300031548	Bacteria	1817
1293	Ga0307408_100214499	3300031548	Bacteria	1567
1294	Ga0307408_100317795	3300031548	Bacteria	1310
1295	Ga0307408_100610836	3300031548	Bacteria	970
1296	Ga0307408_100968574	3300031548	Bacteria	782
1297	Ga0307408_102219087	3300031548	Bacteria	531
1298	Ga0307508_10000004	3300031616	Bacteria	287547
1299	Ga0307508_10000078	3300031616	Bacteria	113416
1300	Ga0307508_10002611	3300031616	Bacteria	18949
1301	Ga0307508_10058330	3300031616	Bacteria	3416
1302	Ga0307508_10097952	3300031616	Bacteria	2525
1303	Ga0307508_10387871	3300031616	Bacteria	988
1304	Ga0307508_10536118	3300031616	Bacteria	767
1305	Ga0307514_10003397	3300031649	Bacteria	15360
1306	Ga0307514_10122350	3300031649	Bacteria	1811
1307	Ga0307514_10132041	3300031649	Bacteria	1717
1308	Ga0316579_10367458	3300031691	Bacteria	695
1309	Ga0307516_10000497	3300031730	Bacteria	52295
1310	Ga0307516_10001023	3300031730	Bacteria	38802
1311	Ga0307516_10017381	3300031730	Bacteria	7501
1312	Ga0307516_10022278	3300031730	Bacteria	6508
1313	Ga0307516_10022921	3300031730	Bacteria	6407
1314	Ga0307516_10046323	3300031730	Bacteria	4291
1315	Ga0307516_10156564	3300031730	Bacteria	2032
1316	Ga0307516_10209567	3300031730	Bacteria	1664
1317	Ga0307516_10402920	3300031730	Bacteria	1027
1318	Ga0307516_10859608	3300031730	Bacteria	571
1319	Ga0307516_11014043	3300031730	Bacteria	503
1320	Ga0307405_10002891	3300031731	Bacteria	7731
1321	Ga0307405_10033496	3300031731	Bacteria	3048
1322	Ga0307405_10058525	3300031731	Bacteria	2425
1323	Ga0307405_10072893	3300031731	Bacteria	2215
1324	Ga0307405_10091624	3300031731	Bacteria	2014
1325	Ga0307405_10145859	3300031731	Bacteria	1657
1326	Ga0307405_12061651	3300031731	Bacteria	511
1327	Ga0316577_10076331	3300031733	Bacteria	1871
1328	Ga0307413_10018011	3300031824	Bacteria	3694
1329	Ga0307413_10036799	3300031824	Bacteria	2821
1330	Ga0307413_10221794	3300031824	Bacteria	1382
1331	Ga0307413_10717891	3300031824	Bacteria	832
1332	Ga0307413_11200767	3300031824	Bacteria	660
1333	Ga0307413_11585218	3300031824	Bacteria	581
1334	Ga0307410_10082470	3300031852	Bacteria	2262
1335	Ga0307410_10124374	3300031852	Bacteria	1886
1336	Ga0307410_10499673	3300031852	Bacteria	1000
1337	Ga0307410_10565987	3300031852	Bacteria	944
1338	Ga0307410_12130887	3300031852	Bacteria	502
1339	Ga0307406_10007967	3300031901	Bacteria	5901
1340	Ga0307406_10182693	3300031901	Bacteria	1528
1341	Ga0307406_10189848	3300031901	Bacteria	1503
1342	Ga0307406_10597273	3300031901	Bacteria	910
1343	Ga0307406_11168192	3300031901	Bacteria	667
1344	Ga0307406_11340675	3300031901	Bacteria	625
1345	Ga0307407_10071891	3300031903	Bacteria	2061
1346	Ga0307407_10307089	3300031903	Bacteria	1108
1347	Ga0307407_10482758	3300031903	Bacteria	905
1348	Ga0307407_11322006	3300031903	Bacteria	566
1349	Ga0307412_10001384	3300031911	Bacteria	13466
1350	Ga0307412_10003210	3300031911	Bacteria	9088
1351	Ga0307412_10021895	3300031911	Bacteria	3910
1352	Ga0307412_10034400	3300031911	Bacteria	3229
1353	Ga0307412_10043071	3300031911	Bacteria	2938
1354	Ga0307412_10043743	3300031911	Bacteria	2918
1355	Ga0307412_10056266	3300031911	Bacteria	2621
1356	Ga0307412_10156113	3300031911	Bacteria	1689
1357	Ga0307412_10236021	3300031911	Bacteria	1411
1358	Ga0307412_10356212	3300031911	Bacteria	1177
1359	Ga0307412_10683024	3300031911	Bacteria	879
1360	Ga0307412_10721909	3300031911	Bacteria	857
1361	Ga0307412_10791088	3300031911	Bacteria	822
1362	Ga0307412_11002241	3300031911	Bacteria	738
1363	Ga0307412_11449973	3300031911	Bacteria	622
1364	Ga0307409_100000086	3300031995	Bacteria	33256
1365	Ga0307409_100024728	3300031995	Bacteria	4196
1366	Ga0307409_100732557	3300031995	Bacteria	991
1367	Ga0307409_101027605	3300031995	Bacteria	843
1368	Ga0307409_101972378	3300031995	Bacteria	613
1369	Ga0307409_102028809	3300031995	Bacteria	605
1370	Ga0307409_102617248	3300031995	Bacteria	533
1371	Ga0307409_102943023	3300031995	Bacteria	503
1372	Ga0307416_100024835	3300032002	Bacteria	4382
1373	Ga0307416_100051514	3300032002	Bacteria	3289
1374	Ga0307416_100130486	3300032002	Bacteria	2261
1375	Ga0307416_100323291	3300032002	Bacteria	1546
1376	Ga0307416_100571575	3300032002	Bacteria	1206
1377	Ga0307416_100623909	3300032002	Bacteria	1160
1378	Ga0307416_101059411	3300032002	Bacteria	915
1379	Ga0307416_101197589	3300032002	Bacteria	865
1380	Ga0307416_101306335	3300032002	Bacteria	831
1381	Ga0307416_101383634	3300032002	Bacteria	809
1382	Ga0307416_101405940	3300032002	Bacteria	803
1383	Ga0307414_10024960	3300032004	Bacteria	3820
1384	Ga0307414_10067625	3300032004	Bacteria	2560
1385	Ga0307414_10086711	3300032004	Bacteria	2311
1386	Ga0307414_10111423	3300032004	Bacteria	2084
1387	Ga0307414_10115418	3300032004	Bacteria	2053
1388	Ga0307414_10174830	3300032004	Bacteria	1721
1389	Ga0307414_11097499	3300032004	Bacteria	735
1390	Ga0307414_11161104	3300032004	Bacteria	714
1391	Ga0307411_10005193	3300032005	Bacteria	6369
1392	Ga0307411_10063367	3300032005	Bacteria	2470
1393	Ga0307411_10074309	3300032005	Bacteria	2316
1394	Ga0307411_10104486	3300032005	Bacteria	2012
1395	Ga0307411_10123397	3300032005	Bacteria	1879
1396	Ga0307411_10180169	3300032005	Bacteria	1603
1397	Ga0307411_10254323	3300032005	Bacteria	1383
1398	Ga0307411_10613968	3300032005	Bacteria	937
1399	Ga0307411_10995515	3300032005	Bacteria	750
1400	Ga0307411_11988153	3300032005	Bacteria	542
1401	Ga0307415_100000361	3300032126	Bacteria	19367
1402	Ga0307415_100133882	3300032126	Bacteria	1881
1403	Ga0307415_101088308	3300032126	Bacteria	748
1404	Ga0316593_10026594	3300032168	Bacteria	1851
1405	Ga0307507_10100794	3300033179	Bacteria	2418
1406	Ga0307507_10130139	3300033179	Bacteria	1973
1407	Ga0307510_10009306	3300033180	Bacteria	11707
1408	Ga0307510_10017087	3300033180	Bacteria	8559
1409	Ga0307510_10041763	3300033180	Bacteria	5008
1410	Ga0307510_10135811	3300033180	Bacteria	2117
1411	Ga0307510_10279920	3300033180	Bacteria	1139
1412	Ga0307510_10367980	3300033180	Bacteria	885
1413	Ga0373930_0026313	3300034816	Bacteria	1172
1414	Ga0373959_0033468	3300034820	Bacteria	1049
1415	Ga0373959_0090448	3300034820	Bacteria	717
1416	Ga0373938_0081594	3300034957	Bacteria	788
1417	Ga0373938_0110016	3300034957	Bacteria	701
1418	Ga0373928_0132188	3300035084	Bacteria	678
1419	Ga0373929_0032309	3300035085	Bacteria	1125
1420	Ga0373940_0011192	3300035088	Bacteria	2127
1421	Ga0373944_0177474	3300035089	Bacteria	762
1422	Ga0373944_0193002	3300035089	Bacteria	735
1423	Ga0373944_0194084	3300035089	Bacteria	733
1424	Ga0373944_0249845	3300035089	Bacteria	654
1425	Ga0373952_0050313	3300035092	Bacteria	991
1426	Ga0373923_0304964	3300035111	Bacteria	754
1427	Ga0373941_0224634	3300035115	Bacteria	723
1428	Ga0373941_0340503	3300035115	Bacteria	608
1429	Ga0373945_0142088	3300035116	Bacteria	968
1430	Ga0373953_0129594	3300035117	Bacteria	1075
1431	Ga0373943_0159516	3300035170	Bacteria	1227
1432	Ga0373946_0039114	3300035171	Bacteria	1935
1433	Ga0373955_0450700	3300035172	Bacteria	784
1434	Ga0373942_0070650	3300035207	Bacteria	1019
1435	Ga0373962_0312170	3300035242	Bacteria	560
1436	Ga0373924_0528130	3300035410	Bacteria	531
1437	Ga0373931_0009283	3300035691	Bacteria	4699
1438	Ga0373931_0014386	3300035691	Bacteria	3866
1439	Ga0373931_0026583	3300035691	Bacteria	2947
1440	Ga0373935_0311811	3300035692	Bacteria	1114
1441	Ga0373935_0523714	3300035692	Bacteria	862
1442	Ga0373935_1408693	3300035692	Bacteria	521
1443	Ga0373927_0009569	3300035695	Bacteria	6500
1444	Ga0373927_0211207	3300035695	Bacteria	1275
1445	Ga0373927_0240876	3300035695	Bacteria	1189
1446	Ga0373933_1163731	3300035724	Bacteria	508
1447	Ga0373947_0473855	3300035725	Bacteria	849
1448	Ga0373947_0531919	3300035725	Bacteria	800
1449	Ga0373947_0891802	3300035725	Bacteria	607
1450	Ga0373937_0069375	3300036401	Bacteria	3250
1451	Ga0373937_0381456	3300036401	Bacteria	1337
1452	Ga0316582_0015066	3300036647	Bacteria	4407
1453	Ga0316584_0092501	3300036712	Bacteria	2264
1454	Ga0373925_0078641	3300037068	Bacteria	2505
1455	Ga0373925_0242397	3300037068	Bacteria	1444
1456	Ga0373925_0307578	3300037068	Bacteria	1281
1457	Ga0373925_0330534	3300037068	Bacteria	1235
1458	Ga0395899_0004720	3300037312	Bacteria	10633
1459	Ga0395900_0000109	3300037418	Bacteria	146053
1460	Ga0395900_0029684	3300037418	Bacteria	5610
1461	Ga0395900_0118039	3300037418	Bacteria	2722
1462	Ga0395900_1485775	3300037418	Bacteria	590
1463	Ga0395898_0015056	3300037466	Bacteria	7939
1464	Ga0395898_0037637	3300037466	Bacteria	4798
1465	Ga0395898_0046059	3300037466	Bacteria	4284
1466	Ga0395898_0297054	3300037466	Bacteria	1541
1467	Ga0395905_0000488	3300037471	Bacteria	54703
1468	Ga0395905_0011451	3300037471	Bacteria	8571
1469	Ga0395905_0025592	3300037471	Bacteria	5565
1470	Ga0395905_0034301	3300037471	Bacteria	4765
1471	Ga0395905_0036014	3300037471	Bacteria	4647
1472	Ga0395905_0166348	3300037471	Bacteria	2072
1473	Ga0395905_0531124	3300037471	Bacteria	1077
1474	Ga0395905_0585851	3300037471	Bacteria	1017
1475	Ga0395905_0592545	3300037471	Bacteria	1010
1476	Ga0316581_0021996	3300037588	Bacteria	1878
1477	Ga0395901_0012844	3300038443	Bacteria	8495
1478	Ga0395901_0985377	3300038443	Bacteria	820
1479	Ga0436365_1178302	3300039437	Bacteria	757
1480	Ga0436360_0258616	3300039438	Bacteria	1164
1481	Ga0436361_0167979	3300039447	Bacteria	86419
1482	Ga0436361_0214541	3300039447	Bacteria	41289
1483	Ga0436361_0217332	3300039447	Bacteria	23737
1484	Ga0436361_0359670	3300039447	Bacteria	47250
1485	Ga0436361_0529504	3300039447	Bacteria	1143
1486	Ga0436361_0683214	3300039447	Bacteria	2945
1487	Ga0436361_0769709	3300039447	Bacteria	2872
1488	Ga0436361_1056645	3300039447	Bacteria	2339
1489	Ga0436361_1092359	3300039447	Bacteria	11490
1490	Ga0436363_0880003	3300039450	Bacteria	583
1491	Ga0436363_1113045	3300039450	Bacteria	1441
1492	Ga0439436_0005082	3300041404	Bacteria	4029
1493	Ga0439436_0017528	3300041404	Bacteria	2143
1494	Ga0439436_0058755	3300041404	Bacteria	1078
1495	Ga0439438_015929	3300041405	Bacteria	2197
1496	Ga0439439_0000304	3300041406	Bacteria	7878
1497	Ga0439439_0167384	3300041406	Bacteria	629
1498	Ga0439447_041937	3300041407	Bacteria	1112
1499	Ga0439453_0072178	3300041408	Bacteria	732
1500	Ga0439461_0014042	3300041410	Bacteria	1517
1501	Ga0439461_0092374	3300041410	Bacteria	727
1502	Ga0439466_0002298	3300041411	Bacteria	7498
1503	Ga0439466_0009551	3300041411	Bacteria	3625
1504	Ga0439465_0003892	3300041413	Bacteria	4872
1505	Ga0439465_0087386	3300041413	Bacteria	1063
1506	Ga0439465_0183658	3300041413	Bacteria	757
1507	Ga0439465_0382652	3300041413	Bacteria	534
1508	Ga0451789_0160463	3300041443	Bacteria	5363
1509	Ga0451791_1329588	3300041451	Bacteria	572
1510	Ga0451793_0907941	3300041452	Bacteria	566
1511	Ga0451793_1009248	3300041452	Bacteria	2201
1512	Ga0451797_1109477	3300041453	Bacteria	1051
1513	Ga0451795_0913388	3300041456	Bacteria	1183
1514	Ga0451798_0882602	3300041458	Bacteria	4359
1515	Ga0451798_1022954	3300041458	Bacteria	729
1516	Ga0451800_0983364	3300041459	Bacteria	2433
1517	Ga0451800_1592322	3300041459	Bacteria	1240
1518	Ga0451802_0064922	3300041460	Bacteria	915
1519	Ga0451806_649029	3300041462	Bacteria	543
1520	Ga0451804_0858374	3300041463	Bacteria	908
1521	Ga0451807_1165661	3300041486	Bacteria	1195
1522	Ga0451807_2033827	3300041486	Bacteria	1337
1523	Ga0451807_2607001	3300041486	Bacteria	720
1524	Ga0451833_1194697	3300041491	Bacteria	1952
1525	Ga0451839_0399468	3300041496	Bacteria	661
1526	Ga0451839_0693068	3300041496	Bacteria	648
1527	Ga0451839_0749505	3300041496	Bacteria	542
1528	Ga0451841_0449173	3300041498	Bacteria	712
1529	Ga0451845_0413049	3300041501	Bacteria	701
1530	Ga0451847_0674285	3300041503	Bacteria	655
1531	Ga0451851_0829363	3300041507	Bacteria	1397
1532	Ga0451843_0383449	3300041509	Bacteria	675
1533	Ga0451843_0510807	3300041509	Bacteria	552
1534	Ga0451843_0908011	3300041509	Bacteria	835
1535	Ga0451843_1432462	3300041509	Bacteria	545
1536	Ga0451853_0990419	3300041512	Bacteria	1450
1537	Ga0451853_1045547	3300041512	Bacteria	688
1538	Ga0451853_1701460	3300041512	Bacteria	568
1539	Ga0451853_1730775	3300041512	Bacteria	618
1540	Ga0439431_0002568	3300041997	Bacteria	4008
1541	Ga0439431_0103546	3300041997	Bacteria	784
1542	Ga0439433_0022304	3300041999	Bacteria	1419
1543	Ga0439433_0080513	3300041999	Bacteria	792
1544	Ga0439442_003022	3300042002	Bacteria	3323
1545	Ga0439442_031470	3300042002	Bacteria	1108
1546	Ga0439442_133545	3300042002	Bacteria	547
1547	Ga0439445_0021223	3300042004	Bacteria	1631
1548	Ga0439445_0051253	3300042004	Bacteria	1115
1549	Ga0439445_0258069	3300042004	Bacteria	521
1550	Ga0439448_0000154	3300042005	Bacteria	13505
1551	Ga0439448_0248931	3300042005	Bacteria	627
1552	Ga0439432_003328	3300042006	Bacteria	5971
1553	Ga0439432_150236	3300042006	Bacteria	683
1554	Ga0439449_0002911	3300042007	Bacteria	6658
1555	Ga0439449_0004348	3300042007	Bacteria	5469
1556	Ga0439449_0142564	3300042007	Bacteria	892
1557	Ga0439452_002322	3300042010	Bacteria	7083
1558	Ga0439452_004417	3300042010	Bacteria	4721
1559	Ga0439455_0004565	3300042012	Bacteria	2752
1560	Ga0439455_0046089	3300042012	Bacteria	1129
1561	Ga0439455_0092612	3300042012	Bacteria	830
1562	Ga0439457_168515	3300042014	Bacteria	532
1563	Ga0439462_0003593	3300042015	Bacteria	3733
1564	Ga0450911_056827	3300042115	Bacteria	508
1565	Ga0450919_000602	3300042121	Bacteria	4562
1566	Ga0450919_011901	3300042121	Bacteria	988
1567	Ga0450920_005125	3300042122	Bacteria	2325
1568	Ga0450923_026479	3300042125	Bacteria	1162
1569	Ga0450888_066290	3300042126	Bacteria	537
1570	Ga0450890_016977	3300042127	Bacteria	966
1571	Ga0450890_026369	3300042127	Bacteria	809
1572	Ga0450890_034900	3300042127	Bacteria	728
1573	Ga0450897_009986	3300042128	Bacteria	906
1574	Ga0450894_013462	3300042131	Bacteria	1074
1575	Ga0450898_049450	3300042134	Bacteria	810
1576	Ga0450898_056288	3300042134	Bacteria	767
1577	Ga0450899_009850	3300042135	Bacteria	1056
1578	Ga0450899_011977	3300042135	Bacteria	972
1579	Ga0450889_015950	3300042144	Bacteria	810
1580	Ga0450906_022700	3300042145	Bacteria	1118
1581	Ga0450907_048795	3300042146	Bacteria	727
1582	Ga0439446_0196246	3300042156	Bacteria	680
1583	Ga0439446_0203182	3300042156	Bacteria	670
1584	Ga0450909_026534	3300042185	Bacteria	873
1585	Ga0439434_0002020	3300042435	Bacteria	5865
1586	Ga0439434_0004225	3300042435	Bacteria	4197
1587	Ga0439434_0091011	3300042435	Bacteria	975
1588	Ga0439459_0016027	3300042438	Bacteria	1381
1589	Ga0450918_000607	3300042531	Bacteria	7684
1590	Ga0450918_003867	3300042531	Bacteria	2757
1591	Ga0450893_0027764	3300042532	Bacteria	999
1592	Ga0451577_0006746	3300042876	Bacteria	11388
1593	Ga0451577_0008963	3300042876	Bacteria	9673
1594	Ga0451577_0065508	3300042876	Bacteria	3240
1595	Ga0451577_0238241	3300042876	Bacteria	1646
1596	Ga0451577_0404128	3300042876	Bacteria	1240
1597	Ga0451577_0445720	3300042876	Bacteria	1175
1598	Ga0451577_1015378	3300042876	Bacteria	744
1599	Ga0451577_1580173	3300042876	Bacteria	579
1600	Ga0451577_1823083	3300042876	Bacteria	534
1601	Ga0466969_0000395	3300044656	Bacteria	23961
1602	Ga0466969_0001952	3300044656	Bacteria	11030
1603	Ga0466969_0008585	3300044656	Bacteria	5419
1604	Ga0466969_0010813	3300044656	Bacteria	4834
1605	Ga0466969_0027212	3300044656	Bacteria	2929
1606	Ga0466972_0008024	3300044658	Bacteria	5291
1607	Ga0466972_0013627	3300044658	Bacteria	4079
1608	Ga0466972_0022412	3300044658	Bacteria	3146
1609	Ga0466972_0038687	3300044658	Bacteria	2330
1610	Ga0466972_0351804	3300044658	Bacteria	689
1611	Ga0466980_0248074	3300044668	Bacteria	1107
1612	Ga0453683_0001626	3300044673	Bacteria	18878
1613	Ga0453683_0119199	3300044673	Bacteria	1661
1614	Ga0453683_1211943	3300044673	Bacteria	506
1615	Ga0466965_0027809	3300044683	Bacteria	2745
1616	Ga0466965_0036578	3300044683	Bacteria	2409
1617	Ga0466965_0041138	3300044683	Bacteria	2276
1618	Ga0466965_0054005	3300044683	Bacteria	1997
1619	Ga0466965_0254979	3300044683	Bacteria	942
1620	Ga0466966_0099105	3300044684	Bacteria	1803
1621	Ga0466966_0200822	3300044684	Bacteria	1206
1622	Ga0466961_0005306	3300044693	Bacteria	8105
1623	Ga0466961_0011241	3300044693	Bacteria	5722
1624	Ga0466961_0035961	3300044693	Bacteria	3179
1625	Ga0466961_0156934	3300044693	Bacteria	1419
1626	Ga0466961_0204242	3300044693	Bacteria	1221
1627	Ga0466961_0298460	3300044693	Bacteria	984
1628	Ga0466963_0057018	3300044694	Bacteria	2601
1629	Ga0466963_0125037	3300044694	Bacteria	1772
1630	Ga0466963_0211748	3300044694	Bacteria	1356
1631	Ga0466964_0031972	3300044706	Bacteria	2089
1632	Ga0466964_0141395	3300044706	Bacteria	1106
1633	Ga0466964_0155240	3300044706	Bacteria	1065
1634	Ga0466964_0408670	3300044706	Bacteria	711
1635	Ga0453684_0003638	3300044712	Bacteria	34257
1636	Ga0453684_0088462	3300044712	Bacteria	3835
1637	Ga0453684_0139796	3300044712	Bacteria	2894
1638	Ga0453684_0172543	3300044712	Bacteria	2547
1639	Ga0453684_0349930	3300044712	Bacteria	1666
1640	Ga0453684_0483714	3300044712	Bacteria	1373
1641	Ga0453684_0513278	3300044712	Bacteria	1325
1642	Ga0453684_0606434	3300044712	Bacteria	1199
1643	Ga0453684_1089263	3300044712	Bacteria	845
1644	Ga0453684_1301134	3300044712	Bacteria	758
1645	Ga0466971_0004739	3300044719	Bacteria	5884
1646	Ga0466971_0189161	3300044719	Bacteria	969
1647	Ga0466971_0269457	3300044719	Bacteria	814
1648	Ga0466968_0059440	3300044735	Bacteria	1646
1649	Ga0466968_0185307	3300044735	Bacteria	969
1650	Ga0466968_0228024	3300044735	Bacteria	879
1651	Ga0466968_0279379	3300044735	Bacteria	799
1652	Ga0466970_0007521	3300044765	Bacteria	5464
1653	Ga0466970_0060241	3300044765	Bacteria	2033
1654	Ga0466970_0147824	3300044765	Bacteria	1297
1655	Ga0466970_0450782	3300044765	Bacteria	737
1656	Ga0466957_0014902	3300044842	Bacteria	4534
1657	Ga0466957_0117828	3300044842	Bacteria	1690
1658	Ga0466957_0166856	3300044842	Bacteria	1432
1659	Ga0466957_0202241	3300044842	Bacteria	1305
1660	Ga0466957_0268488	3300044842	Bacteria	1139
1661	Ga0466957_0443444	3300044842	Bacteria	894
1662	Ga0466960_0020318	3300044901	Bacteria	2940
1663	Ga0466960_0114141	3300044901	Bacteria	1407
1664	Ga0466960_0873204	3300044901	Bacteria	547
1665	Ga0466959_0003919	3300045049	Bacteria	9882
1666	Ga0466959_0087673	3300045049	Bacteria	2238
1667	Ga0466959_0105260	3300045049	Bacteria	2017
1668	Ga0466959_0111821	3300045049	Bacteria	1948
1669	Ga0466959_0218492	3300045049	Bacteria	1322
1670	Ga0466959_0368236	3300045049	Bacteria	979
1671	Ga0451576_0000914	3300045051	Bacteria	55935
1672	Ga0451576_0004476	3300045051	Bacteria	18097
1673	Ga0451576_0014049	3300045051	Bacteria	8922
1674	Ga0451576_0052912	3300045051	Bacteria	4254
1675	Ga0451576_0122968	3300045051	Bacteria	2702
1676	Ga0451576_0241548	3300045051	Bacteria	1887
1677	Ga0451576_0467602	3300045051	Bacteria	1324
1678	Ga0451576_0636156	3300045051	Bacteria	1121
1679	Ga0451576_1358864	3300045051	Bacteria	740
1680	Ga0466958_0074271	3300045836	Bacteria	2083
1681	Ga0466958_0473553	3300045836	Bacteria	812
1682	Ga0466967_0056668	3300045976	Bacteria	3456
1683	Ga0466967_0075650	3300045976	Bacteria	3026
1684	Ga0466967_1135311	3300045976	Bacteria	779
1685	Ga0495627_007566	3300046453	Bacteria	4154
1686	Ga0495592_0008709	3300046454	Bacteria	7615
1687	Ga0495592_0015966	3300046454	Bacteria	5697
1688	Ga0495603_0032423	3300046455	Bacteria	3143
1689	Ga0495591_156730	3300046458	Bacteria	546
1690	Ga0495629_0154872	3300046459	Bacteria	1593
1691	Ga0495629_0381748	3300046459	Bacteria	959
1692	Ga0495638_0051454	3300046460	Bacteria	2569
1693	Ga0495638_0085327	3300046460	Bacteria	1910
1694	Ga0495638_0208178	3300046460	Bacteria	1100
1695	Ga0495651_0311118	3300046462	Bacteria	1053
1696	Ga0495651_0691763	3300046462	Bacteria	636
1697	Ga0495653_0115724	3300046463	Bacteria	1919
1698	Ga0495650_0016331	3300046471	Bacteria	3765
1699	Ga0495650_0191780	3300046471	Bacteria	714
1700	Ga0495580_0145541	3300046472	Bacteria	1642
1701	Ga0495582_0117129	3300046473	Bacteria	1499
1702	Ga0495582_0542480	3300046473	Bacteria	673
1703	Ga0495605_0023835	3300046474	Bacteria	3212
1704	Ga0495605_0105856	3300046474	Bacteria	1288
1705	Ga0495639_0017429	3300046475	Bacteria	3119
1706	Ga0495639_0061533	3300046475	Bacteria	1721
1707	Ga0495664_0132586	3300046477	Bacteria	1509
1708	Ga0495584_0261560	3300046491	Bacteria	879
1709	Ga0495585_0055375	3300046492	Bacteria	2192
1710	Ga0495607_0399698	3300046501	Bacteria	625
1711	Ga0495583_0015974	3300046506	Bacteria	4055
1712	Ga0495606_0099657	3300046507	Bacteria	1771
1713	Ga0495606_0112339	3300046507	Bacteria	1642
1714	Ga0495606_0223399	3300046507	Bacteria	1060
1715	Ga0495608_0178630	3300046511	Bacteria	1344
1716	Ga0495610_0008701	3300046512	Bacteria	6532
1717	Ga0495616_0006630	3300046513	Bacteria	6993
1718	Ga0495618_0346612	3300046514	Bacteria	916
1719	Ga0495620_0010437	3300046515	Bacteria	4901
1720	Ga0495628_0140583	3300046516	Bacteria	1843
1721	Ga0495631_0002748	3300046518	Bacteria	9757
1722	Ga0495632_0009715	3300046519	Bacteria	5772
1723	Ga0495632_0016885	3300046519	Bacteria	4045
1724	Ga0495632_0173014	3300046519	Bacteria	991
1725	Ga0495637_0020235	3300046520	Bacteria	3064
1726	Ga0495648_0042223	3300046524	Bacteria	2871
1727	Ga0495648_0148033	3300046524	Bacteria	1228
1728	Ga0495648_0201241	3300046524	Bacteria	997
1729	Ga0495648_0270304	3300046524	Bacteria	811
1730	Ga0495666_0043869	3300046526	Bacteria	2160
1731	Ga0495642_0013334	3300046528	Bacteria	3178
1732	Ga0495642_0167757	3300046528	Bacteria	953
1733	Ga0495642_0554511	3300046528	Bacteria	510
1734	Ga0495654_0000550	3300046530	Bacteria	30238
1735	Ga0495654_0043604	3300046530	Bacteria	2223
1736	Ga0495640_0366968	3300046533	Bacteria	887
1737	Ga0495586_0021373	3300046535	Bacteria	3449
1738	Ga0495621_0002735	3300046539	Bacteria	4785
1739	Ga0495621_0003885	3300046539	Bacteria	4149
1740	Ga0495621_0160934	3300046539	Bacteria	888
1741	Ga0495597_0000153	3300046542	Bacteria	61233
1742	Ga0495597_0020188	3300046542	Bacteria	3107
1743	Ga0495597_0383230	3300046542	Bacteria	536
1744	Ga0495622_0088536	3300046557	Bacteria	1423
1745	Ga0495622_0250621	3300046557	Bacteria	779
1746	Ga0495656_0000929	3300046615	Bacteria	9473
1747	Ga0495656_0062221	3300046615	Bacteria	1632
1748	Ga0495656_0434962	3300046615	Bacteria	690
1749	Ga0495668_0051073	3300046616	Bacteria	2290
1750	Ga0495668_0360329	3300046616	Bacteria	798
1751	Ga0495634_0625845	3300046642	Bacteria	623
1752	Ga0495611_0175389	3300046648	Bacteria	1002
1753	Ga0495625_0000714	3300046660	Bacteria	46916
1754	Ga0495625_0010826	3300046660	Bacteria	7505
1755	Ga0495625_0096602	3300046660	Bacteria	2035
1756	Ga0495625_0108856	3300046660	Bacteria	1896
1757	Ga0495625_0148101	3300046660	Bacteria	1579
1758	Ga0495625_0627755	3300046660	Bacteria	642
1759	Ga0495625_0850208	3300046660	Bacteria	527
1760	Ga0495635_0463626	3300046663	Bacteria	837
1761	Ga0495588_0076870	3300046674	Bacteria	1740
1762	Ga0495623_0050249	3300046679	Bacteria	2641
1763	Ga0495623_0587185	3300046679	Bacteria	580
1764	Ga0495646_0031855	3300046680	Bacteria	3284
1765	Ga0495647_0009386	3300046681	Bacteria	3313
1766	Ga0495647_0010703	3300046681	Bacteria	3128
1767	Ga0495647_0097247	3300046681	Bacteria	1215
1768	Ga0495658_0201880	3300046683	Bacteria	1239
1769	Ga0495658_0213479	3300046683	Bacteria	1206
1770	Ga0495658_0300309	3300046683	Bacteria	1015
1771	Ga0495658_0348305	3300046683	Bacteria	941
1772	Ga0495658_0835723	3300046683	Bacteria	589
1773	Ga0495613_0240571	3300046689	Bacteria	1266
1774	Ga0495624_0514420	3300046690	Bacteria	716
1775	Ga0495624_0517615	3300046690	Bacteria	713
1776	Ga0495624_0905451	3300046690	Bacteria	519
1777	Ga0495670_0151238	3300046691	Bacteria	1217
1778	Ga0495670_0183285	3300046691	Bacteria	1106
1779	Ga0495671_0019317	3300046692	Bacteria	3605
1780	Ga0495671_0327995	3300046692	Bacteria	735
1781	Ga0495649_0004353	3300046694	Bacteria	9282
1782	Ga0495649_0084532	3300046694	Bacteria	1694
