F496745

General Info

Members Datasets Scaffolds Average Seq Length
2369 826 2130 275

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0782180|Ga0451853_0782180_287_1123
Length 259
Sequence MSRPANPVTLPLAQYVPVHFLLAVADGVATVTLNRPERKNPLTFESYRELTDFFRACAFDDEVKTVVVTGAGGNFSSGGDVFEIIGPLVKMDTKGLTAFTRMTGDLVKAMRACPQPIVAAVGGICAKVAFLFNKVGLAGCDMGACAILPRIIGQSRASELLYTGRFMTAEEGERWGFFSRIVAPDQVLSEAQALARQVTEGPTFANTMTKRMLAMEWAMSVEEAIEAEAVAQALCMTTADFARAFEAFSNKARPVFQGN

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
21 2547132374 Acidovorax radicis N35 Isolate Unclassified
22 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
23 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
24 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
25 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221570 Acidovorax sp. Root568 Isolate Unclassified
30 2643221596 Acidovorax sp. Root70 Isolate Unclassified
31 2643221611 Acidovorax sp. Root219 Isolate Unclassified
32 2643221652 Acidovorax sp. Root402 Isolate Unclassified
33 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
34 2643221717 Acidovorax sp. Root267 Isolate Unclassified
35 2721755523 Delftia sp. HK171 Isolate Unclassified
36 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
37 2738541337 Pelomonas sp. BT06 Isolate Unclassified
38 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
39 2773857925 Microvirga vignae BR3299 Isolate Unclassified
40 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
41 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
42 2791355199
43 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
44 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
45 2818991446 Variovorax sp. 1180 Isolate Unclassified
46 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
47 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
48 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
49 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
50 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
51 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
52 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
53 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
54 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
55 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
56 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
57 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
58 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
59 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
60 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
61 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
62 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
63 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
64 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
65 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
66 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
67 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
68 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
69 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
70 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
71 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
72 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
73 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
74 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
75 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
76 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
77 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
78 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
79 2842733646 Variovorax sp. R-72446 Isolate Unclassified
80 2842747753 Variovorax sp. R-72060 Isolate Unclassified
81 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
82 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
83 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
84 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
85 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
86 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
87 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
88 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
89 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
90 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
91 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
92 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
93 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
94 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
95 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
96 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
97 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
98 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
99 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
100 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
101 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
102 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
103 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
104 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
105 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
106 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
107 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
108 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
109 2885198086 Variovorax sp. 679 Isolate Unclassified
110 2885211737 Variovorax sp. 553 Isolate Unclassified
111 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
112 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
113 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
114 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
115 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
116 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
117 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
118 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
119 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
120 2899924645 Variovorax sp. 369 Isolate Unclassified
121 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
122 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
123 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
124 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
125 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
126 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
127 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
128 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
129 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
130 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
131 2922368715
132 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
133 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
134 2928037797 Variovorax sp. 1126 Isolate Unclassified
135 2928044640 Variovorax sp. 1128 Isolate Unclassified
136 2928051484 Variovorax sp. 1133 Isolate Unclassified
137 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
138 2928070936 Variovorax gossypii 1167 Isolate Unclassified
139 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
140 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
141 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
142 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
143 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
144 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
145 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
146 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
147 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
148 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
149 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
150 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
151 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
152 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
153 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
154 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
155 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
156 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
157 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
158 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
159 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
160 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
161 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
162 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
163 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
164 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
165 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
166 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
167 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
168 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
169 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
170 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
171 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
172 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
173 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
174 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
175 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
176 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
177 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
178 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
179 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
180 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
181 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
182 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
183 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
184 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
185 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
186 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
187 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
188 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
189 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
190 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
191 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
192 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
193 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
194 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
195 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
196 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
197 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
198 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
199 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
200 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
201 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
202 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
203 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
204 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
205 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
206 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
207 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
208 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
209 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
210 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
211 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
212 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
213 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
214 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
215 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
216 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
217 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
218 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
219 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
220 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
221 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
222 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
223 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
224 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
225 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
226 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
227 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
228 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
229 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
230 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
231 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
232 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
233 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
234 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
235 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
236 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
237 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
238 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
239 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
240 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
241 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
242 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
243 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
244 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
245 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
246 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
247 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
248 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
249 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
250 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
251 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
252 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
253 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
254 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
255 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
256 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
257 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
258 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
259 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
260 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
261 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
262 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
263 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
264 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
265 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
266 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
267 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
268 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
269 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
270 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
271 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
272 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
273 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
274 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
275 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
276 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
277 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
278 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
279 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
280 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
281 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
282 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
283 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
284 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
285 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
286 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
287 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
288 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
289 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
290 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
291 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
292 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
293 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
294 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
295 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
296 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
297 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
298 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
299 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
300 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
301 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
302 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
303 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
304 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
305 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
306 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
307 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
308 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
309 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
310 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
311 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
312 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
313 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
314 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
315 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
316 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
317 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
318 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
319 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
320 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
321 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
322 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
323 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
324 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
325 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
326 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
327 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
328 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
329 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
330 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
331 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
332 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
333 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
334 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
335 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
336 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
337 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
338 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
339 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
340 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
341 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
342 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
343 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
344 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
345 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
346 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
347 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
348 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
349 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
350 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
351 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
352 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
353 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
354 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
355 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
356 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
357 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
358 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
359 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
360 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
361 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
362 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
363 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
364 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
365 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
366 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
367 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
368 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
369 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
370 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
371 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
372 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
373 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
374 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
378 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
380 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
381 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
382 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
383 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
385 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
386 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
387 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
388 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
389 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
390 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
391 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
393 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
394 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
396 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
461 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
462 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
463 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
464 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
465 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
467 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
468 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
469 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
470 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
471 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
472 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
476 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
477 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
478 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
479 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
480 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
481 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
482 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
483 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
484 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
485 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
488 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
489 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
490 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
491 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
492 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
493 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
494 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
495 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
496 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
497 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
498 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
499 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
500 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
501 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
502 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
503 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
504 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
505 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
506 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
507 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
508 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
509 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
510 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
511 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
512 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
513 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
514 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
515 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
516 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
517 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
518 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
519 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
520 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
521 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
522 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
523 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
524 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
525 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
526 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
527 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
528 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
529 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
530 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
531 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
532 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
533 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
534 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
535 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
536 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
537 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
538 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
539 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
540 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
541 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
542 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
543 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
544 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
545 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
546 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
547 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
548 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
549 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
550 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
551 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
552 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
553 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
554 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
555 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
556 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
557 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
558 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
559 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
560 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
561 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
562 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
563 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
564 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
565 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
566 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
567 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
568 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
569 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
570 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
571 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
572 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
573 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
574 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
575 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
576 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
577 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
578 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
579 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
580 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
581 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
582 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
583 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
584 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
585 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
586 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
587 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
588 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
589 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
590 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
591 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
592 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
593 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
594 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
595 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
596 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
597 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
598 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
599 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
600 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
601 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
602 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
603 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
604 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
605 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
606 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
607 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
608 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
609 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
610 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
611 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
612 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
613 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
614 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
615 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
616 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
617 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
618 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
619 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
620 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
621 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
622 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
623 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
624 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
625 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
626 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
627 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
628 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
629 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
630 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
631 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
632 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
633 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
634 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
635 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
636 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
637 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
638 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
639 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
640 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
641 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
642 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
643 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
644 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
645 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
646 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
647 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
648 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
649 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
650 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
651 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
652 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
653 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
654 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
655 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
656 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
657 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
658 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
659 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
660 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
661 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
662 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
663 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
664 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
665 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
666 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
667 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
668 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
669 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
670 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
671 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
672 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
673 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
674 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
675 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
676 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
677 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
678 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
679 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
680 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
681 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
682 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
683 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
684 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
685 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
686 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
687 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
688 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
689 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
690 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
691 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
692 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
693 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
694 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
695 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
696 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
697 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
698 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
699 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
700 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
701 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
702 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
703 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
704 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
705 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
706 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
707 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
708 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
709 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
710 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
711 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
712 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
713 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
714 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
715 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
716 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
717 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
718 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
719 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
720 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
721 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
722 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