1783	Ga0495589_0027163	3300046794	Bacteria	2895
1784	Ga0495589_0137394	3300046794	Bacteria	1172
1785	Ga0495660_0006585	3300046810	Bacteria	6863
1786	Ga0495660_0084665	3300046810	Bacteria	1658
1787	Ga0495660_0433749	3300046810	Bacteria	570
1788	Ga0495581_0525553	3300047315	Bacteria	687
1789	Ga0495604_0900102	3300047317	Bacteria	553
1790	Ga0495636_0517764	3300047318	Bacteria	578
1791	Ga0495674_0003080	3300047319	Bacteria	16205
1792	Ga0495674_0025003	3300047319	Bacteria	5481
1793	Ga0495674_0131454	3300047319	Bacteria	2109
1794	Ga0495672_0000655	3300047320	Bacteria	38461
1795	Ga0495672_0022880	3300047320	Bacteria	4054
1796	Ga0495676_0007147	3300047321	Bacteria	10247
1797	Ga0495687_001512	3300047443	Bacteria	21202
1798	Ga0495687_002480	3300047443	Bacteria	14721
1799	Ga0495687_047916	3300047443	Bacteria	1836
1800	Ga0495677_0045384	3300047445	Bacteria	1612
1801	Ga0495673_0026656	3300047469	Bacteria	2760
1802	Ga0495684_0527155	3300047471	Bacteria	808
1803	Ga0495686_0005600	3300047472	Bacteria	9866
1804	Ga0495686_0008724	3300047472	Bacteria	7397
1805	Ga0495593_0006672	3300047673	Bacteria	6755
1806	Ga0495593_0060213	3300047673	Bacteria	1988
1807	Ga0495593_0100100	3300047673	Bacteria	1487
1808	Ga0495602_0226558	3300048088	Bacteria	1407
1809	Ga0495614_0009932	3300048089	Bacteria	4201
1810	Ga0495626_0051745	3300048091	Bacteria	1894
1811	Ga0496100_0047259	3300048903	Bacteria	2772
1812	Ga0496100_0673556	3300048903	Bacteria	806
1813	Ga0496101_0021483	3300048904	Bacteria	4435
1814	Ga0496101_0043750	3300048904	Bacteria	3201
1815	Ga0496101_0504671	3300048904	Bacteria	956
1816	Ga0496101_1055879	3300048904	Bacteria	638
1817	Ga0496102_0013747	3300048905	Bacteria	7020
1818	Ga0496102_0051832	3300048905	Bacteria	3738
1819	Ga0496102_0109753	3300048905	Bacteria	2571
1820	Ga0496102_0173558	3300048905	Bacteria	2029
1821	Ga0496103_0006569	3300048906	Bacteria	6937
1822	Ga0496103_0399580	3300048906	Bacteria	883
1823	Ga0496104_0015973	3300048907	Bacteria	6813
1824	Ga0496104_0270479	3300048907	Bacteria	1612
1825	Ga0496104_0684598	3300048907	Bacteria	933
1826	Ga0496104_1377640	3300048907	Bacteria	608
1827	Ga0496105_0005071	3300048908	Bacteria	9977
1828	Ga0496105_0030674	3300048908	Bacteria	4405
1829	Ga0496105_0045888	3300048908	Bacteria	3605
1830	Ga0496105_0241040	3300048908	Bacteria	1467
1831	Ga0496105_0828454	3300048908	Bacteria	702
1832	Ga0496105_0834771	3300048908	Bacteria	698
1833	Ga0496105_0938940	3300048908	Bacteria	650
1834	Ga0496105_0968325	3300048908	Bacteria	638
1835	Ga0496106_0184459	3300048909	Bacteria	1657
1836	Ga0496106_0540275	3300048909	Bacteria	935
1837	Ga0496107_0144211	3300048910	Bacteria	1760
1838	Ga0496108_0022590	3300048911	Bacteria	5173
1839	Ga0496108_0061117	3300048911	Bacteria	3170
1840	Ga0496108_0090344	3300048911	Bacteria	2604
1841	Ga0496108_0260502	3300048911	Bacteria	1509
1842	Ga0496108_0411333	3300048911	Bacteria	1181
1843	Ga0496108_0580207	3300048911	Bacteria	977
1844	Ga0496108_0731375	3300048911	Bacteria	857
1845	Ga0496108_1024469	3300048911	Bacteria	704
1846	Ga0496108_1396629	3300048911	Bacteria	586
1847	Ga0496109_0074882	3300048912	Bacteria	3113
1848	Ga0496109_0079105	3300048912	Bacteria	3028
1849	Ga0496109_0253973	3300048912	Bacteria	1655
1850	Ga0496109_0435780	3300048912	Bacteria	1238
1851	Ga0496109_0438180	3300048912	Bacteria	1234
1852	Ga0496109_0448801	3300048912	Bacteria	1218
1853	Ga0496110_0010246	3300048913	Bacteria	7614
1854	Ga0496110_0027229	3300048913	Bacteria	4899
1855	Ga0496110_0031132	3300048913	Bacteria	4602
1856	Ga0496110_0070427	3300048913	Bacteria	3099
1857	Ga0496110_0102247	3300048913	Bacteria	2570
1858	Ga0496110_0283289	3300048913	Bacteria	1509
1859	Ga0496110_1587025	3300048913	Bacteria	564
1860	Ga0496111_0149804	3300048914	Bacteria	1730
1861	Ga0496111_0551367	3300048914	Bacteria	846
1862	Ga0496112_0308348	3300048915	Bacteria	1528
1863	Ga0496112_0316248	3300048915	Bacteria	1506
1864	Ga0496112_0330744	3300048915	Bacteria	1467
1865	Ga0496113_0009758	3300048916	Bacteria	6311
1866	Ga0496113_0049458	3300048916	Bacteria	3130
1867	Ga0496113_0777851	3300048916	Bacteria	761
1868	Ga0496114_0079247	3300048917	Bacteria	2772
1869	Ga0496114_1395569	3300048917	Bacteria	588
1870	Ga0496115_0007123	3300048918	Bacteria	8212
1871	Ga0496116_0004666	3300048919	Bacteria	12969
1872	Ga0496116_0009886	3300048919	Bacteria	8068
1873	Ga0496116_0017716	3300048919	Bacteria	5518
1874	Ga0496116_0145930	3300048919	Bacteria	1322
1875	Ga0496116_0337573	3300048919	Bacteria	696
1876	Ga0496116_0477789	3300048919	Bacteria	525
1877	Ga0496117_0020169	3300048920	Bacteria	5445
1878	Ga0496117_0037073	3300048920	Bacteria	3637
1879	Ga0496117_0075277	3300048920	Bacteria	2243
1880	Ga0496117_0117343	3300048920	Bacteria	1643
1881	Ga0496117_0489530	3300048920	Bacteria	599
1882	Ga0496118_0007919	3300048921	Bacteria	11122
1883	Ga0496118_0011718	3300048921	Bacteria	8523
1884	Ga0496118_0015352	3300048921	Bacteria	7096
1885	Ga0496118_0071859	3300048921	Bacteria	2488
1886	Ga0496118_0186102	3300048921	Bacteria	1248
1887	Ga0496119_0049882	3300048922	Bacteria	2584
1888	Ga0496119_0063307	3300048922	Bacteria	2201
1889	Ga0496119_0075863	3300048922	Bacteria	1952
1890	Ga0496119_0228659	3300048922	Bacteria	948
1891	Ga0496119_0367284	3300048922	Bacteria	693
1892	Ga0496120_0011850	3300048923	Bacteria	5966
1893	Ga0496120_0107456	3300048923	Bacteria	1463
1894	Ga0496121_0000257	3300048924	Bacteria	112257
1895	Ga0496121_0000478	3300048924	Bacteria	77761
1896	Ga0496121_0110968	3300048924	Bacteria	2092
1897	Ga0496121_0180297	3300048924	Bacteria	1525
1898	Ga0496121_0223451	3300048924	Bacteria	1324
1899	Ga0496121_0251144	3300048924	Bacteria	1226
1900	Ga0496121_0251147	3300048924	Bacteria	1226
1901	Ga0496121_0724773	3300048924	Bacteria	595
1902	Ga0496122_0000077	3300048925	Bacteria	218099
1903	Ga0496122_0000177	3300048925	Bacteria	151124
1904	Ga0496122_0021150	3300048925	Bacteria	5837
1905	Ga0496122_0056621	3300048925	Bacteria	2921
1906	Ga0496122_0068323	3300048925	Bacteria	2552
1907	Ga0496122_0078507	3300048925	Bacteria	2312
1908	Ga0496122_0143523	3300048925	Bacteria	1489
1909	Ga0496122_0171797	3300048925	Bacteria	1305
1910	Ga0496123_0000050	3300048926	Bacteria	238021
1911	Ga0496123_0003980	3300048926	Bacteria	16002
1912	Ga0496123_0030980	3300048926	Bacteria	3902
1913	Ga0496123_0055801	3300048926	Bacteria	2588
1914	Ga0496123_0065568	3300048926	Bacteria	2307
1915	Ga0496123_0194941	3300048926	Bacteria	1044
1916	Ga0496124_0000036	3300048927	Bacteria	318032
1917	Ga0496124_0002660	3300048927	Bacteria	22924
1918	Ga0496124_0006878	3300048927	Bacteria	12232
1919	Ga0496124_0059631	3300048927	Bacteria	3205
1920	Ga0496124_0103335	3300048927	Bacteria	2305
1921	Ga0496124_0154437	3300048927	Bacteria	1796
1922	Ga0496124_0166248	3300048927	Bacteria	1714
1923	Ga0496124_0242212	3300048927	Bacteria	1340
1924	Ga0496124_0269123	3300048927	Bacteria	1249
1925	Ga0496124_0320485	3300048927	Bacteria	1110
1926	Ga0496124_0437038	3300048927	Bacteria	896
1927	Ga0496124_0472814	3300048927	Bacteria	848
1928	Ga0496125_0000146	3300048928	Bacteria	154919
1929	Ga0496125_0021126	3300048928	Bacteria	6083
1930	Ga0496125_0031217	3300048928	Bacteria	4751
1931	Ga0496125_0043130	3300048928	Bacteria	3834
1932	Ga0496125_0043843	3300048928	Bacteria	3791
1933	Ga0496125_0080851	3300048928	Bacteria	2485
1934	Ga0496125_0097356	3300048928	Bacteria	2180
1935	Ga0496125_0210477	3300048928	Bacteria	1263
1936	Ga0496125_0737410	3300048928	Bacteria	518
1937	Ga0496126_0137352	3300048929	Bacteria	2107
1938	Ga0496126_0156464	3300048929	Bacteria	1950
1939	Ga0496126_0315190	3300048929	Bacteria	1287
1940	Ga0496126_0497852	3300048929	Bacteria	974
1941	Ga0501306_021570	3300049127	Bacteria	903
1942	Ga0501310_015194	3300049130	Bacteria	911
1943	Ga0495682_0014946	3300049460	Bacteria	2941
1944	Ga0495682_0064665	3300049460	Bacteria	1319
1945	Ga0501290_007970	3300049513	Bacteria	1334
1946	Ga0501292_008734	3300049515	Bacteria	1489
1947	Ga0501298_172416	3300049521	Bacteria	539
1948	Ga0501300_009618	3300049523	Bacteria	1410
1949	Ga0501301_015817	3300049524	Bacteria	677
1950	Ga0501303_012601	3300049526	Bacteria	816
1951	Ga0501312_045622	3300049528	Bacteria	727
1952	Ga0501315_014423	3300049531	Bacteria	1001
1953	Ga0501323_026474	3300049539	Bacteria	794
1954	Ga0501032_0335137	3300049569	Bacteria	975
1955	Ga0501033_0020756	3300049570	Bacteria	4963
1956	Ga0501037_0834719	3300049573	Bacteria	607
1957	Ga0501042_0909589	3300049578	Bacteria	641
1958	Ga0501043_0000023	3300049579	Bacteria	154331
1959	Ga0501043_0095479	3300049579	Bacteria	2337
1960	Ga0501046_0000018	3300049580	Bacteria	220589
1961	Ga0501047_0000020	3300049581	Bacteria	259377
1962	Ga0501047_0019486	3300049581	Bacteria	6508
1963	Ga0501047_0279819	3300049581	Bacteria	1513
1964	Ga0501047_0287863	3300049581	Bacteria	1487
1965	Ga0501048_0001064	3300049582	Bacteria	20552
1966	Ga0501068_0794170	3300049584	Bacteria	621
1967	Ga0501070_0220651	3300049586	Bacteria	1555
1968	Ga0501074_1153505	3300049590	Bacteria	544
1969	Ga0501198_000006	3300049649	Bacteria	129954
1970	Ga0501206_022334	3300049653	Bacteria	907
1971	Ga0501222_000007	3300049662	Bacteria	126703
1972	Ga0501222_009041	3300049662	Bacteria	1319
1973	Ga0501222_027554	3300049662	Bacteria	773
1974	Ga0501249_019142	3300049679	Bacteria	1484
1975	Ga0501257_067637	3300049686	Bacteria	909
1976	Ga0501261_029283	3300049690	Bacteria	826
1977	Ga0501221_074704	3300049704	Bacteria	806
1978	Ga0501225_0022614	3300049705	Bacteria	1735
1979	Ga0501080_0447141	3300049742	Bacteria	1159
1980	Ga0501083_0743463	3300049744	Bacteria	638
1981	Ga0501241_090622	3300049758	Bacteria	647
1982	Ga0501262_000426	3300049759	Bacteria	5053
1983	Ga0501262_004524	3300049759	Bacteria	1615
1984	Ga0501265_006632	3300049762	Bacteria	1349
1985	Ga0501035_0005419	3300049822	Bacteria	12063
1986	Ga0501035_0014590	3300049822	Bacteria	7252
1987	Ga0501035_0042955	3300049822	Bacteria	4075
1988	Ga0501035_0640938	3300049822	Bacteria	862
1989	Ga0501035_1512598	3300049822	Bacteria	511
1990	Ga0501044_0000124	3300049823	Bacteria	92998
1991	Ga0501044_0349267	3300049823	Bacteria	1399
1992	nmdc:mga03683_129022_c1	3300050489	Bacteria	1130
1993	nmdc:mga03683_13658_c1	3300050489	Bacteria	2993
1994	nmdc:mga03683_15946_c1	3300050489	Bacteria	2813
1995	nmdc:mga03683_25031_c1	3300050489	Bacteria	2340
1996	nmdc:mga03683_257465_c1	3300050489	Bacteria	811
1997	nmdc:mga03683_302734_c1	3300050489	Bacteria	750
1998	nmdc:mga03683_35298_c1	3300050489	Bacteria	2028
1999	nmdc:mga03683_36243_c1	3300050489	Bacteria	2006
2000	nmdc:mga03683_403677_c1	3300050489	Bacteria	653
2001	nmdc:mga03683_40783_c1	3300050489	Bacteria	1905
2002	nmdc:mga03683_416764_c1	3300050489	Bacteria	643
2003	nmdc:mga03683_52476_c1	3300050489	Bacteria	1704
2004	nmdc:mga03683_64218_c1	3300050489	Bacteria	1557
2005	nmdc:mga03n38_119129_c1	3300050490	Bacteria	1295
2006	nmdc:mga03n38_150061_c1	3300050490	Bacteria	1172
2007	nmdc:mga03n38_29739_c1	3300050490	Bacteria	2289
2008	nmdc:mga03n38_413424_c1	3300050490	Bacteria	745
2009	nmdc:mga03n38_464600_c1	3300050490	Bacteria	706
2010	nmdc:mga03n38_518338_c1	3300050490	Bacteria	671
2011	nmdc:mga03n38_67321_c1	3300050490	Bacteria	1648
2012	nmdc:mga03n38_82759_c1	3300050490	Bacteria	1512
2013	nmdc:mga00v17_178309_c1	3300050491	Bacteria	1371
2014	nmdc:mga00v17_259459_c1	3300050491	Bacteria	1127
2015	nmdc:mga00v17_29618_c1	3300050491	Bacteria	3214
2016	nmdc:mga00v17_36194_c1	3300050491	Bacteria	2941
2017	nmdc:mga00v17_80575_c1	3300050491	Bacteria	2032
2018	nmdc:mga00v17_854253_c1	3300050491	Bacteria	578
2019	nmdc:mga00v17_948565_c1	3300050491	Bacteria	543
2020	nmdc:mga0yw44_17114_c1	3300050492	Bacteria	3936
2021	nmdc:mga0yw44_2117_c1	3300050492	Bacteria	8316
2022	nmdc:mga0yw44_568078_c1	3300050492	Bacteria	770
2023	nmdc:mga0k408_10403_c1	3300050493	Bacteria	5031
2024	nmdc:mga0k408_1042_c1	3300050493	Bacteria	15212
2025	nmdc:mga0k408_113390_c1	3300050493	Bacteria	1270
2026	nmdc:mga0k408_1409_c2	3300050493	Bacteria	9482
2027	nmdc:mga0k408_184_c1	3300050493	Bacteria	32850
2028	nmdc:mga0k408_21023_c1	3300050493	Bacteria	3663
2029	nmdc:mga0k408_213388_c1	3300050493	Bacteria	1153
2030	nmdc:mga0k408_218610_c1	3300050493	Bacteria	1138
2031	nmdc:mga0k408_234464_c1	3300050493	Bacteria	1096
2032	nmdc:mga0k408_24809_c1	3300050493	Bacteria	3093
2033	nmdc:mga0k408_249873_c1	3300050493	Bacteria	1059
2034	nmdc:mga0k408_258989_c1	3300050493	Bacteria	1039
2035	nmdc:mga0k408_269183_c1	3300050493	Bacteria	1017
2036	nmdc:mga0k408_287274_c1	3300050493	Bacteria	982
2037	nmdc:mga0k408_289518_c1	3300050493	Bacteria	978
2038	nmdc:mga0k408_308331_c1	3300050493	Bacteria	945
2039	nmdc:mga0k408_318128_c1	3300050493	Bacteria	929
2040	nmdc:mga0k408_319019_c1	3300050493	Bacteria	927
2041	nmdc:mga0k408_3275_c1	3300050493	Bacteria	8570
2042	nmdc:mga0k408_33719_c1	3300050493	Bacteria	2929
2043	nmdc:mga0k408_33735_c1	3300050493	Bacteria	2928
2044	nmdc:mga0k408_344847_c1	3300050493	Bacteria	888
2045	nmdc:mga0k408_369265_c1	3300050493	Bacteria	855
2046	nmdc:mga0k408_371103_c1	3300050493	Bacteria	853
2047	nmdc:mga0k408_37772_c1	3300050493	Bacteria	2773
2048	nmdc:mga0k408_38238_c2	3300050493	Bacteria	2386
2049	nmdc:mga0k408_428840_c1	3300050493	Bacteria	786
2050	nmdc:mga0k408_431_c1	3300050493	Bacteria	14862
2051	nmdc:mga0k408_446061_c1	3300050493	Bacteria	769
2052	nmdc:mga0k408_6723_c1	3300050493	Bacteria	6133
2053	nmdc:mga0k408_73412_c1	3300050493	Bacteria	1998
2054	nmdc:mga0k408_85145_c1	3300050493	Bacteria	1855
2055	nmdc:mga0k408_922826_c1	3300050493	Bacteria	506
2056	nmdc:mga0k408_98343_c1	3300050493	Bacteria	1724
2057	nmdc:mga06z11_10830_c1	3300050494	Bacteria	3904
2058	nmdc:mga06z11_150164_c1	3300050494	Bacteria	1324
2059	nmdc:mga06z11_150172_c1	3300050494	Bacteria	1324
2060	nmdc:mga06z11_15291_c1	3300050494	Bacteria	3422
2061	nmdc:mga06z11_161766_c1	3300050494	Bacteria	1280
2062	nmdc:mga06z11_524843_c1	3300050494	Bacteria	718
2063	nmdc:mga06z11_617420_c1	3300050494	Bacteria	660
2064	nmdc:mga06z11_783752_c1	3300050494	Bacteria	581
2065	nmdc:mga04h51_165110_c1	3300050495	Bacteria	854
2066	nmdc:mga04h51_183773_c1	3300050495	Bacteria	815
2067	nmdc:mga04h51_486730_c1	3300050495	Bacteria	526
2068	nmdc:mga04h51_50859_c1	3300050495	Bacteria	1390
2069	nmdc:mga04h51_55031_c1	3300050495	Bacteria	1347
2070	nmdc:mga07m45_134161_c1	3300050496	Bacteria	1433
2071	nmdc:mga07m45_142225_c1	3300050496	Bacteria	1390
2072	nmdc:mga07m45_143054_c1	3300050496	Bacteria	1386
2073	nmdc:mga07m45_1476_c1	3300050496	Bacteria	10809
2074	nmdc:mga07m45_15079_c1	3300050496	Bacteria	4127
2075	nmdc:mga07m45_172943_c1	3300050496	Bacteria	1256
2076	nmdc:mga07m45_185_c2	3300050496	Bacteria	20271
2077	nmdc:mga07m45_188626_c1	3300050496	Bacteria	1199
2078	nmdc:mga07m45_235204_c1	3300050496	Bacteria	1066
2079	nmdc:mga07m45_33735_c1	3300050496	Bacteria	2844
2080	nmdc:mga07m45_4156_c1	3300050496	Bacteria	7068
2081	nmdc:mga07m45_42688_c1	3300050496	Bacteria	2543
2082	nmdc:mga07m45_456517_c1	3300050496	Bacteria	741
2083	nmdc:mga07m45_47374_c1	3300050496	Bacteria	2417
2084	nmdc:mga07m45_51524_c1	3300050496	Bacteria	2321
2085	nmdc:mga07m45_57467_c1	3300050496	Bacteria	2200
2086	nmdc:mga07m45_63097_c1	3300050496	Bacteria	2101
2087	nmdc:mga07m45_63_c1	3300050496	Bacteria	41859
2088	nmdc:mga07m45_765786_c1	3300050496	Bacteria	554
2089	nmdc:mga07m45_8991_c1	3300050496	Bacteria	5159
2090	nmdc:mga07m45_89_c1	3300050496	Bacteria	34943
2091	nmdc:mga05p37_224604_c1	3300050507	Bacteria	2265
2092	nmdc:mga0qj67_513127_c1	3300050509	Bacteria	963
2093	nmdc:mga08y16_1118147_c1	3300050511	Bacteria	762
2094	nmdc:mga08y16_1203545_c1	3300050511	Bacteria	728
2095	nmdc:mga0rr50_1478700_c1	3300050513	Bacteria	574
2096	nmdc:mga0a205_1567267_c1	3300050515	Bacteria	507
2097	nmdc:mga0sz30_255183_c1	3300050516	Bacteria	781
2098	nmdc:mga0sz30_5833_c1	3300050516	Bacteria	4538
2099	nmdc:mga0sz30_71021_c1	3300050516	Bacteria	1499
2100	Ga0495601_0019173	3300053077	Bacteria	4170
2101	Ga0500610_0013258	3300053079	Bacteria	3829
2102	Ga0500635_0000141	3300053080	Bacteria	40938
2103	Ga0500635_0174722	3300053080	Bacteria	828
2104	Ga0495595_0027263	3300053084	Bacteria	2544
2105	Ga0495619_0305846	3300053085	Bacteria	1101
2106	Ga0500578_0012415	3300053086	Bacteria	5497
2107	Ga0500578_0014379	3300053086	Bacteria	5091
2108	Ga0500578_0269994	3300053086	Bacteria	1018
2109	Ga0500578_0332177	3300053086	Bacteria	893
2110	Ga0500643_010889	3300053087	Bacteria	3356
2111	Ga0500643_059800	3300053087	Bacteria	1071
2112	Ga0500644_0068624	3300053088	Bacteria	1271
2113	Ga0500644_0203105	3300053088	Bacteria	820
2114	Ga0500581_347294	3300053089	Bacteria	564
2115	Ga0500646_0023313	3300053090	Bacteria	1659
2116	Ga0500651_0000430	3300053093	Bacteria	22553
2117	Ga0500651_0040824	3300053093	Bacteria	2924
2118	Ga0500651_0062864	3300053093	Bacteria	2317
2119	Ga0500651_0071886	3300053093	Bacteria	2152
2120	Ga0500641_0051443	3300053096	Bacteria	1695
2121	Ga0500641_0121902	3300053096	Bacteria	1124
2122	Ga0500650_0137949	3300053098	Bacteria	1131
2123	Ga0500562_013680	3300053108	Bacteria	2075
2124	Ga0500562_033286	3300053108	Bacteria	1362
2125	Ga0500571_000252	3300053110	Bacteria	20356
2126	Ga0500593_000652	3300053117	Bacteria	13240
2127	Ga0500594_0001047	3300053118	Bacteria	5924
2128	Ga0500594_0007268	3300053118	Bacteria	2504
2129	Ga0500595_084247	3300053119	Bacteria	927
2130	Ga0500607_001874	3300053121	Bacteria	18035
2131	Ga0500608_003111	3300053122	Bacteria	6160
2132	Ga0500608_336011	3300053122	Bacteria	542
2133	Ga0500614_143450	3300053123	Bacteria	716
2134	Ga0500618_006166	3300053125	Bacteria	3547
2135	Ga0500626_170970	3300053128	Bacteria	884
2136	Ga0500628_001978	3300053129	Bacteria	3443
2137	Ga0500642_0003789	3300053130	Bacteria	4632
2138	Ga0500642_0343800	3300053130	Bacteria	664
2139	Ga0500652_000307	3300053131	Bacteria	17714
2140	Ga0500652_051518	3300053131	Bacteria	1682
2141	Ga0500658_0000352	3300053134	Bacteria	20402
2142	Ga0500658_0003377	3300053134	Bacteria	6041
2143	Ga0500559_0000191	3300053136	Bacteria	49243
2144	Ga0500559_0021313	3300053136	Bacteria	2746
2145	Ga0500559_0169647	3300053136	Bacteria	1026
2146	Ga0500559_0400613	3300053136	Bacteria	638
2147	Ga0500568_0008116	3300053139	Bacteria	5090
2148	Ga0500568_0010712	3300053139	Bacteria	4282
2149	Ga0500568_0013994	3300053139	Bacteria	3636
2150	Ga0500568_0023355	3300053139	Bacteria	2630
2151	Ga0500577_0056692	3300053142	Bacteria	1492
2152	Ga0500586_272474	3300053145	Bacteria	521
2153	Ga0500600_0004796	3300053149	Bacteria	7946
2154	Ga0500604_0005077	3300053151	Bacteria	3480
2155	Ga0500616_0079455	3300053153	Bacteria	1651
2156	Ga0500619_001373	3300053154	Bacteria	4281
2157	Ga0500622_0000160	3300053156	Bacteria	70774
2158	Ga0500622_0001454	3300053156	Bacteria	18928
2159	Ga0500622_0002916	3300053156	Bacteria	11895
2160	Ga0500622_0049393	3300053156	Bacteria	2169
2161	Ga0500627_0082231	3300053158	Bacteria	1436
2162	Ga0500627_0228641	3300053158	Bacteria	828
2163	Ga0500627_0393109	3300053158	Bacteria	592
2164	Ga0500634_0002470	3300053161	Bacteria	7808
2165	Ga0500638_003518	3300053162	Bacteria	5815
2166	Ga0500636_0000056	3300053177	Bacteria	53780
2167	Ga0500636_0021960	3300053177	Bacteria	3777
2168	Ga0500636_0176766	3300053177	Bacteria	1150
2169	Ga0500637_0082707	3300053178	Bacteria	1855
2170	Ga0500625_159704	3300053729	Bacteria	830
2171	Ga0500645_006616	3300053730	Bacteria	4111
2172	Ga0500645_130547	3300053730	Bacteria	698
2173	Ga0590071_000819	3300059421	Bacteria	8680
2174	Ga0590074_014194	3300059423	Bacteria	1347
2175	Ga0590077_094099	3300059426	Bacteria	697
2176	Ga0587107_039858	3300059652	Bacteria	754
2177	Ga0466962_0023883	3300061719	Bacteria	2938
2178	Ga0466962_0174104	3300061719	Bacteria	1048
2179	Ga0466962_0613120	3300061719	Bacteria	555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006178	Ga0075367_10062713	Ga0075367_100627133	103
2	3300006195	Ga0075366_10009910	Ga0075366_100099107	103
3	3300006195	Ga0075366_10389133	Ga0075366_103891332	104
4	3300031824	Ga0307413_10717891	Ga0307413_107178912	104
5	3300032004	Ga0307414_11097499	Ga0307414_110974992	104
6	3300048905	Ga0496102_0051832	Ga0496102_0051832_2886_3224	104
7	3300049569	Ga0501032_0335137	Ga0501032_0335137_404_742	104
8	3300049573	Ga0501037_0834719	Ga0501037_0834719_27_365	104
9	3300049578	Ga0501042_0909589	Ga0501042_0909589_89_469	104
10	3300049579	Ga0501043_0000023	Ga0501043_0000023_110828_111208	104
11	3300049580	Ga0501046_0000018	Ga0501046_0000018_109354_109734	104
12	3300049581	Ga0501047_0000020	Ga0501047_0000020_148163_148543	104
13	3300049582	Ga0501048_0001064	Ga0501048_0001064_17722_18102	104
14	3300049823	Ga0501044_0349267	Ga0501044_0349267_589_969	104
15	3300050493	nmdc:mga0k408_113390_c1	nmdc:mga0k408_113390_c1_226_564	104
16	3300005468	Ga0070707_100631562	Ga0070707_1006315622	105
17	3300025910	Ga0207684_10401714	Ga0207684_104017143	105
18	3300034820	Ga0373959_0090448	Ga0373959_0090448_367_687	106
19	3300031911	Ga0307412_10356212	Ga0307412_103562122	107
20	3300041410	Ga0439461_0092374	Ga0439461_0092374_88_426	107
21	3300041413	Ga0439465_0087386	Ga0439465_0087386_672_1010	107
22	3300041413	Ga0439465_0382652	Ga0439465_0382652_19_357	107
23	3300041997	Ga0439431_0002568	Ga0439431_0002568_2713_3051	107
24	3300042126	Ga0450888_066290	Ga0450888_066290_189_527	107
25	3300042127	Ga0450890_034900	Ga0450890_034900_331_669	107
26	3300042144	Ga0450889_015950	Ga0450889_015950_71_409	107
27	3300042435	Ga0439434_0091011	Ga0439434_0091011_355_693	107
28	3300042532	Ga0450893_0027764	Ga0450893_0027764_158_496	107
29	3300046679	Ga0495623_0050249	Ga0495623_0050249_2304_2630	107
30	3300047318	Ga0495636_0517764	Ga0495636_0517764_238_564	107
31	iso_pu_bacteria	2554235234	2555260046	107
32	iso_pu_bacteria	2599185169	2599412563	107
33	iso_pu_bacteria	2600255254	2601524089	107
34	iso_pu_bacteria	2600255255	2601529243	107
35	iso_pu_bacteria	2600255280	2601616077	107
36	iso_pu_bacteria	2600255281	2601620802	107
37	iso_pu_bacteria	2600255287	2601644144	107
38	iso_pu_bacteria	2600255288	2601649199	107
39	iso_pu_bacteria	2600255289	2601654126	107
40	iso_pu_bacteria	2600255290	2601659548	107
41	iso_pu_bacteria	2600255291	2601663969	107
42	iso_pu_bacteria	2600255298	2601696926	107
43	iso_pu_bacteria	2600255299	2601701975	107
44	iso_pu_bacteria	2600255300	2601706870	107
45	iso_pu_bacteria	2600255301	2601712179	107
46	iso_pu_bacteria	2600255302	2601717387	107
47	iso_pu_bacteria	2600255303	2601722345	107
48	iso_pu_bacteria	2600255304	2601727315	107
49	iso_pu_bacteria	2600255305	2601732620	107
50	iso_pu_bacteria	2600255306	2601736865	107
51	iso_pu_bacteria	2600255307	2601743192	107
52	iso_pu_bacteria	2600255309	2601753986	107
53	iso_pu_bacteria	2600255392	2602021080	107
54	iso_pu_bacteria	2602042052	2603662127	107
55	iso_pu_bacteria	2602042053	2603667026	107
56	iso_pu_bacteria	2602042103	2603839739	107
57	iso_pu_bacteria	2602042104	2603844813	107
58	iso_pu_bacteria	2602042105	2603850180	107
59	iso_pu_bacteria	2602042106	2603854956	107
60	iso_pu_bacteria	2602042109	2603867704	107
61	iso_pu_bacteria	2602042110	2603872532	107
62	iso_pu_bacteria	2602042111	2603877838	107
63	iso_pu_bacteria	2603880178	2606050009	107
64	iso_pu_bacteria	2603880184	2606071669	107
65	iso_pu_bacteria	2603880202	2606147400	107
66	iso_pu_bacteria	2603880211	2606177899	107
67	iso_pu_bacteria	2609459761	2609909418	107
68	iso_pu_bacteria	2636415599	2637223893	107
69	iso_pu_bacteria	2643221644	2644249093	107
70	iso_pu_bacteria	2675903046	2676405306	107
71	iso_pu_bacteria	2706794495	2707099697	107
72	iso_pu_bacteria	2775507074	2777023209	107
73	iso_pu_bacteria	2791354903	2791922655	107
74	iso_pu_bacteria	2846540461	2846542812	107
75	iso_pu_bacteria	2852103415	2852107325	107
76	iso_pu_bacteria	2854601825	2854602836	107
77	iso_pu_bacteria	2884086401	2884087641	107