723 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
724 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
725 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
726 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
727 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
728 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
729 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
730 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
731 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
732 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
733 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
734 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
735 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
736 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
737 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
738 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
739 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
740 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
741 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
742 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
743 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
744 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
745 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
746 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
747 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
748 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
749 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
750 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
751 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
752 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
753 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
754 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
755 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
756 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
757 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
758 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
759 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
760 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
761 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
762 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
763 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
764 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
765 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
766 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
767 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
768 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
769 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
770 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
771 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
772 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
773 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
774 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
775 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
776 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
777 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
778 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
779 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
780 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
781 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
782 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
783 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
784 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
785 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
786 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
787 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
788 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
789 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
790 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
791 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
792 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
793 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
794 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
795 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
796 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
797 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
798 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
799 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
800 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
801 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
802 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
803 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
804 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
805 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
806 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
807 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
808 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
809 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
810 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
811 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
812 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
813 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
814 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
815 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
816 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
817 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
818 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
819 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
820 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
821 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
822 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
823 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
824 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
825 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
826 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.69
Metatranscriptomes 0.3
Isolates 10.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.4
Nodule 6.96
Rhizoplane 3.93
Rhizosphere 69.48
Stem 0
Stem Tuber 0.04
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011385 3300001989 Bacteria 3285
2 JGI24739J22299_10025926 3300001989 Bacteria 2060
3 JGI24737J22298_10003686 3300001990 Bacteria 5395
4 JGI24743J22301_10002134 3300001991 Bacteria 2921
5 JGI24735J21928_10027784 3300002067 Bacteria 1694
6 JGI25152J39213_1003814 3300002773 Bacteria 4994
7 JGI25150J39212_1002872 3300002774 Bacteria 4172
8 JGI25151J46595_10000332 3300003187 Bacteria 50552
9 JGI25151J46595_10002370 3300003187 Bacteria 11431
10 JGI25406J46586_10000224 3300003203 Bacteria 25048
11 JGI25406J46586_10001185 3300003203 Bacteria 12280
12 JGI25165J46597_1004828 3300003214 Bacteria 2754
13 JGI25153J46596_10000110 3300003215 Bacteria 93591
14 JGI25153J46596_10000161 3300003215 Bacteria 67388
15 JGI25153J46596_10000725 3300003215 Bacteria 20204
16 JGI25153J46596_10001735 3300003215 Bacteria 12943
17 JGI25153J46596_10003973 3300003215 Bacteria 8090
18 JGI25153J46596_10033295 3300003215 Bacteria 1703
19 rootL2_10023171 3300003322 Bacteria 1561
20 JGI25160J50197_1002211 3300003354 Bacteria 9140
21 JGI25160J50197_1002809 3300003354 Bacteria 7972
22 JGI25160J50197_1008188 3300003354 Bacteria 4006
23 JGI25161J50226_1009901 3300003374 Bacteria 1316
24 Ga0006562J51391_1115764 3300003578 Bacteria 3454
25 Ga0006562J51391_1115765 3300003578 Bacteria 1470
26 JGI25404J52841_10004559 3300003659 Bacteria 2816
27 Ga0055535_1000874 3300003761 Bacteria 21113
28 Ga0055542_1000003 3300003762 Bacteria 582721
29 Ga0055526_1000102 3300003771 Bacteria 74957
30 Ga0055526_1000104 3300003771 Bacteria 73451
31 Ga0055536_1003234 3300003781 Bacteria 8824
32 Ga0055534_1006690 3300003784 Bacteria 2866
33 Ga0055530_10000292 3300003791 Bacteria 45623
34 Ga0055540_1023025 3300003792 Bacteria 1578
35 Ga0055531_10004166 3300003794 Bacteria 8916
36 Ga0055531_10022600 3300003794 Bacteria 2390
37 Ga0055531_10024346 3300003794 Bacteria 2237
38 Ga0055543_1002636 3300004625 Bacteria 5777
39 Ga0055543_1009855 3300004625 Bacteria 2030
40 Ga0065165_1000244 3300005262 Bacteria 93411
41 Ga0065165_1000368 3300005262 Bacteria 73904
42 Ga0065165_1005521 3300005262 Bacteria 7066
43 Ga0065165_1024612 3300005262 Bacteria 2018
44 Ga0065715_10001629 3300005293 Bacteria 12037
45 Ga0070658_10000029 3300005327 Bacteria 156910
46 Ga0070658_10009418 3300005327 Bacteria 7846
47 Ga0070658_10036717 3300005327 Bacteria 3949
48 Ga0070658_10056840 3300005327 Bacteria 3181
49 Ga0070658_10062936 3300005327 Bacteria 3024
50 Ga0070676_10107924 3300005328 Bacteria 1729
51 Ga0070683_100016648 3300005329 Bacteria 6487
52 Ga0070683_100019922 3300005329 Bacteria 5964
53 Ga0070683_100161233 3300005329 Bacteria 2128
54 Ga0070683_100544406 3300005329 Bacteria 1110
55 Ga0070690_100284451 3300005330 Bacteria 1181
56 Ga0070670_100009818 3300005331 Bacteria 8176
57 Ga0070670_100033220 3300005331 Bacteria 4445
58 Ga0070670_100061218 3300005331 Bacteria 3232
59 Ga0070677_10009599 3300005333 Bacteria 3287
60 Ga0070677_10019880 3300005333 Bacteria 2439
61 Ga0070677_10021259 3300005333 Bacteria 2378
62 Ga0070677_10139572 3300005333 Bacteria 1116
63 Ga0068869_100103869 3300005334 Bacteria 2153
64 Ga0068869_100313676 3300005334 Bacteria 1270
65 Ga0068869_100491093 3300005334 Bacteria 1023
66 Ga0070666_10107047 3300005335 Bacteria 1932
67 Ga0070666_10145219 3300005335 Bacteria 1654
68 Ga0070666_10234772 3300005335 Bacteria 1296
69 Ga0070680_100001995 3300005336 Bacteria 15024
70 Ga0070680_100053429 3300005336 Bacteria 3298
71 Ga0070680_100086504 3300005336 Bacteria 2591
72 Ga0070680_100099818 3300005336 Bacteria 2409
73 Ga0070680_100184215 3300005336 Bacteria 1759
74 Ga0070680_100195563 3300005336 Bacteria 1705
75 Ga0068868_100000005 3300005338 Bacteria 132403
76 Ga0068868_100008462 3300005338 Bacteria 7368
77 Ga0068868_100061484 3300005338 Bacteria 2975
78 Ga0068868_100159091 3300005338 Bacteria 1864
79 Ga0068868_100203468 3300005338 Bacteria 1652
80 Ga0070660_100003340 3300005339 Bacteria 11025
81 Ga0070660_100003372 3300005339 Bacteria 10987
82 Ga0070660_100027919 3300005339 Bacteria 4217
83 Ga0070660_100053813 3300005339 Bacteria 3105
84 Ga0070660_100087222 3300005339 Bacteria 2456
85 Ga0070660_100101200 3300005339 Bacteria 2283
86 Ga0070660_100176875 3300005339 Bacteria 1726
87 Ga0070660_100452773 3300005339 Bacteria 1065
88 Ga0070689_100269658 3300005340 Bacteria 1409
89 Ga0070689_100400099 3300005340 Bacteria 1161
90 Ga0070691_10002854 3300005341 Bacteria 7735
91 Ga0070687_100134621 3300005343 Bacteria 1431
92 Ga0070661_100012406 3300005344 Bacteria 5962
93 Ga0070661_100040022 3300005344 Bacteria 3418
94 Ga0070661_100076796 3300005344 Bacteria 2462
95 Ga0070661_100082171 3300005344 Bacteria 2379
96 Ga0070661_100316497 3300005344 Bacteria 1218
97 Ga0070661_100457904 3300005344 Bacteria 1016
98 Ga0070692_10001329 3300005345 Bacteria 8896
99 Ga0070668_100002567 3300005347 Bacteria 13355
100 Ga0070668_100084992 3300005347 Bacteria 2486
101 Ga0070668_100086608 3300005347 Bacteria 2463
102 Ga0070668_100115435 3300005347 Bacteria 2140
103 Ga0070668_100158902 3300005347 Bacteria 1833
104 Ga0070668_100199720 3300005347 Bacteria 1641
105 Ga0070668_100461574 3300005347 Bacteria 1094
106 Ga0070668_100470019 3300005347 Bacteria 1084
107 Ga0070669_100003020 3300005353 Bacteria 12112
108 Ga0070669_100018096 3300005353 Bacteria 5033
109 Ga0070669_100025367 3300005353 Bacteria 4257
110 Ga0070669_100061056 3300005353 Bacteria 2769
111 Ga0070669_100248902 3300005353 Bacteria 1414
112 Ga0070669_100322007 3300005353 Bacteria 1249
113 Ga0070669_100353281 3300005353 Bacteria 1194
114 Ga0070669_100419944 3300005353 Bacteria 1097
115 Ga0070669_100596703 3300005353 Bacteria 925
116 Ga0070675_100001425 3300005354 Bacteria 17561
117 Ga0070675_100012081 3300005354 Bacteria 6768
118 Ga0070675_100033049 3300005354 Bacteria 4191
119 Ga0070675_100229226 3300005354 Bacteria 1620
120 Ga0070675_100269558 3300005354 Bacteria 1494
121 Ga0070675_100398498 3300005354 Bacteria 1227
122 Ga0070671_100116660 3300005355 Bacteria 2245
123 Ga0070671_100311675 3300005355 Bacteria 1340
124 Ga0070674_100018354 3300005356 Bacteria 4422
125 Ga0070674_100024025 3300005356 Bacteria 3953
126 Ga0070674_100229094 3300005356 Bacteria 1449
127 Ga0070673_100007540 3300005364 Bacteria 7190
128 Ga0070673_100053106 3300005364 Bacteria 3181
129 Ga0070673_100062072 3300005364 Bacteria 2968
130 Ga0070673_100276446 3300005364 Bacteria 1471
131 Ga0070673_100328445 3300005364 Bacteria 1352
132 Ga0070673_100365801 3300005364 Bacteria 1283
133 Ga0070688_100127320 3300005365 Bacteria 1713
134 Ga0070688_100139361 3300005365 Bacteria 1646
135 Ga0070688_100562113 3300005365 Bacteria 869
136 Ga0070659_100000011 3300005366 Bacteria 185903
137 Ga0070659_100000968 3300005366 Bacteria 21135
138 Ga0070659_100006463 3300005366 Bacteria 8464
139 Ga0070659_100021021 3300005366 Bacteria 4964
140 Ga0070659_100026467 3300005366 Bacteria 4464
141 Ga0070659_100045117 3300005366 Bacteria 3453
142 Ga0070659_100096750 3300005366 Bacteria 2372
143 Ga0070659_100108965 3300005366 Bacteria 2235
144 Ga0070659_100184351 3300005366 Bacteria 1714
145 Ga0070659_100247864 3300005366 Bacteria 1476
146 Ga0070659_100377970 3300005366 Bacteria 1193
147 Ga0070667_100022671 3300005367 Bacteria 5206
148 Ga0070667_100023212 3300005367 Bacteria 5146
149 Ga0070667_100410524 3300005367 Bacteria 1234
150 Ga0070667_100435448 3300005367 Bacteria 1197
151 Ga0070709_10001991 3300005434 Bacteria 11124
152 Ga0070709_10132374 3300005434 Bacteria 1704
153 Ga0070714_100042921 3300005435 Bacteria 3822
154 Ga0070714_100130606 3300005435 Bacteria 2245
155 Ga0070714_100192269 3300005435 Bacteria 1863
156 Ga0070714_100628752 3300005435 Bacteria 1032
157 Ga0070713_100000921 3300005436 Bacteria 18747
158 Ga0070713_100018458 3300005436 Bacteria 5301
159 Ga0070713_100020170 3300005436 Bacteria 5105
160 Ga0070713_100034285 3300005436 Bacteria 4076
161 Ga0070713_100047162 3300005436 Bacteria 3540
162 Ga0070713_100048195 3300005436 Bacteria 3506
163 Ga0070713_100049692 3300005436 Bacteria 3461
164 Ga0070710_10000965 3300005437 Bacteria 13640
165 Ga0070710_10002824 3300005437 Bacteria 8279
166 Ga0070711_100001902 3300005439 Bacteria 11671
167 Ga0070711_100009556 3300005439 Bacteria 5981
168 Ga0070711_100012353 3300005439 Bacteria 5331
169 Ga0070711_100015153 3300005439 Bacteria 4874
170 Ga0070711_100016194 3300005439 Bacteria 4731
171 Ga0070711_100151945 3300005439 Bacteria 1747
172 Ga0070711_100308984 3300005439 Bacteria 1260
173 Ga0070694_100004766 3300005444 Bacteria 8168
174 Ga0070694_100285477 3300005444 Bacteria 1260
175 Ga0070694_100501941 3300005444 Bacteria 965
176 Ga0070708_100138030 3300005445 Bacteria 2260
177 Ga0070663_100081745 3300005455 Bacteria 2375
178 Ga0070663_100109870 3300005455 Bacteria 2070
179 Ga0070663_100147387 3300005455 Bacteria 1802
180 Ga0070663_100255185 3300005455 Bacteria 1389
181 Ga0070663_100352031 3300005455 Bacteria 1193
182 Ga0070678_100018801 3300005456 Bacteria 4486
183 Ga0070678_100041156 3300005456 Bacteria 3274
184 Ga0070678_100073083 3300005456 Bacteria 2572
185 Ga0070678_100101718 3300005456 Bacteria 2228
186 Ga0070678_100192228 3300005456 Bacteria 1679
187 Ga0070678_100215430 3300005456 Bacteria 1593
188 Ga0070678_100428401 3300005456 Bacteria 1155
189 Ga0070678_100517960 3300005456 Bacteria 1055
190 Ga0070678_100520181 3300005456 Bacteria 1052
191 Ga0070662_100004215 3300005457 Bacteria 9058
192 Ga0070662_100013471 3300005457 Bacteria 5442
193 Ga0070662_100017872 3300005457 Bacteria 4786
194 Ga0070662_100047168 3300005457 Bacteria 3098
195 Ga0070662_100064068 3300005457 Bacteria 2690
196 Ga0070662_100099585 3300005457 Bacteria 2197
197 Ga0070662_100178278 3300005457 Bacteria 1673
198 Ga0070662_100229187 3300005457 Bacteria 1485
199 Ga0070662_100310415 3300005457 Bacteria 1284
200 Ga0070662_100337326 3300005457 Bacteria 1232
201 Ga0070681_10028028 3300005458 Bacteria 5661
202 Ga0070681_10041251 3300005458 Bacteria 4625
203 Ga0070681_10046096 3300005458 Bacteria 4359
204 Ga0070681_10107243 3300005458 Bacteria 2734
205 Ga0070681_10195409 3300005458 Bacteria 1942
206 Ga0068867_100000285 3300005459 Bacteria 33321
207 Ga0068867_100033571 3300005459 Bacteria 3717
208 Ga0068867_100075533 3300005459 Bacteria 2528
209 Ga0068867_100108796 3300005459 Bacteria 2126
210 Ga0068867_100301498 3300005459 Bacteria 1321
211 Ga0068867_100349792 3300005459 Bacteria 1233
212 Ga0070685_10065060 3300005466 Bacteria 2146
213 Ga0070706_100220047 3300005467 Bacteria 1772
214 Ga0070707_100042282 3300005468 Bacteria 4363
215 Ga0070707_100043146 3300005468 Bacteria 4318
216 Ga0070707_100064812 3300005468 Bacteria 3509
217 Ga0070707_100101632 3300005468 Bacteria 2786
218 Ga0070699_100008958 3300005518 Bacteria 8670
219 Ga0070679_100000007 3300005530 Bacteria 195373
220 Ga0070679_100003827 3300005530 Bacteria 13814
221 Ga0070679_100021536 3300005530 Bacteria 6295
222 Ga0070679_100032253 3300005530 Bacteria 5180
223 Ga0070679_100036859 3300005530 Bacteria 4855
224 Ga0070679_100067766 3300005530 Bacteria 3559
225 Ga0070679_100102813 3300005530 Bacteria 2843
226 Ga0070679_100287187 3300005530 Bacteria 1597
227 Ga0070679_100341473 3300005530 Bacteria 1445
228 Ga0070679_100369681 3300005530 Bacteria 1381
229 Ga0070679_100654731 3300005530 Bacteria 993
230 Ga0070684_100041168 3300005535 Bacteria 3982
231 Ga0070697_100016393 3300005536 Bacteria 5826
232 Ga0070697_100337114 3300005536 Bacteria 1301
233 Ga0068853_100017303 3300005539 Bacteria 5951
234 Ga0068853_100064981 3300005539 Bacteria 3165
235 Ga0068853_100092671 3300005539 Bacteria 2658
236 Ga0068853_100180221 3300005539 Bacteria 1916
237 Ga0068853_100218220 3300005539 Bacteria 1741
238 Ga0068853_100595522 3300005539 Bacteria 1050
239 Ga0070672_100001070 3300005543 Bacteria 16660
240 Ga0070672_100080622 3300005543 Bacteria 2608
241 Ga0070672_100135539 3300005543 Bacteria 2027
242 Ga0070672_100142885 3300005543 Bacteria 1975
243 Ga0070672_100360406 3300005543 Bacteria 1241
244 Ga0070686_100074623 3300005544 Bacteria 2229
245 Ga0070686_100535947 3300005544 Bacteria 914
246 Ga0070696_100011158 3300005546 Bacteria 6011