78	iso_pu_bacteria	2900051742	2900053258	107
79	iso_pu_bacteria	2904513164	2904517859	107
80	iso_pu_bacteria	2919108558	2919111170	107
81	iso_pu_bacteria	2935625433	2935625487	107
82	iso_pu_bacteria	2939568625	2939570200	107
83	iso_pu_bacteria	2939617950	2939618774	107
84	iso_pu_bacteria	2939642701	2939642757	107
85	iso_pu_bacteria	2945874760	2945876552	107
86	iso_pu_bacteria	2969079654	2969080905	107
87	iso_pu_bacteria	2971820967	2971822304	107
88	iso_pu_bacteria	2974435778	2974439579	107
89	iso_pu_bacteria	2984559226	2984563367	107
90	iso_pu_bacteria	2984595703	2984596101	107
91	iso_pu_bacteria	3000376612	3000378162	107
92	iso_pu_bacteria	8019504834	8019504888	107
93	iso_pu_bacteria	8055693939	8055694809	107
94	iso_pu_bacteria	2501025501	2501072656	108
95	iso_pu_bacteria	2501025502	2501080514	108
96	iso_pu_bacteria	2501025504	2501410538	108
97	iso_pu_bacteria	2508501125	2509129719	108
98	iso_pu_bacteria	2510065045	2510251509	108
99	iso_pu_bacteria	2510917013	2511087025	108
100	iso_pu_bacteria	2510917014	2511096994	108
101	iso_pu_bacteria	2510917015	2511103804	108
102	iso_pu_bacteria	2512047030	2512345533	108
103	iso_pu_bacteria	2513020051	2513226638	108
104	iso_pu_bacteria	2513237151	2513960104	108
105	iso_pu_bacteria	2513237166	2514048883	108
106	iso_pu_bacteria	2515154122	2515680819	108
107	iso_pu_bacteria	2515154123	2515690698	108
108	iso_pu_bacteria	2515154189	2516019471	108
109	iso_pu_bacteria	2519103095	2519459173	108
110	iso_pu_bacteria	2526164713	2527075488	108
111	iso_pu_bacteria	2547132103	2547372534	108
112	iso_pu_bacteria	2562617112	2563058828	108
113	iso_pu_bacteria	2582581311	2585290247	108
114	iso_pu_bacteria	2585428057	2587730421	108
115	iso_pu_bacteria	2585428058	2587733182	108
116	iso_pu_bacteria	2585428062	2587755893	108
117	iso_pu_bacteria	2588253510	2588294396	108
118	iso_pu_bacteria	2599185214	2599624963	108
119	iso_pu_bacteria	2599185226	2599672975	108
120	iso_pu_bacteria	2599185227	2599682575	108
121	iso_pu_bacteria	2599185229	2599694583	108
122	iso_pu_bacteria	2599185239	2599736774	108
123	iso_pu_bacteria	2599185240	2599744846	108
124	iso_pu_bacteria	2599185292	2599905002	108
125	iso_pu_bacteria	2599185355	2600205790	108
126	iso_pu_bacteria	2600255067	2600812107	108
127	iso_pu_bacteria	2643221569	2643860359	108
128	iso_pu_bacteria	2643221592	2643968983	108
129	iso_pu_bacteria	2643221594	2643979418	108
130	iso_pu_bacteria	2643221621	2644119906	108
131	iso_pu_bacteria	2643221625	2644144114	108
132	iso_pu_bacteria	2643221628	2644159347	108
133	iso_pu_bacteria	2643221648	2644273234	108
134	iso_pu_bacteria	2643221654	2644304328	108
135	iso_pu_bacteria	2643221658	2644329274	108
136	iso_pu_bacteria	2643221660	2644337319	108
137	iso_pu_bacteria	2643221672	2644401147	108
138	iso_pu_bacteria	2675903129	2676742975	108
139	iso_pu_bacteria	2711768613	2713476518	108
140	iso_pu_bacteria	2718217991	2719640623	108
141	iso_pu_bacteria	2721755763	2723878533	108
142	iso_pu_bacteria	2734482258	2735818211	108
143	iso_pu_bacteria	2738541277	2738717409	108
144	iso_pu_bacteria	2738541296	2738818678	108
145	iso_pu_bacteria	2738541298	2738831165	108
146	iso_pu_bacteria	2738541306	2738872693	108
147	iso_pu_bacteria	2738541307	2738879013	108
148	iso_pu_bacteria	2738543002	2739184323	108
149	iso_pu_bacteria	2738543008	2739219292	108
150	iso_pu_bacteria	2738543013	2739248803	108
151	iso_pu_bacteria	2738543019	2739278095	108
152	iso_pu_bacteria	2739367655	2739612878	108
153	iso_pu_bacteria	2744054900	2746088695	108
154	iso_pu_bacteria	2744054901	2746097364	108
155	iso_pu_bacteria	2751185846	2753571427	108
156	iso_pu_bacteria	2791355137	2792836075	108
157	iso_pu_bacteria	2808606384	2808972722	108
158	iso_pu_bacteria	2808606390	2809007704	108
159	iso_pu_bacteria	2808606391	2809014756	108
160	iso_pu_bacteria	2808606395	2809035689	108
161	iso_pu_bacteria	2816332253	2817261462	108
162	iso_pu_bacteria	2816332256	2817279148	108
163	iso_pu_bacteria	2816332286	2817456252	108
164	iso_pu_bacteria	2818991446	2819596917	108
165	iso_pu_bacteria	2818991450	2819619972	108
166	iso_pu_bacteria	2818991452	2819631298	108
167	iso_pu_bacteria	2831265667	2831266000	108
168	iso_pu_bacteria	2831864461	2831870061	108
169	iso_pu_bacteria	2834641062	2834641800	108
170	iso_pu_bacteria	2838054893	2838057871	108
171	iso_pu_bacteria	2842324504	2842328626	108
172	iso_pu_bacteria	2842348783	2842352942	108
173	iso_pu_bacteria	2842454564	2842458713	108
174	iso_pu_bacteria	2842677519	2842681050	108
175	iso_pu_bacteria	2843690924	2843694552	108
176	iso_pu_bacteria	2857537821	2857539036	108
177	iso_pu_bacteria	2857542790	2857546976	108
178	iso_pu_bacteria	2858950400	2858956146	108
179	iso_pu_bacteria	2863421361	2863427387	108
180	iso_pu_bacteria	2870068957	2870070855	108
181	iso_pu_bacteria	2881412998	2881414910	108
182	iso_pu_bacteria	2881714928	2881715984	108
183	iso_pu_bacteria	2881927736	2881928151	108
184	iso_pu_bacteria	2883087390	2883093065	108
185	iso_pu_bacteria	2885192300	2885197427	108
186	iso_pu_bacteria	2885198086	2885203659	108
187	iso_pu_bacteria	2885211737	2885216991	108
188	iso_pu_bacteria	2885270888	2885272977	108
189	iso_pu_bacteria	2886848708	2886849521	108
190	iso_pu_bacteria	2895511927	2895516583	108
191	iso_pu_bacteria	2899924645	2899930341	108
192	iso_pu_bacteria	2900634093	2900634255	108
193	iso_pu_bacteria	2902682994	2902683727	108
194	iso_pu_bacteria	2904434214	2904438014	108
195	iso_pu_bacteria	2904449895	2904455129	108
196	iso_pu_bacteria	2904456579	2904457545	108
197	iso_pu_bacteria	2904479285	2904480507	108
198	iso_pu_bacteria	2904483920	2904484565	108
199	iso_pu_bacteria	2904541872	2904543703	108
200	iso_pu_bacteria	2904564687	2904570006	108
201	iso_pu_bacteria	2904571731	2904576083	108
202	iso_pu_bacteria	2904615490	2904624210	108
203	iso_pu_bacteria	2919462493	2919466901	108
204	iso_pu_bacteria	2919527303	2919531471	108
205	iso_pu_bacteria	2919704043	2919704690	108
206	iso_pu_bacteria	2921643360	2921652672	108
207	iso_pu_bacteria	2928037797	2928039454	108
208	iso_pu_bacteria	2928044640	2928044941	108
209	iso_pu_bacteria	2928051484	2928052742	108
210	iso_pu_bacteria	2928064002	2928064584	108
211	iso_pu_bacteria	2928070936	2928075000	108
212	iso_pu_bacteria	2928084124	2928088181	108
213	iso_pu_bacteria	2928108538	2928110535	108
214	iso_pu_bacteria	2928115317	2928116402	108
215	iso_pu_bacteria	2928135762	2928140051	108
216	iso_pu_bacteria	2928170801	2928171570	108
217	iso_pu_bacteria	2928503688	2928505543	108
218	iso_pu_bacteria	2928536128	2928542570	108
219	iso_pu_bacteria	2929160207	2929162745	108
220	iso_pu_bacteria	2929520902	2929527410	108
221	iso_pu_bacteria	2939631187	2939631728	108
222	iso_pu_bacteria	2941479691	2941485628	108
223	iso_pu_bacteria	2945909444	2945911258	108
224	iso_pu_bacteria	2945934425	2945937378	108
225	iso_pu_bacteria	2945945610	2945947273	108
226	iso_pu_bacteria	2945972063	2945977706	108
227	iso_pu_bacteria	2945984333	2945986454	108
228	iso_pu_bacteria	2954767861	2954772688	108
229	iso_pu_bacteria	2990703756	2990705928	108
230	iso_pu_bacteria	2998344455	2998345739	108
231	iso_pu_bacteria	641736151	642425583	108
232	iso_pu_bacteria	641736154	642418902	108
233	iso_pu_bacteria	642555112	642593236	108
234	iso_pu_bacteria	642555113	642622133	108
235	iso_pu_bacteria	8018845410	8018846959	108
236	iso_pu_bacteria	8020807995	8020813612	108
237	iso_pu_bacteria	8020938398	8020944920	108
238	iso_pu_bacteria	8020945358	8020945497	108
239	iso_pu_bacteria	8020953355	8020957043	108
240	iso_pu_bacteria	8021120328	8021122099	108
241	iso_pu_bacteria	8039098773	8039102598	108
242	iso_pu_bacteria	8040167225	8040172810	108
243	iso_pu_bacteria	8040173305	8040173719	108
244	iso_pu_bacteria	8055225921	8055228235	108
245	iso_pu_bacteria	8055266321	8055268962	108
246	iso_pu_bacteria	8055301274	8055302054	108
247	3300050493	nmdc:mga0k408_249873_c1	nmdc:mga0k408_249873_c1_551_883	110
248	3300003759	Ga0055525_1000011	Ga0055525_100001138	111
249	3300009011	Ga0105251_10002173	Ga0105251_1000217311	111
250	3300009036	Ga0105244_10000329	Ga0105244_1000032912	111
251	3300009036	Ga0105244_10037053	Ga0105244_100370533	111
252	3300009092	Ga0105250_10000105	Ga0105250_1000010556	111
253	3300009148	Ga0105243_10003279	Ga0105243_100032798	111
254	3300021361	Ga0213872_10000043	Ga0213872_1000004393	111
255	3300025230	Ga0209563_100005	Ga0209563_100005363	111
256	3300025711	Ga0207696_1000131	Ga0207696_100013159	111
257	3300025728	Ga0207655_1000004	Ga0207655_100000458	111
258	3300025728	Ga0207655_1029730	Ga0207655_10297302	111
259	3300025735	Ga0207713_1000052	Ga0207713_1000052165	111
260	3300025735	Ga0207713_1000084	Ga0207713_1000084125	111
261	3300025935	Ga0207709_10005637	Ga0207709_100056377	111
262	3300026089	Ga0207648_10525420	Ga0207648_105254202	111
263	3300027312	Ga0209371_1000218	Ga0209371_100021821	111
264	3300030500	Ga0268256_1000174	Ga0268256_100017451	111
265	3300031251	Ga0265327_10227028	Ga0265327_102270282	111
266	3300039447	Ga0436361_0359670	Ga0436361_0359670_27560_27895	111
267	3300042121	Ga0450919_000602	Ga0450919_000602_3599_3934	111
268	3300042531	Ga0450918_000607	Ga0450918_000607_6276_6611	111
269	3300048921	Ga0496118_0007919	Ga0496118_0007919_10329_10664	111
270	3300048922	Ga0496119_0075863	Ga0496119_0075863_1025_1360	111
271	3300048928	Ga0496125_0043130	Ga0496125_0043130_189_524	111
272	3300053136	Ga0500559_0169647	Ga0500559_0169647_183_518	111
273	2162886007	SwRhRL2b_contig_1415115	SwRhRL2b_0219.00001300	112
274	3300001979	JGI24740J21852_10005200	JGI24740J21852_100052003	112
275	3300001989	JGI24739J22299_10033552	JGI24739J22299_100335523	112
276	3300001989	JGI24739J22299_10040520	JGI24739J22299_100405202	112
277	3300001990	JGI24737J22298_10022183	JGI24737J22298_100221832	112
278	3300002067	JGI24735J21928_10043643	JGI24735J21928_100436433	112
279	3300002077	JGI24744J21845_10047460	JGI24744J21845_100474602	112
280	3300002705	JGI25156J39149_1000200	JGI25156J39149_10002008	112
281	3300002705	JGI25156J39149_1001430	JGI25156J39149_10014307	112
282	3300002705	JGI25156J39149_1004572	JGI25156J39149_10045722	112
283	3300002705	JGI25156J39149_1007679	JGI25156J39149_10076792	112
284	3300002705	JGI25156J39149_1020932	JGI25156J39149_10209322	112
285	3300002738	JGI25154J39366_1000288	JGI25154J39366_100028812	112
286	3300002738	JGI25154J39366_1000649	JGI25154J39366_10006493	112
287	3300002741	JGI25157J39369_1000095	JGI25157J39369_100009543	112
288	3300002773	JGI25152J39213_1001922	JGI25152J39213_10019229	112
289	3300002773	JGI25152J39213_1004308	JGI25152J39213_10043085	112
290	3300002774	JGI25150J39212_1027828	JGI25150J39212_10278281	112
291	3300002987	JGI25159J45721_1010035	JGI25159J45721_10100352	112
292	3300002987	JGI25159J45721_1010105	JGI25159J45721_10101052	112
293	3300003187	JGI25151J46595_10000262	JGI25151J46595_1000026254	112
294	3300003187	JGI25151J46595_10001813	JGI25151J46595_1000181315	112
295	3300003187	JGI25151J46595_10023911	JGI25151J46595_100239113	112
296	3300003187	JGI25151J46595_10030757	JGI25151J46595_100307572	112
297	3300003215	JGI25153J46596_10001361	JGI25153J46596_100013614	112
298	3300003215	JGI25153J46596_10020746	JGI25153J46596_100207462	112
299	3300003316	rootH1_10061749	rootH1_100617492	112
300	3300003320	rootH2_10002329	rootH2_100023292	112
301	3300003320	rootH2_10166799	rootH2_101667992	112
302	3300003322	rootL2_10000441	rootL2_1000044115	112
303	3300003322	rootL2_10237090	rootL2_102370902	112
304	3300003323	rootH1_10049462	rootH1_100494622	112
305	3300003323	rootH1_10068787	rootH1_100687872	112
306	3300003347	JGI26128J50194_1001209	JGI26128J50194_10012093	112
307	3300003578	Ga0006562J51391_1061692	Ga0006562J51391_10616922	112
308	3300003751	Ga0055538_1004535	Ga0055538_10045352	112
309	3300003752	Ga0055539_1000688	Ga0055539_10006887	112
310	3300003752	Ga0055539_1001465	Ga0055539_10014652	112
311	3300003752	Ga0055539_1014267	Ga0055539_10142672	112
312	3300003756	Ga0055533_1000100	Ga0055533_100010080	112
313	3300003756	Ga0055533_1006422	Ga0055533_10064223	112
314	3300003758	Ga0055532_1002241	Ga0055532_10022414	112
315	3300003758	Ga0055532_1003811	Ga0055532_10038116	112
316	3300003759	Ga0055525_1001558	Ga0055525_10015583	112
317	3300003761	Ga0055535_1001571	Ga0055535_10015717	112
318	3300003761	Ga0055535_1001668	Ga0055535_10016684	112
319	3300003762	Ga0055542_1000027	Ga0055542_1000027126	112
320	3300003762	Ga0055542_1002307	Ga0055542_10023077	112
321	3300003763	Ga0055529_1001099	Ga0055529_10010994	112
322	3300003763	Ga0055529_1001608	Ga0055529_10016084	112
323	3300003771	Ga0055526_1005479	Ga0055526_10054792	112
324	3300003771	Ga0055526_1013218	Ga0055526_10132184	112
325	3300003773	Ga0055537_1000193	Ga0055537_100019317	112
326	3300003775	Ga0055524_1002870	Ga0055524_10028707	112
327	3300003775	Ga0055524_1015745	Ga0055524_10157452	112
328	3300003781	Ga0055536_1000726	Ga0055536_100072619	112
329	3300003781	Ga0055536_1003097	Ga0055536_10030979	112
330	3300003781	Ga0055536_1007352	Ga0055536_10073524	112
331	3300003781	Ga0055536_1015208	Ga0055536_10152082	112
332	3300003781	Ga0055536_1048677	Ga0055536_10486772	112
333	3300003784	Ga0055534_1000186	Ga0055534_100018617	112
334	3300003784	Ga0055534_1002158	Ga0055534_10021589	112
335	3300003784	Ga0055534_1023929	Ga0055534_10239292	112
336	3300003790	Ga0055528_1073688	Ga0055528_10736882	112
337	3300003791	Ga0055530_10000754	Ga0055530_1000075417	112
338	3300003791	Ga0055530_10008221	Ga0055530_100082212	112
339	3300003791	Ga0055530_10030912	Ga0055530_100309122	112
340	3300003791	Ga0055530_10073206	Ga0055530_100732061	112
341	3300003792	Ga0055540_1002266	Ga0055540_100226611	112
342	3300003792	Ga0055540_1002894	Ga0055540_10028947	112
343	3300003792	Ga0055540_1004211	Ga0055540_10042116	112
344	3300003792	Ga0055540_1005185	Ga0055540_10051852	112
345	3300003792	Ga0055540_1010868	Ga0055540_10108683	112
346	3300003794	Ga0055531_10000985	Ga0055531_1000098517	112
347	3300003794	Ga0055531_10002017	Ga0055531_100020174	112
348	3300003794	Ga0055531_10013088	Ga0055531_100130882	112
349	3300003794	Ga0055531_10054307	Ga0055531_100543072	112
350	3300003794	Ga0055531_10065267	Ga0055531_100652672	112
351	3300003841	Ga0055541_1000908	Ga0055541_10009086	112
352	3300005262	Ga0065165_1000613	Ga0065165_10006136	112
353	3300005262	Ga0065165_1055167	Ga0065165_10551672	112
354	3300005288	Ga0065714_10078829	Ga0065714_100788292	112
355	3300005288	Ga0065714_10187930	Ga0065714_101879302	112
356	3300005289	Ga0065704_10079876	Ga0065704_100798766	112
357	3300005289	Ga0065704_10094721	Ga0065704_100947213	112
358	3300005289	Ga0065704_10315903	Ga0065704_103159032	112
359	3300005290	Ga0065712_10111357	Ga0065712_101113572	112
360	3300005293	Ga0065715_10214645	Ga0065715_102146452	112
361	3300005293	Ga0065715_10427078	Ga0065715_104270782	112
362	3300005293	Ga0065715_10978353	Ga0065715_109783532	112
363	3300005295	Ga0065707_10081939	Ga0065707_1008193927	112
364	3300005327	Ga0070658_10028554	Ga0070658_100285545	112
365	3300005327	Ga0070658_10607777	Ga0070658_106077772	112
366	3300005327	Ga0070658_11588604	Ga0070658_115886041	112
367	3300005328	Ga0070676_10023135	Ga0070676_100231354	112
368	3300005328	Ga0070676_10024406	Ga0070676_100244063	112
369	3300005328	Ga0070676_10062029	Ga0070676_100620292	112
370	3300005328	Ga0070676_10137992	Ga0070676_101379922	112
371	3300005328	Ga0070676_10199487	Ga0070676_101994872	112
372	3300005328	Ga0070676_11612860	Ga0070676_116128601	112
373	3300005329	Ga0070683_100007089	Ga0070683_1000070894	112
374	3300005329	Ga0070683_100161279	Ga0070683_1001612792	112
375	3300005330	Ga0070690_100558986	Ga0070690_1005589861	112
376	3300005330	Ga0070690_101013982	Ga0070690_1010139821	112
377	3300005330	Ga0070690_101151193	Ga0070690_1011511932	112
378	3300005331	Ga0070670_100001125	Ga0070670_10000112510	112
379	3300005331	Ga0070670_100046529	Ga0070670_1000465296	112
380	3300005331	Ga0070670_100096992	Ga0070670_1000969923	112
381	3300005331	Ga0070670_100454984	Ga0070670_1004549842	112
382	3300005331	Ga0070670_100472434	Ga0070670_1004724342	112
383	3300005333	Ga0070677_10004970	Ga0070677_100049702	112
384	3300005333	Ga0070677_10053445	Ga0070677_100534452	112
385	3300005333	Ga0070677_10106704	Ga0070677_101067042	112
386	3300005333	Ga0070677_10469173	Ga0070677_104691731	112
387	3300005334	Ga0068869_100001634	Ga0068869_1000016344	112
388	3300005334	Ga0068869_100011402	Ga0068869_1000114022	112
389	3300005334	Ga0068869_100186279	Ga0068869_1001862792	112
390	3300005334	Ga0068869_100186727	Ga0068869_1001867272	112
391	3300005335	Ga0070666_10027432	Ga0070666_100274325	112
392	3300005335	Ga0070666_10385928	Ga0070666_103859282	112
393	3300005336	Ga0070680_100096787	Ga0070680_1000967872	112
394	3300005336	Ga0070680_100200062	Ga0070680_1002000622	112
395	3300005337	Ga0070682_100287160	Ga0070682_1002871601	112
396	3300005337	Ga0070682_100362998	Ga0070682_1003629982	112
397	3300005338	Ga0068868_100006467	Ga0068868_1000064677	112
398	3300005338	Ga0068868_100007731	Ga0068868_1000077312	112
399	3300005338	Ga0068868_100025309	Ga0068868_1000253092	112
400	3300005338	Ga0068868_100065185	Ga0068868_1000651854	112
401	3300005338	Ga0068868_100118510	Ga0068868_1001185102	112
402	3300005338	Ga0068868_101187791	Ga0068868_1011877912	112
403	3300005338	Ga0068868_101773706	Ga0068868_1017737062	112
404	3300005339	Ga0070660_100057666	Ga0070660_1000576661	112
405	3300005339	Ga0070660_100060030	Ga0070660_1000600302	112
406	3300005339	Ga0070660_100064464	Ga0070660_1000644644	112
407	3300005339	Ga0070660_100084433	Ga0070660_1000844332	112
408	3300005339	Ga0070660_100100400	Ga0070660_1001004002	112
409	3300005339	Ga0070660_100421144	Ga0070660_1004211442	112
410	3300005339	Ga0070660_100487769	Ga0070660_1004877692	112
411	3300005340	Ga0070689_100051808	Ga0070689_1000518082	112
412	3300005340	Ga0070689_101720046	Ga0070689_1017200461	112
413	3300005341	Ga0070691_10511035	Ga0070691_105110352	112
414	3300005341	Ga0070691_10702540	Ga0070691_107025402	112
415	3300005343	Ga0070687_100030647	Ga0070687_1000306473	112
416	3300005343	Ga0070687_100101179	Ga0070687_1001011792	112
417	3300005344	Ga0070661_100006518	Ga0070661_1000065188	112
418	3300005344	Ga0070661_100048491	Ga0070661_1000484913	112
419	3300005344	Ga0070661_100171509	Ga0070661_1001715091	112
420	3300005347	Ga0070668_100181696	Ga0070668_1001816961	112
421	3300005347	Ga0070668_100317949	Ga0070668_1003179492	112
422	3300005347	Ga0070668_100685438	Ga0070668_1006854382	112
423	3300005347	Ga0070668_100787852	Ga0070668_1007878522	112
424	3300005353	Ga0070669_100021660	Ga0070669_1000216602	112
425	3300005353	Ga0070669_100094234	Ga0070669_1000942343	112
426	3300005353	Ga0070669_100160968	Ga0070669_1001609682	112
427	3300005353	Ga0070669_100256084	Ga0070669_1002560843	112
428	3300005353	Ga0070669_100256428	Ga0070669_1002564282	112
429	3300005353	Ga0070669_100521925	Ga0070669_1005219252	112
430	3300005353	Ga0070669_100936393	Ga0070669_1009363932	112
431	3300005353	Ga0070669_101719900	Ga0070669_1017199001	112
432	3300005354	Ga0070675_100000735	Ga0070675_1000007353	112
433	3300005354	Ga0070675_100004598	Ga0070675_1000045988	112
434	3300005354	Ga0070675_100015112	Ga0070675_1000151122	112
435	3300005354	Ga0070675_100207836	Ga0070675_1002078362	112
436	3300005354	Ga0070675_100693446	Ga0070675_1006934462	112
437	3300005355	Ga0070671_100001944	Ga0070671_10000194411	112
438	3300005355	Ga0070671_100005456	Ga0070671_1000054565	112
439	3300005355	Ga0070671_100022352	Ga0070671_1000223526	112
440	3300005355	Ga0070671_100046866	Ga0070671_1000468662	112
441	3300005355	Ga0070671_100081043	Ga0070671_1000810432	112
442	3300005355	Ga0070671_100161322	Ga0070671_1001613223	112
443	3300005355	Ga0070671_100195282	Ga0070671_1001952823	112
444	3300005355	Ga0070671_100511880	Ga0070671_1005118801	112
445	3300005355	Ga0070671_100848462	Ga0070671_1008484622	112
446	3300005356	Ga0070674_100013900	Ga0070674_1000139002	112
447	3300005356	Ga0070674_100236533	Ga0070674_1002365332	112
448	3300005356	Ga0070674_100393943	Ga0070674_1003939432	112
449	3300005356	Ga0070674_100558089	Ga0070674_1005580892	112
450	3300005356	Ga0070674_100572738	Ga0070674_1005727382	112
451	3300005356	Ga0070674_101435039	Ga0070674_1014350391	112
452	3300005364	Ga0070673_100023482	Ga0070673_1000234824	112
453	3300005364	Ga0070673_100066105	Ga0070673_1000661053	112
454	3300005364	Ga0070673_100071444	Ga0070673_1000714443	112
455	3300005364	Ga0070673_100132605	Ga0070673_1001326053	112
456	3300005364	Ga0070673_100167182	Ga0070673_1001671822	112
457	3300005364	Ga0070673_101028246	Ga0070673_1010282462	112
458	3300005364	Ga0070673_101089811	Ga0070673_1010898112	112
459	3300005364	Ga0070673_101167683	Ga0070673_1011676831	112
460	3300005364	Ga0070673_101976188	Ga0070673_1019761881	112
461	3300005365	Ga0070688_101394628	Ga0070688_1013946281	112
462	3300005366	Ga0070659_100003967	Ga0070659_1000039674	112
463	3300005366	Ga0070659_100008273	Ga0070659_1000082736	112
464	3300005366	Ga0070659_100025101	Ga0070659_1000251016	112
465	3300005366	Ga0070659_100063404	Ga0070659_1000634042	112
466	3300005366	Ga0070659_100227135	Ga0070659_1002271352	112
467	3300005366	Ga0070659_100239306	Ga0070659_1002393061	112
468	3300005366	Ga0070659_100776578	Ga0070659_1007765781	112
469	3300005366	Ga0070659_100897242	Ga0070659_1008972421	112
470	3300005366	Ga0070659_101989550	Ga0070659_1019895501	112
471	3300005367	Ga0070667_100006642	Ga0070667_1000066423	112
472	3300005367	Ga0070667_100021358	Ga0070667_1000213582	112
473	3300005367	Ga0070667_100032736	Ga0070667_1000327366	112
474	3300005367	Ga0070667_100065683	Ga0070667_1000656832	112
475	3300005367	Ga0070667_100157606	Ga0070667_1001576062	112
476	3300005367	Ga0070667_100177885	Ga0070667_1001778852	112
477	3300005367	Ga0070667_100358733	Ga0070667_1003587332	112
478	3300005367	Ga0070667_100500355	Ga0070667_1005003552	112
479	3300005439	Ga0070711_101059401	Ga0070711_1010594012	112
480	3300005440	Ga0070705_101672577	Ga0070705_1016725771	112
481	3300005441	Ga0070700_100009387	Ga0070700_1000093877	112
482	3300005444	Ga0070694_101409094	Ga0070694_1014090941	112
483	3300005445	Ga0070708_100234856	Ga0070708_1002348562	112
484	3300005455	Ga0070663_100037434	Ga0070663_1000374343	112
485	3300005455	Ga0070663_100087596	Ga0070663_1000875962	112
486	3300005456	Ga0070678_100024742	Ga0070678_1000247425	112
487	3300005456	Ga0070678_100035395	Ga0070678_1000353952	112
488	3300005456	Ga0070678_100077032	Ga0070678_1000770321	112
489	3300005456	Ga0070678_100309688	Ga0070678_1003096882	112
490	3300005456	Ga0070678_100343197	Ga0070678_1003431971	112
491	3300005456	Ga0070678_100580319	Ga0070678_1005803192	112
492	3300005456	Ga0070678_101064826	Ga0070678_1010648262	112
493	3300005456	Ga0070678_101213316	Ga0070678_1012133161	112
494	3300005456	Ga0070678_101541364	Ga0070678_1015413642	112
495	3300005457	Ga0070662_100009726	Ga0070662_1000097267	112
496	3300005457	Ga0070662_100011762	Ga0070662_1000117624	112
497	3300005457	Ga0070662_100019784	Ga0070662_1000197845	112
498	3300005457	Ga0070662_100320690	Ga0070662_1003206902	112
499	3300005457	Ga0070662_100597588	Ga0070662_1005975882	112
500	3300005457	Ga0070662_100649418	Ga0070662_1006494182	112
501	3300005458	Ga0070681_10680870	Ga0070681_106808701	112
502	3300005458	Ga0070681_11479174	Ga0070681_114791741	112
503	3300005459	Ga0068867_100000085	Ga0068867_10000008510	112
504	3300005459	Ga0068867_100004130	Ga0068867_1000041302	112
505	3300005459	Ga0068867_100008539	Ga0068867_1000085396	112
506	3300005459	Ga0068867_100013868	Ga0068867_1000138683	112
507	3300005459	Ga0068867_100105705	Ga0068867_1001057052	112
508	3300005459	Ga0068867_100115384	Ga0068867_1001153842	112
509	3300005459	Ga0068867_100197479	Ga0068867_1001974792	112
510	3300005459	Ga0068867_100322526	Ga0068867_1003225262	112
511	3300005459	Ga0068867_100575423	Ga0068867_1005754232	112
512	3300005459	Ga0068867_100597927	Ga0068867_1005979272	112
513	3300005466	Ga0070685_10597373	Ga0070685_105973731	112
514	3300005467	Ga0070706_100000822	Ga0070706_10000082210	112
515	3300005467	Ga0070706_100156252	Ga0070706_1001562523	112
516	3300005468	Ga0070707_100926753	Ga0070707_1009267532	112
517	3300005518	Ga0070699_101304060	Ga0070699_1013040601	112
518	3300005535	Ga0070684_100002981	Ga0070684_10000298113	112
519	3300005535	Ga0070684_100170273	Ga0070684_1001702732	112
520	3300005535	Ga0070684_100300695	Ga0070684_1003006952	112
521	3300005539	Ga0068853_100057775	Ga0068853_1000577752	112
522	3300005539	Ga0068853_100149756	Ga0068853_1001497562	112
523	3300005539	Ga0068853_100157572	Ga0068853_1001575722	112
524	3300005539	Ga0068853_100222162	Ga0068853_1002221622	112
525	3300005539	Ga0068853_100375749	Ga0068853_1003757493	112
526	3300005543	Ga0070672_100000244	Ga0070672_10000024427	112
527	3300005543	Ga0070672_100005577	Ga0070672_1000055773	112
528	3300005543	Ga0070672_100008576	Ga0070672_1000085768	112
529	3300005543	Ga0070672_100010686	Ga0070672_1000106866	112
530	3300005543	Ga0070672_100125840	Ga0070672_1001258402	112
531	3300005543	Ga0070672_100350090	Ga0070672_1003500902	112
532	3300005543	Ga0070672_100377133	Ga0070672_1003771332	112
533	3300005543	Ga0070672_100592457	Ga0070672_1005924572	112
534	3300005544	Ga0070686_100295769	Ga0070686_1002957692	112
535	3300005545	Ga0070695_100421502	Ga0070695_1004215021	112
536	3300005547	Ga0070693_100355385	Ga0070693_1003553853	112
537	3300005547	Ga0070693_100570766	Ga0070693_1005707662	112
538	3300005548	Ga0070665_100006131	Ga0070665_10000613115	112
539	3300005548	Ga0070665_100107301	Ga0070665_1001073013	112
540	3300005548	Ga0070665_100225136	Ga0070665_1002251363	112
541	3300005548	Ga0070665_100573091	Ga0070665_1005730912	112
542	3300005548	Ga0070665_102492028	Ga0070665_1024920282	112
543	3300005563	Ga0068855_100030205	Ga0068855_1000302055	112
544	3300005563	Ga0068855_100125071	Ga0068855_1001250712	112
545	3300005563	Ga0068855_100166273	Ga0068855_1001662734	112
546	3300005563	Ga0068855_100176007	Ga0068855_1001760072	112
547	3300005563	Ga0068855_100191710	Ga0068855_1001917102	112
548	3300005563	Ga0068855_100395419	Ga0068855_1003954192	112
549	3300005563	Ga0068855_101423419	Ga0068855_1014234191	112
550	3300005563	Ga0068855_101437348	Ga0068855_1014373482	112
551	3300005564	Ga0070664_100021750	Ga0070664_1000217504	112
552	3300005564	Ga0070664_100037096	Ga0070664_1000370965	112
553	3300005564	Ga0070664_100050836	Ga0070664_1000508362	112
554	3300005564	Ga0070664_100179981	Ga0070664_1001799813	112
555	3300005564	Ga0070664_100319026	Ga0070664_1003190262	112
556	3300005564	Ga0070664_100451978	Ga0070664_1004519781	112
557	3300005564	Ga0070664_100552726	Ga0070664_1005527261	112
558	3300005577	Ga0068857_100018728	Ga0068857_1000187286	112
559	3300005577	Ga0068857_100045340	Ga0068857_1000453404	112
560	3300005577	Ga0068857_100115387	Ga0068857_1001153872	112
561	3300005577	Ga0068857_100426752	Ga0068857_1004267522	112
562	3300005577	Ga0068857_100600050	Ga0068857_1006000502	112
563	3300005577	Ga0068857_100787047	Ga0068857_1007870472	112
564	3300005577	Ga0068857_100845678	Ga0068857_1008456782	112
565	3300005577	Ga0068857_101495090	Ga0068857_1014950902	112
566	3300005578	Ga0068854_100002508	Ga0068854_10000250810	112
567	3300005578	Ga0068854_100006996	Ga0068854_1000069966	112
568	3300005578	Ga0068854_100080379	Ga0068854_1000803792	112
569	3300005578	Ga0068854_100096393	Ga0068854_1000963932	112
570	3300005578	Ga0068854_100130539	Ga0068854_1001305392	112
571	3300005578	Ga0068854_100375269	Ga0068854_1003752691	112
572	3300005578	Ga0068854_100384051	Ga0068854_1003840512	112
573	3300005578	Ga0068854_100527821	Ga0068854_1005278212	112
574	3300005578	Ga0068854_100754653	Ga0068854_1007546533	112
575	3300005614	Ga0068856_100013314	Ga0068856_1000133146	112
576	3300005614	Ga0068856_100022023	Ga0068856_1000220232	112
577	3300005614	Ga0068856_100043233	Ga0068856_1000432332	112
578	3300005614	Ga0068856_100098167	Ga0068856_1000981673	112
579	3300005614	Ga0068856_100521922	Ga0068856_1005219222	112
580	3300005614	Ga0068856_100707698	Ga0068856_1007076982	112
581	3300005615	Ga0070702_100122681	Ga0070702_1001226813	112
582	3300005616	Ga0068852_100008757	Ga0068852_1000087578	112
583	3300005616	Ga0068852_100076296	Ga0068852_1000762963	112
584	3300005616	Ga0068852_100109246	Ga0068852_1001092461	112
585	3300005616	Ga0068852_100126238	Ga0068852_1001262382	112
586	3300005616	Ga0068852_100162554	Ga0068852_1001625542	112
587	3300005616	Ga0068852_100177678	Ga0068852_1001776783	112
588	3300005616	Ga0068852_100206166	Ga0068852_1002061662	112
589	3300005616	Ga0068852_100252479	Ga0068852_1002524792	112
590	3300005616	Ga0068852_100295609	Ga0068852_1002956092	112
591	3300005616	Ga0068852_101055902	Ga0068852_1010559022	112
592	3300005616	Ga0068852_102076170	Ga0068852_1020761701	112
593	3300005617	Ga0068859_100032096	Ga0068859_1000320962	112
594	3300005617	Ga0068859_100222130	Ga0068859_1002221302	112
595	3300005617	Ga0068859_100437590	Ga0068859_1004375902	112
596	3300005617	Ga0068859_100539851	Ga0068859_1005398513	112
597	3300005617	Ga0068859_100586895	Ga0068859_1005868951	112
598	3300005617	Ga0068859_101977742	Ga0068859_1019777422	112
599	3300005618	Ga0068864_100011590	Ga0068864_1000115908	112
600	3300005618	Ga0068864_100015868	Ga0068864_1000158685	112
601	3300005618	Ga0068864_100032380	Ga0068864_1000323807	112
602	3300005618	Ga0068864_100078599	Ga0068864_1000785993	112
603	3300005718	Ga0068866_10035274	Ga0068866_100352742	112
604	3300005718	Ga0068866_10245943	Ga0068866_102459432	112
605	3300005719	Ga0068861_100000582	Ga0068861_10000058224	112
606	3300005719	Ga0068861_100000677	Ga0068861_1000006773	112
607	3300005719	Ga0068861_100119213	Ga0068861_1001192132	112
608	3300005834	Ga0068851_10005711	Ga0068851_100057116	112
609	3300005834	Ga0068851_10079563	Ga0068851_100795633	112
610	3300005834	Ga0068851_10086935	Ga0068851_100869353	112
611	3300005834	Ga0068851_10112479	Ga0068851_101124792	112
612	3300005834	Ga0068851_10405114	Ga0068851_104051142	112
613	3300005834	Ga0068851_10606699	Ga0068851_106066992	112
614	3300005840	Ga0068870_10205411	Ga0068870_102054112	112
615	3300005840	Ga0068870_10257640	Ga0068870_102576402	112
616	3300005840	Ga0068870_10540408	Ga0068870_105404082	112
617	3300005840	Ga0068870_10725988	Ga0068870_107259882	112
618	3300005840	Ga0068870_11226770	Ga0068870_112267701	112
619	3300005841	Ga0068863_100004173	Ga0068863_1000041738	112
620	3300005841	Ga0068863_100082398	Ga0068863_1000823982	112
621	3300005841	Ga0068863_100093622	Ga0068863_1000936222	112
622	3300005841	Ga0068863_100357715	Ga0068863_1003577153	112
623	3300005842	Ga0068858_100000560	Ga0068858_1000005602	112
624	3300005842	Ga0068858_100037529	Ga0068858_1000375296	112
625	3300005842	Ga0068858_100057084	Ga0068858_1000570843	112
626	3300005842	Ga0068858_100397457	Ga0068858_1003974572	112
627	3300005842	Ga0068858_100780252	Ga0068858_1007802522	112
628	3300005842	Ga0068858_101140323	Ga0068858_1011403232	112
629	3300005843	Ga0068860_100002632	Ga0068860_10000263218	112
630	3300005843	Ga0068860_100061216	Ga0068860_1000612163	112
631	3300005843	Ga0068860_100240537	Ga0068860_1002405372	112
632	3300005843	Ga0068860_100341603	Ga0068860_1003416031	112
633	3300005843	Ga0068860_101736591	Ga0068860_1017365912	112
634	3300005844	Ga0068862_100010198	Ga0068862_1000101987	112
635	3300005844	Ga0068862_100070096	Ga0068862_1000700963	112
636	3300005844	Ga0068862_100823561	Ga0068862_1008235612	112
637	3300005844	Ga0068862_101997397	Ga0068862_1019973972	112
638	3300005937	Ga0081455_10232278	Ga0081455_102322782	112
639	3300006038	Ga0075365_10004297	Ga0075365_100042975	112
640	3300006038	Ga0075365_10029244	Ga0075365_100292445	112
641	3300006042	Ga0075368_10015003	Ga0075368_100150034	112
642	3300006042	Ga0075368_10025640	Ga0075368_100256402	112
643	3300006042	Ga0075368_10089158	Ga0075368_100891582	112
644	3300006042	Ga0075368_10110095	Ga0075368_101100952	112
645	3300006042	Ga0075368_10120838	Ga0075368_101208382	112
646	3300006042	Ga0075368_10127894	Ga0075368_101278942	112
647	3300006042	Ga0075368_10233661	Ga0075368_102336612	112
648	3300006042	Ga0075368_10483754	Ga0075368_104837542	112
649	3300006048	Ga0075363_100001372	Ga0075363_1000013729	112
650	3300006048	Ga0075363_100011135	Ga0075363_1000111355	112
651	3300006048	Ga0075363_100036596	Ga0075363_1000365964	112
652	3300006048	Ga0075363_100083784	Ga0075363_1000837842	112
653	3300006048	Ga0075363_100083793	Ga0075363_1000837932	112
654	3300006048	Ga0075363_100135138	Ga0075363_1001351382	112
655	3300006048	Ga0075363_100145033	Ga0075363_1001450332	112
656	3300006048	Ga0075363_100245793	Ga0075363_1002457932	112
657	3300006048	Ga0075363_100532557	Ga0075363_1005325572	112
658	3300006048	Ga0075363_100642870	Ga0075363_1006428702	112
659	3300006051	Ga0075364_10012528	Ga0075364_100125284	112
660	3300006051	Ga0075364_10016278	Ga0075364_100162783	112
661	3300006051	Ga0075364_10085088	Ga0075364_100850884	112
662	3300006051	Ga0075364_10100218	Ga0075364_101002182	112
663	3300006051	Ga0075364_10393356	Ga0075364_103933561	112
664	3300006051	Ga0075364_10433501	Ga0075364_104335012	112
665	3300006051	Ga0075364_10457758	Ga0075364_104577582	112
666	3300006051	Ga0075364_10624434	Ga0075364_106244341	112
667	3300006051	Ga0075364_10754383	Ga0075364_107543832	112
668	3300006058	Ga0075432_10150260	Ga0075432_101502602	112
669	3300006177	Ga0075362_10005070	Ga0075362_100050702	112
670	3300006177	Ga0075362_10006907	Ga0075362_100069075	112
671	3300006177	Ga0075362_10006970	Ga0075362_100069705	112
672	3300006177	Ga0075362_10018421	Ga0075362_100184212	112
673	3300006177	Ga0075362_10024484	Ga0075362_100244842	112
674	3300006177	Ga0075362_10114760	Ga0075362_101147603	112
675	3300006177	Ga0075362_10125632	Ga0075362_101256322	112
676	3300006177	Ga0075362_10135822	Ga0075362_101358222	112
677	3300006177	Ga0075362_10150654	Ga0075362_101506542	112
678	3300006177	Ga0075362_10288997	Ga0075362_102889972	112
679	3300006177	Ga0075362_10299394	Ga0075362_102993941	112
680	3300006177	Ga0075362_10536063	Ga0075362_105360631	112
681	3300006177	Ga0075362_10589544	Ga0075362_105895441	112
682	3300006178	Ga0075367_10005547	Ga0075367_100055477	112
683	3300006178	Ga0075367_10012600	Ga0075367_100126006	112
684	3300006178	Ga0075367_10026352	Ga0075367_100263522	112
685	3300006178	Ga0075367_10036496	Ga0075367_100364963	112
686	3300006178	Ga0075367_10037500	Ga0075367_100375002	112
687	3300006178	Ga0075367_10069417	Ga0075367_100694173	112
688	3300006178	Ga0075367_10111626	Ga0075367_101116262	112
689	3300006178	Ga0075367_10574567	Ga0075367_105745671	112
690	3300006178	Ga0075367_10846119	Ga0075367_108461192	112
691	3300006186	Ga0075369_10001852	Ga0075369_100018527	112
692	3300006186	Ga0075369_10095160	Ga0075369_100951603	112
693	3300006186	Ga0075369_10097573	Ga0075369_100975732	112
694	3300006186	Ga0075369_10136040	Ga0075369_101360402	112
695	3300006195	Ga0075366_10001677	Ga0075366_100016772	112
696	3300006195	Ga0075366_10002935	Ga0075366_100029359	112
697	3300006195	Ga0075366_10003541	Ga0075366_100035416	112
698	3300006195	Ga0075366_10004492	Ga0075366_1000449210	112
699	3300006195	Ga0075366_10005743	Ga0075366_100057435	112
700	3300006195	Ga0075366_10010575	Ga0075366_100105752	112
701	3300006195	Ga0075366_10011468	Ga0075366_100114686	112
702	3300006195	Ga0075366_10013487	Ga0075366_100134876	112
703	3300006195	Ga0075366_10033053	Ga0075366_100330532	112
704	3300006195	Ga0075366_10034984	Ga0075366_100349841	112
705	3300006195	Ga0075366_10043108	Ga0075366_100431085	112
706	3300006195	Ga0075366_10048738	Ga0075366_100487382	112
707	3300006195	Ga0075366_10051847	Ga0075366_100518473	112
708	3300006195	Ga0075366_10052964	Ga0075366_100529642	112
709	3300006195	Ga0075366_10091551	Ga0075366_100915512	112
710	3300006195	Ga0075366_10096603	Ga0075366_100966032	112
711	3300006195	Ga0075366_10101808	Ga0075366_101018084	112
712	3300006195	Ga0075366_10106830	Ga0075366_101068302	112
713	3300006195	Ga0075366_10148761	Ga0075366_101487612	112
714	3300006195	Ga0075366_10155628	Ga0075366_101556282	112
715	3300006195	Ga0075366_10196689	Ga0075366_101966892	112
716	3300006195	Ga0075366_10201532	Ga0075366_102015322	112
717	3300006195	Ga0075366_10219966	Ga0075366_102199662	112
718	3300006195	Ga0075366_10257032	Ga0075366_102570322	112
719	3300006195	Ga0075366_10278101	Ga0075366_102781012	112
720	3300006195	Ga0075366_10284664	Ga0075366_102846642	112
721	3300006195	Ga0075366_10307972	Ga0075366_103079721	112
722	3300006195	Ga0075366_10319902	Ga0075366_103199022	112
723	3300006195	Ga0075366_10441189	Ga0075366_104411892	112
724	3300006195	Ga0075366_10879797	Ga0075366_108797972	112
725	3300006195	Ga0075366_11018047	Ga0075366_110180471	112
726	3300006237	Ga0097621_100011918	Ga0097621_1000119182	112
727	3300006237	Ga0097621_100040679	Ga0097621_1000406796	112
728	3300006237	Ga0097621_100064071	Ga0097621_1000640716	112
729	3300006237	Ga0097621_100107140	Ga0097621_1001071402	112
730	3300006237	Ga0097621_100134827	Ga0097621_1001348272	112
731	3300006237	Ga0097621_100137354	Ga0097621_1001373544	112
732	3300006237	Ga0097621_100498620	Ga0097621_1004986202	112
733	3300006237	Ga0097621_101343929	Ga0097621_1013439291	112
734	3300006353	Ga0075370_10000124	Ga0075370_1000012411	112
735	3300006353	Ga0075370_10000159	Ga0075370_1000015914	112
736	3300006353	Ga0075370_10001473	Ga0075370_1000147313	112
737	3300006353	Ga0075370_10003561	Ga0075370_100035616	112
738	3300006353	Ga0075370_10004375	Ga0075370_100043753	112
739	3300006353	Ga0075370_10008986	Ga0075370_100089864	112
740	3300006353	Ga0075370_10011875	Ga0075370_100118752	112
741	3300006353	Ga0075370_10012982	Ga0075370_100129822	112
742	3300006353	Ga0075370_10018684	Ga0075370_100186846	112
743	3300006353	Ga0075370_10024332	Ga0075370_100243325	112
744	3300006353	Ga0075370_10031609	Ga0075370_100316092	112
745	3300006353	Ga0075370_10041223	Ga0075370_100412232	112
746	3300006353	Ga0075370_10044762	Ga0075370_100447623	112
747	3300006353	Ga0075370_10049244	Ga0075370_100492442	112
748	3300006353	Ga0075370_10081886	Ga0075370_100818862	112
749	3300006353	Ga0075370_10083339	Ga0075370_100833393	112
750	3300006353	Ga0075370_10103526	Ga0075370_101035262	112
751	3300006353	Ga0075370_10150489	Ga0075370_101504892	112
752	3300006353	Ga0075370_10170120	Ga0075370_101701202	112
753	3300006353	Ga0075370_10539614	Ga0075370_105396142	112
754	3300006353	Ga0075370_10877565	Ga0075370_108775652	112
755	3300006358	Ga0068871_100044806	Ga0068871_1000448062	112
756	3300006358	Ga0068871_100108518	Ga0068871_1001085184	112
757	3300006358	Ga0068871_100526870	Ga0068871_1005268702	112
758	3300006880	Ga0075429_101499775	Ga0075429_1014997752	112
759	3300006881	Ga0068865_100040309	Ga0068865_1000403096	112
760	3300006881	Ga0068865_100058476	Ga0068865_1000584765	112
761	3300006881	Ga0068865_100168495	Ga0068865_1001684952	112
762	3300006881	Ga0068865_100459002	Ga0068865_1004590022	112
763	3300006881	Ga0068865_100749447	Ga0068865_1007494472	112
764	3300006931	Ga0097620_100032096	Ga0097620_1000320962	112
765	3300006931	Ga0097620_100222131	Ga0097620_1002221312	112
766	3300006931	Ga0097620_100437573	Ga0097620_1004375732	112
767	3300006931	Ga0097620_100539782	Ga0097620_1005397823	112
768	3300006931	Ga0097620_100586914	Ga0097620_1005869141	112
769	3300006931	Ga0097620_101977887	Ga0097620_1019778871	112
770	3300006944	Ga0099823_1058477	Ga0099823_10584772	112
771	3300006948	Ga0099826_10029080	Ga0099826_100290802	112
772	3300006948	Ga0099826_10131993	Ga0099826_101319931	112
773	3300007076	Ga0075435_100640821	Ga0075435_1006408212	112
774	3300009011	Ga0105251_10017441	Ga0105251_100174414	112
775	3300009011	Ga0105251_10058772	Ga0105251_100587722	112
776	3300009036	Ga0105244_10001834	Ga0105244_100018343	112
777	3300009036	Ga0105244_10024925	Ga0105244_100249252	112
778	3300009036	Ga0105244_10368012	Ga0105244_103680121	112
779	3300009092	Ga0105250_10129259	Ga0105250_101292592	112
780	3300009093	Ga0105240_10017700	Ga0105240_100177009	112
781	3300009093	Ga0105240_10020431	Ga0105240_100204316	112
782	3300009093	Ga0105240_10022278	Ga0105240_100222784	112
783	3300009093	Ga0105240_10336480	Ga0105240_103364802	112
784	3300009093	Ga0105240_11672081	Ga0105240_116720812	112
785	3300009094	Ga0111539_11096507	Ga0111539_110965072	112
786	3300009094	Ga0111539_11532128	Ga0111539_115321282	112
787	3300009094	Ga0111539_12951320	Ga0111539_129513201	112
788	3300009098	Ga0105245_10150078	Ga0105245_101500782	112
789	3300009098	Ga0105245_10172687	Ga0105245_101726873	112
790	3300009098	Ga0105245_10245508	Ga0105245_102455083	112
791	3300009098	Ga0105245_10485053	Ga0105245_104850532	112
792	3300009098	Ga0105245_10669374	Ga0105245_106693742	112
793	3300009098	Ga0105245_11204771	Ga0105245_112047712	112
794	3300009098	Ga0105245_11594832	Ga0105245_115948322	112
795	3300009101	Ga0105247_10441827	Ga0105247_104418272	112
796	3300009101	Ga0105247_11257926	Ga0105247_112579262	112
797	3300009147	Ga0114129_10051750	Ga0114129_100517504	112
798	3300009148	Ga0105243_10000486	Ga0105243_1000048627	112
799	3300009148	Ga0105243_10003231	Ga0105243_1000323113	112
800	3300009148	Ga0105243_10021379	Ga0105243_100213794	112
801	3300009148	Ga0105243_10105356	Ga0105243_101053564	112
802	3300009148	Ga0105243_10120855	Ga0105243_101208552	112
803	3300009148	Ga0105243_10335147	Ga0105243_103351472	112
804	3300009148	Ga0105243_10415518	Ga0105243_104155182	112
805	3300009148	Ga0105243_11059092	Ga0105243_110590922	112
806	3300009148	Ga0105243_11142834	Ga0105243_111428342	112
807	3300009148	Ga0105243_12170737	Ga0105243_121707371	112
808	3300009174	Ga0105241_10003239	Ga0105241_1000323913	112
809	3300009174	Ga0105241_10401883	Ga0105241_104018832	112
810	3300009174	Ga0105241_10724360	Ga0105241_107243602	112
811	3300009174	Ga0105241_10935623	Ga0105241_109356232	112
812	3300009174	Ga0105241_11873201	Ga0105241_118732012	112
813	3300009174	Ga0105241_12604394	Ga0105241_126043942	112
814	3300009176	Ga0105242_10961652	Ga0105242_109616522	112
815	3300009176	Ga0105242_11425078	Ga0105242_114250782	112
816	3300009177	Ga0105248_10000445	Ga0105248_1000044523	112
817	3300009177	Ga0105248_10017866	Ga0105248_100178668	112
818	3300009177	Ga0105248_10025421	Ga0105248_100254213	112
819	3300009177	Ga0105248_10046075	Ga0105248_100460752	112
820	3300009177	Ga0105248_10409042	Ga0105248_104090423	112
821	3300009177	Ga0105248_10728412	Ga0105248_107284121	112
822	3300009177	Ga0105248_11419170	Ga0105248_114191702	112
823	3300009177	Ga0105248_11874896	Ga0105248_118748962	112
824	3300009177	Ga0105248_12224160	Ga0105248_122241602	112
825	3300009545	Ga0105237_10000548	Ga0105237_1000054822	112
826	3300009545	Ga0105237_10015839	Ga0105237_100158397	112
827	3300009545	Ga0105237_10182787	Ga0105237_101827871	112
828	3300009545	Ga0105237_10231058	Ga0105237_102310582	112
829	3300009545	Ga0105237_10341422	Ga0105237_103414222	112
830	3300009545	Ga0105237_10445838	Ga0105237_104458382	112
831	3300009545	Ga0105237_10738902	Ga0105237_107389022	112
832	3300009545	Ga0105237_10923354	Ga0105237_109233542	112
833	3300009551	Ga0105238_10020973	Ga0105238_100209734	112
834	3300009551	Ga0105238_10136657	Ga0105238_101366572	112
835	3300009551	Ga0105238_10161939	Ga0105238_101619394	112
836	3300009551	Ga0105238_10650503	Ga0105238_106505032	112
837	3300009553	Ga0105249_10038755	Ga0105249_100387552	112
838	3300009553	Ga0105249_10052334	Ga0105249_100523342	112
839	3300009553	Ga0105249_10177219	Ga0105249_101772194	112
840	3300009553	Ga0105249_10318349	Ga0105249_103183492	112
841	3300009553	Ga0105249_10336225	Ga0105249_103362253	112
842	3300009553	Ga0105249_13095095	Ga0105249_130950951	112
843	3300010375	Ga0105239_10001569	Ga0105239_1000156921	112
844	3300010375	Ga0105239_10052411	Ga0105239_100524113	112
845	3300010375	Ga0105239_10174209	Ga0105239_101742094	112
846	3300010375	Ga0105239_10274852	Ga0105239_102748522	112
847	3300010375	Ga0105239_10280880	Ga0105239_102808802	112
848	3300010375	Ga0105239_10777111	Ga0105239_107771112	112
849	3300010375	Ga0105239_13137326	Ga0105239_131373261	112
850	3300011119	Ga0105246_10007754	Ga0105246_100077542	112
851	3300011119	Ga0105246_10200957	Ga0105246_102009572	112
852	3300011119	Ga0105246_10375419	Ga0105246_103754191	112
853	3300011119	Ga0105246_11159263	Ga0105246_111592632	112
854	3300011119	Ga0105246_11783863	Ga0105246_117838631	112
855	3300012490	Ga0157322_1021901	Ga0157322_10219011	112
856	3300012497	Ga0157319_1000006	Ga0157319_100000637	112
857	3300012502	Ga0157347_1003675	Ga0157347_10036752	112
858	3300012505	Ga0157339_1024310	Ga0157339_10243102	112
859	3300012507	Ga0157342_1018967	Ga0157342_10189672	112
860	3300012512	Ga0157327_1046646	Ga0157327_10466461	112
861	3300013100	Ga0157373_10004477	Ga0157373_100044773	112
862	3300013100	Ga0157373_10005848	Ga0157373_100058486	112
863	3300013100	Ga0157373_10037609	Ga0157373_100376095	112
864	3300013100	Ga0157373_10103380	Ga0157373_101033805	112
865	3300013100	Ga0157373_10115188	Ga0157373_101151882	112
866	3300013100	Ga0157373_10151556	Ga0157373_101515562	112
867	3300013102	Ga0157371_10099143	Ga0157371_100991432	112
868	3300013102	Ga0157371_10255462	Ga0157371_102554621	112
869	3300013102	Ga0157371_10616305	Ga0157371_106163051	112
870	3300013102	Ga0157371_10722570	Ga0157371_107225702	112
871	3300013102	Ga0157371_11100124	Ga0157371_111001241	112
872	3300013104	Ga0157370_10001046	Ga0157370_1000104618	112
873	3300013104	Ga0157370_10014128	Ga0157370_100141286	112
874	3300013104	Ga0157370_10217371	Ga0157370_102173713	112
875	3300013104	Ga0157370_10312903	Ga0157370_103129033	112
876	3300013104	Ga0157370_10353690	Ga0157370_103536902	112
877	3300013104	Ga0157370_10923045	Ga0157370_109230451	112
878	3300013105	Ga0157369_10000981	Ga0157369_100009812	112
879	3300013105	Ga0157369_10014051	Ga0157369_100140518	112
880	3300013105	Ga0157369_10017535	Ga0157369_100175352	112
881	3300013105	Ga0157369_10019561	Ga0157369_100195618	112
882	3300013105	Ga0157369_10374804	Ga0157369_103748042	112
883	3300013105	Ga0157369_10397815	Ga0157369_103978153	112
884	3300013105	Ga0157369_11428250	Ga0157369_114282502	112
885	3300013296	Ga0157374_10000032	Ga0157374_1000003278	112
886	3300013296	Ga0157374_10005865	Ga0157374_100058655	112
887	3300013296	Ga0157374_10014186	Ga0157374_100141867	112
888	3300013296	Ga0157374_10145876	Ga0157374_101458762	112
889	3300013296	Ga0157374_10277004	Ga0157374_102770042	112
890	3300013296	Ga0157374_10380304	Ga0157374_103803042	112
891	3300013296	Ga0157374_10419587	Ga0157374_104195873	112
892	3300013297	Ga0157378_10000558	Ga0157378_1000055837	112
893	3300013297	Ga0157378_10481027	Ga0157378_104810272	112
894	3300013297	Ga0157378_10511813	Ga0157378_105118132	112
895	3300013297	Ga0157378_10831066	Ga0157378_108310662	112
896	3300013297	Ga0157378_10835110	Ga0157378_108351102	112
897	3300013297	Ga0157378_11412386	Ga0157378_114123861	112
898	3300013297	Ga0157378_11729265	Ga0157378_117292651	112
899	3300013297	Ga0157378_11757097	Ga0157378_117570972	112
900	3300013297	Ga0157378_12632226	Ga0157378_126322261	112
901	3300013297	Ga0157378_12638068	Ga0157378_126380681	112
902	3300013306	Ga0163162_10005747	Ga0163162_100057473	112
903	3300013306	Ga0163162_10045656	Ga0163162_100456565	112
904	3300013306	Ga0163162_10109110	Ga0163162_101091102	112
905	3300013306	Ga0163162_10223961	Ga0163162_102239612	112
906	3300013306	Ga0163162_10232252	Ga0163162_102322522	112
907	3300013306	Ga0163162_10609804	Ga0163162_106098042	112
908	3300013306	Ga0163162_11187961	Ga0163162_111879612	112
909	3300013307	Ga0157372_10019251	Ga0157372_100192515	112
910	3300013307	Ga0157372_10188302	Ga0157372_101883023	112
911	3300013307	Ga0157372_10276126	Ga0157372_102761263	112