247 Ga0070696_100013451 3300005546 Bacteria 5491
248 Ga0070696_100077454 3300005546 Bacteria 2350
249 Ga0070696_100114521 3300005546 Bacteria 1945
250 Ga0070693_100069589 3300005547 Bacteria 2069
251 Ga0070693_100247563 3300005547 Bacteria 1180
252 Ga0070665_100000380 3300005548 Bacteria 65676
253 Ga0070665_100013089 3300005548 Bacteria 8353
254 Ga0070665_100025378 3300005548 Bacteria 5972
255 Ga0070665_100027447 3300005548 Bacteria 5735
256 Ga0070665_100051209 3300005548 Bacteria 4141
257 Ga0070665_100059843 3300005548 Bacteria 3818
258 Ga0070665_100095605 3300005548 Bacteria 2976
259 Ga0070665_100188831 3300005548 Bacteria 2061
260 Ga0070665_100190426 3300005548 Bacteria 2052
261 Ga0070665_100207744 3300005548 Bacteria 1959
262 Ga0070665_100215214 3300005548 Bacteria 1922
263 Ga0070665_100330690 3300005548 Bacteria 1528
264 Ga0070665_100522529 3300005548 Bacteria 1198
265 Ga0068855_100004718 3300005563 Bacteria 16648
266 Ga0068855_100007683 3300005563 Bacteria 13027
267 Ga0068855_100019660 3300005563 Bacteria 8111
268 Ga0068855_100032183 3300005563 Bacteria 6262
269 Ga0068855_100043191 3300005563 Bacteria 5341
270 Ga0068855_100057975 3300005563 Bacteria 4538
271 Ga0068855_100082424 3300005563 Bacteria 3728
272 Ga0068855_100138623 3300005563 Bacteria 2774
273 Ga0068855_100629260 3300005563 Bacteria 1155
274 Ga0070664_100004242 3300005564 Bacteria 11532
275 Ga0070664_100044608 3300005564 Bacteria 3743
276 Ga0070664_100063796 3300005564 Bacteria 3141
277 Ga0070664_100102590 3300005564 Bacteria 2489
278 Ga0070664_100280293 3300005564 Bacteria 1503
279 Ga0070664_100341577 3300005564 Bacteria 1360
280 Ga0070664_100353660 3300005564 Bacteria 1337
281 Ga0070664_100446003 3300005564 Bacteria 1188
282 Ga0070664_100760195 3300005564 Bacteria 905
283 Ga0068857_100053451 3300005577 Bacteria 3583
284 Ga0068857_100054029 3300005577 Bacteria 3563
285 Ga0068857_100068647 3300005577 Bacteria 3155
286 Ga0068854_100040820 3300005578 Bacteria 3275
287 Ga0068854_100079018 3300005578 Bacteria 2425
288 Ga0068854_100189799 3300005578 Bacteria 1609
289 Ga0068854_100221032 3300005578 Bacteria 1499
290 Ga0068854_100261181 3300005578 Bacteria 1386
291 Ga0068854_100264672 3300005578 Bacteria 1378
292 Ga0068856_100000147 3300005614 Bacteria 71694
293 Ga0068856_100005034 3300005614 Bacteria 13085
294 Ga0068856_100069833 3300005614 Bacteria 3474
295 Ga0068856_100162305 3300005614 Bacteria 2245
296 Ga0068856_100196095 3300005614 Bacteria 2033
297 Ga0068856_100330638 3300005614 Bacteria 1541
298 Ga0068856_100473303 3300005614 Bacteria 1273
299 Ga0070702_100086925 3300005615 Bacteria 1887
300 Ga0068852_100022132 3300005616 Bacteria 5092
301 Ga0068852_100030238 3300005616 Bacteria 4456
302 Ga0068852_100035255 3300005616 Bacteria 4171
303 Ga0068852_100040905 3300005616 Bacteria 3915
304 Ga0068852_100050969 3300005616 Bacteria 3550
305 Ga0068852_100148554 3300005616 Bacteria 2177
306 Ga0068852_100173399 3300005616 Bacteria 2023
307 Ga0068852_100180522 3300005616 Bacteria 1985
308 Ga0068852_100215312 3300005616 Bacteria 1824
309 Ga0068859_100005527 3300005617 Bacteria 12872
310 Ga0068859_100050860 3300005617 Bacteria 4163
311 Ga0068859_100057981 3300005617 Bacteria 3900
312 Ga0068859_100125347 3300005617 Bacteria 2637
313 Ga0068859_100269639 3300005617 Bacteria 1794
314 Ga0068864_100023922 3300005618 Bacteria 5134
315 Ga0068864_100071279 3300005618 Bacteria 3025
316 Ga0068864_100094335 3300005618 Bacteria 2645
317 Ga0068864_100153816 3300005618 Bacteria 2086
318 Ga0068864_100713358 3300005618 Bacteria 980
319 Ga0068866_10054748 3300005718 Bacteria 2046
320 Ga0068861_100037014 3300005719 Bacteria 3626
321 Ga0068861_100153652 3300005719 Bacteria 1891
322 Ga0068861_100184415 3300005719 Bacteria 1739
323 Ga0068851_10007825 3300005834 Bacteria 4920
324 Ga0068851_10009284 3300005834 Bacteria 4565
325 Ga0068851_10183801 3300005834 Bacteria 1159
326 Ga0068863_100015315 3300005841 Bacteria 7369
327 Ga0068863_100526180 3300005841 Bacteria 1166
328 Ga0068858_100011350 3300005842 Bacteria 8412
329 Ga0068858_100030269 3300005842 Bacteria 5027
330 Ga0068858_100118424 3300005842 Bacteria 2476
331 Ga0068858_100141648 3300005842 Bacteria 2257
332 Ga0068858_100258344 3300005842 Bacteria 1655
333 Ga0068858_100617325 3300005842 Bacteria 1052
334 Ga0068860_100000302 3300005843 Bacteria 68581
335 Ga0068860_100037214 3300005843 Bacteria 4658
336 Ga0068860_100037514 3300005843 Bacteria 4639
337 Ga0068860_100139851 3300005843 Bacteria 2326
338 Ga0068860_100218011 3300005843 Bacteria 1852
339 Ga0068860_100418110 3300005843 Bacteria 1328
340 Ga0068860_100449261 3300005843 Bacteria 1281
341 Ga0068862_100033548 3300005844 Bacteria 4340
342 Ga0068862_100046319 3300005844 Bacteria 3710
343 Ga0068862_100056187 3300005844 Bacteria 3372
344 Ga0068862_100066590 3300005844 Bacteria 3104
345 Ga0068862_100541415 3300005844 Bacteria 1110
346 Ga0081455_10000715 3300005937 Bacteria 43119
347 Ga0081455_10069205 3300005937 Bacteria 2936
348 Ga0081455_10167403 3300005937 Bacteria 1678
349 Ga0081540_1000085 3300005983 Bacteria 99716
350 Ga0081540_1005117 3300005983 Bacteria 9833
351 Ga0081540_1005134 3300005983 Bacteria 9805
352 Ga0081540_1006569 3300005983 Bacteria 8439
353 Ga0081540_1014622 3300005983 Bacteria 5017
354 Ga0081540_1014909 3300005983 Bacteria 4945
355 Ga0081540_1022082 3300005983 Bacteria 3765
356 Ga0081540_1024701 3300005983 Bacteria 3480
357 Ga0081540_1032477 3300005983 Bacteria 2851
358 Ga0081540_1082270 3300005983 Bacteria 1445
359 Ga0081539_10000115 3300005985 Bacteria 188623
360 Ga0081539_10000172 3300005985 Bacteria 151505
361 Ga0081539_10000199 3300005985 Bacteria 139305
362 Ga0081539_10000785 3300005985 Bacteria 61844
363 Ga0081539_10105036 3300005985 Bacteria 1432
364 Ga0081539_10199651 3300005985 Bacteria 925
365 Ga0070717_10001544 3300006028 Bacteria 15960
366 Ga0070717_10004489 3300006028 Bacteria 10079
367 Ga0070717_10039248 3300006028 Bacteria 3852
368 Ga0070717_10062109 3300006028 Bacteria 3098
369 Ga0070717_10114498 3300006028 Bacteria 2304
370 Ga0070717_10431354 3300006028 Bacteria 1186
371 Ga0075365_10014062 3300006038 Bacteria 4806
372 Ga0075365_10021071 3300006038 Bacteria 4058
373 Ga0075365_10028542 3300006038 Bacteria 3559
374 Ga0075365_10031524 3300006038 Bacteria 3401
375 Ga0075365_10059673 3300006038 Bacteria 2543
376 Ga0075365_10209485 3300006038 Bacteria 1366
377 Ga0075365_10210133 3300006038 Bacteria 1364
378 Ga0075365_10282271 3300006038 Bacteria 1168
379 Ga0075368_10005521 3300006042 Bacteria 4356
380 Ga0075368_10013315 3300006042 Bacteria 3019
381 Ga0075368_10017067 3300006042 Bacteria 2713
382 Ga0075363_100004092 3300006048 Bacteria 6320
383 Ga0075363_100009121 3300006048 Bacteria 4656
384 Ga0075363_100088365 3300006048 Bacteria 1703
385 Ga0075363_100099858 3300006048 Bacteria 1605
386 Ga0075364_10005255 3300006051 Bacteria 7513
387 Ga0075364_10013415 3300006051 Bacteria 5036
388 Ga0075364_10052670 3300006051 Bacteria 2660
389 Ga0075364_10069176 3300006051 Bacteria 2322
390 Ga0075432_10007816 3300006058 Bacteria 3645
391 Ga0075432_10019337 3300006058 Bacteria 2326
392 Ga0070715_10002681 3300006163 Bacteria 5512
393 Ga0070716_100001142 3300006173 Bacteria 11707
394 Ga0070716_100014236 3300006173 Bacteria 4072
395 Ga0070716_100046158 3300006173 Bacteria 2450
396 Ga0070716_100097542 3300006173 Bacteria 1794
397 Ga0070716_100100009 3300006173 Bacteria 1775
398 Ga0070712_100024007 3300006175 Bacteria 4034
399 Ga0070712_100067121 3300006175 Bacteria 2552
400 Ga0070712_100286863 3300006175 Bacteria 1328
401 Ga0075362_10019216 3300006177 Bacteria 2838
402 Ga0075362_10042466 3300006177 Bacteria 2010
403 Ga0075362_10046250 3300006177 Bacteria 1935
404 Ga0075362_10077020 3300006177 Bacteria 1532
405 Ga0075362_10093559 3300006177 Bacteria 1398
406 Ga0075367_10022968 3300006178 Bacteria 3504
407 Ga0075367_10050940 3300006178 Bacteria 2446
408 Ga0075367_10069015 3300006178 Bacteria 2121
409 Ga0075369_10001488 3300006186 Bacteria 7991
410 Ga0075369_10045018 3300006186 Bacteria 1897
411 Ga0075369_10045822 3300006186 Bacteria 1881
412 Ga0075369_10131036 3300006186 Bacteria 1139
413 Ga0075366_10005712 3300006195 Bacteria 6752
414 Ga0075366_10013458 3300006195 Bacteria 4659
415 Ga0097621_100002807 3300006237 Bacteria 11929
416 Ga0097621_100033028 3300006237 Bacteria 4117
417 Ga0097621_100137832 3300006237 Bacteria 2083
418 Ga0097621_100158478 3300006237 Bacteria 1944
419 Ga0075370_10006725 3300006353 Bacteria 5801
420 Ga0075370_10016448 3300006353 Bacteria 3980
421 Ga0075370_10032898 3300006353 Bacteria 2901
422 Ga0075370_10061359 3300006353 Bacteria 2142
423 Ga0068871_100031492 3300006358 Bacteria 4183
424 Ga0068871_100035550 3300006358 Bacteria 3960
425 Ga0068871_100079198 3300006358 Bacteria 2718
426 Ga0068871_100122118 3300006358 Bacteria 2201
427 Ga0068871_100211413 3300006358 Bacteria 1678
428 Ga0068871_100320609 3300006358 Bacteria 1364
429 Ga0075428_100001052 3300006844 Bacteria 29310
430 Ga0075428_100039764 3300006844 Bacteria 5176
431 Ga0075428_100164641 3300006844 Bacteria 2406
432 Ga0075428_100707426 3300006844 Bacteria 1073
433 Ga0075430_100000534 3300006846 Bacteria 28676
434 Ga0075430_100029014 3300006846 Bacteria 4697
435 Ga0075431_100000254 3300006847 Bacteria 40759
436 Ga0075431_100032436 3300006847 Bacteria 5382
437 Ga0075431_100545098 3300006847 Bacteria 1148
438 Ga0075433_10003127 3300006852 Bacteria 12750
439 Ga0075433_10037592 3300006852 Bacteria 4177
440 Ga0075433_10431746 3300006852 Bacteria 1161
441 Ga0075434_100002106 3300006871 Bacteria 17308
442 Ga0075429_100000200 3300006880 Bacteria 39608
443 Ga0075429_100006359 3300006880 Bacteria 10222
444 Ga0075429_100419214 3300006880 Bacteria 1172
445 Ga0068865_100006815 3300006881 Bacteria 6996
446 Ga0068865_100033834 3300006881 Bacteria 3424
447 Ga0068865_100072880 3300006881 Bacteria 2440
448 Ga0068865_100119517 3300006881 Bacteria 1957
449 Ga0068865_100192161 3300006881 Bacteria 1580
450 Ga0068865_100395507 3300006881 Bacteria 1131
451 Ga0097620_100005527 3300006931 Bacteria 12872
452 Ga0097620_100050860 3300006931 Bacteria 4163
453 Ga0097620_100057981 3300006931 Bacteria 3900
454 Ga0097620_100125338 3300006931 Bacteria 2637
455 Ga0097620_100269638 3300006931 Bacteria 1794
456 Ga0099825_1027246 3300006941 Bacteria 2929
457 Ga0099824_1016349 3300006942 Bacteria 6749
458 Ga0079104_1000724 3300006946 Bacteria 29488
459 Ga0075435_100016695 3300007076 Bacteria 5538
460 Ga0075435_100119440 3300007076 Bacteria 2199
461 Ga0075435_100152299 3300007076 Bacteria 1945
462 Ga0075435_100170922 3300007076 Bacteria 1833
463 Ga0099794_10008728 3300007265 Bacteria 4221
464 Ga0105250_10112414 3300009092 Bacteria 1116
465 Ga0105240_10004412 3300009093 Bacteria 21461
466 Ga0105240_10008091 3300009093 Bacteria 15101
467 Ga0105240_10008642 3300009093 Bacteria 14552
468 Ga0105240_10010045 3300009093 Bacteria 13330
469 Ga0105240_10012019 3300009093 Bacteria 12001
470 Ga0105240_10015247 3300009093 Bacteria 10456
471 Ga0105240_10017488 3300009093 Bacteria 9663
472 Ga0105240_10034973 3300009093 Bacteria 6478
473 Ga0105240_10090434 3300009093 Bacteria 3741
474 Ga0105240_10090511 3300009093 Bacteria 3739
475 Ga0105240_10106678 3300009093 Bacteria 3397
476 Ga0105240_10108292 3300009093 Bacteria 3367
477 Ga0105240_10471305 3300009093 Bacteria 1401
478 Ga0105240_10760145 3300009093 Bacteria 1053
479 Ga0111539_10000564 3300009094 Bacteria 47420
480 Ga0111539_10012366 3300009094 Bacteria 10699
481 Ga0111539_10070747 3300009094 Bacteria 4118
482 Ga0111539_10082393 3300009094 Bacteria 3784
483 Ga0111539_10089824 3300009094 Bacteria 3610
484 Ga0111539_10094281 3300009094 Bacteria 3516
485 Ga0111539_10193811 3300009094 Bacteria 2370
486 Ga0111539_10244053 3300009094 Bacteria 2091
487 Ga0111539_10313824 3300009094 Bacteria 1825
488 Ga0105245_10040531 3300009098 Bacteria 4150
489 Ga0105245_10163250 3300009098 Bacteria 2115
490 Ga0105245_10189152 3300009098 Bacteria 1971
491 Ga0105245_10229063 3300009098 Bacteria 1796
492 Ga0105245_10543751 3300009098 Bacteria 1183
493 Ga0105247_10073195 3300009101 Bacteria 2146
494 Ga0105247_10108294 3300009101 Bacteria 1785
495 Ga0105247_10122189 3300009101 Bacteria 1689
496 Ga0114129_10000401 3300009147 Bacteria 50696
497 Ga0114129_10011646 3300009147 Bacteria 12519
498 Ga0114129_10226999 3300009147 Bacteria 2516
499 Ga0114129_10647731 3300009147 Bacteria 1364
500 Ga0105243_10001009 3300009148 Bacteria 26043
501 Ga0105243_10006328 3300009148 Bacteria 9146
502 Ga0105243_10108321 3300009148 Bacteria 2319
503 Ga0105243_10285668 3300009148 Bacteria 1488
504 Ga0105243_10324969 3300009148 Bacteria 1403
505 Ga0105243_10457638 3300009148 Bacteria 1199
506 Ga0105243_10512711 3300009148 Bacteria 1139
507 Ga0105243_10590422 3300009148 Bacteria 1068
508 Ga0105241_10004915 3300009174 Bacteria 9852
509 Ga0105241_10024079 3300009174 Bacteria 4521
510 Ga0105241_10072272 3300009174 Bacteria 2680
511 Ga0105241_10145832 3300009174 Bacteria 1931
512 Ga0105242_10002274 3300009176 Bacteria 15171
513 Ga0105242_10012513 3300009176 Bacteria 6532
514 Ga0105242_10141549 3300009176 Bacteria 2088
515 Ga0105242_10264759 3300009176 Bacteria 1554
516 Ga0105242_10324652 3300009176 Bacteria 1413
517 Ga0105242_10334141 3300009176 Bacteria 1394
518 Ga0105242_10652965 3300009176 Bacteria 1023
519 Ga0105248_10028788 3300009177 Bacteria 6192
520 Ga0105248_10041091 3300009177 Bacteria 5184
521 Ga0105248_10089860 3300009177 Bacteria 3458
522 Ga0105248_10111773 3300009177 Bacteria 3081
523 Ga0105248_10392028 3300009177 Bacteria 1564
524 Ga0105248_10552465 3300009177 Bacteria 1299
525 Ga0105248_10576570 3300009177 Bacteria 1269
526 Ga0105237_10000892 3300009545 Bacteria 40254
527 Ga0105237_10006394 3300009545 Bacteria 13075
528 Ga0105237_10007390 3300009545 Bacteria 12032
529 Ga0105237_10087486 3300009545 Bacteria 3105
530 Ga0105237_10097877 3300009545 Bacteria 2925
531 Ga0105237_10119279 3300009545 Bacteria 2632
532 Ga0105237_10125521 3300009545 Bacteria 2561
533 Ga0105237_10138637 3300009545 Bacteria 2427
534 Ga0105237_10362669 3300009545 Bacteria 1453
535 Ga0105237_10492705 3300009545 Bacteria 1232
536 Ga0105238_10018146 3300009551 Bacteria 7155
537 Ga0105238_10021641 3300009551 Bacteria 6550
538 Ga0105238_10024436 3300009551 Bacteria 6159
539 Ga0105238_10026218 3300009551 Bacteria 5939
540 Ga0105238_10113334 3300009551 Bacteria 2691
541 Ga0105238_10192185 3300009551 Bacteria 2017
542 Ga0105238_10206214 3300009551 Bacteria 1942
543 Ga0105238_10242693 3300009551 Bacteria 1779
544 Ga0105238_10396505 3300009551 Bacteria 1373
545 Ga0105238_10450042 3300009551 Bacteria 1285
546 Ga0105238_10520468 3300009551 Bacteria 1192
547 Ga0105249_10006166 3300009553 Bacteria 10404
548 Ga0105249_10153100 3300009553 Bacteria 2222
549 Ga0105249_10246814 3300009553 Bacteria 1768
550 Ga0105249_10280156 3300009553 Bacteria 1665
551 Ga0099796_10023926 3300010159 Bacteria 1912
552 Ga0105239_10006372 3300010375 Bacteria 13711
553 Ga0105239_10031875 3300010375 Bacteria 5792
554 Ga0105239_10038605 3300010375 Bacteria 5234
555 Ga0105239_10039382 3300010375 Bacteria 5179
556 Ga0105239_10083653 3300010375 Bacteria 3514
557 Ga0105239_10384083 3300010375 Bacteria 1588
558 Ga0105239_10838527 3300010375 Bacteria 1054
559 Ga0105246_10003387 3300011119 Bacteria 9655
560 Ga0105246_10025946 3300011119 Bacteria 3822
561 Ga0105246_10074656 3300011119 Bacteria 2398
562 Ga0105246_10094126 3300011119 Bacteria 2166
563 Ga0105246_10140827 3300011119 Bacteria 1813
564 Ga0157342_1008141 3300012507 Bacteria 1032
565 Ga0157373_10029298 3300013100 Bacteria 3965
566 Ga0157373_10049807 3300013100 Bacteria 2984
567 Ga0157373_10053043 3300013100 Bacteria 2883
568 Ga0157371_10066941 3300013102 Bacteria 2543
569 Ga0157370_10002015 3300013104 Bacteria 24961
570 Ga0157370_10038514 3300013104 Bacteria 4624
571 Ga0157370_10068482 3300013104 Bacteria 3354
572 Ga0157370_10084692 3300013104 Bacteria 2979
573 Ga0157370_10144763 3300013104 Bacteria 2213
574 Ga0157370_10239308 3300013104 Bacteria 1680
575 Ga0157369_10012743 3300013105 Bacteria 9534
576 Ga0157369_10016806 3300013105 Bacteria 8224
577 Ga0157369_10066983 3300013105 Bacteria 3862
578 Ga0157369_10332266 3300013105 Bacteria 1579
579 Ga0157374_10004594 3300013296 Bacteria 11576
580 Ga0157374_10007579 3300013296 Bacteria 9262
581 Ga0157374_10035746 3300013296 Bacteria 4546
582 Ga0157374_10173041 3300013296 Bacteria 2107
583 Ga0157374_10199058 3300013296 Bacteria 1961
584 Ga0157374_10227860 3300013296 Bacteria 1830
585 Ga0157374_10403583 3300013296 Bacteria 1364
586 Ga0157378_10032048 3300013297 Bacteria 4643
587 Ga0157378_10053721 3300013297 Bacteria 3587
588 Ga0157378_10101211 3300013297 Bacteria 2632
589 Ga0157378_10169792 3300013297 Bacteria 2045
590 Ga0163162_10007077 3300013306 Bacteria 10885
591 Ga0163162_10029211 3300013306 Bacteria 5456
592 Ga0163162_10080781 3300013306 Bacteria 3320
593 Ga0163162_10140829 3300013306 Bacteria 2525
594 Ga0163162_10395262 3300013306 Bacteria 1515
595 Ga0157372_10057177 3300013307 Bacteria 4360
596 Ga0157372_10092400 3300013307 Bacteria 3442
597 Ga0157372_10355368 3300013307 Bacteria 1707
598 Ga0157372_10720877 3300013307 Bacteria 1160
599 Ga0157375_10016147 3300013308 Bacteria 6697
600 Ga0157375_10068425 3300013308 Bacteria 3553
601 Ga0157375_10115048 3300013308 Bacteria 2793
602 Ga0157375_10123080 3300013308 Bacteria 2706
603 Ga0157375_10232686 3300013308 Bacteria 2002
604 Ga0157375_10635269 3300013308 Bacteria 1225
605 Ga0163163_10005130 3300014325 Bacteria 11291
606 Ga0163163_10128078 3300014325 Bacteria 2577
607 Ga0163163_10227834 3300014325 Bacteria 1913
608 Ga0163163_10251131 3300014325 Bacteria 1819
609 Ga0163163_10266619 3300014325 Bacteria 1764
610 Ga0163163_10311256 3300014325 Bacteria 1628
611 Ga0163163_10559056 3300014325 Bacteria 1207
612 Ga0157380_10543291 3300014326 Bacteria 1138
613 Ga0182008_10001406 3300014497 Bacteria 16196
614 Ga0182008_10034814 3300014497 Bacteria 2524
615 Ga0157377_10000226 3300014745 Bacteria 29529
616 Ga0157377_10285272 3300014745 Bacteria 1084
617 Ga0157379_10006804 3300014968 Bacteria 9883
618 Ga0157379_10006836 3300014968 Bacteria 9858
619 Ga0157379_10207663 3300014968 Bacteria 1772
620 Ga0157376_10019350 3300014969 Bacteria 5246
621 Ga0157376_10276079 3300014969 Bacteria 1581
622 Ga0163161_10009467 3300017792 Bacteria 6742
623 Ga0163161_10100605 3300017792 Bacteria 2151
624 Ga0206354_11011613 3300020081 Bacteria 3396
625 Ga0206353_10844025 3300020082 Bacteria 6329
626 Ga0214544_1000055 3300021320 Bacteria 133217
627 Ga0214542_1003337 3300021321 Bacteria 32859
628 Ga0214542_1026901 3300021321 Bacteria 2723
629 Ga0214545_1000028 3300021324 Bacteria 127957
630 Ga0214545_1026201 3300021324 Bacteria 3213
631 Ga0214543_1000044 3300021327 Bacteria 158132
632 Ga0214543_1028673 3300021327 Bacteria 2600
633 Ga0213873_10000702 3300021358 Bacteria 5450
634 Ga0213873_10022236 3300021358 Bacteria 1500
635 Ga0213872_10000018 3300021361 Bacteria 175951
636 Ga0213872_10002065 3300021361 Bacteria 12162
637 Ga0213872_10011223 3300021361 Bacteria 4243
638 Ga0213872_10053333 3300021361 Bacteria 1834
639 Ga0213872_10064933 3300021361 Bacteria 1648
640 Ga0213874_10000116 3300021377 Bacteria 13265
641 Ga0213876_10000739 3300021384 Bacteria 22677
642 Ga0213876_10077582 3300021384 Bacteria 1755
643 Ga0213876_10085625 3300021384 Bacteria 1668
644 Ga0213876_10110427 3300021384 Bacteria 1460
645 Ga0213876_10136138 3300021384 Bacteria 1307
646 Ga0213871_10040830 3300021441 Bacteria 1245
647 Ga0209672_100460 3300025228 Bacteria 23072
648 Ga0209147_100840 3300025229 Bacteria 14431
649 Ga0209258_100015 3300025242 Bacteria 706310
650 Ga0207425_1000244 3300025245 Bacteria 41649
651 Ga0207425_1002150 3300025245 Bacteria 7207
652 Ga0209677_100280 3300025253 Bacteria 34034
653 Ga0209677_103878 3300025253 Bacteria 4589
654 Ga0209148_1000028 3300025254 Bacteria 582773
655 Ga0209148_1000224 3300025254 Bacteria 92967
656 Ga0209129_1000049 3300025258 Bacteria 268086
657 Ga0209129_1000908 3300025258 Bacteria 18128
658 Ga0209129_1010353 3300025258 Bacteria 2336
659 Ga0209233_1001356 3300025261 Bacteria 9764
660 Ga0209233_1003282 3300025261 Bacteria 5737
661 Ga0209233_1024180 3300025261 Bacteria 1524
662 Ga0209565_1000862 3300025263 Bacteria 16807
663 Ga0209565_1001345 3300025263 Bacteria 11184
664 Ga0209455_1000635 3300025272 Bacteria 21604
665 Ga0209455_1008356 3300025272 Bacteria 2820
666 Ga0209673_1000477 3300025273 Bacteria 66849
667 Ga0209673_1002692 3300025273 Bacteria 11833
668 Ga0209130_1000267 3300025284 Bacteria 65435
669 Ga0209130_1003103 3300025284 Bacteria 7411
670 Ga0209130_1005512 3300025284 Bacteria 4362
671 Ga0209675_1005805 3300025291 Bacteria 5081
672 Ga0209676_1000026 3300025292 Bacteria 574599
673 Ga0209676_1000137 3300025292 Bacteria 179437
674 Ga0209676_1016289 3300025292 Bacteria 2691
675 Ga0209025_1000265 3300025294 Bacteria 123182
676 Ga0209025_1000481 3300025294 Bacteria 77405
677 Ga0209025_1002411 3300025294 Bacteria 19909
678 Ga0209025_1035647 3300025294 Bacteria 2244
679 Ga0209025_1039009 3300025294 Bacteria 2079
680 Ga0209564_1000023 3300025295 Bacteria 555102
681 Ga0209564_1000141 3300025295 Bacteria 179852
682 Ga0209564_1000936 3300025295 Bacteria 37836
683 Ga0209564_1001368 3300025295 Bacteria 25567
684 Ga0209564_1001413 3300025295 Bacteria 24762
685 Ga0209564_1016873 3300025295 Bacteria 2880
686 Ga0209564_1031662 3300025295 Bacteria 1610
687 Ga0209564_1033997 3300025295 Bacteria 1504
688 Ga0209758_1000075 3300025297 Bacteria 271585
689 Ga0209758_1000087 3300025297 Bacteria 254384
690 Ga0209758_1000135 3300025297 Bacteria 177753
691 Ga0209758_1001472 3300025297 Bacteria 27590
692 Ga0209758_1002263 3300025297 Bacteria 19964
693 Ga0209758_1003895 3300025297 Bacteria 13047
694 Ga0209758_1004550 3300025297 Bacteria 11455
695 Ga0209758_1006443 3300025297 Bacteria 8432
696 Ga0209758_1009361 3300025297 Bacteria 6104
697 Ga0209758_1012485 3300025297 Bacteria 4751
698 Ga0209758_1014095 3300025297 Bacteria 4288
699 Ga0209758_1035129 3300025297 Bacteria 1980
700 Ga0209050_1000015 3300025298 Bacteria 759102
701 Ga0209050_1038483 3300025298 Bacteria 1363
702 Ga0209256_1000129 3300025299 Bacteria 163766
703 Ga0209256_1000330 3300025299 Bacteria 79958
704 Ga0209256_1000604 3300025299 Bacteria 49837
705 Ga0209256_1006248 3300025299 Bacteria 6406
706 Ga0207426_1000160 3300025302 Bacteria 174540
707 Ga0207426_1000171 3300025302 Bacteria 163766
708 Ga0207426_1000185 3300025302 Bacteria 154146
709 Ga0207426_1000287 3300025302 Bacteria 100566
710 Ga0207426_1000289 3300025302 Bacteria 99963
711 Ga0207426_1002426 3300025302 Bacteria 11930
712 Ga0207426_1047672 3300025302 Bacteria 1291
713 Ga0209051_1000010 3300025303 Bacteria 641298
714 Ga0209051_1027886 3300025303 Bacteria 2241
715 Ga0209257_1000026 3300025304 Bacteria 723225
716 Ga0209257_1000382 3300025304 Bacteria 88368
717 Ga0207697_10008917 3300025315 Bacteria 4358
718 Ga0207697_10013135 3300025315 Bacteria 3459
719 Ga0207697_10029703 3300025315 Bacteria 2238
720 Ga0207697_10071932 3300025315 Bacteria 1449
721 Ga0207682_10002804 3300025893 Bacteria 7709
722 Ga0207682_10138857 3300025893 Bacteria 1089
723 Ga0207692_10008762 3300025898 Bacteria 4201
724 Ga0207692_10030805 3300025898 Bacteria 2562
725 Ga0207692_10278002 3300025898 Bacteria 1012
726 Ga0207642_10120723 3300025899 Bacteria 1351
727 Ga0207710_10018385 3300025900 Bacteria 2972
728 Ga0207688_10011258 3300025901 Bacteria 4868
729 Ga0207688_10045160 3300025901 Bacteria 2457
730 Ga0207688_10094381 3300025901 Bacteria 1721
731 Ga0207688_10101948 3300025901 Bacteria 1658
732 Ga0207647_10000181 3300025904 Bacteria 50570
733 Ga0207647_10008822 3300025904 Bacteria 7197
734 Ga0207647_10028859 3300025904 Bacteria 3598
735 Ga0207647_10050867 3300025904 Bacteria 2564
736 Ga0207647_10052761 3300025904 Bacteria 2509
737 Ga0207647_10249175 3300025904 Bacteria 1019
738 Ga0207647_10254112 3300025904 Bacteria 1007
739 Ga0207685_10000117 3300025905 Bacteria 11992
740 Ga0207699_10000561 3300025906 Bacteria 18332
741 Ga0207699_10002981 3300025906 Bacteria 8050
742 Ga0207699_10345747 3300025906 Bacteria 1049
743 Ga0207645_10021282 3300025907 Bacteria 4231
744 Ga0207645_10027095 3300025907 Bacteria 3703
745 Ga0207645_10070297 3300025907 Bacteria 2239
746 Ga0207645_10102883 3300025907 Bacteria 1844
747 Ga0207645_10114768 3300025907 Bacteria 1745
748 Ga0207643_10056467 3300025908 Bacteria 2233
749 Ga0207705_10000002 3300025909 Bacteria 2046852
750 Ga0207705_10002417 3300025909 Bacteria 14410
751 Ga0207705_10014317 3300025909 Bacteria 5708
752 Ga0207705_10029640 3300025909 Bacteria 3901
753 Ga0207705_10038453 3300025909 Bacteria 3426
754 Ga0207705_10087687 3300025909 Bacteria 2276
755 Ga0207705_10088868 3300025909 Bacteria 2260
756 Ga0207705_10143894 3300025909 Bacteria 1782
757 Ga0207705_10224070 3300025909 Bacteria 1429
758 Ga0207705_10231313 3300025909 Bacteria 1406
759 Ga0207705_10313401 3300025909 Bacteria 1205
760 Ga0207705_10482578 3300025909 Bacteria 962
761 Ga0207684_10039712 3300025910 Bacteria 3991
762 Ga0207684_10111434 3300025910 Bacteria 2342
763 Ga0207684_10125240 3300025910 Bacteria 2204
764 Ga0207654_10019399 3300025911 Bacteria 3588
765 Ga0207654_10020194 3300025911 Bacteria 3528
766 Ga0207654_10173564 3300025911 Bacteria 1402
767 Ga0207654_10250098 3300025911 Bacteria 1188
768 Ga0207707_10007110 3300025912 Bacteria 9751
769 Ga0207707_10016413 3300025912 Bacteria 6459
770 Ga0207707_10054341 3300025912 Bacteria 3486
771 Ga0207707_10058645 3300025912 Bacteria 3350
772 Ga0207707_10091506 3300025912 Bacteria 2658
773 Ga0207707_10098243 3300025912 Bacteria 2559
774 Ga0207707_10105844 3300025912 Bacteria 2459
775 Ga0207707_10248773 3300025912 Bacteria 1544
776 Ga0207707_10356729 3300025912 Bacteria 1259
777 Ga0207695_10000029 3300025913 Bacteria 548364
778 Ga0207695_10004391 3300025913 Bacteria 19276
779 Ga0207695_10006972 3300025913 Bacteria 14506
780 Ga0207695_10035319 3300025913 Bacteria 5423
781 Ga0207695_10091535 3300025913 Bacteria 3055
782 Ga0207695_10106653 3300025913 Bacteria 2788
783 Ga0207695_10155990 3300025913 Bacteria 2217
784 Ga0207695_10243096 3300025913 Bacteria 1701
785 Ga0207671_10005591 3300025914 Bacteria 11545
786 Ga0207671_10015933 3300025914 Bacteria 5861
787 Ga0207671_10025983 3300025914 Bacteria 4392
788 Ga0207671_10036268 3300025914 Bacteria 3657
789 Ga0207671_10091344 3300025914 Bacteria 2294
790 Ga0207671_10132033 3300025914 Bacteria 1917
791 Ga0207671_10163587 3300025914 Bacteria 1724
792 Ga0207671_10248068 3300025914 Bacteria 1399
793 Ga0207671_10260703 3300025914 Bacteria 1364
794 Ga0207671_10322926 3300025914 Bacteria 1222
795 Ga0207693_10000326 3300025915 Bacteria 44051
796 Ga0207693_10005581 3300025915 Bacteria 10467
797 Ga0207693_10053622 3300025915 Bacteria 3164
798 Ga0207693_10097801 3300025915 Bacteria 2302
799 Ga0207693_10228311 3300025915 Bacteria 1462
800 Ga0207663_10000362 3300025916 Bacteria 19744
801 Ga0207663_10010962 3300025916 Bacteria 4845
802 Ga0207663_10012171 3300025916 Bacteria 4642
803 Ga0207663_10172511 3300025916 Bacteria 1537
804 Ga0207660_10001628 3300025917 Bacteria 15062
805 Ga0207660_10036788 3300025917 Bacteria 3405
806 Ga0207660_10049154 3300025917 Bacteria 2987
807 Ga0207660_10065702 3300025917 Bacteria 2622
808 Ga0207660_10108315 3300025917 Bacteria 2086
809 Ga0207660_10250685 3300025917 Bacteria 1397
810 Ga0207660_10298469 3300025917 Bacteria 1282
811 Ga0207662_10094697 3300025918 Bacteria 1842
812 Ga0207662_10122103 3300025918 Bacteria 1635
813 Ga0207657_10000659 3300025919 Bacteria 36733
814 Ga0207657_10001814 3300025919 Bacteria 23056
815 Ga0207657_10005795 3300025919 Bacteria 12876
816 Ga0207657_10006465 3300025919 Bacteria 12143
817 Ga0207657_10007485 3300025919 Bacteria 11190
818 Ga0207657_10013513 3300025919 Bacteria 8007
819 Ga0207657_10020740 3300025919 Bacteria 6202
820 Ga0207657_10036996 3300025919 Bacteria 4364
821 Ga0207657_10039797 3300025919 Bacteria 4173
822 Ga0207657_10044542 3300025919 Bacteria 3900
823 Ga0207657_10048009 3300025919 Bacteria 3729
824 Ga0207657_10054494 3300025919 Bacteria 3458
825 Ga0207657_10064044 3300025919 Bacteria 3140
826 Ga0207657_10089783 3300025919 Bacteria 2565
827 Ga0207649_10041654 3300025920 Bacteria 2796
828 Ga0207649_10053618 3300025920 Bacteria 2507
829 Ga0207649_10092968 3300025920 Bacteria 1978
830 Ga0207649_10200893 3300025920 Bacteria 1408
831 Ga0207649_10254929 3300025920 Bacteria 1265
832 Ga0207649_10394928 3300025920 Bacteria 1034
833 Ga0207652_10000001 3300025921 Bacteria 1006643
834 Ga0207652_10013066 3300025921 Bacteria 6720
835 Ga0207652_10023863 3300025921 Bacteria 5072
836 Ga0207652_10026596 3300025921 Bacteria 4821
837 Ga0207652_10054634 3300025921 Bacteria 3433
838 Ga0207652_10059606 3300025921 Bacteria 3291
839 Ga0207652_10158790 3300025921 Bacteria 2026
840 Ga0207652_10236329 3300025921 Bacteria 1647
841 Ga0207652_10310722 3300025921 Bacteria 1423
842 Ga0207652_10447979 3300025921 Bacteria 1164
843 Ga0207652_10489822 3300025921 Bacteria 1107
844 Ga0207646_10005973 3300025922 Bacteria 12696
845 Ga0207646_10068196 3300025922 Bacteria 3177
846 Ga0207646_10106774 3300025922 Bacteria 2512
847 Ga0207646_10128892 3300025922 Bacteria 2276
848 Ga0207681_10002516 3300025923 Bacteria 11651
849 Ga0207681_10016135 3300025923 Bacteria 4666
850 Ga0207681_10040964 3300025923 Bacteria 3085
851 Ga0207681_10075463 3300025923 Bacteria 2365
852 Ga0207681_10239877 3300025923 Bacteria 1411
853 Ga0207681_10259592 3300025923 Bacteria 1360
854 Ga0207681_10454771 3300025923 Bacteria 1042
855 Ga0207681_10458556 3300025923 Bacteria 1038
856 Ga0207681_10535428 3300025923 Bacteria 962
857 Ga0207694_10002889 3300025924 Bacteria 13820
858 Ga0207694_10007413 3300025924 Bacteria 8320
859 Ga0207694_10048259 3300025924 Bacteria 3294
860 Ga0207694_10184916 3300025924 Bacteria 1691
861 Ga0207694_10232074 3300025924 Bacteria 1507
862 Ga0207694_10247543 3300025924 Bacteria 1458
863 Ga0207694_10261222 3300025924 Bacteria 1418
864 Ga0207650_10008732 3300025925 Bacteria 6921
865 Ga0207650_10037599 3300025925 Bacteria 3528
866 Ga0207650_10071022 3300025925 Bacteria 2618
867 Ga0207659_10000728 3300025926 Bacteria 19479
868 Ga0207659_10023583 3300025926 Bacteria 4109
869 Ga0207659_10025581 3300025926 Bacteria 3968
870 Ga0207659_10052290 3300025926 Bacteria 2909
871 Ga0207659_10059700 3300025926 Bacteria 2742
872 Ga0207659_10209002 3300025926 Bacteria 1563
873 Ga0207687_10066128 3300025927 Bacteria 2569
874 Ga0207687_10128342 3300025927 Bacteria 1907
875 Ga0207687_10290627 3300025927 Bacteria 1313
876 Ga0207687_10300079 3300025927 Bacteria 1294
877 Ga0207700_10023512 3300025928 Bacteria 4250
878 Ga0207700_10033458 3300025928 Bacteria 3678
879 Ga0207700_10063462 3300025928 Bacteria 2809
880 Ga0207700_10068438 3300025928 Bacteria 2721
881 Ga0207700_10101172 3300025928 Bacteria 2299
882 Ga0207664_10001455 3300025929 Bacteria 15548
883 Ga0207664_10054799 3300025929 Bacteria 3161
884 Ga0207664_10077877 3300025929 Bacteria 2687
885 Ga0207664_10145266 3300025929 Bacteria 2011
886 Ga0207664_10168261 3300025929 Bacteria 1874
887 Ga0207664_10174619 3300025929 Bacteria 1841
888 Ga0207644_10207584 3300025931 Bacteria 1547
889 Ga0207644_10630620 3300025931 Bacteria 891
890 Ga0207690_10000005 3300025932 Bacteria 581199
891 Ga0207690_10002077 3300025932 Bacteria 12273
892 Ga0207690_10023248 3300025932 Bacteria 3867
893 Ga0207690_10111848 3300025932 Bacteria 1969
894 Ga0207690_10159624 3300025932 Bacteria 1680
895 Ga0207690_10202669 3300025932 Bacteria 1508
896 Ga0207690_10208624 3300025932 Bacteria 1488
897 Ga0207690_10261763 3300025932 Bacteria 1340
898 Ga0207690_10423770 3300025932 Bacteria 1065
899 Ga0207706_10002491 3300025933 Bacteria 17939
900 Ga0207706_10012557 3300025933 Bacteria 7713
901 Ga0207706_10028060 3300025933 Bacteria 5029
902 Ga0207706_10046173 3300025933 Bacteria 3857
903 Ga0207706_10054774 3300025933 Bacteria 3519
904 Ga0207706_10060522 3300025933 Bacteria 3335
905 Ga0207706_10066703 3300025933 Bacteria 3167
906 Ga0207706_10081504 3300025933 Bacteria 2843
907 Ga0207706_10124927 3300025933 Bacteria 2263
908 Ga0207706_10206678 3300025933 Bacteria 1721
909 Ga0207706_10237268 3300025933 Bacteria 1594
910 Ga0207706_10249811 3300025933 Bacteria 1550
911 Ga0207706_10432815 3300025933 Bacteria 1139
912 Ga0207706_10522637 3300025933 Bacteria 1023
913 Ga0207686_10003755 3300025934 Bacteria 8149
914 Ga0207686_10031355 3300025934 Bacteria 3155
915 Ga0207686_10521112 3300025934 Bacteria 925
916 Ga0207709_10001388 3300025935 Bacteria 16960
917 Ga0207709_10003465 3300025935 Bacteria 9360
918 Ga0207709_10018084 3300025935 Bacteria 3943
919 Ga0207709_10109204 3300025935 Bacteria 1846
920 Ga0207709_10158082 3300025935 Bacteria 1578
921 Ga0207670_10186242 3300025936 Bacteria 1567
922 Ga0207670_10336348 3300025936 Bacteria 1192
923 Ga0207669_10007280 3300025937 Bacteria 5104
924 Ga0207669_10057454 3300025937 Bacteria 2369
925 Ga0207669_10137518 3300025937 Bacteria 1690
926 Ga0207669_10252765 3300025937 Bacteria 1313
927 Ga0207704_10012151 3300025938 Bacteria 4265
928 Ga0207704_10016958 3300025938 Bacteria 3761
929 Ga0207704_10265710 3300025938 Bacteria 1296
930 Ga0207665_10000194 3300025939 Bacteria 40747
931 Ga0207665_10028096 3300025939 Bacteria 3715
932 Ga0207665_10155356 3300025939 Bacteria 1642
933 Ga0207691_10004302 3300025940 Bacteria 13826
934 Ga0207691_10013936 3300025940 Bacteria 7670
935 Ga0207691_10047595 3300025940 Bacteria 3935
936 Ga0207691_10057577 3300025940 Bacteria 3536
937 Ga0207691_10059944 3300025940 Bacteria 3460
938 Ga0207691_10080680 3300025940 Bacteria 2926
939 Ga0207691_10223872 3300025940 Bacteria 1630
940 Ga0207711_10052734 3300025941 Bacteria 3487
941 Ga0207711_10062894 3300025941 Bacteria 3203
942 Ga0207711_10252160 3300025941 Bacteria 1621
943 Ga0207711_10544084 3300025941 Bacteria 1083
944 Ga0207689_10031582 3300025942 Bacteria 4408
945 Ga0207689_10050489 3300025942 Bacteria 3429
946 Ga0207689_10063968 3300025942 Bacteria 3027
947 Ga0207689_10205324 3300025942 Bacteria 1627
948 Ga0207689_10225223 3300025942 Bacteria 1550
949 Ga0207689_10359730 3300025942 Bacteria 1210
950 Ga0207689_10417005 3300025942 Bacteria 1120
951 Ga0207661_10026021 3300025944 Bacteria 4454
952 Ga0207661_10033925 3300025944 Bacteria 3964
953 Ga0207661_10047181 3300025944 Bacteria 3418
954 Ga0207661_10207545 3300025944 Bacteria 1725
955 Ga0207661_10470036 3300025944 Bacteria 1147
956 Ga0207679_10016166 3300025945 Bacteria 4948
957 Ga0207679_10071622 3300025945 Bacteria 2615
958 Ga0207679_10080112 3300025945 Bacteria 2492
959 Ga0207679_10100558 3300025945 Bacteria 2260
960 Ga0207679_10327661 3300025945 Bacteria 1328
961 Ga0207679_10462479 3300025945 Bacteria 1127
962 Ga0207667_10002854 3300025949 Bacteria 21441
963 Ga0207667_10004603 3300025949 Bacteria 16917
964 Ga0207667_10018732 3300025949 Bacteria 7753
965 Ga0207667_10024903 3300025949 Bacteria 6561
966 Ga0207667_10026378 3300025949 Bacteria 6349
967 Ga0207667_10064921 3300025949 Bacteria 3809
968 Ga0207667_10078368 3300025949 Bacteria 3425
969 Ga0207667_10085761 3300025949 Bacteria 3259
970 Ga0207667_10092539 3300025949 Bacteria 3123
971 Ga0207667_10122480 3300025949 Bacteria 2679
972 Ga0207667_10364303 3300025949 Bacteria 1474
973 Ga0207667_10433782 3300025949 Bacteria 1336
974 Ga0207667_10527027 3300025949 Bacteria 1196
975 Ga0207651_10060955 3300025960 Bacteria 2621
976 Ga0207651_10062185 3300025960 Bacteria 2600
977 Ga0207651_10275366 3300025960 Bacteria 1388
978 Ga0207651_10586741 3300025960 Bacteria 973
979 Ga0207712_10002025 3300025961 Bacteria 13300
980 Ga0207712_10063785 3300025961 Bacteria 2624
981 Ga0207712_10153755 3300025961 Bacteria 1780
982 Ga0207712_10245022 3300025961 Bacteria 1446
983 Ga0207668_10000580 3300025972 Bacteria 22885
984 Ga0207668_10020304 3300025972 Bacteria 4218
985 Ga0207668_10077701 3300025972 Bacteria 2394
986 Ga0207668_10163641 3300025972 Bacteria 1736
987 Ga0207668_10184124 3300025972 Bacteria 1650
988 Ga0207668_10385701 3300025972 Bacteria 1180
989 Ga0207668_10392227 3300025972 Bacteria 1171
990 Ga0207668_10445639 3300025972 Bacteria 1104
991 Ga0207640_10000024 3300025981 Bacteria 154876
992 Ga0207640_10179941 3300025981 Bacteria 1584
993 Ga0207658_10137690 3300025986 Bacteria 1971
994 Ga0207658_10197868 3300025986 Bacteria 1675
995 Ga0207677_10000845 3300026023 Bacteria 17515
996 Ga0207677_10030563 3300026023 Bacteria 3440
997 Ga0207677_10030598 3300026023 Bacteria 3438
998 Ga0207677_10376047 3300026023 Bacteria 1198
999 Ga0207677_10388963 3300026023 Bacteria 1179
1000 Ga0207677_10498893 3300026023 Bacteria 1052