912	3300013307	Ga0157372_10372342	Ga0157372_103723421	112
913	3300013307	Ga0157372_10388386	Ga0157372_103883863	112
914	3300013307	Ga0157372_10712918	Ga0157372_107129182	112
915	3300013307	Ga0157372_11133255	Ga0157372_111332552	112
916	3300013307	Ga0157372_11258917	Ga0157372_112589172	112
917	3300013308	Ga0157375_10013127	Ga0157375_100131272	112
918	3300013308	Ga0157375_10031297	Ga0157375_100312972	112
919	3300013308	Ga0157375_10059867	Ga0157375_100598673	112
920	3300013308	Ga0157375_10068447	Ga0157375_100684473	112
921	3300013308	Ga0157375_10106464	Ga0157375_101064642	112
922	3300013308	Ga0157375_10119991	Ga0157375_101199914	112
923	3300013308	Ga0157375_10187002	Ga0157375_101870022	112
924	3300013308	Ga0157375_10325666	Ga0157375_103256661	112
925	3300013308	Ga0157375_10548459	Ga0157375_105484592	112
926	3300013308	Ga0157375_10723557	Ga0157375_107235573	112
927	3300013308	Ga0157375_11604339	Ga0157375_116043392	112
928	3300014325	Ga0163163_10129383	Ga0163163_101293833	112
929	3300014325	Ga0163163_10272395	Ga0163163_102723952	112
930	3300014325	Ga0163163_10817455	Ga0163163_108174552	112
931	3300014325	Ga0163163_11322412	Ga0163163_113224122	112
932	3300014326	Ga0157380_10053803	Ga0157380_100538034	112
933	3300014326	Ga0157380_10228832	Ga0157380_102288322	112
934	3300014326	Ga0157380_10320589	Ga0157380_103205893	112
935	3300014326	Ga0157380_10571025	Ga0157380_105710252	112
936	3300014326	Ga0157380_11716265	Ga0157380_117162651	112
937	3300014326	Ga0157380_12956872	Ga0157380_129568722	112
938	3300014497	Ga0182008_10001960	Ga0182008_100019605	112
939	3300014497	Ga0182008_10009359	Ga0182008_100093594	112
940	3300014497	Ga0182008_10116948	Ga0182008_101169482	112
941	3300014497	Ga0182008_10431370	Ga0182008_104313702	112
942	3300014497	Ga0182008_10983333	Ga0182008_109833331	112
943	3300014745	Ga0157377_10000028	Ga0157377_1000002853	112
944	3300014745	Ga0157377_10077811	Ga0157377_100778113	112
945	3300014968	Ga0157379_10035995	Ga0157379_100359952	112
946	3300014968	Ga0157379_10043963	Ga0157379_100439632	112
947	3300014968	Ga0157379_10051052	Ga0157379_100510522	112
948	3300014968	Ga0157379_10107677	Ga0157379_101076772	112
949	3300014968	Ga0157379_10142242	Ga0157379_101422423	112
950	3300014968	Ga0157379_10181011	Ga0157379_101810112	112
951	3300014968	Ga0157379_10242497	Ga0157379_102424973	112
952	3300014968	Ga0157379_10290484	Ga0157379_102904842	112
953	3300014968	Ga0157379_11078161	Ga0157379_110781612	112
954	3300014969	Ga0157376_10009600	Ga0157376_100096006	112
955	3300014969	Ga0157376_10048381	Ga0157376_100483812	112
956	3300014969	Ga0157376_10092691	Ga0157376_100926913	112
957	3300014969	Ga0157376_10187310	Ga0157376_101873102	112
958	3300014969	Ga0157376_10576089	Ga0157376_105760891	112
959	3300014969	Ga0157376_10671608	Ga0157376_106716082	112
960	3300014969	Ga0157376_11200374	Ga0157376_112003741	112
961	3300014969	Ga0157376_11914755	Ga0157376_119147552	112
962	3300015261	Ga0182006_1001354	Ga0182006_100135414	112
963	3300015261	Ga0182006_1010741	Ga0182006_10107417	112
964	3300015261	Ga0182006_1011055	Ga0182006_10110554	112
965	3300015261	Ga0182006_1030375	Ga0182006_10303752	112
966	3300015261	Ga0182006_1071057	Ga0182006_10710572	112
967	3300015262	Ga0182007_10001767	Ga0182007_100017673	112
968	3300015262	Ga0182007_10021863	Ga0182007_100218634	112
969	3300015262	Ga0182007_10111558	Ga0182007_101115582	112
970	3300015262	Ga0182007_10270552	Ga0182007_102705521	112
971	3300015265	Ga0182005_1029694	Ga0182005_10296942	112
972	3300015265	Ga0182005_1091376	Ga0182005_10913762	112
973	3300015265	Ga0182005_1297163	Ga0182005_12971632	112
974	3300017792	Ga0163161_10001250	Ga0163161_100012509	112
975	3300017792	Ga0163161_10023133	Ga0163161_100231336	112
976	3300017792	Ga0163161_10048400	Ga0163161_100484002	112
977	3300017792	Ga0163161_10196275	Ga0163161_101962752	112
978	3300017792	Ga0163161_10216770	Ga0163161_102167701	112
979	3300017792	Ga0163161_10669334	Ga0163161_106693341	112
980	3300017792	Ga0163161_10675892	Ga0163161_106758922	112
981	3300020076	Ga0206355_1269035	Ga0206355_12690352	112
982	3300020078	Ga0206352_10797362	Ga0206352_107973621	112
983	3300021361	Ga0213872_10000011	Ga0213872_10000011110	112
984	3300021361	Ga0213872_10000272	Ga0213872_1000027221	112
985	3300021361	Ga0213872_10040543	Ga0213872_100405433	112
986	3300021361	Ga0213872_10060109	Ga0213872_100601092	112
987	3300021361	Ga0213872_10074479	Ga0213872_100744792	112
988	3300021361	Ga0213872_10075054	Ga0213872_100750542	112
989	3300021361	Ga0213872_10227793	Ga0213872_102277932	112
990	3300021384	Ga0213876_10287255	Ga0213876_102872552	112
991	3300025206	Ga0209435_125931	Ga0209435_1259312	112
992	3300025208	Ga0209436_101446	Ga0209436_1014466	112
993	3300025224	Ga0209784_100938	Ga0209784_1009384	112
994	3300025225	Ga0209566_100561	Ga0209566_10056111	112
995	3300025226	Ga0209674_100003	Ga0209674_1000031938	112
996	3300025226	Ga0209674_100122	Ga0209674_10012256	112
997	3300025228	Ga0209672_100191	Ga0209672_10019140	112
998	3300025228	Ga0209672_100222	Ga0209672_10022210	112
999	3300025229	Ga0209147_100435	Ga0209147_10043520	112
1000	3300025230	Ga0209563_100017	Ga0209563_10001732	112
1001	3300025230	Ga0209563_103222	Ga0209563_1032225	112
1002	3300025242	Ga0209258_100048	Ga0209258_100048249	112
1003	3300025242	Ga0209258_100559	Ga0209258_10055933	112
1004	3300025242	Ga0209258_102813	Ga0209258_1028136	112
1005	3300025245	Ga0207425_1000786	Ga0207425_100078614	112
1006	3300025245	Ga0207425_1003597	Ga0207425_10035974	112
1007	3300025246	Ga0209646_1000022	Ga0209646_1000022180	112
1008	3300025246	Ga0209646_1000271	Ga0209646_100027116	112
1009	3300025250	Ga0209026_1000085	Ga0209026_1000085146	112
1010	3300025250	Ga0209026_1004183	Ga0209026_10041832	112
1011	3300025253	Ga0209677_101546	Ga0209677_1015467	112
1012	3300025253	Ga0209677_101615	Ga0209677_1016157	112
1013	3300025253	Ga0209677_103383	Ga0209677_1033833	112
1014	3300025254	Ga0209148_1000021	Ga0209148_1000021579	112
1015	3300025254	Ga0209148_1000040	Ga0209148_1000040249	112
1016	3300025254	Ga0209148_1012316	Ga0209148_10123162	112
1017	3300025256	Ga0209759_1000068	Ga0209759_1000068144	112
1018	3300025256	Ga0209759_1001746	Ga0209759_10017465	112
1019	3300025256	Ga0209759_1001796	Ga0209759_100179612	112
1020	3300025256	Ga0209759_1002047	Ga0209759_10020473	112
1021	3300025256	Ga0209759_1021973	Ga0209759_10219732	112
1022	3300025256	Ga0209759_1031313	Ga0209759_10313133	112
1023	3300025258	Ga0209129_1000007	Ga0209129_1000007139	112
1024	3300025258	Ga0209129_1000369	Ga0209129_100036930	112
1025	3300025258	Ga0209129_1001205	Ga0209129_100120515	112
1026	3300025258	Ga0209129_1024238	Ga0209129_10242382	112
1027	3300025263	Ga0209565_1000153	Ga0209565_100015362	112
1028	3300025263	Ga0209565_1001390	Ga0209565_10013906	112
1029	3300025263	Ga0209565_1003425	Ga0209565_10034256	112
1030	3300025263	Ga0209565_1078898	Ga0209565_10788981	112
1031	3300025272	Ga0209455_1000643	Ga0209455_10006433	112
1032	3300025272	Ga0209455_1001880	Ga0209455_10018809	112
1033	3300025273	Ga0209673_1000423	Ga0209673_100042341	112
1034	3300025273	Ga0209673_1000566	Ga0209673_100056644	112
1035	3300025273	Ga0209673_1000801	Ga0209673_100080120	112
1036	3300025273	Ga0209673_1006937	Ga0209673_10069372	112
1037	3300025273	Ga0209673_1013020	Ga0209673_10130203	112
1038	3300025273	Ga0209673_1013271	Ga0209673_10132713	112
1039	3300025273	Ga0209673_1013645	Ga0209673_10136453	112
1040	3300025273	Ga0209673_1046556	Ga0209673_10465562	112
1041	3300025284	Ga0209130_1000953	Ga0209130_100095310	112
1042	3300025284	Ga0209130_1001018	Ga0209130_100101813	112
1043	3300025284	Ga0209130_1001734	Ga0209130_100173413	112
1044	3300025291	Ga0209675_1000150	Ga0209675_100015062	112
1045	3300025291	Ga0209675_1001481	Ga0209675_100148113	112
1046	3300025291	Ga0209675_1001635	Ga0209675_10016352	112
1047	3300025291	Ga0209675_1002237	Ga0209675_100223712	112
1048	3300025291	Ga0209675_1002884	Ga0209675_10028848	112
1049	3300025292	Ga0209676_1000004	Ga0209676_1000004889	112
1050	3300025292	Ga0209676_1000735	Ga0209676_100073531	112
1051	3300025292	Ga0209676_1001743	Ga0209676_100174316	112
1052	3300025292	Ga0209676_1002326	Ga0209676_100232614	112
1053	3300025292	Ga0209676_1004231	Ga0209676_10042316	112
1054	3300025292	Ga0209676_1007213	Ga0209676_10072137	112
1055	3300025292	Ga0209676_1030459	Ga0209676_10304592	112
1056	3300025294	Ga0209025_1000057	Ga0209025_1000057259	112
1057	3300025294	Ga0209025_1000217	Ga0209025_100021780	112
1058	3300025294	Ga0209025_1000278	Ga0209025_100027826	112
1059	3300025294	Ga0209025_1001179	Ga0209025_100117921	112
1060	3300025294	Ga0209025_1010012	Ga0209025_10100127	112
1061	3300025294	Ga0209025_1018495	Ga0209025_10184952	112
1062	3300025294	Ga0209025_1124121	Ga0209025_11241212	112
1063	3300025295	Ga0209564_1000003	Ga0209564_10000031257	112
1064	3300025295	Ga0209564_1000046	Ga0209564_1000046127	112
1065	3300025295	Ga0209564_1000915	Ga0209564_10009158	112
1066	3300025295	Ga0209564_1001044	Ga0209564_10010442	112
1067	3300025295	Ga0209564_1015210	Ga0209564_10152102	112
1068	3300025295	Ga0209564_1077190	Ga0209564_10771902	112
1069	3300025297	Ga0209758_1000025	Ga0209758_1000025387	112
1070	3300025297	Ga0209758_1000709	Ga0209758_100070927	112
1071	3300025297	Ga0209758_1002316	Ga0209758_100231616	112
1072	3300025297	Ga0209758_1020934	Ga0209758_10209342	112
1073	3300025298	Ga0209050_1000002	Ga0209050_10000021399	112
1074	3300025298	Ga0209050_1000861	Ga0209050_100086111	112
1075	3300025298	Ga0209050_1001823	Ga0209050_100182324	112
1076	3300025298	Ga0209050_1002866	Ga0209050_100286610	112
1077	3300025298	Ga0209050_1002874	Ga0209050_10028743	112
1078	3300025298	Ga0209050_1003318	Ga0209050_100331813	112
1079	3300025298	Ga0209050_1035133	Ga0209050_10351332	112
1080	3300025298	Ga0209050_1037278	Ga0209050_10372782	112
1081	3300025298	Ga0209050_1097324	Ga0209050_10973241	112
1082	3300025299	Ga0209256_1000067	Ga0209256_1000067206	112
1083	3300025299	Ga0209256_1000366	Ga0209256_100036626	112
1084	3300025299	Ga0209256_1005597	Ga0209256_10055972	112
1085	3300025299	Ga0209256_1008454	Ga0209256_10084544	112
1086	3300025299	Ga0209256_1041041	Ga0209256_10410412	112
1087	3300025299	Ga0209256_1042846	Ga0209256_10428462	112
1088	3300025299	Ga0209256_1094527	Ga0209256_10945272	112
1089	3300025302	Ga0207426_1000001	Ga0207426_1000001191	112
1090	3300025302	Ga0207426_1000028	Ga0207426_100002881	112
1091	3300025302	Ga0207426_1020977	Ga0207426_10209772	112
1092	3300025303	Ga0209051_1000002	Ga0209051_10000021169	112
1093	3300025303	Ga0209051_1000049	Ga0209051_1000049259	112
1094	3300025303	Ga0209051_1000096	Ga0209051_100009616	112
1095	3300025303	Ga0209051_1000532	Ga0209051_100053218	112
1096	3300025303	Ga0209051_1000913	Ga0209051_100091311	112
1097	3300025303	Ga0209051_1004959	Ga0209051_10049595	112
1098	3300025303	Ga0209051_1007617	Ga0209051_10076172	112
1099	3300025303	Ga0209051_1010944	Ga0209051_10109444	112
1100	3300025303	Ga0209051_1013466	Ga0209051_10134662	112
1101	3300025303	Ga0209051_1035263	Ga0209051_10352632	112
1102	3300025303	Ga0209051_1107638	Ga0209051_11076382	112
1103	3300025304	Ga0209257_1000002	Ga0209257_10000021310	112
1104	3300025304	Ga0209257_1000072	Ga0209257_1000072312	112
1105	3300025304	Ga0209257_1005501	Ga0209257_10055015	112
1106	3300025304	Ga0209257_1005948	Ga0209257_10059485	112
1107	3300025304	Ga0209257_1012640	Ga0209257_10126406	112
1108	3300025304	Ga0209257_1013234	Ga0209257_10132342	112
1109	3300025304	Ga0209257_1021343	Ga0209257_10213432	112
1110	3300025315	Ga0207697_10054088	Ga0207697_100540883	112
1111	3300025315	Ga0207697_10101513	Ga0207697_101015132	112
1112	3300025315	Ga0207697_10455412	Ga0207697_104554121	112
1113	3300025321	Ga0207656_10012183	Ga0207656_100121834	112
1114	3300025321	Ga0207656_10029824	Ga0207656_100298244	112
1115	3300025321	Ga0207656_10071677	Ga0207656_100716772	112
1116	3300025321	Ga0207656_10111356	Ga0207656_101113561	112
1117	3300025321	Ga0207656_10111360	Ga0207656_101113602	112
1118	3300025728	Ga0207655_1003340	Ga0207655_100334013	112
1119	3300025728	Ga0207655_1118431	Ga0207655_11184311	112
1120	3300025728	Ga0207655_1236898	Ga0207655_12368981	112
1121	3300025735	Ga0207713_1043333	Ga0207713_10433332	112
1122	3300025893	Ga0207682_10006629	Ga0207682_100066295	112
1123	3300025893	Ga0207682_10022477	Ga0207682_100224772	112
1124	3300025893	Ga0207682_10067253	Ga0207682_100672533	112
1125	3300025893	Ga0207682_10071200	Ga0207682_100712003	112
1126	3300025893	Ga0207682_10532095	Ga0207682_105320951	112
1127	3300025899	Ga0207642_10037663	Ga0207642_100376632	112
1128	3300025899	Ga0207642_10743245	Ga0207642_107432452	112
1129	3300025901	Ga0207688_10036837	Ga0207688_100368372	112
1130	3300025901	Ga0207688_10167683	Ga0207688_101676831	112
1131	3300025901	Ga0207688_10248005	Ga0207688_102480052	112
1132	3300025903	Ga0207680_10216266	Ga0207680_102162662	112
1133	3300025904	Ga0207647_10046340	Ga0207647_100463403	112
1134	3300025904	Ga0207647_10052312	Ga0207647_100523122	112
1135	3300025905	Ga0207685_10596594	Ga0207685_105965942	112
1136	3300025907	Ga0207645_10003439	Ga0207645_100034397	112
1137	3300025907	Ga0207645_10015692	Ga0207645_100156923	112
1138	3300025907	Ga0207645_10030847	Ga0207645_100308473	112
1139	3300025907	Ga0207645_10066499	Ga0207645_100664994	112
1140	3300025907	Ga0207645_10205138	Ga0207645_102051382	112
1141	3300025907	Ga0207645_11133322	Ga0207645_111333222	112
1142	3300025908	Ga0207643_10244189	Ga0207643_102441892	112
1143	3300025909	Ga0207705_10026548	Ga0207705_100265483	112
1144	3300025909	Ga0207705_10102916	Ga0207705_101029162	112
1145	3300025909	Ga0207705_10165193	Ga0207705_101651933	112
1146	3300025909	Ga0207705_10236422	Ga0207705_102364222	112
1147	3300025909	Ga0207705_10347626	Ga0207705_103476262	112
1148	3300025909	Ga0207705_10378081	Ga0207705_103780812	112
1149	3300025909	Ga0207705_11014738	Ga0207705_110147382	112
1150	3300025909	Ga0207705_11017966	Ga0207705_110179662	112
1151	3300025910	Ga0207684_10002530	Ga0207684_100025306	112
1152	3300025910	Ga0207684_10136233	Ga0207684_101362332	112
1153	3300025911	Ga0207654_10197100	Ga0207654_101971003	112
1154	3300025911	Ga0207654_10639853	Ga0207654_106398532	112
1155	3300025912	Ga0207707_10024701	Ga0207707_100247016	112
1156	3300025912	Ga0207707_11140491	Ga0207707_111404911	112
1157	3300025912	Ga0207707_11289473	Ga0207707_112894731	112
1158	3300025913	Ga0207695_10030367	Ga0207695_100303676	112
1159	3300025913	Ga0207695_10177375	Ga0207695_101773752	112
1160	3300025913	Ga0207695_10204007	Ga0207695_102040072	112
1161	3300025913	Ga0207695_10267148	Ga0207695_102671482	112
1162	3300025913	Ga0207695_10430581	Ga0207695_104305812	112
1163	3300025914	Ga0207671_10010913	Ga0207671_100109133	112
1164	3300025914	Ga0207671_10134750	Ga0207671_101347502	112
1165	3300025914	Ga0207671_10143413	Ga0207671_101434132	112
1166	3300025914	Ga0207671_10356571	Ga0207671_103565712	112
1167	3300025914	Ga0207671_10883563	Ga0207671_108835632	112
1168	3300025916	Ga0207663_10737599	Ga0207663_107375991	112
1169	3300025917	Ga0207660_10491418	Ga0207660_104914182	112
1170	3300025918	Ga0207662_10594733	Ga0207662_105947333	112
1171	3300025919	Ga0207657_10000539	Ga0207657_100005393	112
1172	3300025919	Ga0207657_10016351	Ga0207657_100163516	112
1173	3300025919	Ga0207657_10063967	Ga0207657_100639674	112
1174	3300025919	Ga0207657_10095194	Ga0207657_100951943	112
1175	3300025919	Ga0207657_10154007	Ga0207657_101540072	112
1176	3300025919	Ga0207657_10160330	Ga0207657_101603303	112
1177	3300025919	Ga0207657_10342010	Ga0207657_103420102	112
1178	3300025919	Ga0207657_10951572	Ga0207657_109515722	112
1179	3300025920	Ga0207649_10027765	Ga0207649_100277652	112
1180	3300025920	Ga0207649_10065254	Ga0207649_100652542	112
1181	3300025920	Ga0207649_10859077	Ga0207649_108590772	112
1182	3300025921	Ga0207652_10164160	Ga0207652_101641602	112
1183	3300025921	Ga0207652_10273281	Ga0207652_102732813	112
1184	3300025921	Ga0207652_11186502	Ga0207652_111865021	112
1185	3300025922	Ga0207646_10149795	Ga0207646_101497953	112
1186	3300025923	Ga0207681_10010347	Ga0207681_100103477	112
1187	3300025923	Ga0207681_10015245	Ga0207681_100152452	112
1188	3300025923	Ga0207681_10065307	Ga0207681_100653072	112
1189	3300025923	Ga0207681_10136055	Ga0207681_101360552	112
1190	3300025923	Ga0207681_11262814	Ga0207681_112628142	112
1191	3300025924	Ga0207694_10065085	Ga0207694_100650853	112
1192	3300025924	Ga0207694_10110900	Ga0207694_101109002	112
1193	3300025924	Ga0207694_10147805	Ga0207694_101478052	112
1194	3300025924	Ga0207694_10323332	Ga0207694_103233322	112
1195	3300025924	Ga0207694_10663995	Ga0207694_106639952	112
1196	3300025924	Ga0207694_11171087	Ga0207694_111710872	112
1197	3300025925	Ga0207650_10001071	Ga0207650_1000107121	112
1198	3300025925	Ga0207650_10033566	Ga0207650_100335663	112
1199	3300025925	Ga0207650_10208534	Ga0207650_102085342	112
1200	3300025925	Ga0207650_10233262	Ga0207650_102332622	112
1201	3300025925	Ga0207650_10457365	Ga0207650_104573652	112
1202	3300025925	Ga0207650_10596088	Ga0207650_105960882	112
1203	3300025925	Ga0207650_10628582	Ga0207650_106285821	112
1204	3300025925	Ga0207650_10865198	Ga0207650_108651981	112
1205	3300025926	Ga0207659_10002589	Ga0207659_100025898	112
1206	3300025926	Ga0207659_10010915	Ga0207659_100109152	112
1207	3300025926	Ga0207659_10013311	Ga0207659_100133115	112
1208	3300025926	Ga0207659_10127689	Ga0207659_101276892	112
1209	3300025926	Ga0207659_10371230	Ga0207659_103712302	112
1210	3300025926	Ga0207659_10538064	Ga0207659_105380642	112
1211	3300025926	Ga0207659_10721579	Ga0207659_107215792	112
1212	3300025927	Ga0207687_10055314	Ga0207687_100553142	112
1213	3300025927	Ga0207687_10066030	Ga0207687_100660302	112
1214	3300025927	Ga0207687_10225398	Ga0207687_102253982	112
1215	3300025927	Ga0207687_10291600	Ga0207687_102916002	112
1216	3300025927	Ga0207687_11043346	Ga0207687_110433462	112
1217	3300025929	Ga0207664_10020035	Ga0207664_100200354	112
1218	3300025931	Ga0207644_10002293	Ga0207644_100022935	112
1219	3300025931	Ga0207644_10005830	Ga0207644_100058305	112
1220	3300025931	Ga0207644_10008258	Ga0207644_100082586	112
1221	3300025931	Ga0207644_10033013	Ga0207644_100330132	112
1222	3300025931	Ga0207644_10066865	Ga0207644_100668652	112
1223	3300025931	Ga0207644_10181125	Ga0207644_101811253	112
1224	3300025931	Ga0207644_10451985	Ga0207644_104519852	112
1225	3300025931	Ga0207644_10582408	Ga0207644_105824082	112
1226	3300025931	Ga0207644_10919969	Ga0207644_109199692	112
1227	3300025931	Ga0207644_10967293	Ga0207644_109672932	112
1228	3300025932	Ga0207690_10009822	Ga0207690_100098224	112
1229	3300025932	Ga0207690_10047094	Ga0207690_100470942	112
1230	3300025932	Ga0207690_10051966	Ga0207690_100519665	112
1231	3300025932	Ga0207690_10075669	Ga0207690_100756692	112
1232	3300025932	Ga0207690_10161082	Ga0207690_101610822	112
1233	3300025932	Ga0207690_10195198	Ga0207690_101951982	112
1234	3300025932	Ga0207690_10387241	Ga0207690_103872412	112
1235	3300025932	Ga0207690_10397108	Ga0207690_103971082	112
1236	3300025933	Ga0207706_10001856	Ga0207706_100018567	112
1237	3300025933	Ga0207706_10005010	Ga0207706_100050102	112
1238	3300025933	Ga0207706_10023334	Ga0207706_100233346	112
1239	3300025933	Ga0207706_10050415	Ga0207706_100504152	112
1240	3300025933	Ga0207706_10127657	Ga0207706_101276571	112
1241	3300025933	Ga0207706_10278780	Ga0207706_102787803	112
1242	3300025933	Ga0207706_10396119	Ga0207706_103961192	112
1243	3300025933	Ga0207706_10666473	Ga0207706_106664732	112
1244	3300025933	Ga0207706_11275413	Ga0207706_112754132	112
1245	3300025934	Ga0207686_10562429	Ga0207686_105624292	112
1246	3300025934	Ga0207686_10687661	Ga0207686_106876612	112
1247	3300025935	Ga0207709_10000348	Ga0207709_1000034834	112
1248	3300025935	Ga0207709_10000556	Ga0207709_100005564	112
1249	3300025935	Ga0207709_10006258	Ga0207709_100062586	112
1250	3300025935	Ga0207709_10007492	Ga0207709_100074924	112
1251	3300025935	Ga0207709_10193284	Ga0207709_101932842	112
1252	3300025935	Ga0207709_10803082	Ga0207709_108030821	112
1253	3300025936	Ga0207670_10036922	Ga0207670_100369222	112
1254	3300025937	Ga0207669_10002735	Ga0207669_100027357	112
1255	3300025937	Ga0207669_10163716	Ga0207669_101637162	112
1256	3300025937	Ga0207669_10198881	Ga0207669_101988812	112
1257	3300025937	Ga0207669_10549955	Ga0207669_105499552	112
1258	3300025938	Ga0207704_10061644	Ga0207704_100616442	112
1259	3300025938	Ga0207704_10351102	Ga0207704_103511021	112
1260	3300025938	Ga0207704_10439315	Ga0207704_104393152	112
1261	3300025940	Ga0207691_10004533	Ga0207691_100045333	112
1262	3300025940	Ga0207691_10005312	Ga0207691_1000531210	112
1263	3300025940	Ga0207691_10007653	Ga0207691_100076533	112
1264	3300025940	Ga0207691_10057377	Ga0207691_100573772	112
1265	3300025940	Ga0207691_10174786	Ga0207691_101747862	112
1266	3300025940	Ga0207691_10327127	Ga0207691_103271272	112
1267	3300025940	Ga0207691_10618110	Ga0207691_106181101	112
1268	3300025940	Ga0207691_10733465	Ga0207691_107334652	112
1269	3300025940	Ga0207691_11369505	Ga0207691_113695052	112
1270	3300025941	Ga0207711_10007461	Ga0207711_100074619	112
1271	3300025941	Ga0207711_10013057	Ga0207711_100130578	112
1272	3300025941	Ga0207711_10015303	Ga0207711_100153033	112
1273	3300025941	Ga0207711_10078718	Ga0207711_100787182	112
1274	3300025941	Ga0207711_10245986	Ga0207711_102459862	112
1275	3300025941	Ga0207711_10375692	Ga0207711_103756923	112
1276	3300025941	Ga0207711_11205800	Ga0207711_112058002	112
1277	3300025941	Ga0207711_11233896	Ga0207711_112338962	112
1278	3300025941	Ga0207711_11868024	Ga0207711_118680242	112
1279	3300025942	Ga0207689_10004291	Ga0207689_100042916	112
1280	3300025942	Ga0207689_10018167	Ga0207689_100181677	112
1281	3300025942	Ga0207689_10022168	Ga0207689_100221686	112
1282	3300025942	Ga0207689_10051486	Ga0207689_100514862	112
1283	3300025942	Ga0207689_10282689	Ga0207689_102826892	112
1284	3300025942	Ga0207689_10371595	Ga0207689_103715952	112
1285	3300025942	Ga0207689_10460278	Ga0207689_104602782	112
1286	3300025942	Ga0207689_11056852	Ga0207689_110568522	112
1287	3300025944	Ga0207661_10069956	Ga0207661_100699563	112
1288	3300025944	Ga0207661_10152654	Ga0207661_101526542	112
1289	3300025945	Ga0207679_10037286	Ga0207679_100372862	112
1290	3300025945	Ga0207679_10046527	Ga0207679_100465271	112
1291	3300025945	Ga0207679_10151674	Ga0207679_101516742	112
1292	3300025945	Ga0207679_10185328	Ga0207679_101853281	112
1293	3300025945	Ga0207679_10322897	Ga0207679_103228972	112
1294	3300025945	Ga0207679_10483534	Ga0207679_104835342	112
1295	3300025945	Ga0207679_10684044	Ga0207679_106840442	112
1296	3300025949	Ga0207667_10016870	Ga0207667_100168707	112
1297	3300025949	Ga0207667_10053981	Ga0207667_100539814	112
1298	3300025949	Ga0207667_10080136	Ga0207667_100801363	112
1299	3300025949	Ga0207667_10108428	Ga0207667_101084285	112
1300	3300025949	Ga0207667_10116858	Ga0207667_101168583	112
1301	3300025949	Ga0207667_10271910	Ga0207667_102719103	112
1302	3300025949	Ga0207667_10836318	Ga0207667_108363182	112
1303	3300025949	Ga0207667_11999714	Ga0207667_119997141	112
1304	3300025960	Ga0207651_10003468	Ga0207651_100034685	112
1305	3300025960	Ga0207651_10032840	Ga0207651_100328404	112
1306	3300025960	Ga0207651_10041449	Ga0207651_100414494	112
1307	3300025960	Ga0207651_10074451	Ga0207651_100744512	112
1308	3300025960	Ga0207651_10078352	Ga0207651_100783522	112
1309	3300025960	Ga0207651_10278866	Ga0207651_102788662	112
1310	3300025960	Ga0207651_10336242	Ga0207651_103362422	112
1311	3300025960	Ga0207651_10380602	Ga0207651_103806021	112
1312	3300025960	Ga0207651_10989381	Ga0207651_109893812	112
1313	3300025960	Ga0207651_11035467	Ga0207651_110354672	112
1314	3300025960	Ga0207651_11180812	Ga0207651_111808122	112
1315	3300025961	Ga0207712_10016113	Ga0207712_100161132	112