1001 Ga0207703_10006101 3300026035 Bacteria 9641
1002 Ga0207703_10042309 3300026035 Bacteria 3654
1003 Ga0207703_10045380 3300026035 Bacteria 3535
1004 Ga0207703_10051821 3300026035 Bacteria 3329
1005 Ga0207703_10073678 3300026035 Bacteria 2825
1006 Ga0207703_10092531 3300026035 Bacteria 2545
1007 Ga0207703_10170664 3300026035 Bacteria 1913
1008 Ga0207703_10411687 3300026035 Bacteria 1256
1009 Ga0207639_10039358 3300026041 Bacteria 3522
1010 Ga0207639_10205196 3300026041 Bacteria 1693
1011 Ga0207639_10209611 3300026041 Bacteria 1677
1012 Ga0207639_10399122 3300026041 Bacteria 1238
1013 Ga0207678_10033232 3300026067 Bacteria 4495
1014 Ga0207678_10046104 3300026067 Bacteria 3770
1015 Ga0207678_10054300 3300026067 Bacteria 3450
1016 Ga0207678_10063670 3300026067 Bacteria 3169
1017 Ga0207678_10073540 3300026067 Bacteria 2929
1018 Ga0207678_10109704 3300026067 Bacteria 2354
1019 Ga0207678_10117286 3300026067 Bacteria 2271
1020 Ga0207678_10162784 3300026067 Bacteria 1905
1021 Ga0207678_10244407 3300026067 Bacteria 1537
1022 Ga0207702_10001454 3300026078 Bacteria 23549
1023 Ga0207702_10008316 3300026078 Bacteria 8762
1024 Ga0207702_10031585 3300026078 Bacteria 4414
1025 Ga0207702_10082530 3300026078 Bacteria 2795
1026 Ga0207702_10084485 3300026078 Bacteria 2764
1027 Ga0207702_10139034 3300026078 Bacteria 2195
1028 Ga0207641_10006863 3300026088 Bacteria 9527
1029 Ga0207641_10020003 3300026088 Bacteria 5495
1030 Ga0207641_10258004 3300026088 Bacteria 1631
1031 Ga0207648_10000421 3300026089 Bacteria 46603
1032 Ga0207648_10006730 3300026089 Bacteria 11400
1033 Ga0207648_10030619 3300026089 Bacteria 4763
1034 Ga0207648_10042420 3300026089 Bacteria 3993
1035 Ga0207648_10059352 3300026089 Bacteria 3336
1036 Ga0207648_10095094 3300026089 Bacteria 2606
1037 Ga0207648_10109752 3300026089 Bacteria 2422
1038 Ga0207648_10155281 3300026089 Bacteria 2020
1039 Ga0207648_10163445 3300026089 Bacteria 1967
1040 Ga0207676_10015791 3300026095 Bacteria 5459
1041 Ga0207676_10071808 3300026095 Bacteria 2780
1042 Ga0207676_10072113 3300026095 Bacteria 2775
1043 Ga0207676_10166326 3300026095 Bacteria 1917
1044 Ga0207676_10245714 3300026095 Bacteria 1608
1045 Ga0207676_10282285 3300026095 Bacteria 1508
1046 Ga0207674_10011986 3300026116 Bacteria 9715
1047 Ga0207674_10018313 3300026116 Bacteria 7615
1048 Ga0207674_10020525 3300026116 Bacteria 7135
1049 Ga0207674_10063613 3300026116 Bacteria 3724
1050 Ga0207674_10074616 3300026116 Bacteria 3403
1051 Ga0207674_10081339 3300026116 Bacteria 3241
1052 Ga0207674_10090990 3300026116 Bacteria 3042
1053 Ga0207674_10234157 3300026116 Bacteria 1784
1054 Ga0207675_100005114 3300026118 Bacteria 12627
1055 Ga0207675_100099163 3300026118 Bacteria 2744
1056 Ga0207675_100162835 3300026118 Bacteria 2129
1057 Ga0207675_100273012 3300026118 Bacteria 1641
1058 Ga0207675_100381844 3300026118 Bacteria 1385
1059 Ga0207683_10000315 3300026121 Bacteria 44025
1060 Ga0207683_10009082 3300026121 Bacteria 8471
1061 Ga0207683_10015224 3300026121 Bacteria 6546
1062 Ga0207683_10016322 3300026121 Bacteria 6320
1063 Ga0207683_10021620 3300026121 Bacteria 5513
1064 Ga0207683_10044648 3300026121 Bacteria 3874
1065 Ga0207683_10083870 3300026121 Bacteria 2832
1066 Ga0207683_10611465 3300026121 Bacteria 1009
1067 Ga0207698_10029514 3300026142 Bacteria 3930
1068 Ga0207698_10066764 3300026142 Bacteria 2833
1069 Ga0207698_10160760 3300026142 Bacteria 1964
1070 Ga0207698_10200440 3300026142 Bacteria 1787
1071 Ga0207698_10218767 3300026142 Bacteria 1719
1072 Ga0207698_10266847 3300026142 Bacteria 1575
1073 Ga0207698_10684116 3300026142 Bacteria 1019
1074 Ga0209281_1000020 3300027111 Bacteria 575972
1075 Ga0209389_1000137 3300027296 Bacteria 63287
1076 Ga0209389_1000353 3300027296 Bacteria 27634
1077 Ga0209589_1003439 3300027357 Bacteria 27634
1078 Ga0209489_100192 3300027361 Bacteria 98028
1079 Ga0209489_107326 3300027361 Bacteria 16591
1080 Ga0209489_107331 3300027361 Bacteria 16585
1081 Ga0209700_100046 3300027363 Bacteria 159296
1082 Ga0209588_1010085 3300027671 Bacteria 2835
1083 Ga0209971_1013049 3300027682 Bacteria 1969
1084 Ga0209971_1056487 3300027682 Bacteria 949
1085 Ga0209813_10002651 3300027866 Bacteria 4113
1086 Ga0209813_10029173 3300027866 Bacteria 1614
1087 Ga0209813_10097043 3300027866 Bacteria 998
1088 Ga0209974_10003984 3300027876 Bacteria 5282
1089 Ga0209974_10066018 3300027876 Bacteria 1229
1090 Ga0207428_10000094 3300027907 Bacteria 123649
1091 Ga0207428_10006429 3300027907 Bacteria 10850
1092 Ga0207428_10036101 3300027907 Bacteria 4035
1093 Ga0207428_10134025 3300027907 Bacteria 1894
1094 Ga0207428_10150755 3300027907 Bacteria 1770
1095 Ga0207428_10288383 3300027907 Bacteria 1217
1096 Ga0265354_1002569 3300028016 Bacteria 2218
1097 Ga0265357_1002524 3300028023 Bacteria 1506
1098 Ga0268266_10000256 3300028379 Bacteria 89436
1099 Ga0268266_10005499 3300028379 Bacteria 11797
1100 Ga0268266_10007711 3300028379 Bacteria 9662
1101 Ga0268266_10009538 3300028379 Bacteria 8542
1102 Ga0268266_10048979 3300028379 Bacteria 3622
1103 Ga0268266_10049467 3300028379 Bacteria 3605
1104 Ga0268266_10096350 3300028379 Bacteria 2600
1105 Ga0268266_10126627 3300028379 Bacteria 2280
1106 Ga0268266_10169766 3300028379 Bacteria 1979
1107 Ga0268266_10347521 3300028379 Bacteria 1393
1108 Ga0268266_10381941 3300028379 Bacteria 1329
1109 Ga0268265_10018992 3300028380 Bacteria 4773
1110 Ga0268265_10042854 3300028380 Bacteria 3360
1111 Ga0268265_10050537 3300028380 Bacteria 3133
1112 Ga0268265_10181056 3300028380 Bacteria 1810
1113 Ga0268265_10395865 3300028380 Bacteria 1275
1114 Ga0268264_10000020 3300028381 Bacteria 483593
1115 Ga0268264_10001404 3300028381 Bacteria 22509
1116 Ga0268264_10025359 3300028381 Bacteria 4844
1117 Ga0268264_10070120 3300028381 Bacteria 2967
1118 Ga0268264_10073701 3300028381 Bacteria 2898
1119 Ga0268264_10254179 3300028381 Bacteria 1634
1120 Ga0268264_10473321 3300028381 Bacteria 1217
1121 Ga0268264_10498821 3300028381 Bacteria 1187
1122 Ga0268264_10538420 3300028381 Bacteria 1144
1123 Ga0265337_1001859 3300028556 Bacteria 10076
1124 Ga0265334_10000410 3300028573 Bacteria 22501
1125 Ga0265334_10045433 3300028573 Bacteria 1701
1126 Ga0265323_10000658 3300028653 Bacteria 18872
1127 Ga0265336_10000063 3300028666 Bacteria 98413
1128 Ga0307517_10000235 3300028786 Bacteria 93944
1129 Ga0307515_10037902 3300028794 Bacteria 7731
1130 Ga0307515_10144305 3300028794 Bacteria 2532
1131 Ga0307515_10170842 3300028794 Bacteria 2168
1132 Ga0307515_10414548 3300028794 Bacteria 969
1133 Ga0265338_10000154 3300028800 Bacteria 125708
1134 Ga0265324_10002963 3300029957 Bacteria 8307
1135 Ga0307511_10033177 3300030521 Bacteria 4564
1136 Ga0316182_1443699 3300030745 Bacteria 1552
1137 Ga0265762_1010074 3300030760 Bacteria 1688
1138 Ga0265770_1000021 3300030878 Bacteria 15470
1139 Ga0265330_10147348 3300031235 Bacteria 1000
1140 Ga0265332_10001225 3300031238 Bacteria 14836
1141 Ga0265332_10059636 3300031238 Bacteria 1633
1142 Ga0265328_10028391 3300031239 Bacteria 2093
1143 Ga0265328_10106874 3300031239 Bacteria 1039
1144 Ga0265340_10000669 3300031247 Bacteria 19187
1145 Ga0265340_10024686 3300031247 Bacteria 3051
1146 Ga0265340_10087769 3300031247 Bacteria 1457
1147 Ga0265340_10159875 3300031247 Bacteria 1024
1148 Ga0265339_10000253 3300031249 Bacteria 42950
1149 Ga0265339_10024827 3300031249 Bacteria 3449
1150 Ga0265331_10005905 3300031250 Bacteria 7323
1151 Ga0265331_10024351 3300031250 Bacteria 3063
1152 Ga0265316_10205982 3300031344 Bacteria 1456
1153 Ga0307513_10089608 3300031456 Bacteria 3140
1154 Ga0307513_10128769 3300031456 Bacteria 2481
1155 Ga0307513_10182218 3300031456 Bacteria 1962
1156 Ga0307513_10206786 3300031456 Bacteria 1798
1157 Ga0307513_10360338 3300031456 Bacteria 1199
1158 Ga0307509_10065496 3300031507 Bacteria 3815
1159 Ga0307509_10196714 3300031507 Bacteria 1858
1160 Ga0307509_10248650 3300031507 Bacteria 1564
1161 Ga0307408_100042559 3300031548 Bacteria 3227
1162 Ga0307408_100060812 3300031548 Bacteria 2755
1163 Ga0307408_100065368 3300031548 Bacteria 2667
1164 Ga0307408_100160546 3300031548 Bacteria 1785
1165 Ga0307408_100269743 3300031548 Bacteria 1412
1166 Ga0307408_100277982 3300031548 Bacteria 1393
1167 Ga0265313_10021048 3300031595 Bacteria 3577
1168 Ga0307508_10000025 3300031616 Bacteria 174642
1169 Ga0307508_10077767 3300031616 Bacteria 2897
1170 Ga0307508_10117852 3300031616 Bacteria 2257
1171 Ga0265314_10005071 3300031711 Bacteria 12001
1172 Ga0265314_10021311 3300031711 Bacteria 4986
1173 Ga0265314_10029059 3300031711 Bacteria 4113
1174 Ga0265314_10104302 3300031711 Bacteria 1816
1175 Ga0265342_10000039 3300031712 Bacteria 140091
1176 Ga0265342_10000131 3300031712 Bacteria 82968
1177 Ga0265342_10003931 3300031712 Bacteria 11934
1178 Ga0265342_10069837 3300031712 Bacteria 2050
1179 Ga0265342_10130696 3300031712 Bacteria 1407
1180 Ga0316576_10012107 3300031727 Bacteria 5688
1181 Ga0307516_10015801 3300031730 Bacteria 7927
1182 Ga0307405_10006215 3300031731 Bacteria 5855
1183 Ga0307405_10007256 3300031731 Bacteria 5526
1184 Ga0307405_10028119 3300031731 Bacteria 3270
1185 Ga0307405_10030253 3300031731 Bacteria 3173
1186 Ga0307405_10073494 3300031731 Bacteria 2208
1187 Ga0307405_10094951 3300031731 Bacteria 1984
1188 Ga0307405_10219086 3300031731 Bacteria 1395
1189 Ga0307405_10315549 3300031731 Bacteria 1192
1190 Ga0316577_10046142 3300031733 Bacteria 2434
1191 Ga0307413_10004158 3300031824 Bacteria 6248
1192 Ga0307413_10047505 3300031824 Bacteria 2560
1193 Ga0307413_10054751 3300031824 Bacteria 2423
1194 Ga0307413_10060657 3300031824 Bacteria 2329
1195 Ga0307413_10070387 3300031824 Bacteria 2199
1196 Ga0307413_10115877 3300031824 Bacteria 1804
1197 Ga0307413_10274282 3300031824 Bacteria 1264
1198 Ga0307413_10301388 3300031824 Bacteria 1215
1199 Ga0307410_10000933 3300031852 Bacteria 12527
1200 Ga0307410_10006512 3300031852 Bacteria 6307
1201 Ga0307410_10024224 3300031852 Bacteria 3789
1202 Ga0307410_10036744 3300031852 Bacteria 3193
1203 Ga0307410_10046366 3300031852 Bacteria 2899
1204 Ga0307410_10110690 3300031852 Bacteria 1987
1205 Ga0307410_10129125 3300031852 Bacteria 1854
1206 Ga0307410_10142856 3300031852 Bacteria 1773
1207 Ga0307410_10143467 3300031852 Bacteria 1769
1208 Ga0307410_10209595 3300031852 Bacteria 1492
1209 Ga0307410_10309948 3300031852 Bacteria 1248
1210 Ga0307410_10320733 3300031852 Bacteria 1229
1211 Ga0307410_10337658 3300031852 Bacteria 1200
1212 Ga0307406_10014184 3300031901 Bacteria 4580
1213 Ga0307406_10049555 3300031901 Bacteria 2658
1214 Ga0307406_10051333 3300031901 Bacteria 2618
1215 Ga0307406_10058492 3300031901 Bacteria 2477
1216 Ga0307406_10068791 3300031901 Bacteria 2313
1217 Ga0307406_10120650 3300031901 Bacteria 1822
1218 Ga0307406_10139191 3300031901 Bacteria 1715
1219 Ga0307406_10207649 3300031901 Bacteria 1447
1220 Ga0307406_10483789 3300031901 Bacteria 1000
1221 Ga0307407_10001131 3300031903 Bacteria 9350
1222 Ga0307407_10015574 3300031903 Bacteria 3764
1223 Ga0307407_10023172 3300031903 Bacteria 3235
1224 Ga0307407_10042870 3300031903 Bacteria 2540
1225 Ga0307407_10149980 3300031903 Bacteria 1514
1226 Ga0307407_10250701 3300031903 Bacteria 1213
1227 Ga0307412_10002229 3300031911 Bacteria 10749
1228 Ga0307412_10024471 3300031911 Bacteria 3727
1229 Ga0307412_10034503 3300031911 Bacteria 3224
1230 Ga0307412_10046829 3300031911 Bacteria 2836
1231 Ga0307412_10066764 3300031911 Bacteria 2439
1232 Ga0307412_10099944 3300031911 Bacteria 2049
1233 Ga0307412_10206278 3300031911 Bacteria 1496
1234 Ga0307412_10443495 3300031911 Bacteria 1067
1235 Ga0307409_100005340 3300031995 Bacteria 7377
1236 Ga0307409_100006358 3300031995 Bacteria 6933
1237 Ga0307409_100025009 3300031995 Bacteria 4179
1238 Ga0307409_100026079 3300031995 Bacteria 4115
1239 Ga0307409_100046719 3300031995 Bacteria 3280
1240 Ga0307409_100059146 3300031995 Bacteria 2981
1241 Ga0307409_100073405 3300031995 Bacteria 2728
1242 Ga0307409_100150518 3300031995 Bacteria 2019
1243 Ga0307409_100361686 3300031995 Bacteria 1373
1244 Ga0307409_100390151 3300031995 Bacteria 1326
1245 Ga0307409_100441286 3300031995 Bacteria 1254
1246 Ga0307409_100476430 3300031995 Bacteria 1210
1247 Ga0307416_100003734 3300032002 Bacteria 9036
1248 Ga0307416_100007023 3300032002 Bacteria 7104
1249 Ga0307416_100011217 3300032002 Bacteria 5958
1250 Ga0307416_100016114 3300032002 Bacteria 5182
1251 Ga0307416_100027070 3300032002 Bacteria 4238
1252 Ga0307416_100093739 3300032002 Bacteria 2587
1253 Ga0307416_100133243 3300032002 Bacteria 2242
1254 Ga0307416_100166963 3300032002 Bacteria 2043
1255 Ga0307416_100194922 3300032002 Bacteria 1915
1256 Ga0307416_100236820 3300032002 Bacteria 1765
1257 Ga0307416_100284635 3300032002 Bacteria 1632
1258 Ga0307416_100363962 3300032002 Bacteria 1469
1259 Ga0307416_100471455 3300032002 Bacteria 1313
1260 Ga0307416_100592689 3300032002 Bacteria 1187
1261 Ga0307414_10000931 3300032004 Bacteria 14968
1262 Ga0307414_10005926 3300032004 Bacteria 6768
1263 Ga0307414_10020194 3300032004 Bacteria 4146
1264 Ga0307414_10026614 3300032004 Bacteria 3725
1265 Ga0307414_10046289 3300032004 Bacteria 2985
1266 Ga0307414_10061749 3300032004 Bacteria 2655
1267 Ga0307414_10076603 3300032004 Bacteria 2431
1268 Ga0307414_10081124 3300032004 Bacteria 2374
1269 Ga0307414_10089507 3300032004 Bacteria 2281
1270 Ga0307414_10160109 3300032004 Bacteria 1787
1271 Ga0307414_10211147 3300032004 Bacteria 1586
1272 Ga0307414_10219148 3300032004 Bacteria 1561
1273 Ga0307414_10244514 3300032004 Bacteria 1487
1274 Ga0307414_10298064 3300032004 Bacteria 1362
1275 Ga0307411_10007133 3300032005 Bacteria 5661
1276 Ga0307411_10011246 3300032005 Bacteria 4819
1277 Ga0307411_10018655 3300032005 Bacteria 3986
1278 Ga0307411_10051801 3300032005 Bacteria 2680
1279 Ga0307411_10107970 3300032005 Bacteria 1984
1280 Ga0307411_10122203 3300032005 Bacteria 1886
1281 Ga0307411_10141433 3300032005 Bacteria 1775
1282 Ga0307411_10147510 3300032005 Bacteria 1743
1283 Ga0307411_10236948 3300032005 Bacteria 1426
1284 Ga0307411_10269047 3300032005 Bacteria 1350
1285 Ga0307411_10341206 3300032005 Bacteria 1217
1286 Ga0307411_10356027 3300032005 Bacteria 1195
1287 Ga0307411_10368417 3300032005 Bacteria 1177
1288 Ga0307415_100007681 3300032126 Bacteria 5920
1289 Ga0307415_100029071 3300032126 Bacteria 3527
1290 Ga0307415_100033565 3300032126 Bacteria 3333
1291 Ga0307415_100043110 3300032126 Bacteria 3007
1292 Ga0307415_100046152 3300032126 Bacteria 2925
1293 Ga0307415_100055671 3300032126 Bacteria 2707
1294 Ga0307415_100084756 3300032126 Bacteria 2275
1295 Ga0307415_100140143 3300032126 Bacteria 1846
1296 Ga0307415_100155561 3300032126 Bacteria 1765
1297 Ga0307507_10130911 3300033179 Bacteria 1963
1298 Ga0307510_10033677 3300033180 Bacteria 5750
1299 Ga0307510_10050374 3300033180 Bacteria 4419
1300 Ga0307510_10117291 3300033180 Bacteria 2380
1301 Ga0307510_10148617 3300033180 Bacteria 1968
1302 Ga0373926_0023239 3300035083 Bacteria 2153
1303 Ga0373928_0016902 3300035084 Bacteria 1497
1304 Ga0373923_0057453 3300035111 Bacteria 1645
1305 Ga0373923_0100956 3300035111 Bacteria 1272
1306 Ga0373923_0168469 3300035111 Bacteria 1002
1307 Ga0373936_0007123 3300035113 Bacteria 4207
1308 Ga0373945_0002208 3300035116 Bacteria 6085
1309 Ga0373945_0010335 3300035116 Bacteria 3072
1310 Ga0373945_0056084 3300035116 Bacteria 1460
1311 Ga0373956_0013934 3300035119 Bacteria 3351
1312 Ga0373957_0006378 3300035120 Bacteria 3713
1313 Ga0373946_0013149 3300035171 Bacteria 3107
1314 Ga0373955_0035945 3300035172 Bacteria 2626
1315 Ga0373955_0168120 3300035172 Bacteria 1297
1316 Ga0316574_0048820 3300035398 Bacteria 2630
1317 Ga0373924_0020428 3300035410 Bacteria 2574
1318 Ga0373924_0051011 3300035410 Bacteria 1715
1319 Ga0373931_0005114 3300035691 Bacteria 6039
1320 Ga0373931_0111394 3300035691 Bacteria 1553
1321 Ga0373931_0180427 3300035691 Bacteria 1250
1322 Ga0373931_0301184 3300035691 Bacteria 990
1323 Ga0373935_0003467 3300035692 Bacteria 9166
1324 Ga0373935_0054250 3300035692 Bacteria 2551
1325 Ga0373935_0098227 3300035692 Bacteria 1927
1326 Ga0373935_0165473 3300035692 Bacteria 1510
1327 Ga0373927_0010081 3300035695 Bacteria 6325
1328 Ga0373927_0064985 3300035695 Bacteria 2360
1329 Ga0373927_0067413 3300035695 Bacteria 2316
1330 Ga0373927_0088419 3300035695 Bacteria 2011
1331 Ga0373927_0108420 3300035695 Bacteria 1809
1332 Ga0373933_0000225 3300035724 Bacteria 37547
1333 Ga0373933_0076538 3300035724 Bacteria 2044
1334 Ga0373947_0002642 3300035725 Bacteria 10769
1335 Ga0373947_0008433 3300035725 Bacteria 5938
1336 Ga0373947_0014002 3300035725 Bacteria 4597
1337 Ga0373947_0091764 3300035725 Bacteria 1895
1338 Ga0373937_0054286 3300036401 Bacteria 3676
1339 Ga0373937_0059352 3300036401 Bacteria 3516
1340 Ga0373937_0064661 3300036401 Bacteria 3365
1341 Ga0373937_0310771 3300036401 Bacteria 1491
1342 Ga0373937_0655142 3300036401 Bacteria 996
1343 Ga0372808_004872 3300036459 Bacteria 1740
1344 Ga0316582_0183242 3300036647 Bacteria 1425
1345 Ga0316584_0014162 3300036712 Bacteria 5668
1346 Ga0373925_0032363 3300037068 Bacteria 3849
1347 Ga0373925_0077195 3300037068 Bacteria 2527
1348 Ga0373925_0084812 3300037068 Bacteria 2414
1349 Ga0373925_0107674 3300037068 Bacteria 2150
1350 Ga0373925_0112446 3300037068 Bacteria 2105
1351 Ga0373925_0177630 3300037068 Bacteria 1684
1352 Ga0373925_0241683 3300037068 Bacteria 1446
1353 Ga0395899_0010129 3300037312 Bacteria 7228
1354 Ga0395899_0011973 3300037312 Bacteria 6646
1355 Ga0395899_0021576 3300037312 Bacteria 4884
1356 Ga0395899_0072835 3300037312 Bacteria 2513
1357 Ga0395899_0095033 3300037312 Bacteria 2156
1358 Ga0395900_0000943 3300037418 Bacteria 37925
1359 Ga0395900_0005612 3300037418 Bacteria 13121
1360 Ga0395900_0008466 3300037418 Bacteria 10577
1361 Ga0395900_0024575 3300037418 Bacteria 6169
1362 Ga0395900_0031192 3300037418 Bacteria 5475
1363 Ga0395900_0098011 3300037418 Bacteria 3012
1364 Ga0395900_0098863 3300037418 Bacteria 2998
1365 Ga0395900_0131609 3300037418 Bacteria 2563
1366 Ga0395900_0145422 3300037418 Bacteria 2424
1367 Ga0395900_0147368 3300037418 Bacteria 2406
1368 Ga0395900_0231566 3300037418 Bacteria 1858
1369 Ga0395900_0341476 3300037418 Bacteria 1473
1370 Ga0395898_0002974 3300037466 Bacteria 19263
1371 Ga0395898_0022005 3300037466 Bacteria 6458
1372 Ga0395898_0030996 3300037466 Bacteria 5347