1316	3300025961	Ga0207712_10162453	Ga0207712_101624533	112
1317	3300025961	Ga0207712_10485853	Ga0207712_104858532	112
1318	3300025961	Ga0207712_11132805	Ga0207712_111328052	112
1319	3300025972	Ga0207668_10160980	Ga0207668_101609802	112
1320	3300025972	Ga0207668_10185382	Ga0207668_101853822	112
1321	3300025972	Ga0207668_10284338	Ga0207668_102843383	112
1322	3300025972	Ga0207668_10564733	Ga0207668_105647332	112
1323	3300025972	Ga0207668_11103147	Ga0207668_111031471	112
1324	3300025972	Ga0207668_11177387	Ga0207668_111773872	112
1325	3300025972	Ga0207668_11208167	Ga0207668_112081671	112
1326	3300025981	Ga0207640_10001781	Ga0207640_100017817	112
1327	3300025981	Ga0207640_10114521	Ga0207640_101145214	112
1328	3300025981	Ga0207640_10276907	Ga0207640_102769072	112
1329	3300025981	Ga0207640_10502366	Ga0207640_105023662	112
1330	3300025981	Ga0207640_11005044	Ga0207640_110050442	112
1331	3300025981	Ga0207640_11475505	Ga0207640_114755051	112
1332	3300025986	Ga0207658_10005312	Ga0207658_100053128	112
1333	3300025986	Ga0207658_10035630	Ga0207658_100356305	112
1334	3300025986	Ga0207658_10069435	Ga0207658_100694352	112
1335	3300025986	Ga0207658_10117580	Ga0207658_101175803	112
1336	3300025986	Ga0207658_10134850	Ga0207658_101348502	112
1337	3300025986	Ga0207658_10268119	Ga0207658_102681193	112
1338	3300025986	Ga0207658_10278531	Ga0207658_102785312	112
1339	3300025986	Ga0207658_11076938	Ga0207658_110769382	112
1340	3300026023	Ga0207677_10000972	Ga0207677_1000097212	112
1341	3300026023	Ga0207677_10001461	Ga0207677_100014613	112
1342	3300026023	Ga0207677_10006577	Ga0207677_100065772	112
1343	3300026023	Ga0207677_10568710	Ga0207677_105687102	112
1344	3300026023	Ga0207677_10695636	Ga0207677_106956362	112
1345	3300026023	Ga0207677_11868105	Ga0207677_118681051	112
1346	3300026035	Ga0207703_10012389	Ga0207703_100123897	112
1347	3300026035	Ga0207703_10082733	Ga0207703_100827332	112
1348	3300026035	Ga0207703_10621142	Ga0207703_106211422	112
1349	3300026035	Ga0207703_10831053	Ga0207703_108310531	112
1350	3300026035	Ga0207703_11080904	Ga0207703_110809042	112
1351	3300026041	Ga0207639_10004119	Ga0207639_100041193	112
1352	3300026041	Ga0207639_10032894	Ga0207639_100328944	112
1353	3300026041	Ga0207639_10067958	Ga0207639_100679583	112
1354	3300026041	Ga0207639_10215624	Ga0207639_102156242	112
1355	3300026041	Ga0207639_10898220	Ga0207639_108982202	112
1356	3300026041	Ga0207639_10988179	Ga0207639_109881792	112
1357	3300026067	Ga0207678_10018317	Ga0207678_100183173	112
1358	3300026067	Ga0207678_10073350	Ga0207678_100733503	112
1359	3300026067	Ga0207678_10649783	Ga0207678_106497832	112
1360	3300026067	Ga0207678_10864781	Ga0207678_108647812	112
1361	3300026067	Ga0207678_11010811	Ga0207678_110108112	112
1362	3300026067	Ga0207678_11168927	Ga0207678_111689271	112
1363	3300026067	Ga0207678_11196387	Ga0207678_111963871	112
1364	3300026067	Ga0207678_11362173	Ga0207678_113621732	112
1365	3300026067	Ga0207678_11499097	Ga0207678_114990971	112
1366	3300026075	Ga0207708_10222353	Ga0207708_102223533	112
1367	3300026078	Ga0207702_10000698	Ga0207702_1000069836	112
1368	3300026078	Ga0207702_10000732	Ga0207702_1000073230	112
1369	3300026078	Ga0207702_10001319	Ga0207702_100013192	112
1370	3300026078	Ga0207702_10184699	Ga0207702_101846992	112
1371	3300026078	Ga0207702_10277540	Ga0207702_102775402	112
1372	3300026078	Ga0207702_10553839	Ga0207702_105538392	112
1373	3300026078	Ga0207702_10797152	Ga0207702_107971522	112
1374	3300026078	Ga0207702_11018288	Ga0207702_110182882	112
1375	3300026088	Ga0207641_10003025	Ga0207641_100030258	112
1376	3300026088	Ga0207641_10082621	Ga0207641_100826212	112
1377	3300026088	Ga0207641_10096599	Ga0207641_100965992	112
1378	3300026088	Ga0207641_10354578	Ga0207641_103545782	112
1379	3300026089	Ga0207648_10000146	Ga0207648_1000014619	112
1380	3300026089	Ga0207648_10001822	Ga0207648_1000182218	112
1381	3300026089	Ga0207648_10003244	Ga0207648_100032443	112
1382	3300026089	Ga0207648_10011303	Ga0207648_100113034	112
1383	3300026089	Ga0207648_10013115	Ga0207648_100131154	112
1384	3300026089	Ga0207648_10193560	Ga0207648_101935602	112
1385	3300026089	Ga0207648_10265695	Ga0207648_102656951	112
1386	3300026089	Ga0207648_10280515	Ga0207648_102805152	112
1387	3300026089	Ga0207648_10309354	Ga0207648_103093542	112
1388	3300026089	Ga0207648_10316866	Ga0207648_103168662	112
1389	3300026089	Ga0207648_10627607	Ga0207648_106276072	112
1390	3300026089	Ga0207648_11413271	Ga0207648_114132712	112
1391	3300026095	Ga0207676_10001000	Ga0207676_1000100022	112
1392	3300026095	Ga0207676_10007652	Ga0207676_100076521	112
1393	3300026095	Ga0207676_10014293	Ga0207676_100142936	112
1394	3300026095	Ga0207676_10214855	Ga0207676_102148553	112
1395	3300026095	Ga0207676_10307788	Ga0207676_103077882	112
1396	3300026095	Ga0207676_10592142	Ga0207676_105921422	112
1397	3300026095	Ga0207676_11598846	Ga0207676_115988462	112
1398	3300026095	Ga0207676_11608865	Ga0207676_116088652	112
1399	3300026116	Ga0207674_10005362	Ga0207674_100053624	112
1400	3300026116	Ga0207674_10012070	Ga0207674_100120702	112
1401	3300026116	Ga0207674_10020685	Ga0207674_100206855	112
1402	3300026116	Ga0207674_10083208	Ga0207674_100832082	112
1403	3300026116	Ga0207674_10126264	Ga0207674_101262643	112
1404	3300026116	Ga0207674_10203057	Ga0207674_102030573	112
1405	3300026116	Ga0207674_10323642	Ga0207674_103236422	112
1406	3300026116	Ga0207674_10340698	Ga0207674_103406981	112
1407	3300026116	Ga0207674_10637731	Ga0207674_106377312	112
1408	3300026116	Ga0207674_10929873	Ga0207674_109298732	112
1409	3300026116	Ga0207674_10956645	Ga0207674_109566452	112
1410	3300026116	Ga0207674_11239762	Ga0207674_112397622	112
1411	3300026116	Ga0207674_11559830	Ga0207674_115598301	112
1412	3300026118	Ga0207675_100000857	Ga0207675_10000085714	112
1413	3300026118	Ga0207675_100007272	Ga0207675_1000072722	112
1414	3300026118	Ga0207675_100048118	Ga0207675_1000481183	112
1415	3300026118	Ga0207675_101542020	Ga0207675_1015420202	112
1416	3300026118	Ga0207675_101706059	Ga0207675_1017060592	112
1417	3300026118	Ga0207675_102439470	Ga0207675_1024394701	112
1418	3300026121	Ga0207683_10003588	Ga0207683_100035887	112
1419	3300026121	Ga0207683_10025072	Ga0207683_100250724	112
1420	3300026121	Ga0207683_10100629	Ga0207683_101006292	112
1421	3300026121	Ga0207683_10237104	Ga0207683_102371042	112
1422	3300026121	Ga0207683_10296833	Ga0207683_102968333	112
1423	3300026121	Ga0207683_10389095	Ga0207683_103890952	112
1424	3300026121	Ga0207683_11136446	Ga0207683_111364461	112
1425	3300026121	Ga0207683_11149581	Ga0207683_111495812	112
1426	3300026142	Ga0207698_10048848	Ga0207698_100488483	112
1427	3300026142	Ga0207698_10059821	Ga0207698_100598212	112
1428	3300026142	Ga0207698_10109749	Ga0207698_101097491	112
1429	3300026142	Ga0207698_10112411	Ga0207698_101124112	112
1430	3300026142	Ga0207698_10113315	Ga0207698_101133152	112
1431	3300026142	Ga0207698_10130132	Ga0207698_101301322	112
1432	3300026142	Ga0207698_10140855	Ga0207698_101408552	112
1433	3300026142	Ga0207698_10319705	Ga0207698_103197052	112
1434	3300026142	Ga0207698_10388622	Ga0207698_103886222	112
1435	3300026142	Ga0207698_10457285	Ga0207698_104572852	112
1436	3300026142	Ga0207698_10651216	Ga0207698_106512162	112
1437	3300026142	Ga0207698_10777828	Ga0207698_107778282	112
1438	3300026142	Ga0207698_10994646	Ga0207698_109946462	112
1439	3300026142	Ga0207698_11196478	Ga0207698_111964782	112
1440	3300026142	Ga0207698_11490572	Ga0207698_114905722	112
1441	3300026142	Ga0207698_12714087	Ga0207698_127140871	112
1442	3300027296	Ga0209389_1067513	Ga0209389_10675132	112
1443	3300027312	Ga0209371_1009244	Ga0209371_10092443	112
1444	3300027378	Ga0209981_1009284	Ga0209981_10092842	112
1445	3300027378	Ga0209981_1046705	Ga0209981_10467052	112
1446	3300027395	Ga0209996_1001204	Ga0209996_10012043	112
1447	3300027471	Ga0209995_1003268	Ga0209995_10032682	112
1448	3300027526	Ga0209968_1000123	Ga0209968_10001234	112
1449	3300027543	Ga0209999_1009109	Ga0209999_10091092	112
1450	3300027666	Ga0209282_1002929	Ga0209282_10029292	112
1451	3300027695	Ga0209966_1000001	Ga0209966_100000122	112
1452	3300027717	Ga0209998_10020024	Ga0209998_100200242	112
1453	3300027717	Ga0209998_10043006	Ga0209998_100430061	112
1454	3300027866	Ga0209813_10018067	Ga0209813_100180672	112
1455	3300027866	Ga0209813_10045904	Ga0209813_100459043	112
1456	3300027866	Ga0209813_10144705	Ga0209813_101447052	112
1457	3300027866	Ga0209813_10227928	Ga0209813_102279282	112
1458	3300027866	Ga0209813_10335095	Ga0209813_103350951	112
1459	3300027866	Ga0209813_10356493	Ga0209813_103564932	112
1460	3300027876	Ga0209974_10001570	Ga0209974_100015709	112
1461	3300027876	Ga0209974_10039516	Ga0209974_100395162	112
1462	3300027876	Ga0209974_10133454	Ga0209974_101334542	112
1463	3300027907	Ga0207428_10775357	Ga0207428_107753572	112
1464	3300028379	Ga0268266_10081508	Ga0268266_100815083	112
1465	3300028379	Ga0268266_10327068	Ga0268266_103270682	112
1466	3300028379	Ga0268266_10466277	Ga0268266_104662772	112
1467	3300028379	Ga0268266_10562082	Ga0268266_105620822	112
1468	3300028379	Ga0268266_11245677	Ga0268266_112456772	112
1469	3300028380	Ga0268265_10008049	Ga0268265_100080495	112
1470	3300028380	Ga0268265_10094734	Ga0268265_100947342	112
1471	3300028380	Ga0268265_10395518	Ga0268265_103955182	112
1472	3300028381	Ga0268264_10009130	Ga0268264_100091309	112
1473	3300028381	Ga0268264_10073483	Ga0268264_100734832	112
1474	3300028381	Ga0268264_10245697	Ga0268264_102456972	112
1475	3300028381	Ga0268264_10264306	Ga0268264_102643063	112
1476	3300028381	Ga0268264_10549097	Ga0268264_105490972	112
1477	3300028381	Ga0268264_10757437	Ga0268264_107574372	112
1478	3300028573	Ga0265334_10122037	Ga0265334_101220372	112
1479	3300028653	Ga0265323_10040942	Ga0265323_100409422	112
1480	3300028786	Ga0307517_10000805	Ga0307517_100008058	112
1481	3300028786	Ga0307517_10077388	Ga0307517_100773883	112
1482	3300028786	Ga0307517_10183915	Ga0307517_101839151	112
1483	3300028786	Ga0307517_10195603	Ga0307517_101956032	112
1484	3300028786	Ga0307517_10346790	Ga0307517_103467902	112
1485	3300028786	Ga0307517_10407601	Ga0307517_104076012	112
1486	3300028794	Ga0307515_10000020	Ga0307515_10000020337	112
1487	3300028794	Ga0307515_10000053	Ga0307515_10000053137	112
1488	3300028794	Ga0307515_10001032	Ga0307515_1000103242	112
1489	3300028794	Ga0307515_10002612	Ga0307515_100026121	112
1490	3300028794	Ga0307515_10005265	Ga0307515_100052653	112
1491	3300028794	Ga0307515_10014672	Ga0307515_1001467215	112
1492	3300028794	Ga0307515_10037926	Ga0307515_100379265	112
1493	3300028794	Ga0307515_10045683	Ga0307515_100456833	112
1494	3300028794	Ga0307515_10048358	Ga0307515_100483587	112
1495	3300028794	Ga0307515_10084485	Ga0307515_100844854	112
1496	3300028794	Ga0307515_10112003	Ga0307515_101120032	112
1497	3300028794	Ga0307515_10413000	Ga0307515_104130002	112
1498	3300028794	Ga0307515_10588117	Ga0307515_105881171	112
1499	3300029957	Ga0265324_10227390	Ga0265324_102273901	112
1500	3300030500	Ga0268256_1016030	Ga0268256_10160302	112
1501	3300030500	Ga0268256_1021508	Ga0268256_10215081	112
1502	3300030522	Ga0307512_10035617	Ga0307512_100356174	112
1503	3300030522	Ga0307512_10044313	Ga0307512_100443132	112
1504	3300030522	Ga0307512_10233285	Ga0307512_102332851	112
1505	3300030731	Ga0316177_1178071	Ga0316177_11780712	112
1506	3300030732	Ga0316176_1020296	Ga0316176_10202962	112
1507	3300030733	Ga0314311_1266168	Ga0314311_12661682	112
1508	3300030734	Ga0316179_1063983	Ga0316179_10639832	112
1509	3300030735	Ga0316178_1148277	Ga0316178_11482772	112
1510	3300030742	Ga0316183_1017320	Ga0316183_10173205	112
1511	3300030744	Ga0316181_1020992	Ga0316181_10209922	112
1512	3300030745	Ga0316182_1299692	Ga0316182_12996922	112
1513	3300031251	Ga0265327_10000158	Ga0265327_1000015879	112
1514	3300031251	Ga0265327_10000640	Ga0265327_1000064053	112
1515	3300031251	Ga0265327_10023188	Ga0265327_100231885	112
1516	3300031251	Ga0265327_10316668	Ga0265327_103166682	112
1517	3300031344	Ga0265316_10236963	Ga0265316_102369631	112
1518	3300031344	Ga0265316_11282330	Ga0265316_112823301	112
1519	3300031456	Ga0307513_10014068	Ga0307513_100140687	112
1520	3300031456	Ga0307513_10119699	Ga0307513_101196991	112
1521	3300031456	Ga0307513_10135699	Ga0307513_101356992	112
1522	3300031456	Ga0307513_10158438	Ga0307513_101584382	112
1523	3300031456	Ga0307513_10242399	Ga0307513_102423992	112
1524	3300031456	Ga0307513_10323194	Ga0307513_103231942	112
1525	3300031456	Ga0307513_10476072	Ga0307513_104760722	112
1526	3300031456	Ga0307513_10693839	Ga0307513_106938392	112
1527	3300031507	Ga0307509_10001946	Ga0307509_1000194629	112
1528	3300031507	Ga0307509_10002654	Ga0307509_1000265428	112
1529	3300031507	Ga0307509_10008897	Ga0307509_1000889715	112
1530	3300031507	Ga0307509_10140975	Ga0307509_101409752	112
1531	3300031507	Ga0307509_10143796	Ga0307509_101437962	112
1532	3300031507	Ga0307509_10202426	Ga0307509_102024264	112
1533	3300031507	Ga0307509_10291208	Ga0307509_102912081	112
1534	3300031507	Ga0307509_11005609	Ga0307509_110056092	112
1535	3300031548	Ga0307408_100008062	Ga0307408_1000080628	112
1536	3300031548	Ga0307408_100008200	Ga0307408_1000082007	112
1537	3300031548	Ga0307408_100047567	Ga0307408_1000475671	112
1538	3300031548	Ga0307408_100065038	Ga0307408_1000650385	112
1539	3300031548	Ga0307408_100076502	Ga0307408_1000765023	112
1540	3300031548	Ga0307408_100154143	Ga0307408_1001541432	112
1541	3300031548	Ga0307408_100214499	Ga0307408_1002144992	112
1542	3300031548	Ga0307408_100317795	Ga0307408_1003177952	112
1543	3300031548	Ga0307408_100610836	Ga0307408_1006108361	112
1544	3300031548	Ga0307408_100968574	Ga0307408_1009685742	112
1545	3300031548	Ga0307408_102219087	Ga0307408_1022190871	112
1546	3300031616	Ga0307508_10000004	Ga0307508_10000004104	112
1547	3300031616	Ga0307508_10000078	Ga0307508_1000007826	112
1548	3300031616	Ga0307508_10002611	Ga0307508_100026117	112
1549	3300031616	Ga0307508_10058330	Ga0307508_100583305	112
1550	3300031616	Ga0307508_10097952	Ga0307508_100979522	112
1551	3300031616	Ga0307508_10387871	Ga0307508_103878712	112
1552	3300031616	Ga0307508_10536118	Ga0307508_105361182	112
1553	3300031649	Ga0307514_10003397	Ga0307514_100033975	112
1554	3300031649	Ga0307514_10122350	Ga0307514_101223502	112
1555	3300031649	Ga0307514_10132041	Ga0307514_101320412	112
1556	3300031691	Ga0316579_10367458	Ga0316579_103674582	112
1557	3300031730	Ga0307516_10000497	Ga0307516_1000049751	112
1558	3300031730	Ga0307516_10001023	Ga0307516_1000102316	112
1559	3300031730	Ga0307516_10017381	Ga0307516_100173817	112
1560	3300031730	Ga0307516_10022278	Ga0307516_100222785	112
1561	3300031730	Ga0307516_10022921	Ga0307516_100229215	112
1562	3300031730	Ga0307516_10046323	Ga0307516_100463235	112
1563	3300031730	Ga0307516_10156564	Ga0307516_101565642	112
1564	3300031730	Ga0307516_10209567	Ga0307516_102095672	112
1565	3300031730	Ga0307516_10402920	Ga0307516_104029202	112
1566	3300031730	Ga0307516_10859608	Ga0307516_108596082	112
1567	3300031730	Ga0307516_11014043	Ga0307516_110140432	112
1568	3300031731	Ga0307405_10002891	Ga0307405_100028914	112
1569	3300031731	Ga0307405_10033496	Ga0307405_100334962	112
1570	3300031731	Ga0307405_10058525	Ga0307405_100585252	112
1571	3300031731	Ga0307405_10072893	Ga0307405_100728932	112
1572	3300031731	Ga0307405_10091624	Ga0307405_100916242	112
1573	3300031731	Ga0307405_10145859	Ga0307405_101458592	112
1574	3300031731	Ga0307405_12061651	Ga0307405_120616512	112
1575	3300031733	Ga0316577_10076331	Ga0316577_100763312	112
1576	3300031824	Ga0307413_10018011	Ga0307413_100180113	112
1577	3300031824	Ga0307413_10036799	Ga0307413_100367993	112
1578	3300031824	Ga0307413_10221794	Ga0307413_102217942	112
1579	3300031824	Ga0307413_11200767	Ga0307413_112007672	112
1580	3300031824	Ga0307413_11585218	Ga0307413_115852182	112
1581	3300031852	Ga0307410_10082470	Ga0307410_100824702	112
1582	3300031852	Ga0307410_10124374	Ga0307410_101243742	112
1583	3300031852	Ga0307410_10499673	Ga0307410_104996732	112
1584	3300031852	Ga0307410_10565987	Ga0307410_105659872	112
1585	3300031852	Ga0307410_12130887	Ga0307410_121308872	112
1586	3300031901	Ga0307406_10007967	Ga0307406_100079674	112
1587	3300031901	Ga0307406_10182693	Ga0307406_101826932	112
1588	3300031901	Ga0307406_10189848	Ga0307406_101898483	112
1589	3300031901	Ga0307406_10597273	Ga0307406_105972732	112
1590	3300031901	Ga0307406_11168192	Ga0307406_111681922	112
1591	3300031901	Ga0307406_11340675	Ga0307406_113406752	112
1592	3300031903	Ga0307407_10071891	Ga0307407_100718913	112
1593	3300031903	Ga0307407_10307089	Ga0307407_103070892	112
1594	3300031903	Ga0307407_10482758	Ga0307407_104827581	112
1595	3300031903	Ga0307407_11322006	Ga0307407_113220062	112
1596	3300031911	Ga0307412_10001384	Ga0307412_100013844	112
1597	3300031911	Ga0307412_10003210	Ga0307412_100032103	112
1598	3300031911	Ga0307412_10021895	Ga0307412_100218954	112
1599	3300031911	Ga0307412_10034400	Ga0307412_100344005	112
1600	3300031911	Ga0307412_10043071	Ga0307412_100430712	112
1601	3300031911	Ga0307412_10043743	Ga0307412_100437432	112
1602	3300031911	Ga0307412_10056266	Ga0307412_100562662	112
1603	3300031911	Ga0307412_10156113	Ga0307412_101561133	112
1604	3300031911	Ga0307412_10236021	Ga0307412_102360212	112
1605	3300031911	Ga0307412_10683024	Ga0307412_106830242	112
1606	3300031911	Ga0307412_10721909	Ga0307412_107219092	112
1607	3300031911	Ga0307412_10791088	Ga0307412_107910882	112
1608	3300031911	Ga0307412_11002241	Ga0307412_110022412	112
1609	3300031911	Ga0307412_11449973	Ga0307412_114499732	112
1610	3300031995	Ga0307409_100000086	Ga0307409_10000008628	112
1611	3300031995	Ga0307409_100024728	Ga0307409_1000247282	112
1612	3300031995	Ga0307409_100732557	Ga0307409_1007325571	112
1613	3300031995	Ga0307409_101027605	Ga0307409_1010276052	112
1614	3300031995	Ga0307409_101972378	Ga0307409_1019723781	112
1615	3300031995	Ga0307409_102028809	Ga0307409_1020288091	112
1616	3300031995	Ga0307409_102617248	Ga0307409_1026172481	112
1617	3300031995	Ga0307409_102943023	Ga0307409_1029430231	112
1618	3300032002	Ga0307416_100024835	Ga0307416_1000248352	112
1619	3300032002	Ga0307416_100051514	Ga0307416_1000515144	112
1620	3300032002	Ga0307416_100130486	Ga0307416_1001304862	112
1621	3300032002	Ga0307416_100323291	Ga0307416_1003232911	112
1622	3300032002	Ga0307416_100571575	Ga0307416_1005715752	112
1623	3300032002	Ga0307416_100623909	Ga0307416_1006239092	112
1624	3300032002	Ga0307416_101059411	Ga0307416_1010594112	112
1625	3300032002	Ga0307416_101197589	Ga0307416_1011975892	112
1626	3300032002	Ga0307416_101306335	Ga0307416_1013063352	112
1627	3300032002	Ga0307416_101383634	Ga0307416_1013836342	112
1628	3300032002	Ga0307416_101405940	Ga0307416_1014059402	112
1629	3300032004	Ga0307414_10024960	Ga0307414_100249602	112
1630	3300032004	Ga0307414_10067625	Ga0307414_100676252	112
1631	3300032004	Ga0307414_10086711	Ga0307414_100867112	112
1632	3300032004	Ga0307414_10111423	Ga0307414_101114232	112
1633	3300032004	Ga0307414_10115418	Ga0307414_101154182	112
1634	3300032004	Ga0307414_10174830	Ga0307414_101748303	112
1635	3300032004	Ga0307414_11161104	Ga0307414_111611042	112
1636	3300032005	Ga0307411_10005193	Ga0307411_100051936	112
1637	3300032005	Ga0307411_10063367	Ga0307411_100633672	112
1638	3300032005	Ga0307411_10074309	Ga0307411_100743093	112
1639	3300032005	Ga0307411_10104486	Ga0307411_101044863	112
1640	3300032005	Ga0307411_10123397	Ga0307411_101233972	112
1641	3300032005	Ga0307411_10180169	Ga0307411_101801692	112
1642	3300032005	Ga0307411_10254323	Ga0307411_102543232	112
1643	3300032005	Ga0307411_10613968	Ga0307411_106139682	112
1644	3300032005	Ga0307411_10995515	Ga0307411_109955152	112
1645	3300032005	Ga0307411_11988153	Ga0307411_119881531	112
1646	3300032126	Ga0307415_100000361	Ga0307415_1000003616	112
1647	3300032126	Ga0307415_100133882	Ga0307415_1001338822	112
1648	3300032126	Ga0307415_101088308	Ga0307415_1010883082	112
1649	3300032168	Ga0316593_10026594	Ga0316593_100265942	112
1650	3300033179	Ga0307507_10100794	Ga0307507_101007944	112
1651	3300033179	Ga0307507_10130139	Ga0307507_101301392	112
1652	3300033180	Ga0307510_10009306	Ga0307510_100093066	112
1653	3300033180	Ga0307510_10017087	Ga0307510_100170875	112
1654	3300033180	Ga0307510_10041763	Ga0307510_100417636	112
1655	3300033180	Ga0307510_10135811	Ga0307510_101358112	112
1656	3300033180	Ga0307510_10279920	Ga0307510_102799202	112
1657	3300033180	Ga0307510_10367980	Ga0307510_103679802	112
1658	3300034816	Ga0373930_0026313	Ga0373930_0026313_337_675	112
1659	3300034820	Ga0373959_0033468	Ga0373959_0033468_668_1006	112
1660	3300034957	Ga0373938_0081594	Ga0373938_0081594_308_646	112
1661	3300034957	Ga0373938_0110016	Ga0373938_0110016_16_354	112
1662	3300035084	Ga0373928_0132188	Ga0373928_0132188_120_458	112
1663	3300035085	Ga0373929_0032309	Ga0373929_0032309_468_806	112
1664	3300035088	Ga0373940_0011192	Ga0373940_0011192_1395_1733	112
1665	3300035089	Ga0373944_0177474	Ga0373944_0177474_303_641	112
1666	3300035089	Ga0373944_0193002	Ga0373944_0193002_267_605	112
1667	3300035089	Ga0373944_0194084	Ga0373944_0194084_55_393	112
1668	3300035089	Ga0373944_0249845	Ga0373944_0249845_137_475	112
1669	3300035092	Ga0373952_0050313	Ga0373952_0050313_349_687	112
1670	3300035111	Ga0373923_0304964	Ga0373923_0304964_19_357	112
1671	3300035115	Ga0373941_0224634	Ga0373941_0224634_101_439	112
1672	3300035115	Ga0373941_0340503	Ga0373941_0340503_16_354	112
1673	3300035116	Ga0373945_0142088	Ga0373945_0142088_231_569	112
1674	3300035117	Ga0373953_0129594	Ga0373953_0129594_239_577	112
1675	3300035170	Ga0373943_0159516	Ga0373943_0159516_539_877	112
1676	3300035171	Ga0373946_0039114	Ga0373946_0039114_75_413	112
1677	3300035172	Ga0373955_0450700	Ga0373955_0450700_421_759	112
1678	3300035207	Ga0373942_0070650	Ga0373942_0070650_134_472	112
1679	3300035242	Ga0373962_0312170	Ga0373962_0312170_209_547	112
1680	3300035410	Ga0373924_0528130	Ga0373924_0528130_47_385	112
1681	3300035691	Ga0373931_0009283	Ga0373931_0009283_3797_4135	112
1682	3300035691	Ga0373931_0014386	Ga0373931_0014386_2229_2567	112
1683	3300035691	Ga0373931_0026583	Ga0373931_0026583_570_908	112
1684	3300035692	Ga0373935_0311811	Ga0373935_0311811_422_760	112
1685	3300035692	Ga0373935_0523714	Ga0373935_0523714_216_554	112
1686	3300035692	Ga0373935_1408693	Ga0373935_1408693_141_479	112
1687	3300035695	Ga0373927_0009569	Ga0373927_0009569_1275_1613	112
1688	3300035695	Ga0373927_0211207	Ga0373927_0211207_366_704	112
1689	3300035695	Ga0373927_0240876	Ga0373927_0240876_164_502	112
1690	3300035724	Ga0373933_1163731	Ga0373933_1163731_149_487	112
1691	3300035725	Ga0373947_0473855	Ga0373947_0473855_406_744	112
1692	3300035725	Ga0373947_0531919	Ga0373947_0531919_320_658	112
1693	3300035725	Ga0373947_0891802	Ga0373947_0891802_166_504	112
1694	3300036401	Ga0373937_0069375	Ga0373937_0069375_1261_1599	112
1695	3300036401	Ga0373937_0381456	Ga0373937_0381456_782_1120	112
1696	3300036647	Ga0316582_0015066	Ga0316582_0015066_2915_3253	112
1697	3300036712	Ga0316584_0092501	Ga0316584_0092501_576_914	112
1698	3300037068	Ga0373925_0078641	Ga0373925_0078641_1463_1801	112
1699	3300037068	Ga0373925_0242397	Ga0373925_0242397_513_851	112
1700	3300037068	Ga0373925_0307578	Ga0373925_0307578_196_534	112
1701	3300037068	Ga0373925_0330534	Ga0373925_0330534_462_800	112
1702	3300037312	Ga0395899_0004720	Ga0395899_0004720_6886_7224	112
1703	3300037418	Ga0395900_0000109	Ga0395900_0000109_127139_127477	112
1704	3300037418	Ga0395900_0029684	Ga0395900_0029684_5073_5411	112
1705	3300037418	Ga0395900_0118039	Ga0395900_0118039_837_1178	112
1706	3300037418	Ga0395900_1485775	Ga0395900_1485775_238_576	112
1707	3300037466	Ga0395898_0015056	Ga0395898_0015056_2948_3286	112
1708	3300037466	Ga0395898_0037637	Ga0395898_0037637_330_668	112
1709	3300037466	Ga0395898_0046059	Ga0395898_0046059_364_705	112
1710	3300037466	Ga0395898_0297054	Ga0395898_0297054_1169_1507	112
1711	3300037471	Ga0395905_0000488	Ga0395905_0000488_25505_25843	112
1712	3300037471	Ga0395905_0011451	Ga0395905_0011451_2466_2804	112
1713	3300037471	Ga0395905_0025592	Ga0395905_0025592_4891_5229	112
1714	3300037471	Ga0395905_0034301	Ga0395905_0034301_2658_2996	112
1715	3300037471	Ga0395905_0036014	Ga0395905_0036014_3502_3840	112
1716	3300037471	Ga0395905_0166348	Ga0395905_0166348_401_739	112
1717	3300037471	Ga0395905_0531124	Ga0395905_0531124_53_391	112
1718	3300037471	Ga0395905_0585851	Ga0395905_0585851_547_885	112
1719	3300037471	Ga0395905_0592545	Ga0395905_0592545_354_692	112
1720	3300037588	Ga0316581_0021996	Ga0316581_0021996_868_1206	112
1721	3300038443	Ga0395901_0012844	Ga0395901_0012844_5016_5354	112
1722	3300038443	Ga0395901_0985377	Ga0395901_0985377_372_728	112
1723	3300039437	Ga0436365_1178302	Ga0436365_1178302_174_512	112
1724	3300039438	Ga0436360_0258616	Ga0436360_0258616_170_508	112
1725	3300039447	Ga0436361_0167979	Ga0436361_0167979_4427_4765	112
1726	3300039447	Ga0436361_0214541	Ga0436361_0214541_25505_25843	112
1727	3300039447	Ga0436361_0217332	Ga0436361_0217332_12125_12463	112
1728	3300039447	Ga0436361_0529504	Ga0436361_0529504_136_477	112
1729	3300039447	Ga0436361_0683214	Ga0436361_0683214_437_775	112
1730	3300039447	Ga0436361_0769709	Ga0436361_0769709_457_795	112
1731	3300039447	Ga0436361_1056645	Ga0436361_1056645_1755_2093	112
1732	3300039447	Ga0436361_1092359	Ga0436361_1092359_1361_1699	112
1733	3300039450	Ga0436363_0880003	Ga0436363_0880003_111_452	112
1734	3300039450	Ga0436363_1113045	Ga0436363_1113045_692_1030	112
1735	3300041404	Ga0439436_0005082	Ga0439436_0005082_2266_2604	112
1736	3300041404	Ga0439436_0017528	Ga0439436_0017528_1642_1980	112
1737	3300041404	Ga0439436_0058755	Ga0439436_0058755_423_764	112
1738	3300041405	Ga0439438_015929	Ga0439438_015929_493_831	112
1739	3300041406	Ga0439439_0000304	Ga0439439_0000304_3582_3920	112
1740	3300041406	Ga0439439_0167384	Ga0439439_0167384_52_390	112
1741	3300041407	Ga0439447_041937	Ga0439447_041937_71_409	112
1742	3300041408	Ga0439453_0072178	Ga0439453_0072178_305_643	112
1743	3300041410	Ga0439461_0014042	Ga0439461_0014042_270_608	112
1744	3300041411	Ga0439466_0002298	Ga0439466_0002298_3866_4204	112
1745	3300041411	Ga0439466_0009551	Ga0439466_0009551_1482_1820	112
1746	3300041413	Ga0439465_0003892	Ga0439465_0003892_3952_4290	112
1747	3300041413	Ga0439465_0183658	Ga0439465_0183658_59_397	112
1748	3300041443	Ga0451789_0160463	Ga0451789_0160463_2374_2712	112
1749	3300041451	Ga0451791_1329588	Ga0451791_1329588_76_414	112
1750	3300041452	Ga0451793_0907941	Ga0451793_0907941_201_539	112
1751	3300041452	Ga0451793_1009248	Ga0451793_1009248_1786_2124	112
1752	3300041453	Ga0451797_1109477	Ga0451797_1109477_478_816	112
1753	3300041456	Ga0451795_0913388	Ga0451795_0913388_194_532	112
1754	3300041458	Ga0451798_0882602	Ga0451798_0882602_3634_3972	112
1755	3300041458	Ga0451798_1022954	Ga0451798_1022954_73_411	112
1756	3300041459	Ga0451800_0983364	Ga0451800_0983364_746_1084	112
1757	3300041459	Ga0451800_1592322	Ga0451800_1592322_375_713	112
1758	3300041460	Ga0451802_0064922	Ga0451802_0064922_539_877	112
1759	3300041462	Ga0451806_649029	Ga0451806_649029_84_422	112
1760	3300041463	Ga0451804_0858374	Ga0451804_0858374_492_830	112
1761	3300041486	Ga0451807_1165661	Ga0451807_1165661_616_954	112
1762	3300041486	Ga0451807_2033827	Ga0451807_2033827_397_735	112
1763	3300041486	Ga0451807_2607001	Ga0451807_2607001_99_437	112
1764	3300041491	Ga0451833_1194697	Ga0451833_1194697_1337_1675	112
1765	3300041496	Ga0451839_0399468	Ga0451839_0399468_63_401	112
1766	3300041496	Ga0451839_0693068	Ga0451839_0693068_61_399	112
1767	3300041496	Ga0451839_0749505	Ga0451839_0749505_121_459	112
1768	3300041498	Ga0451841_0449173	Ga0451841_0449173_22_360	112
1769	3300041501	Ga0451845_0413049	Ga0451845_0413049_344_682	112
1770	3300041503	Ga0451847_0674285	Ga0451847_0674285_117_455	112
1771	3300041507	Ga0451851_0829363	Ga0451851_0829363_334_672	112
1772	3300041509	Ga0451843_0383449	Ga0451843_0383449_36_374	112
1773	3300041509	Ga0451843_0510807	Ga0451843_0510807_144_482	112
1774	3300041509	Ga0451843_0908011	Ga0451843_0908011_456_794	112
1775	3300041509	Ga0451843_1432462	Ga0451843_1432462_150_488	112
1776	3300041512	Ga0451853_0990419	Ga0451853_0990419_989_1327	112
1777	3300041512	Ga0451853_1045547	Ga0451853_1045547_240_578	112
1778	3300041512	Ga0451853_1701460	Ga0451853_1701460_176_514	112
1779	3300041512	Ga0451853_1730775	Ga0451853_1730775_58_396	112
1780	3300041997	Ga0439431_0103546	Ga0439431_0103546_403_741	112
1781	3300041999	Ga0439433_0022304	Ga0439433_0022304_920_1258	112
1782	3300041999	Ga0439433_0080513	Ga0439433_0080513_366_704	112
1783	3300042002	Ga0439442_003022	Ga0439442_003022_917_1255	112
1784	3300042002	Ga0439442_031470	Ga0439442_031470_445_783	112
1785	3300042002	Ga0439442_133545	Ga0439442_133545_42_380	112
1786	3300042004	Ga0439445_0021223	Ga0439445_0021223_802_1140	112
1787	3300042004	Ga0439445_0051253	Ga0439445_0051253_596_934	112
1788	3300042004	Ga0439445_0258069	Ga0439445_0258069_139_477	112
1789	3300042005	Ga0439448_0000154	Ga0439448_0000154_5873_6214	112
1790	3300042005	Ga0439448_0248931	Ga0439448_0248931_158_496	112
1791	3300042006	Ga0439432_003328	Ga0439432_003328_3528_3866	112
1792	3300042006	Ga0439432_150236	Ga0439432_150236_304_642	112
1793	3300042007	Ga0439449_0002911	Ga0439449_0002911_3292_3630	112
1794	3300042007	Ga0439449_0004348	Ga0439449_0004348_3954_4292	112
1795	3300042007	Ga0439449_0142564	Ga0439449_0142564_365_703	112
1796	3300042010	Ga0439452_002322	Ga0439452_002322_6015_6353	112
1797	3300042010	Ga0439452_004417	Ga0439452_004417_946_1284	112
1798	3300042012	Ga0439455_0004565	Ga0439455_0004565_1045_1383	112
1799	3300042012	Ga0439455_0046089	Ga0439455_0046089_497_835	112
1800	3300042012	Ga0439455_0092612	Ga0439455_0092612_174_512	112
1801	3300042014	Ga0439457_168515	Ga0439457_168515_14_352	112
1802	3300042015	Ga0439462_0003593	Ga0439462_0003593_3055_3393	112
1803	3300042115	Ga0450911_056827	Ga0450911_056827_141_479	112
1804	3300042121	Ga0450919_011901	Ga0450919_011901_115_453	112
1805	3300042122	Ga0450920_005125	Ga0450920_005125_913_1251	112
1806	3300042125	Ga0450923_026479	Ga0450923_026479_606_944	112
1807	3300042127	Ga0450890_016977	Ga0450890_016977_178_516	112
1808	3300042127	Ga0450890_026369	Ga0450890_026369_287_625	112
1809	3300042128	Ga0450897_009986	Ga0450897_009986_147_485	112
1810	3300042131	Ga0450894_013462	Ga0450894_013462_102_440	112
1811	3300042134	Ga0450898_049450	Ga0450898_049450_98_436	112
1812	3300042134	Ga0450898_056288	Ga0450898_056288_79_417	112
1813	3300042135	Ga0450899_009850	Ga0450899_009850_354_692	112
1814	3300042135	Ga0450899_011977	Ga0450899_011977_129_467	112
1815	3300042145	Ga0450906_022700	Ga0450906_022700_323_661	112
1816	3300042146	Ga0450907_048795	Ga0450907_048795_235_573	112
1817	3300042156	Ga0439446_0196246	Ga0439446_0196246_24_362	112
1818	3300042156	Ga0439446_0203182	Ga0439446_0203182_167_505	112
1819	3300042185	Ga0450909_026534	Ga0450909_026534_366_704	112
1820	3300042435	Ga0439434_0002020	Ga0439434_0002020_2703_3041	112
1821	3300042435	Ga0439434_0004225	Ga0439434_0004225_3504_3842	112
1822	3300042438	Ga0439459_0016027	Ga0439459_0016027_98_436	112
1823	3300042531	Ga0450918_003867	Ga0450918_003867_527_865	112
1824	3300042876	Ga0451577_0006746	Ga0451577_0006746_3601_3939	112
1825	3300042876	Ga0451577_0008963	Ga0451577_0008963_4931_5269	112
1826	3300042876	Ga0451577_0065508	Ga0451577_0065508_2314_2652	112
1827	3300042876	Ga0451577_0238241	Ga0451577_0238241_604_942	112
1828	3300042876	Ga0451577_0404128	Ga0451577_0404128_467_808	112
1829	3300042876	Ga0451577_0445720	Ga0451577_0445720_796_1134	112
1830	3300042876	Ga0451577_1015378	Ga0451577_1015378_337_678	112
1831	3300042876	Ga0451577_1580173	Ga0451577_1580173_101_442	112
1832	3300042876	Ga0451577_1823083	Ga0451577_1823083_63_401	112
1833	3300044656	Ga0466969_0000395	Ga0466969_0000395_22414_22752	112
1834	3300044656	Ga0466969_0001952	Ga0466969_0001952_9856_10197	112
1835	3300044656	Ga0466969_0008585	Ga0466969_0008585_4668_5009	112
1836	3300044656	Ga0466969_0010813	Ga0466969_0010813_3821_4159	112
1837	3300044656	Ga0466969_0027212	Ga0466969_0027212_1551_1889	112
1838	3300044658	Ga0466972_0008024	Ga0466972_0008024_2223_2561	112
1839	3300044658	Ga0466972_0013627	Ga0466972_0013627_3590_3946	112
1840	3300044658	Ga0466972_0022412	Ga0466972_0022412_1204_1542	112
1841	3300044658	Ga0466972_0038687	Ga0466972_0038687_799_1137	112
1842	3300044658	Ga0466972_0351804	Ga0466972_0351804_221_559	112
1843	3300044668	Ga0466980_0248074	Ga0466980_0248074_92_433	112
1844	3300044673	Ga0453683_0001626	Ga0453683_0001626_3743_4081	112
1845	3300044673	Ga0453683_0119199	Ga0453683_0119199_1089_1427	112
1846	3300044673	Ga0453683_1211943	Ga0453683_1211943_51_389	112
1847	3300044683	Ga0466965_0027809	Ga0466965_0027809_1889_2227	112
1848	3300044683	Ga0466965_0036578	Ga0466965_0036578_1113_1469	112
1849	3300044683	Ga0466965_0041138	Ga0466965_0041138_1568_1906	112
1850	3300044683	Ga0466965_0054005	Ga0466965_0054005_316_654	112
1851	3300044683	Ga0466965_0254979	Ga0466965_0254979_329_667	112
1852	3300044684	Ga0466966_0099105	Ga0466966_0099105_1257_1595	112
1853	3300044684	Ga0466966_0200822	Ga0466966_0200822_100_438	112
1854	3300044693	Ga0466961_0005306	Ga0466961_0005306_3894_4232	112
1855	3300044693	Ga0466961_0011241	Ga0466961_0011241_5235_5573	112
1856	3300044693	Ga0466961_0035961	Ga0466961_0035961_2638_2976	112
1857	3300044693	Ga0466961_0156934	Ga0466961_0156934_178_519	112
1858	3300044693	Ga0466961_0204242	Ga0466961_0204242_640_981	112
1859	3300044693	Ga0466961_0298460	Ga0466961_0298460_526_864	112
1860	3300044694	Ga0466963_0057018	Ga0466963_0057018_100_438	112
1861	3300044694	Ga0466963_0125037	Ga0466963_0125037_291_629	112
1862	3300044694	Ga0466963_0211748	Ga0466963_0211748_349_687	112
1863	3300044706	Ga0466964_0031972	Ga0466964_0031972_1211_1549	112
1864	3300044706	Ga0466964_0141395	Ga0466964_0141395_262_600	112
1865	3300044706	Ga0466964_0155240	Ga0466964_0155240_184_540	112
1866	3300044706	Ga0466964_0408670	Ga0466964_0408670_59_397	112
1867	3300044712	Ga0453684_0003638	Ga0453684_0003638_26633_26974	112
1868	3300044712	Ga0453684_0088462	Ga0453684_0088462_563_901	112
1869	3300044712	Ga0453684_0139796	Ga0453684_0139796_1224_1562	112
1870	3300044712	Ga0453684_0172543	Ga0453684_0172543_2055_2393	112
1871	3300044712	Ga0453684_0349930	Ga0453684_0349930_36_374	112
1872	3300044712	Ga0453684_0483714	Ga0453684_0483714_953_1291	112
1873	3300044712	Ga0453684_0513278	Ga0453684_0513278_503_841	112
1874	3300044712	Ga0453684_0606434	Ga0453684_0606434_411_752	112
1875	3300044712	Ga0453684_1089263	Ga0453684_1089263_78_416	112
1876	3300044712	Ga0453684_1301134	Ga0453684_1301134_367_705	112
1877	3300044719	Ga0466971_0004739	Ga0466971_0004739_1795_2133	112
1878	3300044719	Ga0466971_0189161	Ga0466971_0189161_610_948	112
1879	3300044719	Ga0466971_0269457	Ga0466971_0269457_164_502	112
1880	3300044735	Ga0466968_0059440	Ga0466968_0059440_761_1099	112
1881	3300044735	Ga0466968_0185307	Ga0466968_0185307_390_728	112
1882	3300044735	Ga0466968_0228024	Ga0466968_0228024_458_799	112
1883	3300044735	Ga0466968_0279379	Ga0466968_0279379_221_559	112
1884	3300044765	Ga0466970_0007521	Ga0466970_0007521_3882_4220	112
1885	3300044765	Ga0466970_0060241	Ga0466970_0060241_816_1154	112
1886	3300044765	Ga0466970_0147824	Ga0466970_0147824_513_851	112
1887	3300044765	Ga0466970_0450782	Ga0466970_0450782_112_453	112
1888	3300044842	Ga0466957_0014902	Ga0466957_0014902_398_736	112
1889	3300044842	Ga0466957_0117828	Ga0466957_0117828_181_519	112
1890	3300044842	Ga0466957_0166856	Ga0466957_0166856_348_689	112
1891	3300044842	Ga0466957_0202241	Ga0466957_0202241_690_1028	112
1892	3300044842	Ga0466957_0268488	Ga0466957_0268488_597_938	112
1893	3300044842	Ga0466957_0443444	Ga0466957_0443444_513_851	112
1894	3300044901	Ga0466960_0020318	Ga0466960_0020318_205_543	112
1895	3300044901	Ga0466960_0114141	Ga0466960_0114141_930_1268	112
1896	3300044901	Ga0466960_0873204	Ga0466960_0873204_16_354	112
1897	3300045049	Ga0466959_0003919	Ga0466959_0003919_7769_8107	112
1898	3300045049	Ga0466959_0087673	Ga0466959_0087673_646_984	112
1899	3300045049	Ga0466959_0105260	Ga0466959_0105260_518_856	112
1900	3300045049	Ga0466959_0111821	Ga0466959_0111821_267_605	112
1901	3300045049	Ga0466959_0218492	Ga0466959_0218492_677_1018	112
1902	3300045049	Ga0466959_0368236	Ga0466959_0368236_608_946	112
1903	3300045051	Ga0451576_0000914	Ga0451576_0000914_45787_46125	112
1904	3300045051	Ga0451576_0004476	Ga0451576_0004476_13638_13976	112
1905	3300045051	Ga0451576_0014049	Ga0451576_0014049_2807_3145	112
1906	3300045051	Ga0451576_0052912	Ga0451576_0052912_3068_3406	112
1907	3300045051	Ga0451576_0122968	Ga0451576_0122968_1012_1350	112
1908	3300045051	Ga0451576_0241548	Ga0451576_0241548_297_635	112
1909	3300045051	Ga0451576_0467602	Ga0451576_0467602_632_970	112
1910	3300045051	Ga0451576_0636156	Ga0451576_0636156_202_540	112
1911	3300045051	Ga0451576_1358864	Ga0451576_1358864_168_506	112
1912	3300045836	Ga0466958_0074271	Ga0466958_0074271_991_1329	112
1913	3300045836	Ga0466958_0473553	Ga0466958_0473553_358_696	112
1914	3300045976	Ga0466967_0056668	Ga0466967_0056668_3097_3435	112
1915	3300045976	Ga0466967_0075650	Ga0466967_0075650_2427_2765	112
1916	3300045976	Ga0466967_1135311	Ga0466967_1135311_358_696	112
1917	3300046453	Ga0495627_007566	Ga0495627_007566_1816_2154	112
1918	3300046454	Ga0495592_0008709	Ga0495592_0008709_4078_4419	112
1919	3300046454	Ga0495592_0015966	Ga0495592_0015966_1836_2177	112
1920	3300046455	Ga0495603_0032423	Ga0495603_0032423_1203_1544	112
1921	3300046458	Ga0495591_156730	Ga0495591_156730_111_449	112
1922	3300046459	Ga0495629_0154872	Ga0495629_0154872_652_990	112
1923	3300046459	Ga0495629_0381748	Ga0495629_0381748_415_753	112
1924	3300046460	Ga0495638_0051454	Ga0495638_0051454_205_543	112
1925	3300046460	Ga0495638_0085327	Ga0495638_0085327_1336_1674	112
1926	3300046460	Ga0495638_0208178	Ga0495638_0208178_738_1076	112
1927	3300046462	Ga0495651_0311118	Ga0495651_0311118_633_971	112
1928	3300046462	Ga0495651_0691763	Ga0495651_0691763_141_479	112
1929	3300046463	Ga0495653_0115724	Ga0495653_0115724_1192_1530	112
1930	3300046471	Ga0495650_0016331	Ga0495650_0016331_1134_1472	112
1931	3300046471	Ga0495650_0191780	Ga0495650_0191780_361_699	112
1932	3300046472	Ga0495580_0145541	Ga0495580_0145541_412_750	112
1933	3300046473	Ga0495582_0117129	Ga0495582_0117129_47_385	112
1934	3300046473	Ga0495582_0542480	Ga0495582_0542480_66_404	112
1935	3300046474	Ga0495605_0023835	Ga0495605_0023835_2829_3170	112
1936	3300046474	Ga0495605_0105856	Ga0495605_0105856_383_721	112
1937	3300046475	Ga0495639_0017429	Ga0495639_0017429_1237_1575	112
1938	3300046475	Ga0495639_0061533	Ga0495639_0061533_479_817	112
1939	3300046477	Ga0495664_0132586	Ga0495664_0132586_309_650	112
1940	3300046491	Ga0495584_0261560	Ga0495584_0261560_301_642	112
1941	3300046492	Ga0495585_0055375	Ga0495585_0055375_1627_1965	112
1942	3300046501	Ga0495607_0399698	Ga0495607_0399698_108_446	112
1943	3300046506	Ga0495583_0015974	Ga0495583_0015974_2514_2855	112
1944	3300046507	Ga0495606_0099657	Ga0495606_0099657_334_672	112
1945	3300046507	Ga0495606_0112339	Ga0495606_0112339_959_1297	112
1946	3300046507	Ga0495606_0223399	Ga0495606_0223399_36_377	112
1947	3300046511	Ga0495608_0178630	Ga0495608_0178630_540_878	112
1948	3300046512	Ga0495610_0008701	Ga0495610_0008701_4795_5133	112
1949	3300046513	Ga0495616_0006630	Ga0495616_0006630_165_503	112
1950	3300046514	Ga0495618_0346612	Ga0495618_0346612_197_538	112
1951	3300046515	Ga0495620_0010437	Ga0495620_0010437_4160_4498	112
1952	3300046516	Ga0495628_0140583	Ga0495628_0140583_1284_1622	112
1953	3300046518	Ga0495631_0002748	Ga0495631_0002748_6766_7104	112
1954	3300046519	Ga0495632_0009715	Ga0495632_0009715_1778_2116	112
1955	3300046519	Ga0495632_0016885	Ga0495632_0016885_2323_2661	112
1956	3300046519	Ga0495632_0173014	Ga0495632_0173014_300_638	112
1957	3300046520	Ga0495637_0020235	Ga0495637_0020235_2377_2715	112
1958	3300046524	Ga0495648_0042223	Ga0495648_0042223_654_995	112
1959	3300046524	Ga0495648_0148033	Ga0495648_0148033_438_776	112
1960	3300046524	Ga0495648_0201241	Ga0495648_0201241_71_409	112
1961	3300046524	Ga0495648_0270304	Ga0495648_0270304_35_373	112
1962	3300046526	Ga0495666_0043869	Ga0495666_0043869_976_1314	112
1963	3300046528	Ga0495642_0013334	Ga0495642_0013334_39_377	112
1964	3300046528	Ga0495642_0167757	Ga0495642_0167757_271_612	112
1965	3300046528	Ga0495642_0554511	Ga0495642_0554511_74_412	112
1966	3300046530	Ga0495654_0000550	Ga0495654_0000550_6824_7162	112
1967	3300046530	Ga0495654_0043604	Ga0495654_0043604_905_1243	112
1968	3300046533	Ga0495640_0366968	Ga0495640_0366968_457_795	112
1969	3300046535	Ga0495586_0021373	Ga0495586_0021373_1511_1849	112
1970	3300046539	Ga0495621_0002735	Ga0495621_0002735_1465_1803	112
1971	3300046539	Ga0495621_0003885	Ga0495621_0003885_1474_1812	112
1972	3300046539	Ga0495621_0160934	Ga0495621_0160934_219_557	112
1973	3300046542	Ga0495597_0000153	Ga0495597_0000153_3104_3442	112
1974	3300046542	Ga0495597_0020188	Ga0495597_0020188_46_384	112
1975	3300046542	Ga0495597_0383230	Ga0495597_0383230_83_424	112
1976	3300046557	Ga0495622_0088536	Ga0495622_0088536_372_713	112
1977	3300046557	Ga0495622_0250621	Ga0495622_0250621_291_629	112
1978	3300046615	Ga0495656_0000929	Ga0495656_0000929_836_1174	112
1979	3300046615	Ga0495656_0062221	Ga0495656_0062221_300_638	112
1980	3300046615	Ga0495656_0434962	Ga0495656_0434962_215_553	112
1981	3300046616	Ga0495668_0051073	Ga0495668_0051073_407_745	112
1982	3300046616	Ga0495668_0360329	Ga0495668_0360329_438_776	112
1983	3300046642	Ga0495634_0625845	Ga0495634_0625845_220_558	112
1984	3300046648	Ga0495611_0175389	Ga0495611_0175389_76_414	112
1985	3300046660	Ga0495625_0000714	Ga0495625_0000714_18617_18955	112
1986	3300046660	Ga0495625_0010826	Ga0495625_0010826_5997_6335	112
1987	3300046660	Ga0495625_0096602	Ga0495625_0096602_698_1036	112
1988	3300046660	Ga0495625_0108856	Ga0495625_0108856_1281_1619	112
1989	3300046660	Ga0495625_0148101	Ga0495625_0148101_105_443	112
1990	3300046660	Ga0495625_0627755	Ga0495625_0627755_64_402	112
1991	3300046660	Ga0495625_0850208	Ga0495625_0850208_40_378	112
1992	3300046663	Ga0495635_0463626	Ga0495635_0463626_475_813	112
1993	3300046674	Ga0495588_0076870	Ga0495588_0076870_889_1227	112
1994	3300046679	Ga0495623_0587185	Ga0495623_0587185_104_442	112
1995	3300046680	Ga0495646_0031855	Ga0495646_0031855_2028_2369	112
1996	3300046681	Ga0495647_0009386	Ga0495647_0009386_722_1060	112
1997	3300046681	Ga0495647_0010703	Ga0495647_0010703_1428_1766	112
1998	3300046681	Ga0495647_0097247	Ga0495647_0097247_857_1195	112
1999	3300046683	Ga0495658_0201880	Ga0495658_0201880_529_867	112
2000	3300046683	Ga0495658_0213479	Ga0495658_0213479_166_504	112
2001	3300046683	Ga0495658_0300309	Ga0495658_0300309_497_835	112
2002	3300046683	Ga0495658_0348305	Ga0495658_0348305_353_691	112
2003	3300046683	Ga0495658_0835723	Ga0495658_0835723_168_509	112
2004	3300046689	Ga0495613_0240571	Ga0495613_0240571_601_939	112
2005	3300046690	Ga0495624_0514420	Ga0495624_0514420_278_616	112
2006	3300046690	Ga0495624_0517615	Ga0495624_0517615_232_573	112
2007	3300046690	Ga0495624_0905451	Ga0495624_0905451_37_378	112
2008	3300046691	Ga0495670_0151238	Ga0495670_0151238_367_705	112
2009	3300046691	Ga0495670_0183285	Ga0495670_0183285_510_848	112
2010	3300046692	Ga0495671_0019317	Ga0495671_0019317_2808_3146	112
2011	3300046692	Ga0495671_0327995	Ga0495671_0327995_145_483	112
2012	3300046694	Ga0495649_0004353	Ga0495649_0004353_307_645	112
2013	3300046694	Ga0495649_0084532	Ga0495649_0084532_1152_1493	112
2014	3300046794	Ga0495589_0027163	Ga0495589_0027163_1207_1548	112
2015	3300046794	Ga0495589_0137394	Ga0495589_0137394_387_725	112
2016	3300046810	Ga0495660_0006585	Ga0495660_0006585_5925_6263	112
2017	3300046810	Ga0495660_0084665	Ga0495660_0084665_139_477	112
2018	3300046810	Ga0495660_0433749	Ga0495660_0433749_37_375	112
2019	3300047315	Ga0495581_0525553	Ga0495581_0525553_169_510	112
2020	3300047317	Ga0495604_0900102	Ga0495604_0900102_71_409	112
2021	3300047319	Ga0495674_0003080	Ga0495674_0003080_1427_1768	112
2022	3300047319	Ga0495674_0025003	Ga0495674_0025003_520_861	112
2023	3300047319	Ga0495674_0131454	Ga0495674_0131454_1669_2007	112
2024	3300047320	Ga0495672_0000655	Ga0495672_0000655_36607_37008	112
2025	3300047320	Ga0495672_0022880	Ga0495672_0022880_2611_2952	112
2026	3300047321	Ga0495676_0007147	Ga0495676_0007147_6264_6602	112
2027	3300047443	Ga0495687_001512	Ga0495687_001512_3403_3741	112
2028	3300047443	Ga0495687_002480	Ga0495687_002480_8770_9108	112
2029	3300047443	Ga0495687_047916	Ga0495687_047916_1206_1547	112
2030	3300047445	Ga0495677_0045384	Ga0495677_0045384_1204_1545	112
2031	3300047469	Ga0495673_0026656	Ga0495673_0026656_1323_1664	112
2032	3300047471	Ga0495684_0527155	Ga0495684_0527155_415_753	112
2033	3300047472	Ga0495686_0005600	Ga0495686_0005600_6584_6922	112
2034	3300047472	Ga0495686_0008724	Ga0495686_0008724_453_791	112
2035	3300047673	Ga0495593_0006672	Ga0495593_0006672_3611_3949	112
2036	3300047673	Ga0495593_0060213	Ga0495593_0060213_374_715	112
2037	3300047673	Ga0495593_0100100	Ga0495593_0100100_395_733	112
2038	3300048088	Ga0495602_0226558	Ga0495602_0226558_101_439	112
2039	3300048089	Ga0495614_0009932	Ga0495614_0009932_3732_4070	112
2040	3300048091	Ga0495626_0051745	Ga0495626_0051745_384_725	112
2041	3300048903	Ga0496100_0047259	Ga0496100_0047259_1119_1457	112
2042	3300048903	Ga0496100_0673556	Ga0496100_0673556_208_546	112
2043	3300048904	Ga0496101_0021483	Ga0496101_0021483_3330_3668	112
2044	3300048904	Ga0496101_0043750	Ga0496101_0043750_26_364	112
2045	3300048904	Ga0496101_0504671	Ga0496101_0504671_509_847	112
2046	3300048904	Ga0496101_1055879	Ga0496101_1055879_106_444	112
2047	3300048905	Ga0496102_0013747	Ga0496102_0013747_5961_6299	112
2048	3300048905	Ga0496102_0109753	Ga0496102_0109753_1900_2238	112
2049	3300048905	Ga0496102_0173558	Ga0496102_0173558_1170_1508	112
2050	3300048906	Ga0496103_0006569	Ga0496103_0006569_5103_5441	112
2051	3300048906	Ga0496103_0399580	Ga0496103_0399580_456_794	112
2052	3300048907	Ga0496104_0015973	Ga0496104_0015973_5398_5736	112
2053	3300048907	Ga0496104_0270479	Ga0496104_0270479_767_1105	112
2054	3300048907	Ga0496104_0684598	Ga0496104_0684598_508_846	112
2055	3300048907	Ga0496104_1377640	Ga0496104_1377640_21_359	112
2056	3300048908	Ga0496105_0005071	Ga0496105_0005071_6489_6827	112
2057	3300048908	Ga0496105_0030674	Ga0496105_0030674_289_627	112
2058	3300048908	Ga0496105_0045888	Ga0496105_0045888_1200_1541	112
2059	3300048908	Ga0496105_0241040	Ga0496105_0241040_870_1208	112
2060	3300048908	Ga0496105_0828454	Ga0496105_0828454_27_365	112
2061	3300048908	Ga0496105_0834771	Ga0496105_0834771_69_407	112
2062	3300048908	Ga0496105_0938940	Ga0496105_0938940_261_599	112
2063	3300048908	Ga0496105_0968325	Ga0496105_0968325_88_426	112
2064	3300048909	Ga0496106_0184459	Ga0496106_0184459_1232_1570	112
2065	3300048909	Ga0496106_0540275	Ga0496106_0540275_301_642	112
2066	3300048910	Ga0496107_0144211	Ga0496107_0144211_266_604	112
2067	3300048911	Ga0496108_0022590	Ga0496108_0022590_604_942	112
2068	3300048911	Ga0496108_0061117	Ga0496108_0061117_1979_2317	112
2069	3300048911	Ga0496108_0090344	Ga0496108_0090344_1316_1654	112
2070	3300048911	Ga0496108_0260502	Ga0496108_0260502_447_785	112
2071	3300048911	Ga0496108_0411333	Ga0496108_0411333_723_1061	112
2072	3300048911	Ga0496108_0580207	Ga0496108_0580207_41_379	112