1373 Ga0395898_0054338 3300037466 Bacteria 3908
1374 Ga0395898_0335949 3300037466 Bacteria 1441
1375 Ga0395898_0449775 3300037466 Bacteria 1227
1376 Ga0395905_0001191 3300037471 Bacteria 32527
1377 Ga0395905_0001314 3300037471 Bacteria 30557
1378 Ga0395905_0003656 3300037471 Bacteria 16314
1379 Ga0395905_0027387 3300037471 Bacteria 5375
1380 Ga0395905_0109426 3300037471 Bacteria 2594
1381 Ga0395905_0118840 3300037471 Bacteria 2484
1382 Ga0395905_0125672 3300037471 Bacteria 2411
1383 Ga0395905_0130273 3300037471 Bacteria 2366
1384 Ga0395905_0140385 3300037471 Bacteria 2273
1385 Ga0395905_0207970 3300037471 Bacteria 1834
1386 Ga0395905_0219105 3300037471 Bacteria 1781
1387 Ga0395905_0380779 3300037471 Bacteria 1305
1388 Ga0436364_0806555 3300037853 Bacteria 2926
1389 Ga0436364_1062405 3300037853 Bacteria 1116
1390 Ga0395901_0000320 3300038443 Bacteria 59479
1391 Ga0395901_0001973 3300038443 Bacteria 21111
1392 Ga0395901_0002693 3300038443 Bacteria 17903
1393 Ga0395901_0033917 3300038443 Bacteria 5271
1394 Ga0395901_0065739 3300038443 Bacteria 3776
1395 Ga0395901_0083304 3300038443 Bacteria 3343
1396 Ga0395901_0115492 3300038443 Bacteria 2819
1397 Ga0395901_0139345 3300038443 Bacteria 2549
1398 Ga0395901_0380884 3300038443 Bacteria 1452
1399 Ga0395901_0563583 3300038443 Bacteria 1153
1400 Ga0436365_0876968 3300039437 Bacteria 38690
1401 Ga0436365_1019011 3300039437 Bacteria 1012
1402 Ga0436365_1030657 3300039437 Bacteria 25086
1403 Ga0436365_1251026 3300039437 Bacteria 1590
1404 Ga0436365_1541048 3300039437 Bacteria 2214
1405 Ga0436360_0318167 3300039438 Bacteria 3918
1406 Ga0436360_0336060 3300039438 Bacteria 2967
1407 Ga0436361_0151792 3300039447 Bacteria 3109
1408 Ga0436361_0259732 3300039447 Bacteria 2075
1409 Ga0436361_0303744 3300039447 Bacteria 2150
1410 Ga0436361_0336849 3300039447 Bacteria 2327
1411 Ga0436361_0523670 3300039447 Bacteria 2056
1412 Ga0436361_0677882 3300039447 Bacteria 228834
1413 Ga0436361_0869861 3300039447 Bacteria 12333
1414 Ga0436361_0950110 3300039447 Bacteria 1550
1415 Ga0436361_1071877 3300039447 Bacteria 3879
1416 Ga0436363_0634802 3300039450 Bacteria 44772
1417 Ga0436363_1153269 3300039450 Bacteria 906
1418 Ga0436363_1261345 3300039450 Bacteria 12716
1419 Ga0436363_1610649 3300039450 Bacteria 5773
1420 Ga0436362_0379214 3300039453 Bacteria 7269
1421 Ga0436362_0423859 3300039453 Bacteria 1604
1422 Ga0439439_0003872 3300041406 Bacteria 3331
1423 Ga0451837_1440309 3300041494 Bacteria 962
1424 Ga0451839_1350009 3300041496 Bacteria 871
1425 Ga0451853_0782180 3300041512 Bacteria 1909
1426 Ga0439445_0000421 3300042004 Bacteria 8524
1427 Ga0439449_0112431 3300042007 Bacteria 1009
1428 Ga0450920_016702 3300042122 Bacteria 1400
1429 Ga0450922_003443 3300042124 Bacteria 1458
1430 Ga0450923_002117 3300042125 Bacteria 2786
1431 Ga0450898_000749 3300042134 Bacteria 3978
1432 Ga0450905_003404 3300042142 Bacteria 2091
1433 Ga0439446_0039325 3300042156 Bacteria 1389
1434 Ga0439446_0044634 3300042156 Bacteria 1312
1435 Ga0439434_0008290 3300042435 Bacteria 3047
1436 Ga0439435_0002525 3300042436 Bacteria 3656
1437 Ga0439435_0017240 3300042436 Bacteria 1822
1438 Ga0439444_0001098 3300042437 Bacteria 3373
1439 Ga0439459_0024458 3300042438 Bacteria 1185
1440 Ga0450916_001478 3300042530 Bacteria 2358
1441 Ga0466969_0002344 3300044656 Bacteria 10115
1442 Ga0466969_0016377 3300044656 Bacteria 3879
1443 Ga0466972_0039915 3300044658 Bacteria 2289
1444 Ga0466972_0100953 3300044658 Bacteria 1365
1445 Ga0466965_0036286 3300044683 Bacteria 2418
1446 Ga0466965_0112543 3300044683 Bacteria 1400
1447 Ga0466965_0167058 3300044683 Bacteria 1156
1448 Ga0466965_0174577 3300044683 Bacteria 1132
1449 Ga0466966_0000229 3300044684 Bacteria 37407
1450 Ga0466966_0018263 3300044684 Bacteria 4627
1451 Ga0466966_0035952 3300044684 Bacteria 3199
1452 Ga0466966_0084161 3300044684 Bacteria 1979
1453 Ga0466966_0246989 3300044684 Bacteria 1075
1454 Ga0466961_0000029 3300044693 Bacteria 86710
1455 Ga0466963_0000376 3300044694 Bacteria 20368
1456 Ga0466963_0034650 3300044694 Bacteria 3286
1457 Ga0466963_0175690 3300044694 Bacteria 1494
1458 Ga0466964_0022821 3300044706 Bacteria 2430
1459 Ga0466964_0140606 3300044706 Bacteria 1109
1460 Ga0466971_0009429 3300044719 Bacteria 4262
1461 Ga0466971_0013597 3300044719 Bacteria 3576
1462 Ga0466971_0067718 3300044719 Bacteria 1619
1463 Ga0466968_0007268 3300044735 Bacteria 4209
1464 Ga0466968_0162575 3300044735 Bacteria 1031
1465 Ga0466970_0006059 3300044765 Bacteria 6030
1466 Ga0466970_0048706 3300044765 Bacteria 2260
1467 Ga0466957_0006077 3300044842 Bacteria 6816
1468 Ga0466957_0006659 3300044842 Bacteria 6533
1469 Ga0466957_0018120 3300044842 Bacteria 4130
1470 Ga0466957_0114925 3300044842 Bacteria 1710
1471 Ga0466957_0227562 3300044842 Bacteria 1233
1472 Ga0466960_0128241 3300044901 Bacteria 1336
1473 Ga0466959_0000533 3300045049 Bacteria 22053
1474 Ga0466959_0003809 3300045049 Bacteria 9999
1475 Ga0466959_0019883 3300045049 Bacteria 4942
1476 Ga0466959_0176034 3300045049 Bacteria 1498
1477 Ga0466958_0001039 3300045836 Bacteria 12689
1478 Ga0466958_0029823 3300045836 Bacteria 3237
1479 Ga0466967_0030661 3300045976 Bacteria 4515
1480 Ga0495592_0013467 3300046454 Bacteria 6222
1481 Ga0495592_0086216 3300046454 Bacteria 2262
1482 Ga0495592_0185120 3300046454 Bacteria 1415
1483 Ga0495603_0000237 3300046455 Bacteria 28782
1484 Ga0495603_0001754 3300046455 Bacteria 12775
1485 Ga0495603_0011365 3300046455 Bacteria 5391
1486 Ga0495603_0025069 3300046455 Bacteria 3607
1487 Ga0495603_0038759 3300046455 Bacteria 2857
1488 Ga0495603_0040610 3300046455 Bacteria 2784
1489 Ga0495603_0059521 3300046455 Bacteria 2258
1490 Ga0495629_0000772 3300046459 Bacteria 25859
1491 Ga0495629_0002337 3300046459 Bacteria 14606
1492 Ga0495629_0031955 3300046459 Bacteria 3727
1493 Ga0495629_0056707 3300046459 Bacteria 2739
1494 Ga0495629_0170919 3300046459 Bacteria 1508
1495 Ga0495629_0178254 3300046459 Bacteria 1473
1496 Ga0495638_0004143 3300046460 Bacteria 11070
1497 Ga0495638_0004606 3300046460 Bacteria 10435
1498 Ga0495638_0005372 3300046460 Bacteria 9553
1499 Ga0495638_0041430 3300046460 Bacteria 2913
1500 Ga0495638_0198653 3300046460 Bacteria 1133
1501 Ga0495641_0012966 3300046461 Bacteria 4617
1502 Ga0495651_0011651 3300046462 Bacteria 6759
1503 Ga0495651_0098891 3300046462 Bacteria 2176
1504 Ga0495651_0143868 3300046462 Bacteria 1726
1505 Ga0495653_0022036 3300046463 Bacteria 5156
1506 Ga0495653_0027863 3300046463 Bacteria 4521
1507 Ga0495653_0217635 3300046463 Bacteria 1286
1508 Ga0495650_0000230 3300046471 Bacteria 114025
1509 Ga0495650_0025394 3300046471 Bacteria 2778
1510 Ga0495580_0004214 3300046472 Bacteria 12092
1511 Ga0495580_0052612 3300046472 Bacteria 2875
1512 Ga0495582_0000209 3300046473 Bacteria 32511
1513 Ga0495582_0014036 3300046473 Bacteria 4410
1514 Ga0495582_0041407 3300046473 Bacteria 2538
1515 Ga0495605_0000071 3300046474 Bacteria 135203
1516 Ga0495605_0116685 3300046474 Bacteria 1213
1517 Ga0495605_0123331 3300046474 Bacteria 1173
1518 Ga0495639_0000387 3300046475 Bacteria 20931
1519 Ga0495662_0002150 3300046476 Bacteria 9897
1520 Ga0495662_0065754 3300046476 Bacteria 1753
1521 Ga0495664_0001615 3300046477 Bacteria 11993
1522 Ga0495664_0020289 3300046477 Bacteria 3832
1523 Ga0495664_0036970 3300046477 Bacteria 2880
1524 Ga0495664_0164827 3300046477 Bacteria 1345
1525 Ga0495664_0224499 3300046477 Bacteria 1137
1526 Ga0495584_0112301 3300046491 Bacteria 1379
1527 Ga0495585_0063354 3300046492 Bacteria 2029
1528 Ga0495585_0083407 3300046492 Bacteria 1730
1529 Ga0495594_0000342 3300046499 Bacteria 23227
1530 Ga0495594_0053255 3300046499 Bacteria 2229
1531 Ga0495594_0245976 3300046499 Bacteria 1019
1532 Ga0495596_0075093 3300046500 Bacteria 1313
1533 Ga0495596_0096815 3300046500 Bacteria 1146
1534 Ga0495607_0054467 3300046501 Bacteria 2305
1535 Ga0495606_0000077 3300046507 Bacteria 166824
1536 Ga0495606_0002837 3300046507 Bacteria 19219
1537 Ga0495606_0021044 3300046507 Bacteria 4787
1538 Ga0495606_0022784 3300046507 Bacteria 4552
1539 Ga0495606_0176234 3300046507 Bacteria 1236
1540 Ga0495608_0018247 3300046511 Bacteria 4842
1541 Ga0495608_0030836 3300046511 Bacteria 3627
1542 Ga0495610_0004699 3300046512 Bacteria 9973
1543 Ga0495610_0018192 3300046512 Bacteria 3977
1544 Ga0495610_0029652 3300046512 Bacteria 2878
1545 Ga0495610_0046624 3300046512 Bacteria 2137
1546 Ga0495618_0013641 3300046514 Bacteria 4944
1547 Ga0495618_0092392 3300046514 Bacteria 1935
1548 Ga0495618_0170990 3300046514 Bacteria 1383
1549 Ga0495628_0022291 3300046516 Bacteria 5203
1550 Ga0495628_0053583 3300046516 Bacteria 3183
1551 Ga0495630_0001378 3300046517 Bacteria 16750
1552 Ga0495630_0017390 3300046517 Bacteria 5267
1553 Ga0495630_0108191 3300046517 Bacteria 2106
1554 Ga0495631_0030198 3300046518 Bacteria 2460
1555 Ga0495632_0060728 3300046519 Bacteria 1836
1556 Ga0495632_0075713 3300046519 Bacteria 1610
1557 Ga0495643_0008539 3300046522 Bacteria 6470
1558 Ga0495643_0050056 3300046522 Bacteria 2251
1559 Ga0495644_0008390 3300046523 Bacteria 3979
1560 Ga0495644_0042265 3300046523 Bacteria 1716
1561 Ga0495648_0003600 3300046524 Bacteria 13558
1562 Ga0495648_0067174 3300046524 Bacteria 2098
1563 Ga0495648_0073583 3300046524 Bacteria 1972
1564 Ga0495648_0131370 3300046524 Bacteria 1331
1565 Ga0495648_0221562 3300046524 Bacteria 932
1566 Ga0495648_0223705 3300046524 Bacteria 926
1567 Ga0495663_0000244 3300046525 Bacteria 21549
1568 Ga0495663_0004640 3300046525 Bacteria 3850
1569 Ga0495663_0005899 3300046525 Bacteria 3391
1570 Ga0495663_0035860 3300046525 Bacteria 1491
1571 Ga0495642_0044451 3300046528 Bacteria 1813
1572 Ga0495652_0005332 3300046529 Bacteria 12122
1573 Ga0495652_0015193 3300046529 Bacteria 6893
1574 Ga0495652_0048216 3300046529 Bacteria 3651
1575 Ga0495652_0250060 3300046529 Bacteria 1314
1576 Ga0495665_0000280 3300046531 Bacteria 25894
1577 Ga0495640_0001578 3300046533 Bacteria 17975
1578 Ga0495640_0009615 3300046533 Bacteria 7520
1579 Ga0495640_0092149 3300046533 Bacteria 1999
1580 Ga0495587_0080106 3300046536 Bacteria 1893
1581 Ga0495587_0089701 3300046536 Bacteria 1776
1582 Ga0495598_0031078 3300046537 Bacteria 1501
1583 Ga0495621_0001420 3300046539 Bacteria 6202
1584 Ga0495621_0003194 3300046539 Bacteria 4494
1585 Ga0495621_0005820 3300046539 Bacteria 3565
1586 Ga0495597_0024441 3300046542 Bacteria 2789
1587 Ga0495597_0046672 3300046542 Bacteria 1919
1588 Ga0495645_0003978 3300046543 Bacteria 10080
1589 Ga0495645_0026670 3300046543 Bacteria 4194
1590 Ga0495645_0128905 3300046543 Bacteria 1775
1591 Ga0495622_0003837 3300046557 Bacteria 7020
1592 Ga0495622_0054002 3300046557 Bacteria 1864
1593 Ga0495633_0000682 3300046558 Bacteria 31296
1594 Ga0495667_0010850 3300046559 Bacteria 6159
1595 Ga0495667_0021239 3300046559 Bacteria 4380
1596 Ga0495667_0031330 3300046559 Bacteria 3569
1597 Ga0495667_0124426 3300046559 Bacteria 1664
1598 Ga0495656_0001211 3300046615 Bacteria 8402
1599 Ga0495656_0022169 3300046615 Bacteria 2484
1600 Ga0495656_0033251 3300046615 Bacteria 2104
1601 Ga0495668_0000064 3300046616 Bacteria 180583
1602 Ga0495668_0003739 3300046616 Bacteria 11175
1603 Ga0495668_0004733 3300046616 Bacteria 9533
1604 Ga0495668_0020880 3300046616 Bacteria 3761
1605 Ga0495668_0063027 3300046616 Bacteria 2042
1606 Ga0495634_0000865 3300046642 Bacteria 29129
1607 Ga0495634_0041615 3300046642 Bacteria 3120
1608 Ga0495634_0090070 3300046642 Bacteria 1993
1609 Ga0495634_0106789 3300046642 Bacteria 1804
1610 Ga0495625_0046907 3300046660 Bacteria 3116
1611 Ga0495625_0098424 3300046660 Bacteria 2012
1612 Ga0495625_0123908 3300046660 Bacteria 1756
1613 Ga0495625_0354240 3300046660 Bacteria 927
1614 Ga0495635_0001610 3300046663 Bacteria 15179
1615 Ga0495635_0003974 3300046663 Bacteria 10282
1616 Ga0495635_0113873 3300046663 Bacteria 1846
1617 Ga0495659_0009267 3300046664 Bacteria 3140
1618 Ga0495659_0104545 3300046664 Bacteria 1100
1619 Ga0495661_0070986 3300046665 Bacteria 2036
1620 Ga0495657_0004288 3300046675 Bacteria 11387
1621 Ga0495657_0027394 3300046675 Bacteria 4022
1622 Ga0495657_0036159 3300046675 Bacteria 3415
1623 Ga0495657_0072961 3300046675 Bacteria 2237
1624 Ga0495599_0000895 3300046678 Bacteria 16666
1625 Ga0495599_0042087 3300046678 Bacteria 2867
1626 Ga0495599_0044019 3300046678 Bacteria 2800
1627 Ga0495599_0071169 3300046678 Bacteria 2171
1628 Ga0495599_0138971 3300046678 Bacteria 1507
1629 Ga0495623_0023407 3300046679 Bacteria 3987
1630 Ga0495623_0037031 3300046679 Bacteria 3124
1631 Ga0495623_0075975 3300046679 Bacteria 2085
1632 Ga0495623_0140412 3300046679 Bacteria 1438
1633 Ga0495646_0102307 3300046680 Unclassified 1641
1634 Ga0495647_0000763 3300046681 Bacteria 9576
1635 Ga0495658_0001222 3300046683 Bacteria 13486
1636 Ga0495658_0090814 3300046683 Bacteria 1808
1637 Ga0495669_0000425 3300046684 Bacteria 20076
1638 Ga0495669_0003790 3300046684 Bacteria 6209
1639 Ga0495669_0038102 3300046684 Bacteria 2129
1640 Ga0495669_0045924 3300046684 Bacteria 1948
1641 Ga0495669_0063315 3300046684 Bacteria 1677
1642 Ga0495669_0091178 3300046684 Bacteria 1407
1643 Ga0495613_0058134 3300046689 Bacteria 2839
1644 Ga0495613_0164536 3300046689 Bacteria 1576
1645 Ga0495624_0001082 3300046690 Bacteria 21523
1646 Ga0495670_0002809 3300046691 Bacteria 8614
1647 Ga0495670_0018241 3300046691 Bacteria 3455
1648 Ga0495670_0074944 3300046691 Bacteria 1717
1649 Ga0495670_0165554 3300046691 Bacteria 1163
1650 Ga0495671_0102447 3300046692 Bacteria 1399
1651 Ga0495671_0147660 3300046692 Bacteria 1145
1652 Ga0495649_0136631 3300046694 Bacteria 1292
1653 Ga0495589_0196479 3300046794 Bacteria 953
1654 Ga0495600_0001516 3300046809 Bacteria 12897
1655 Ga0495600_0008985 3300046809 Bacteria 6157
1656 Ga0495600_0026432 3300046809 Bacteria 3745
1657 Ga0495600_0081749 3300046809 Bacteria 2108
1658 Ga0495600_0298963 3300046809 Bacteria 1016
1659 Ga0495581_0000969 3300047315 Bacteria 15425
1660 Ga0495581_0055226 3300047315 Bacteria 2292
1661 Ga0495581_0083192 3300047315 Bacteria 1854
1662 Ga0495604_0005690 3300047317 Bacteria 9884
1663 Ga0495604_0009731 3300047317 Bacteria 7602
1664 Ga0495604_0047249 3300047317 Bacteria 3353
1665 Ga0495604_0109157 3300047317 Bacteria 2020
1666 Ga0495604_0110793 3300047317 Bacteria 2002
1667 Ga0495604_0315607 3300047317 Bacteria 1046
1668 Ga0495674_0004372 3300047319 Bacteria 13583
1669 Ga0495674_0144466 3300047319 Bacteria 1998
1670 Ga0495674_0160871 3300047319 Bacteria 1879
1671 Ga0495674_0164583 3300047319 Bacteria 1854
1672 Ga0495674_0256672 3300047319 Bacteria 1437
1673 Ga0495674_0418134 3300047319 Bacteria 1080
1674 Ga0495676_0009743 3300047321 Bacteria 8733
1675 Ga0495676_0024919 3300047321 Bacteria 5170
1676 Ga0495676_0095906 3300047321 Bacteria 2206
1677 Ga0495680_0007239 3300047322 Bacteria 10218
1678 Ga0495680_0014577 3300047322 Bacteria 6804
1679 Ga0495680_0158436 3300047322 Bacteria 1645
1680 Ga0495687_004926 3300047443 Bacteria 8741
1681 Ga0495675_0378012 3300047444 Bacteria 829
1682 Ga0495677_0012274 3300047445 Bacteria 3126
1683 Ga0495677_0022919 3300047445 Bacteria 2266
1684 Ga0495677_0049355 3300047445 Bacteria 1547
1685 Ga0495685_054974 3300047447 Bacteria 1347
1686 Ga0495673_0003053 3300047469 Bacteria 11253
1687 Ga0495673_0037524 3300047469 Bacteria 2212
1688 Ga0495684_0028329 3300047471 Bacteria 4301
1689 Ga0495684_0034887 3300047471 Bacteria 3859
1690 Ga0495684_0040228 3300047471 Bacteria 3584
1691 Ga0495684_0122080 3300047471 Bacteria 1961
1692 Ga0495686_0004694 3300047472 Bacteria 11086
1693 Ga0495686_0018170 3300047472 Bacteria 4724
1694 Ga0495686_0029770 3300047472 Bacteria 3550
1695 Ga0495686_0098577 3300047472 Bacteria 1766
1696 Ga0495686_0101275 3300047472 Bacteria 1737
1697 Ga0495686_0102627 3300047472 Bacteria 1723
1698 Ga0495593_0000238 3300047673 Bacteria 29664
1699 Ga0495602_0054399 3300048088 Bacteria 3534
1700 Ga0495602_0072832 3300048088 Bacteria 2927
1701 Ga0495602_0088952 3300048088 Bacteria 2569
1702 Ga0495602_0308361 3300048088 Bacteria 1156
1703 Ga0495614_0050431 3300048089 Bacteria 1783
1704 Ga0495615_0026386 3300048090 Bacteria 1356
1705 Ga0495626_0043133 3300048091 Bacteria 2117
1706 Ga0496100_0057279 3300048903 Bacteria 2552
1707 Ga0496100_0420706 3300048903 Bacteria 1020
1708 Ga0496101_0107022 3300048904 Bacteria 2100
1709 Ga0496102_0001874 3300048905 Bacteria 18120
1710 Ga0496102_0014235 3300048905 Bacteria 6912
1711 Ga0496102_0023662 3300048905 Bacteria 5458
1712 Ga0496102_0027582 3300048905 Bacteria 5071
1713 Ga0496102_0063502 3300048905 Bacteria 3382
1714 Ga0496102_0068985 3300048905 Bacteria 3245
1715 Ga0496102_0130845 3300048905 Bacteria 2348
1716 Ga0496102_0262361 3300048905 Bacteria 1629
1717 Ga0496102_0519316 3300048905 Bacteria 1113
1718 Ga0496103_0005154 3300048906 Bacteria 7868
1719 Ga0496103_0013419 3300048906 Bacteria 4858
1720 Ga0496103_0091118 3300048906 Bacteria 1924
1721 Ga0496103_0113947 3300048906 Bacteria 1719
1722 Ga0496104_0002350 3300048907 Bacteria 16350
1723 Ga0496104_0004135 3300048907 Bacteria 12598
1724 Ga0496104_0032406 3300048907 Bacteria 4863
1725 Ga0496104_0063581 3300048907 Bacteria 3500
1726 Ga0496104_0066816 3300048907 Bacteria 3414
1727 Ga0496104_0086027 3300048907 Bacteria 3001
1728 Ga0496104_0109245 3300048907 Bacteria 2651
1729 Ga0496104_0513955 3300048907 Bacteria 1109
1730 Ga0496105_0005457 3300048908 Bacteria 9648
1731 Ga0496105_0006033 3300048908 Bacteria 9265
1732 Ga0496105_0031458 3300048908 Bacteria 4350
1733 Ga0496105_0037552 3300048908 Bacteria 3988
1734 Ga0496105_0051057 3300048908 Bacteria 3417
1735 Ga0496105_0103946 3300048908 Bacteria 2346
1736 Ga0496105_0109410 3300048908 Bacteria 2281
1737 Ga0496105_0179667 3300048908 Bacteria 1733
1738 Ga0496106_0005572 3300048909 Bacteria 9321
1739 Ga0496106_0032730 3300048909 Bacteria 3878
1740 Ga0496106_0037383 3300048909 Bacteria 3632
1741 Ga0496106_0100459 3300048909 Bacteria 2243
1742 Ga0496106_0456658 3300048909 Bacteria 1026
1743 Ga0496107_0012285 3300048910 Bacteria 5977
1744 Ga0496107_0024590 3300048910 Bacteria 4261
1745 Ga0496107_0048206 3300048910 Bacteria 3068
1746 Ga0496107_0150166 3300048910 Bacteria 1723
1747 Ga0496108_0004499 3300048911 Bacteria 11230
1748 Ga0496108_0054660 3300048911 Bacteria 3350
1749 Ga0496109_0069006 3300048912 Bacteria 3241
1750 Ga0496109_0084752 3300048912 Bacteria 2924