2073	3300048911	Ga0496108_0731375	Ga0496108_0731375_12_350	112
2074	3300048911	Ga0496108_1024469	Ga0496108_1024469_66_407	112
2075	3300048911	Ga0496108_1396629	Ga0496108_1396629_146_484	112
2076	3300048912	Ga0496109_0074882	Ga0496109_0074882_1251_1589	112
2077	3300048912	Ga0496109_0079105	Ga0496109_0079105_743_1081	112
2078	3300048912	Ga0496109_0253973	Ga0496109_0253973_1012_1350	112
2079	3300048912	Ga0496109_0435780	Ga0496109_0435780_764_1102	112
2080	3300048912	Ga0496109_0438180	Ga0496109_0438180_874_1212	112
2081	3300048912	Ga0496109_0448801	Ga0496109_0448801_359_697	112
2082	3300048913	Ga0496110_0010246	Ga0496110_0010246_5585_5923	112
2083	3300048913	Ga0496110_0027229	Ga0496110_0027229_3452_3790	112
2084	3300048913	Ga0496110_0031132	Ga0496110_0031132_3756_4094	112
2085	3300048913	Ga0496110_0070427	Ga0496110_0070427_1966_2304	112
2086	3300048913	Ga0496110_0102247	Ga0496110_0102247_1233_1571	112
2087	3300048913	Ga0496110_0283289	Ga0496110_0283289_742_1080	112
2088	3300048913	Ga0496110_1587025	Ga0496110_1587025_49_387	112
2089	3300048914	Ga0496111_0149804	Ga0496111_0149804_258_596	112
2090	3300048914	Ga0496111_0551367	Ga0496111_0551367_266_604	112
2091	3300048915	Ga0496112_0308348	Ga0496112_0308348_1005_1343	112
2092	3300048915	Ga0496112_0316248	Ga0496112_0316248_1121_1459	112
2093	3300048915	Ga0496112_0330744	Ga0496112_0330744_785_1123	112
2094	3300048916	Ga0496113_0009758	Ga0496113_0009758_5878_6216	112
2095	3300048916	Ga0496113_0049458	Ga0496113_0049458_2364_2705	112
2096	3300048916	Ga0496113_0777851	Ga0496113_0777851_138_476	112
2097	3300048917	Ga0496114_0079247	Ga0496114_0079247_742_1080	112
2098	3300048917	Ga0496114_1395569	Ga0496114_1395569_143_481	112
2099	3300048918	Ga0496115_0007123	Ga0496115_0007123_3851_4189	112
2100	3300048919	Ga0496116_0004666	Ga0496116_0004666_8418_8756	112
2101	3300048919	Ga0496116_0009886	Ga0496116_0009886_3243_3584	112
2102	3300048919	Ga0496116_0017716	Ga0496116_0017716_4985_5326	112
2103	3300048919	Ga0496116_0145930	Ga0496116_0145930_884_1222	112
2104	3300048919	Ga0496116_0337573	Ga0496116_0337573_159_497	112
2105	3300048919	Ga0496116_0477789	Ga0496116_0477789_103_441	112
2106	3300048920	Ga0496117_0020169	Ga0496117_0020169_351_692	112
2107	3300048920	Ga0496117_0037073	Ga0496117_0037073_741_1079	112
2108	3300048920	Ga0496117_0075277	Ga0496117_0075277_1022_1360	112
2109	3300048920	Ga0496117_0117343	Ga0496117_0117343_983_1324	112
2110	3300048920	Ga0496117_0489530	Ga0496117_0489530_94_432	112
2111	3300048921	Ga0496118_0011718	Ga0496118_0011718_2194_2535	112
2112	3300048921	Ga0496118_0015352	Ga0496118_0015352_1052_1393	112
2113	3300048921	Ga0496118_0071859	Ga0496118_0071859_1734_2072	112
2114	3300048921	Ga0496118_0186102	Ga0496118_0186102_88_426	112
2115	3300048922	Ga0496119_0049882	Ga0496119_0049882_695_1036	112
2116	3300048922	Ga0496119_0063307	Ga0496119_0063307_1159_1497	112
2117	3300048922	Ga0496119_0228659	Ga0496119_0228659_301_642	112
2118	3300048922	Ga0496119_0367284	Ga0496119_0367284_219_557	112
2119	3300048923	Ga0496120_0011850	Ga0496120_0011850_4590_4931	112
2120	3300048923	Ga0496120_0107456	Ga0496120_0107456_456_797	112
2121	3300048924	Ga0496121_0000257	Ga0496121_0000257_475_813	112
2122	3300048924	Ga0496121_0000478	Ga0496121_0000478_57946_58287	112
2123	3300048924	Ga0496121_0110968	Ga0496121_0110968_960_1298	112
2124	3300048924	Ga0496121_0180297	Ga0496121_0180297_640_978	112
2125	3300048924	Ga0496121_0223451	Ga0496121_0223451_48_386	112
2126	3300048924	Ga0496121_0251144	Ga0496121_0251144_78_416	112
2127	3300048924	Ga0496121_0251147	Ga0496121_0251147_78_416	112
2128	3300048924	Ga0496121_0724773	Ga0496121_0724773_122_460	112
2129	3300048925	Ga0496122_0000077	Ga0496122_0000077_201397_201738	112
2130	3300048925	Ga0496122_0000177	Ga0496122_0000177_98684_99022	112
2131	3300048925	Ga0496122_0021150	Ga0496122_0021150_988_1329	112
2132	3300048925	Ga0496122_0056621	Ga0496122_0056621_67_405	112
2133	3300048925	Ga0496122_0068323	Ga0496122_0068323_977_1315	112
2134	3300048925	Ga0496122_0078507	Ga0496122_0078507_1614_1955	112
2135	3300048925	Ga0496122_0143523	Ga0496122_0143523_722_1060	112
2136	3300048925	Ga0496122_0171797	Ga0496122_0171797_264_602	112
2137	3300048926	Ga0496123_0000050	Ga0496123_0000050_85880_86218	112
2138	3300048926	Ga0496123_0003980	Ga0496123_0003980_12790_13131	112
2139	3300048926	Ga0496123_0030980	Ga0496123_0030980_694_1035	112
2140	3300048926	Ga0496123_0055801	Ga0496123_0055801_1763_2101	112
2141	3300048926	Ga0496123_0065568	Ga0496123_0065568_991_1329	112
2142	3300048926	Ga0496123_0194941	Ga0496123_0194941_255_596	112
2143	3300048927	Ga0496124_0000036	Ga0496124_0000036_241142_241483	112
2144	3300048927	Ga0496124_0002660	Ga0496124_0002660_2589_2927	112
2145	3300048927	Ga0496124_0006878	Ga0496124_0006878_1387_1725	112
2146	3300048927	Ga0496124_0059631	Ga0496124_0059631_2290_2631	112
2147	3300048927	Ga0496124_0103335	Ga0496124_0103335_1429_1767	112
2148	3300048927	Ga0496124_0154437	Ga0496124_0154437_577_915	112
2149	3300048927	Ga0496124_0166248	Ga0496124_0166248_837_1178	112
2150	3300048927	Ga0496124_0242212	Ga0496124_0242212_838_1176	112
2151	3300048927	Ga0496124_0269123	Ga0496124_0269123_687_1025	112
2152	3300048927	Ga0496124_0320485	Ga0496124_0320485_365_703	112
2153	3300048927	Ga0496124_0437038	Ga0496124_0437038_382_723	112
2154	3300048927	Ga0496124_0472814	Ga0496124_0472814_24_365	112
2155	3300048928	Ga0496125_0000146	Ga0496125_0000146_140336_140677	112
2156	3300048928	Ga0496125_0021126	Ga0496125_0021126_3638_3976	112
2157	3300048928	Ga0496125_0031217	Ga0496125_0031217_869_1207	112
2158	3300048928	Ga0496125_0043843	Ga0496125_0043843_2778_3116	112
2159	3300048928	Ga0496125_0080851	Ga0496125_0080851_606_944	112
2160	3300048928	Ga0496125_0097356	Ga0496125_0097356_211_552	112
2161	3300048928	Ga0496125_0210477	Ga0496125_0210477_748_1086	112
2162	3300048928	Ga0496125_0737410	Ga0496125_0737410_155_493	112
2163	3300048929	Ga0496126_0137352	Ga0496126_0137352_744_1085	112
2164	3300048929	Ga0496126_0156464	Ga0496126_0156464_354_695	112
2165	3300048929	Ga0496126_0315190	Ga0496126_0315190_561_899	112
2166	3300048929	Ga0496126_0497852	Ga0496126_0497852_572_910	112
2167	3300049127	Ga0501306_021570	Ga0501306_021570_277_615	112
2168	3300049130	Ga0501310_015194	Ga0501310_015194_294_632	112
2169	3300049460	Ga0495682_0014946	Ga0495682_0014946_616_957	112
2170	3300049460	Ga0495682_0064665	Ga0495682_0064665_43_381	112
2171	3300049513	Ga0501290_007970	Ga0501290_007970_871_1215	112
2172	3300049515	Ga0501292_008734	Ga0501292_008734_541_879	112
2173	3300049521	Ga0501298_172416	Ga0501298_172416_189_527	112
2174	3300049523	Ga0501300_009618	Ga0501300_009618_585_926	112
2175	3300049524	Ga0501301_015817	Ga0501301_015817_120_458	112
2176	3300049526	Ga0501303_012601	Ga0501303_012601_34_372	112
2177	3300049528	Ga0501312_045622	Ga0501312_045622_350_688	112
2178	3300049531	Ga0501315_014423	Ga0501315_014423_313_651	112
2179	3300049539	Ga0501323_026474	Ga0501323_026474_405_743	112
2180	3300049570	Ga0501033_0020756	Ga0501033_0020756_4381_4722	112
2181	3300049579	Ga0501043_0095479	Ga0501043_0095479_131_472	112
2182	3300049581	Ga0501047_0019486	Ga0501047_0019486_2199_2540	112
2183	3300049581	Ga0501047_0279819	Ga0501047_0279819_584_922	112
2184	3300049581	Ga0501047_0287863	Ga0501047_0287863_606_944	112
2185	3300049584	Ga0501068_0794170	Ga0501068_0794170_203_541	112
2186	3300049586	Ga0501070_0220651	Ga0501070_0220651_948_1289	112
2187	3300049590	Ga0501074_1153505	Ga0501074_1153505_95_433	112
2188	3300049649	Ga0501198_000006	Ga0501198_000006_97033_97371	112
2189	3300049653	Ga0501206_022334	Ga0501206_022334_450_788	112
2190	3300049662	Ga0501222_000007	Ga0501222_000007_57008_57346	112
2191	3300049662	Ga0501222_009041	Ga0501222_009041_810_1148	112
2192	3300049662	Ga0501222_027554	Ga0501222_027554_19_357	112
2193	3300049679	Ga0501249_019142	Ga0501249_019142_597_935	112
2194	3300049686	Ga0501257_067637	Ga0501257_067637_93_431	112
2195	3300049690	Ga0501261_029283	Ga0501261_029283_85_423	112
2196	3300049704	Ga0501221_074704	Ga0501221_074704_291_629	112
2197	3300049705	Ga0501225_0022614	Ga0501225_0022614_519_857	112
2198	3300049742	Ga0501080_0447141	Ga0501080_0447141_240_581	112
2199	3300049744	Ga0501083_0743463	Ga0501083_0743463_94_435	112
2200	3300049758	Ga0501241_090622	Ga0501241_090622_163_501	112
2201	3300049759	Ga0501262_000426	Ga0501262_000426_513_851	112
2202	3300049759	Ga0501262_004524	Ga0501262_004524_1240_1578	112
2203	3300049762	Ga0501265_006632	Ga0501265_006632_70_408	112
2204	3300049822	Ga0501035_0005419	Ga0501035_0005419_3497_3838	112
2205	3300049822	Ga0501035_0014590	Ga0501035_0014590_2565_2906	112
2206	3300049822	Ga0501035_0042955	Ga0501035_0042955_1866_2204	112
2207	3300049822	Ga0501035_0640938	Ga0501035_0640938_443_784	112
2208	3300049822	Ga0501035_1512598	Ga0501035_1512598_19_360	112
2209	3300049823	Ga0501044_0000124	Ga0501044_0000124_65279_65620	112
2210	3300050489	nmdc:mga03683_129022_c1	nmdc:mga03683_129022_c1_112_450	112
2211	3300050489	nmdc:mga03683_13658_c1	nmdc:mga03683_13658_c1_545_883	112
2212	3300050489	nmdc:mga03683_15946_c1	nmdc:mga03683_15946_c1_1940_2278	112
2213	3300050489	nmdc:mga03683_25031_c1	nmdc:mga03683_25031_c1_1136_1474	112
2214	3300050489	nmdc:mga03683_257465_c1	nmdc:mga03683_257465_c1_207_545	112
2215	3300050489	nmdc:mga03683_302734_c1	nmdc:mga03683_302734_c1_113_451	112
2216	3300050489	nmdc:mga03683_35298_c1	nmdc:mga03683_35298_c1_387_725	112
2217	3300050489	nmdc:mga03683_36243_c1	nmdc:mga03683_36243_c1_1475_1813	112
2218	3300050489	nmdc:mga03683_403677_c1	nmdc:mga03683_403677_c1_156_494	112
2219	3300050489	nmdc:mga03683_40783_c1	nmdc:mga03683_40783_c1_325_663	112
2220	3300050489	nmdc:mga03683_416764_c1	nmdc:mga03683_416764_c1_181_519	112
2221	3300050489	nmdc:mga03683_52476_c1	nmdc:mga03683_52476_c1_712_1050	112
2222	3300050489	nmdc:mga03683_64218_c1	nmdc:mga03683_64218_c1_623_961	112
2223	3300050490	nmdc:mga03n38_119129_c1	nmdc:mga03n38_119129_c1_372_710	112
2224	3300050490	nmdc:mga03n38_150061_c1	nmdc:mga03n38_150061_c1_19_357	112
2225	3300050490	nmdc:mga03n38_29739_c1	nmdc:mga03n38_29739_c1_464_802	112
2226	3300050490	nmdc:mga03n38_413424_c1	nmdc:mga03n38_413424_c1_169_507	112
2227	3300050490	nmdc:mga03n38_464600_c1	nmdc:mga03n38_464600_c1_331_669	112
2228	3300050490	nmdc:mga03n38_518338_c1	nmdc:mga03n38_518338_c1_186_524	112
2229	3300050490	nmdc:mga03n38_67321_c1	nmdc:mga03n38_67321_c1_294_632	112
2230	3300050490	nmdc:mga03n38_82759_c1	nmdc:mga03n38_82759_c1_658_996	112
2231	3300050491	nmdc:mga00v17_178309_c1	nmdc:mga00v17_178309_c1_977_1315	112
2232	3300050491	nmdc:mga00v17_259459_c1	nmdc:mga00v17_259459_c1_480_818	112
2233	3300050491	nmdc:mga00v17_29618_c1	nmdc:mga00v17_29618_c1_1093_1431	112
2234	3300050491	nmdc:mga00v17_36194_c1	nmdc:mga00v17_36194_c1_231_569	112
2235	3300050491	nmdc:mga00v17_80575_c1	nmdc:mga00v17_80575_c1_1136_1477	112
2236	3300050491	nmdc:mga00v17_854253_c1	nmdc:mga00v17_854253_c1_53_391	112
2237	3300050491	nmdc:mga00v17_948565_c1	nmdc:mga00v17_948565_c1_26_367	112
2238	3300050492	nmdc:mga0yw44_17114_c1	nmdc:mga0yw44_17114_c1_2953_3291	112
2239	3300050492	nmdc:mga0yw44_2117_c1	nmdc:mga0yw44_2117_c1_1723_2061	112
2240	3300050492	nmdc:mga0yw44_568078_c1	nmdc:mga0yw44_568078_c1_300_638	112
2241	3300050493	nmdc:mga0k408_10403_c1	nmdc:mga0k408_10403_c1_1163_1501	112
2242	3300050493	nmdc:mga0k408_1042_c1	nmdc:mga0k408_1042_c1_1703_2041	112
2243	3300050493	nmdc:mga0k408_1409_c2	nmdc:mga0k408_1409_c2_6992_7330	112
2244	3300050493	nmdc:mga0k408_184_c1	nmdc:mga0k408_184_c1_10774_11112	112
2245	3300050493	nmdc:mga0k408_21023_c1	nmdc:mga0k408_21023_c1_594_932	112
2246	3300050493	nmdc:mga0k408_213388_c1	nmdc:mga0k408_213388_c1_193_531	112
2247	3300050493	nmdc:mga0k408_218610_c1	nmdc:mga0k408_218610_c1_498_836	112
2248	3300050493	nmdc:mga0k408_234464_c1	nmdc:mga0k408_234464_c1_381_719	112
2249	3300050493	nmdc:mga0k408_24809_c1	nmdc:mga0k408_24809_c1_1115_1453	112
2250	3300050493	nmdc:mga0k408_258989_c1	nmdc:mga0k408_258989_c1_192_533	112
2251	3300050493	nmdc:mga0k408_269183_c1	nmdc:mga0k408_269183_c1_140_478	112
2252	3300050493	nmdc:mga0k408_287274_c1	nmdc:mga0k408_287274_c1_537_875	112
2253	3300050493	nmdc:mga0k408_289518_c1	nmdc:mga0k408_289518_c1_236_574	112
2254	3300050493	nmdc:mga0k408_308331_c1	nmdc:mga0k408_308331_c1_140_478	112
2255	3300050493	nmdc:mga0k408_318128_c1	nmdc:mga0k408_318128_c1_397_735	112
2256	3300050493	nmdc:mga0k408_319019_c1	nmdc:mga0k408_319019_c1_232_570	112
2257	3300050493	nmdc:mga0k408_3275_c1	nmdc:mga0k408_3275_c1_7710_8048	112
2258	3300050493	nmdc:mga0k408_33719_c1	nmdc:mga0k408_33719_c1_2089_2433	112
2259	3300050493	nmdc:mga0k408_33735_c1	nmdc:mga0k408_33735_c1_1024_1362	112
2260	3300050493	nmdc:mga0k408_344847_c1	nmdc:mga0k408_344847_c1_405_743	112
2261	3300050493	nmdc:mga0k408_369265_c1	nmdc:mga0k408_369265_c1_276_614	112
2262	3300050493	nmdc:mga0k408_371103_c1	nmdc:mga0k408_371103_c1_360_698	112
2263	3300050493	nmdc:mga0k408_37772_c1	nmdc:mga0k408_37772_c1_1894_2232	112
2264	3300050493	nmdc:mga0k408_38238_c2	nmdc:mga0k408_38238_c2_1092_1430	112
2265	3300050493	nmdc:mga0k408_428840_c1	nmdc:mga0k408_428840_c1_409_747	112
2266	3300050493	nmdc:mga0k408_431_c1	nmdc:mga0k408_431_c1_12619_12957	112
2267	3300050493	nmdc:mga0k408_446061_c1	nmdc:mga0k408_446061_c1_141_479	112
2268	3300050493	nmdc:mga0k408_6723_c1	nmdc:mga0k408_6723_c1_1364_1702	112
2269	3300050493	nmdc:mga0k408_73412_c1	nmdc:mga0k408_73412_c1_909_1247	112
2270	3300050493	nmdc:mga0k408_85145_c1	nmdc:mga0k408_85145_c1_421_759	112
2271	3300050493	nmdc:mga0k408_922826_c1	nmdc:mga0k408_922826_c1_110_448	112
2272	3300050493	nmdc:mga0k408_98343_c1	nmdc:mga0k408_98343_c1_1108_1446	112
2273	3300050494	nmdc:mga06z11_10830_c1	nmdc:mga06z11_10830_c1_2584_2922	112
2274	3300050494	nmdc:mga06z11_150164_c1	nmdc:mga06z11_150164_c1_310_648	112
2275	3300050494	nmdc:mga06z11_150172_c1	nmdc:mga06z11_150172_c1_624_962	112
2276	3300050494	nmdc:mga06z11_15291_c1	nmdc:mga06z11_15291_c1_628_966	112
2277	3300050494	nmdc:mga06z11_161766_c1	nmdc:mga06z11_161766_c1_159_497	112
2278	3300050494	nmdc:mga06z11_524843_c1	nmdc:mga06z11_524843_c1_339_677	112
2279	3300050494	nmdc:mga06z11_617420_c1	nmdc:mga06z11_617420_c1_30_368	112
2280	3300050494	nmdc:mga06z11_783752_c1	nmdc:mga06z11_783752_c1_57_395	112
2281	3300050495	nmdc:mga04h51_165110_c1	nmdc:mga04h51_165110_c1_376_714	112
2282	3300050495	nmdc:mga04h51_183773_c1	nmdc:mga04h51_183773_c1_426_764	112
2283	3300050495	nmdc:mga04h51_486730_c1	nmdc:mga04h51_486730_c1_50_388	112
2284	3300050495	nmdc:mga04h51_50859_c1	nmdc:mga04h51_50859_c1_592_930	112
2285	3300050495	nmdc:mga04h51_55031_c1	nmdc:mga04h51_55031_c1_641_979	112
2286	3300050496	nmdc:mga07m45_134161_c1	nmdc:mga07m45_134161_c1_851_1189	112
2287	3300050496	nmdc:mga07m45_142225_c1	nmdc:mga07m45_142225_c1_750_1088	112
2288	3300050496	nmdc:mga07m45_143054_c1	nmdc:mga07m45_143054_c1_893_1231	112
2289	3300050496	nmdc:mga07m45_1476_c1	nmdc:mga07m45_1476_c1_7986_8324	112
2290	3300050496	nmdc:mga07m45_15079_c1	nmdc:mga07m45_15079_c1_2174_2512	112
2291	3300050496	nmdc:mga07m45_172943_c1	nmdc:mga07m45_172943_c1_637_975	112
2292	3300050496	nmdc:mga07m45_185_c2	nmdc:mga07m45_185_c2_7874_8212	112
2293	3300050496	nmdc:mga07m45_188626_c1	nmdc:mga07m45_188626_c1_121_459	112
2294	3300050496	nmdc:mga07m45_235204_c1	nmdc:mga07m45_235204_c1_687_1025	112
2295	3300050496	nmdc:mga07m45_33735_c1	nmdc:mga07m45_33735_c1_1987_2325	112
2296	3300050496	nmdc:mga07m45_4156_c1	nmdc:mga07m45_4156_c1_4181_4519	112
2297	3300050496	nmdc:mga07m45_42688_c1	nmdc:mga07m45_42688_c1_1579_1917	112
2298	3300050496	nmdc:mga07m45_456517_c1	nmdc:mga07m45_456517_c1_33_371	112
2299	3300050496	nmdc:mga07m45_47374_c1	nmdc:mga07m45_47374_c1_993_1331	112
2300	3300050496	nmdc:mga07m45_51524_c1	nmdc:mga07m45_51524_c1_1228_1566	112
2301	3300050496	nmdc:mga07m45_57467_c1	nmdc:mga07m45_57467_c1_1256_1594	112
2302	3300050496	nmdc:mga07m45_63097_c1	nmdc:mga07m45_63097_c1_1210_1548	112
2303	3300050496	nmdc:mga07m45_63_c1	nmdc:mga07m45_63_c1_34337_34675	112
2304	3300050496	nmdc:mga07m45_765786_c1	nmdc:mga07m45_765786_c1_124_462	112
2305	3300050496	nmdc:mga07m45_8991_c1	nmdc:mga07m45_8991_c1_3595_3933	112
2306	3300050496	nmdc:mga07m45_89_c1	nmdc:mga07m45_89_c1_12223_12561	112
2307	3300050507	nmdc:mga05p37_224604_c1	nmdc:mga05p37_224604_c1_551_889	112
2308	3300050509	nmdc:mga0qj67_513127_c1	nmdc:mga0qj67_513127_c1_423_761	112
2309	3300050511	nmdc:mga08y16_1118147_c1	nmdc:mga08y16_1118147_c1_402_740	112
2310	3300050511	nmdc:mga08y16_1203545_c1	nmdc:mga08y16_1203545_c1_13_351	112
2311	3300050513	nmdc:mga0rr50_1478700_c1	nmdc:mga0rr50_1478700_c1_168_506	112
2312	3300050515	nmdc:mga0a205_1567267_c1	nmdc:mga0a205_1567267_c1_86_424	112
2313	3300050516	nmdc:mga0sz30_255183_c1	nmdc:mga0sz30_255183_c1_177_515	112
2314	3300050516	nmdc:mga0sz30_5833_c1	nmdc:mga0sz30_5833_c1_1748_2086	112
2315	3300050516	nmdc:mga0sz30_71021_c1	nmdc:mga0sz30_71021_c1_387_725	112
2316	3300053077	Ga0495601_0019173	Ga0495601_0019173_2716_3054	112
2317	3300053079	Ga0500610_0013258	Ga0500610_0013258_126_464	112
2318	3300053080	Ga0500635_0000141	Ga0500635_0000141_33163_33501	112
2319	3300053080	Ga0500635_0174722	Ga0500635_0174722_222_560	112
2320	3300053084	Ga0495595_0027263	Ga0495595_0027263_2045_2383	112
2321	3300053085	Ga0495619_0305846	Ga0495619_0305846_510_848	112
2322	3300053086	Ga0500578_0012415	Ga0500578_0012415_2762_3100	112
2323	3300053086	Ga0500578_0014379	Ga0500578_0014379_2564_2902	112
2324	3300053086	Ga0500578_0269994	Ga0500578_0269994_290_628	112
2325	3300053086	Ga0500578_0332177	Ga0500578_0332177_479_817	112
2326	3300053087	Ga0500643_010889	Ga0500643_010889_1162_1500	112
2327	3300053087	Ga0500643_059800	Ga0500643_059800_176_514	112
2328	3300053088	Ga0500644_0068624	Ga0500644_0068624_477_815	112
2329	3300053088	Ga0500644_0203105	Ga0500644_0203105_446_784	112
2330	3300053089	Ga0500581_347294	Ga0500581_347294_184_522	112
2331	3300053090	Ga0500646_0023313	Ga0500646_0023313_600_938	112
2332	3300053093	Ga0500651_0000430	Ga0500651_0000430_7972_8310	112
2333	3300053093	Ga0500651_0040824	Ga0500651_0040824_279_617	112
2334	3300053093	Ga0500651_0062864	Ga0500651_0062864_1660_1998	112
2335	3300053093	Ga0500651_0071886	Ga0500651_0071886_1137_1475	112
2336	3300053096	Ga0500641_0051443	Ga0500641_0051443_1216_1557	112
2337	3300053096	Ga0500641_0121902	Ga0500641_0121902_609_947	112
2338	3300053098	Ga0500650_0137949	Ga0500650_0137949_347_685	112
2339	3300053108	Ga0500562_013680	Ga0500562_013680_740_1078	112
2340	3300053108	Ga0500562_033286	Ga0500562_033286_612_950	112
2341	3300053110	Ga0500571_000252	Ga0500571_000252_6597_6935	112
2342	3300053117	Ga0500593_000652	Ga0500593_000652_3728_4066	112
2343	3300053118	Ga0500594_0001047	Ga0500594_0001047_1952_2290	112
2344	3300053118	Ga0500594_0007268	Ga0500594_0007268_1938_2276	112
2345	3300053119	Ga0500595_084247	Ga0500595_084247_474_812	112
2346	3300053121	Ga0500607_001874	Ga0500607_001874_6336_6674	112
2347	3300053122	Ga0500608_003111	Ga0500608_003111_2981_3319	112
2348	3300053122	Ga0500608_336011	Ga0500608_336011_46_387	112
2349	3300053123	Ga0500614_143450	Ga0500614_143450_176_514	112
2350	3300053125	Ga0500618_006166	Ga0500618_006166_3104_3445	112
2351	3300053128	Ga0500626_170970	Ga0500626_170970_507_845	112
2352	3300053129	Ga0500628_001978	Ga0500628_001978_2228_2566	112
2353	3300053130	Ga0500642_0003789	Ga0500642_0003789_985_1323	112
2354	3300053130	Ga0500642_0343800	Ga0500642_0343800_103_441	112
2355	3300053131	Ga0500652_000307	Ga0500652_000307_13992_14330	112
2356	3300053131	Ga0500652_051518	Ga0500652_051518_251_592	112
2357	3300053134	Ga0500658_0000352	Ga0500658_0000352_17639_17977	112
2358	3300053134	Ga0500658_0003377	Ga0500658_0003377_3278_3616	112
2359	3300053136	Ga0500559_0000191	Ga0500559_0000191_37154_37492	112
2360	3300053136	Ga0500559_0021313	Ga0500559_0021313_751_1089	112
2361	3300053136	Ga0500559_0400613	Ga0500559_0400613_19_366	112
2362	3300053139	Ga0500568_0008116	Ga0500568_0008116_41_379	112
2363	3300053139	Ga0500568_0010712	Ga0500568_0010712_2526_2864	112
2364	3300053139	Ga0500568_0013994	Ga0500568_0013994_3138_3476	112
2365	3300053139	Ga0500568_0023355	Ga0500568_0023355_1880_2218	112
2366	3300053142	Ga0500577_0056692	Ga0500577_0056692_363_701	112
2367	3300053145	Ga0500586_272474	Ga0500586_272474_68_406	112
2368	3300053149	Ga0500600_0004796	Ga0500600_0004796_6771_7115	112
2369	3300053151	Ga0500604_0005077	Ga0500604_0005077_1410_1748	112
2370	3300053153	Ga0500616_0079455	Ga0500616_0079455_808_1146	112
2371	3300053154	Ga0500619_001373	Ga0500619_001373_3421_3759	112
2372	3300053156	Ga0500622_0000160	Ga0500622_0000160_32716_33054	112
2373	3300053156	Ga0500622_0001454	Ga0500622_0001454_3944_4282	112
2374	3300053156	Ga0500622_0002916	Ga0500622_0002916_8554_8892	112
2375	3300053156	Ga0500622_0049393	Ga0500622_0049393_17_355	112
2376	3300053158	Ga0500627_0082231	Ga0500627_0082231_26_364	112
2377	3300053158	Ga0500627_0228641	Ga0500627_0228641_10_348	112
2378	3300053158	Ga0500627_0393109	Ga0500627_0393109_233_571	112
2379	3300053161	Ga0500634_0002470	Ga0500634_0002470_878_1216	112
2380	3300053162	Ga0500638_003518	Ga0500638_003518_2750_3088	112
2381	3300053177	Ga0500636_0000056	Ga0500636_0000056_8459_8806	112
2382	3300053177	Ga0500636_0021960	Ga0500636_0021960_849_1187	112
2383	3300053177	Ga0500636_0176766	Ga0500636_0176766_776_1114	112
2384	3300053178	Ga0500637_0082707	Ga0500637_0082707_538_885	112
2385	3300053729	Ga0500625_159704	Ga0500625_159704_461_808	112
2386	3300053730	Ga0500645_006616	Ga0500645_006616_2639_2977	112
2387	3300053730	Ga0500645_130547	Ga0500645_130547_83_421	112
2388	3300059421	Ga0590071_000819	Ga0590071_000819_4667_5008	112
2389	3300059423	Ga0590074_014194	Ga0590074_014194_549_890	112
2390	3300059426	Ga0590077_094099	Ga0590077_094099_232_570	112
2391	3300059652	Ga0587107_039858	Ga0587107_039858_156_497	112
2392	3300061719	Ga0466962_0023883	Ga0466962_0023883_358_696	112
2393	3300061719	Ga0466962_0174104	Ga0466962_0174104_282_620	112
2394	3300061719	Ga0466962_0613120	Ga0466962_0613120_207_545	112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

27

108

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1i7h-assembly3.cif.gz_C	crystal sturcuture of fdx	0.9753	2	108
1i7h-assembly3.cif.gz_C	crystal sturcuture of fdx	0.9577	2	108
3ah7-assembly1.cif.gz_A-2	crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004	0.9543	1	107
3ah7-assembly1.cif.gz_A-2	crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004	0.9292	1	107
3n9y-assembly1.cif.gz_C	crystal structure of human cyp11a1 in complex with cholesterol	0.8668	26	89

ID	Description	Score	Start	End	Superfamily
1i7hA00	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.9679	2	110	3.10.20.30
1i7hA00	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.9593	2	110	3.10.20.30
af_Q9CPW2_55_168_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.867	2	107	3.10.20.30
af_A4I756_34_144_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.8637	2	104	3.10.20.30
4ltuB00	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.8604	2	104	3.10.20.30

ID	Description	Score	Start	End	GO Terms
AF-A0A6L9CCH0-F1-model_v4	deleted	0.9842	1	91
AF-Q89A15-F1-model_v4	2Fe-2S ferredoxin	0.9767	1	107	GO:0005829 GO:0009055 GO:0046872 GO:0051537 GO:0140647
AF-A0A6L5CA48-F1-model_v4	deleted	0.9763	45	101
AF-A0A6L9CCH0-F1-model_v4	deleted	0.9736	1	91
AF-A0A455TAU1-F1-model_v4	2Fe-2S ferredoxin	0.9729	1	107	GO:0005829 GO:0009055 GO:0051537 GO:0140647

Feature Viewer

pLDDT	pTM	Quality
88.27	0.83	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496772

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

27

108

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map