1751 Ga0496109_0089390 3300048912 Bacteria 2847
1752 Ga0496109_0092516 3300048912 Bacteria 2797
1753 Ga0496109_0278350 3300048912 Bacteria 1577
1754 Ga0496109_0311404 3300048912 Bacteria 1485
1755 Ga0496110_0060294 3300048913 Bacteria 3345
1756 Ga0496110_0124160 3300048913 Bacteria 2328
1757 Ga0496110_0140750 3300048913 Bacteria 2181
1758 Ga0496110_0175342 3300048913 Bacteria 1946
1759 Ga0496110_0521775 3300048913 Bacteria 1081
1760 Ga0496111_0023618 3300048914 Bacteria 4318
1761 Ga0496111_0105454 3300048914 Bacteria 2074
1762 Ga0496111_0197704 3300048914 Bacteria 1495
1763 Ga0496111_0218049 3300048914 Bacteria 1417
1764 Ga0496111_0253803 3300048914 Bacteria 1305
1765 Ga0496112_0000111 3300048915 Bacteria 50958
1766 Ga0496112_0033792 3300048915 Bacteria 4973
1767 Ga0496112_0036737 3300048915 Bacteria 4779
1768 Ga0496112_0042124 3300048915 Bacteria 4467
1769 Ga0496112_0077684 3300048915 Bacteria 3283
1770 Ga0496112_0113093 3300048915 Bacteria 2685
1771 Ga0496112_0150135 3300048915 Bacteria 2297
1772 Ga0496112_0254947 3300048915 Bacteria 1705
1773 Ga0496112_0369215 3300048915 Bacteria 1376
1774 Ga0496113_0063987 3300048916 Bacteria 2780
1775 Ga0496113_0247281 3300048916 Bacteria 1423
1776 Ga0496113_0309761 3300048916 Bacteria 1265
1777 Ga0496113_0318990 3300048916 Bacteria 1245
1778 Ga0496113_0634733 3300048916 Bacteria 854
1779 Ga0496114_0000006 3300048917 Bacteria 472921
1780 Ga0496114_0010915 3300048917 Bacteria 7240
1781 Ga0496114_0015072 3300048917 Bacteria 6216
1782 Ga0496114_0050568 3300048917 Bacteria 3459
1783 Ga0496114_0153699 3300048917 Bacteria 1997
1784 Ga0496114_0386513 3300048917 Bacteria 1239
1785 Ga0496115_0058680 3300048918 Bacteria 3097
1786 Ga0496115_0065612 3300048918 Bacteria 2932
1787 Ga0496115_0087107 3300048918 Bacteria 2548
1788 Ga0496115_0098033 3300048918 Bacteria 2400
1789 Ga0496115_0105574 3300048918 Bacteria 2312
1790 Ga0496115_0145985 3300048918 Bacteria 1952
1791 Ga0496115_0152980 3300048918 Bacteria 1905
1792 Ga0496115_0289354 3300048918 Bacteria 1344
1793 Ga0496115_0365111 3300048918 Bacteria 1176
1794 Ga0496115_0450644 3300048918 Bacteria 1039
1795 Ga0496116_0000520 3300048919 Bacteria 51826
1796 Ga0496116_0017386 3300048919 Bacteria 5582
1797 Ga0496117_0028383 3300048920 Bacteria 4335
1798 Ga0496117_0056829 3300048920 Bacteria 2722
1799 Ga0496117_0073645 3300048920 Bacteria 2278
1800 Ga0496117_0178549 3300048920 Bacteria 1223
1801 Ga0496117_0229023 3300048920 Bacteria 1028
1802 Ga0496118_0010974 3300048921 Bacteria 8903
1803 Ga0496118_0027793 3300048921 Bacteria 4778
1804 Ga0496118_0041819 3300048921 Bacteria 3623
1805 Ga0496118_0060350 3300048921 Bacteria 2816
1806 Ga0496118_0109313 3300048921 Bacteria 1840
1807 Ga0496119_0011955 3300048922 Bacteria 7113
1808 Ga0496119_0012495 3300048922 Bacteria 6889
1809 Ga0496119_0028314 3300048922 Bacteria 3826
1810 Ga0496119_0070076 3300048922 Bacteria 2058
1811 Ga0496120_0061168 3300048923 Bacteria 2103
1812 Ga0496121_0001361 3300048924 Bacteria 41683
1813 Ga0496121_0001375 3300048924 Bacteria 41255
1814 Ga0496121_0009848 3300048924 Bacteria 10908
1815 Ga0496121_0010696 3300048924 Bacteria 10297
1816 Ga0496121_0024520 3300048924 Bacteria 5765
1817 Ga0496121_0029624 3300048924 Bacteria 5054
1818 Ga0496121_0045348 3300048924 Bacteria 3779
1819 Ga0496121_0053239 3300048924 Bacteria 3392
1820 Ga0496121_0074732 3300048924 Bacteria 2709
1821 Ga0496121_0074837 3300048924 Bacteria 2707
1822 Ga0496121_0105948 3300048924 Bacteria 2156
1823 Ga0496121_0139284 3300048924 Bacteria 1802
1824 Ga0496121_0174499 3300048924 Bacteria 1558
1825 Ga0496121_0264212 3300048924 Bacteria 1186
1826 Ga0496122_0000317 3300048925 Bacteria 105883
1827 Ga0496122_0064643 3300048925 Bacteria 2660
1828 Ga0496122_0100311 3300048925 Bacteria 1938
1829 Ga0496123_0000264 3300048926 Bacteria 105015
1830 Ga0496123_0044466 3300048926 Bacteria 3037
1831 Ga0496123_0055971 3300048926 Bacteria 2583
1832 Ga0496123_0107425 3300048926 Bacteria 1605
1833 Ga0496124_0010052 3300048927 Bacteria 9651
1834 Ga0496124_0016823 3300048927 Bacteria 6932
1835 Ga0496124_0030133 3300048927 Bacteria 4821
1836 Ga0496124_0067619 3300048927 Bacteria 2973
1837 Ga0496124_0365101 3300048927 Bacteria 1016
1838 Ga0496125_0000202 3300048928 Bacteria 125963
1839 Ga0496125_0001999 3300048928 Bacteria 27642
1840 Ga0496125_0011066 3300048928 Bacteria 9055
1841 Ga0496125_0015391 3300048928 Bacteria 7403
1842 Ga0496125_0015510 3300048928 Bacteria 7364
1843 Ga0496125_0043334 3300048928 Bacteria 3821
1844 Ga0496125_0115642 3300048928 Bacteria 1928
1845 Ga0496125_0178586 3300048928 Bacteria 1417
1846 Ga0496125_0208981 3300048928 Bacteria 1269
1847 Ga0496125_0260186 3300048928 Bacteria 1088
1848 Ga0496126_0004835 3300048929 Bacteria 15796
1849 Ga0496126_0012757 3300048929 Bacteria 8588
1850 Ga0496126_0013430 3300048929 Bacteria 8329
1851 Ga0496126_0031523 3300048929 Bacteria 5007
1852 Ga0496126_0060578 3300048929 Bacteria 3403
1853 Ga0496126_0076633 3300048929 Bacteria 2967
1854 Ga0496126_0086531 3300048929 Bacteria 2762
1855 Ga0496126_0086623 3300048929 Bacteria 2760
1856 Ga0496126_0087691 3300048929 Bacteria 2742
1857 Ga0496126_0106036 3300048929 Bacteria 2453
1858 Ga0496126_0109568 3300048929 Bacteria 2407
1859 Ga0496126_0114059 3300048929 Bacteria 2351
1860 Ga0496126_0131831 3300048929 Bacteria 2159
1861 Ga0496126_0175520 3300048929 Bacteria 1823
1862 Ga0496126_0197717 3300048929 Bacteria 1699
1863 Ga0496126_0250560 3300048929 Bacteria 1476
1864 Ga0495682_0009656 3300049460 Bacteria 3761
1865 Ga0495682_0089185 3300049460 Bacteria 1108
1866 Ga0501031_0001272 3300049568 Bacteria 15446
1867 Ga0501031_0009736 3300049568 Bacteria 6258
1868 Ga0501032_0000257 3300049569 Bacteria 44325
1869 Ga0501032_0002207 3300049569 Bacteria 15325
1870 Ga0501032_0017662 3300049569 Bacteria 5007
1871 Ga0501033_0000124 3300049570 Bacteria 74731
1872 Ga0501033_0000244 3300049570 Bacteria 52231
1873 Ga0501034_0000159 3300049571 Bacteria 127397
1874 Ga0501034_0015413 3300049571 Bacteria 7856
1875 Ga0501034_0041167 3300049571 Bacteria 4674
1876 Ga0501034_0041285 3300049571 Bacteria 4667
1877 Ga0501034_0089183 3300049571 Bacteria 3082
1878 Ga0501034_0094099 3300049571 Bacteria 2993
1879 Ga0501036_0000039 3300049572 Bacteria 83065
1880 Ga0501036_0007815 3300049572 Bacteria 8747
1881 Ga0501037_0000247 3300049573 Bacteria 46080
1882 Ga0501037_0001386 3300049573 Bacteria 17773
1883 Ga0501037_0030882 3300049573 Bacteria 3957
1884 Ga0501038_0000041 3300049574 Bacteria 120557
1885 Ga0501038_0000207 3300049574 Bacteria 50307
1886 Ga0501038_0193738 3300049574 Bacteria 1634
1887 Ga0501039_0000064 3300049575 Bacteria 83415
1888 Ga0501039_0000148 3300049575 Bacteria 47789
1889 Ga0501039_0019776 3300049575 Bacteria 5162
1890 Ga0501040_0018578 3300049576 Bacteria 4616
1891 Ga0501041_0361396 3300049577 Bacteria 918
1892 Ga0501042_0026466 3300049578 Bacteria 4076
1893 Ga0501042_0065421 3300049578 Bacteria 2598
1894 Ga0501043_0000202 3300049579 Bacteria 54441
1895 Ga0501043_0030154 3300049579 Bacteria 4261
1896 Ga0501043_0032864 3300049579 Bacteria 4080
1897 Ga0501043_0236760 3300049579 Bacteria 1409
1898 Ga0501046_0000185 3300049580 Bacteria 63459
1899 Ga0501046_0047426 3300049580 Bacteria 3406
1900 Ga0501046_0063676 3300049580 Bacteria 2879
1901 Ga0501046_0224003 3300049580 Bacteria 1391
1902 Ga0501047_0000154 3300049581 Bacteria 83424
1903 Ga0501047_0000288 3300049581 Bacteria 57965
1904 Ga0501047_0000392 3300049581 Bacteria 49114
1905 Ga0501047_0002801 3300049581 Bacteria 16556
1906 Ga0501048_0000536 3300049582 Bacteria 26743
1907 Ga0501048_0074941 3300049582 Bacteria 2387
1908 Ga0501067_0000896 3300049583 Bacteria 16010
1909 Ga0501067_0016856 3300049583 Bacteria 4035
1910 Ga0501067_0065527 3300049583 Bacteria 2011
1911 Ga0501067_0304339 3300049583 Bacteria 888
1912 Ga0501068_0002219 3300049584 Bacteria 10329
1913 Ga0501068_0009442 3300049584 Bacteria 5459
1914 Ga0501069_0003631 3300049585 Bacteria 7945
1915 Ga0501069_0017962 3300049585 Bacteria 3815
1916 Ga0501070_0000175 3300049586 Bacteria 59483
1917 Ga0501070_0000557 3300049586 Bacteria 34014
1918 Ga0501070_0003774 3300049586 Bacteria 13087
1919 Ga0501070_0125744 3300049586 Bacteria 2119
1920 Ga0501070_0161410 3300049586 Bacteria 1848
1921 Ga0501071_0026378 3300049587 Bacteria 4078
1922 Ga0501071_0306570 3300049587 Bacteria 1204
1923 Ga0501072_0001033 3300049588 Bacteria 20627
1924 Ga0501072_0172336 3300049588 Bacteria 1727
1925 Ga0501072_0241408 3300049588 Bacteria 1439
1926 Ga0501073_0000034 3300049589 Bacteria 95224
1927 Ga0501073_0109839 3300049589 Bacteria 1913
1928 Ga0501074_0002163 3300049590 Bacteria 13619
1929 Ga0501074_0014736 3300049590 Bacteria 5686
1930 Ga0501074_0067981 3300049590 Bacteria 2561
1931 Ga0501076_0003638 3300049592 Bacteria 10831
1932 Ga0501076_0184579 3300049592 Bacteria 1701
1933 Ga0501249_004258 3300049679 Bacteria 2904
1934 Ga0501079_0000773 3300049741 Bacteria 21906
1935 Ga0501079_0165115 3300049741 Bacteria 1727
1936 Ga0501079_0321504 3300049741 Bacteria 1211
1937 Ga0501080_0000805 3300049742 Bacteria 25642
1938 Ga0501080_0001103 3300049742 Bacteria 22242
1939 Ga0501080_0190860 3300049742 Bacteria 1882
1940 Ga0501080_0213623 3300049742 Bacteria 1767
1941 Ga0501081_0028882 3300049743 Bacteria 3745
1942 Ga0501083_0000118 3300049744 Bacteria 54096
1943 Ga0501035_0000137 3300049822 Bacteria 89273
1944 Ga0501035_0000155 3300049822 Bacteria 84012
1945 Ga0501035_0013576 3300049822 Bacteria 7516
1946 Ga0501035_0185462 3300049822 Bacteria 1791
1947 Ga0501044_0000393 3300049823 Bacteria 54257
1948 Ga0501044_0000431 3300049823 Bacteria 51668
1949 Ga0501044_0043652 3300049823 Bacteria 4657
1950 Ga0501044_0048505 3300049823 Bacteria 4386
1951 Ga0501044_0184415 3300049823 Bacteria 2052
1952 Ga0501044_0273692 3300049823 Bacteria 1623
1953 Ga0501045_0005484 3300049824 Bacteria 8780
1954 Ga0501045_0011293 3300049824 Bacteria 6269
1955 Ga0501045_0370025 3300049824 Bacteria 1067
1956 nmdc:mga03683_18717_c1 3300050489 Bacteria 2636
1957 nmdc:mga03683_213821_c1 3300050489 Bacteria 888
1958 nmdc:mga03683_79709_c1 3300050489 Bacteria 1412
1959 nmdc:mga03n38_11501_c1 3300050490 Bacteria 3301
1960 nmdc:mga00v17_47706_c1 3300050491 Bacteria 2595
1961 nmdc:mga00v17_49102_c1 3300050491 Bacteria 2559
1962 nmdc:mga00v17_5677_c1 3300050491 Bacteria 6588
1963 nmdc:mga0yw44_10115_c1 3300050492 Bacteria 4804
1964 nmdc:mga0yw44_244705_c1 3300050492 Bacteria 1193
1965 nmdc:mga0yw44_49878_c1 3300050492 Bacteria 2528
1966 nmdc:mga0yw44_67720_c1 3300050492 Bacteria 2207
1967 nmdc:mga0yw44_87100_c1 3300050492 Bacteria 1968
1968 nmdc:mga0k408_151890_c1 3300050493 Bacteria 1379
1969 nmdc:mga0k408_26106_c1 3300050493 Bacteria 3311
1970 nmdc:mga0k408_72426_c1 3300050493 Bacteria 2012
1971 nmdc:mga0k408_97542_c1 3300050493 Bacteria 1731
1972 nmdc:mga06z11_140673_c1 3300050494 Bacteria 1364
1973 nmdc:mga06z11_172160_c1 3300050494 Bacteria 1244
1974 nmdc:mga06z11_269336_c1 3300050494 Bacteria 1007
1975 nmdc:mga06z11_5709_c1 3300050494 Bacteria 5013
1976 nmdc:mga06z11_5831_c1 3300050494 Bacteria 4972
1977 nmdc:mga06z11_62884_c1 3300050494 Bacteria 1539
1978 nmdc:mga07m45_110346_c1 3300050496 Bacteria 1584
1979 nmdc:mga07m45_26891_c1 3300050496 Bacteria 3165
1980 nmdc:mga07m45_7680_c1 3300050496 Bacteria 5223
1981 nmdc:mga05p37_168433_c1 3300050507 Bacteria 2673
1982 nmdc:mga05p37_213047_c1 3300050507 Bacteria 2334
1983 nmdc:mga05p37_293_c1 3300050507 Bacteria 52375
1984 nmdc:mga05p37_296873_c1 3300050507 Bacteria 1921
1985 nmdc:mga05p37_3152_c1 3300050507 Bacteria 19188
1986 nmdc:mga09592_1602_c1 3300050508 Bacteria 18242
1987 nmdc:mga09592_306541_c1 3300050508 Bacteria 1376
1988 nmdc:mga09592_347162_c1 3300050508 Bacteria 1284
1989 nmdc:mga09592_8789_c1 3300050508 Bacteria 8220
1990 nmdc:mga0qj67_1524_c1 3300050509 Bacteria 16254
1991 nmdc:mga0qj67_17595_c2 3300050509 Bacteria 4150
1992 nmdc:mga0qj67_237550_c1 3300050509 Bacteria 1478
1993 nmdc:mga06r32_139_c1 3300050510 Bacteria 54112
1994 nmdc:mga06r32_392781_c1 3300050510 Bacteria 1369
1995 nmdc:mga06r32_70_c1 3300050510 Bacteria 66330
1996 nmdc:mga06r32_8345_c1 3300050510 Bacteria 9325
1997 nmdc:mga08y16_210988_c1 3300050511 Bacteria 2011
1998 nmdc:mga08y16_36453_c1 3300050511 Bacteria 5166
1999 nmdc:mga08y16_43379_c1 3300050511 Bacteria 4713
2000 nmdc:mga08y16_6788_c1 3300050511 Bacteria 12011
2001 nmdc:mga08y16_81_c1 3300050511 Bacteria 81573
2002 nmdc:mga08y16_88943_c1 3300050511 Bacteria 3218
2003 nmdc:mga08y16_93500_c1 3300050511 Bacteria 3132
2004 nmdc:mga0n895_2094_c1 3300050512 Bacteria 15379
2005 nmdc:mga0n895_262777_c1 3300050512 Bacteria 1751
2006 nmdc:mga0n895_40277_c1 3300050512 Bacteria 4538
2007 nmdc:mga0rr50_108497_c1 3300050513 Bacteria 2193
2008 nmdc:mga0rr50_15563_c1 3300050513 Bacteria 5024
2009 nmdc:mga0rr50_555731_c1 3300050513 Bacteria 977
2010 nmdc:mga0rr50_59994_c1 3300050513 Bacteria 2859
2011 nmdc:mga0a205_17040_c1 3300050515 Bacteria 6801
2012 nmdc:mga0a205_29441_c1 3300050515 Bacteria 5255
2013 nmdc:mga0a205_294871_c2 3300050515 Bacteria 1058
2014 nmdc:mga0a205_31493_c1 3300050515 Bacteria 5081
2015 nmdc:mga0a205_830_c1 3300050515 Bacteria 25159
2016 nmdc:mga0sz30_15323_c1 3300050516 Bacteria 3028
2017 nmdc:mga0sz30_3996_c1 3300050516 Bacteria 5311
2018 Ga0495601_0296932 3300053077 Bacteria 1053
2019 Ga0495612_0034855 3300053078 Bacteria 2038
2020 Ga0495612_0079508 3300053078 Bacteria 1377
2021 Ga0500610_0000004 3300053079 Bacteria 139897
2022 Ga0495655_0054562 3300053083 Bacteria 1070
2023 Ga0495595_0070503 3300053084 Bacteria 1651
2024 Ga0495619_0015826 3300053085 Bacteria 4775
2025 Ga0495619_0048033 3300053085 Bacteria 2812
2026 Ga0495619_0127345 3300053085 Bacteria 1748
2027 Ga0500578_0028483 3300053086 Bacteria 3587
2028 Ga0500643_000037 3300053087 Bacteria 180821
2029 Ga0500643_027503 3300053087 Bacteria 1768
2030 Ga0500643_028911 3300053087 Bacteria 1710
2031 Ga0500646_0011894 3300053090 Bacteria 2242
2032 Ga0500647_0040972 3300053091 Bacteria 2222
2033 Ga0500651_0001199 3300053093 Bacteria 12870
2034 Ga0500651_0080305 3300053093 Bacteria 2020
2035 Ga0500566_0000166 3300053094 Bacteria 33843
2036 Ga0500566_0001046 3300053094 Bacteria 16010
2037 Ga0500566_0001772 3300053094 Bacteria 12687
2038 Ga0500566_0002306 3300053094 Bacteria 11289
2039 Ga0500566_0085084 3300053094 Bacteria 1754
2040 Ga0500566_0100525 3300053094 Bacteria 1586
2041 Ga0500640_000873 3300053095 Bacteria 8371
2042 Ga0500640_047604 3300053095 Bacteria 1880
2043 Ga0500641_0010047 3300053096 Bacteria 3412
2044 Ga0500641_0014080 3300053096 Bacteria 2947
2045 Ga0500641_0025121 3300053096 Bacteria 2303
2046 Ga0500641_0156289 3300053096 Bacteria 984
2047 Ga0500654_077221 3300053099 Bacteria 1579
2048 Ga0500554_000266 3300053102 Bacteria 11311
2049 Ga0500555_000550 3300053103 Bacteria 14953
2050 Ga0500556_0000089 3300053104 Bacteria 84468
2051 Ga0500557_000047 3300053105 Bacteria 59226
2052 Ga0500562_003706 3300053108 Bacteria 3842
2053 Ga0500572_000474 3300053111 Bacteria 13955
2054 Ga0500572_000614 3300053111 Bacteria 11989
2055 Ga0500572_007111 3300053111 Bacteria 2583
2056 Ga0500595_000891 3300053119 Bacteria 17010
2057 Ga0500595_002669 3300053119 Bacteria 8673
2058 Ga0500595_004982 3300053119 Bacteria 5863
2059 Ga0500595_007131 3300053119 Bacteria 4668
2060 Ga0500607_009772 3300053121 Bacteria 5757
2061 Ga0500608_000206 3300053122 Bacteria 23563
2062 Ga0500608_030294 3300053122 Bacteria 2564
2063 Ga0500614_002313 3300053123 Bacteria 4270
2064 Ga0500626_064744 3300053128 Bacteria 1632
2065 Ga0500642_0000050 3300053130 Bacteria 79050
2066 Ga0500642_0000071 3300053130 Bacteria 55663
2067 Ga0500652_000004 3300053131 Bacteria 173428
2068 Ga0500652_009694 3300053131 Bacteria 3269
2069 Ga0500655_004071 3300053133 Bacteria 2633
2070 Ga0500658_0023361 3300053134 Bacteria 2360
2071 Ga0500658_0091606 3300053134 Bacteria 1315
2072 Ga0500658_0213137 3300053134 Bacteria 884
2073 Ga0500559_0000136 3300053136 Bacteria 56922
2074 Ga0500559_0001651 3300053136 Bacteria 12343
2075 Ga0500559_0002659 3300053136 Bacteria 9097
2076 Ga0500559_0003297 3300053136 Bacteria 8005
2077 Ga0500559_0008736 3300053136 Bacteria 4419
2078 Ga0500568_0001309 3300053139 Bacteria 16339
2079 Ga0500568_0021334 3300053139 Bacteria 2788
2080 Ga0500568_0026208 3300053139 Bacteria 2449
2081 Ga0500568_0101520 3300053139 Bacteria 1079
2082 Ga0500573_0120136 3300053140 Bacteria 1463
2083 Ga0500577_0000632 3300053142 Bacteria 9019
2084 Ga0500577_0081718 3300053142 Bacteria 1290
2085 Ga0500586_002729 3300053145 Bacteria 4048
2086 Ga0500589_091596 3300053147 Bacteria 1338
2087 Ga0500603_000501 3300053150 Bacteria 9959
2088 Ga0500603_001014 3300053150 Bacteria 6610
2089 Ga0500603_008704 3300053150 Bacteria 2259
2090 Ga0500604_0000021 3300053151 Bacteria 72909
2091 Ga0500604_0017071 3300053151 Bacteria 2004
2092 Ga0500604_0026562 3300053151 Bacteria 1670
2093 Ga0500604_0113034 3300053151 Bacteria 903
2094 Ga0500616_0000026 3300053153 Bacteria 454314
2095 Ga0500616_0009002 3300053153 Bacteria 6115
2096 Ga0500616_0094571 3300053153 Bacteria 1472
2097 Ga0500622_0001149 3300053156 Bacteria 22026
2098 Ga0500622_0001752 3300053156 Bacteria 16718
2099 Ga0500622_0134081 3300053156 Bacteria 1188
2100 Ga0500627_0055392 3300053158 Bacteria 1736
2101 Ga0500630_002780 3300053159 Bacteria 8437
2102 Ga0500633_0004613 3300053160 Bacteria 3184
2103 Ga0500638_023402 3300053162 Bacteria 2936
2104 Ga0500638_030195 3300053162 Bacteria 2609
2105 Ga0500638_051323 3300053162 Bacteria 1994
2106 Ga0500638_078689 3300053162 Bacteria 1568
2107 Ga0500639_000112 3300053163 Bacteria 38789
2108 Ga0500636_0000880 3300053177 Bacteria 16096
2109 Ga0500636_0002910 3300053177 Bacteria 9590
2110 Ga0500636_0023543 3300053177 Bacteria 3640
2111 Ga0500636_0023642 3300053177 Bacteria 3633
2112 Ga0500636_0051194 3300053177 Bacteria 2428
2113 Ga0500636_0094499 3300053177 Bacteria 1708
2114 Ga0500636_0167953 3300053177 Bacteria 1189
2115 Ga0500637_0000240 3300053178 Bacteria 20394
2116 Ga0500637_0000582 3300053178 Bacteria 14362
2117 Ga0500637_0159389 3300053178 Bacteria 1301
2118 Ga0500637_0197576 3300053178 Bacteria 1146
2119 Ga0500625_001064 3300053729 Bacteria 8854
2120 Ga0500645_071404 3300053730 Bacteria 996
2121 Ga0500596_001425 3300053735 Bacteria 4835
2122 Ga0500596_016115 3300053735 Bacteria 1123
2123 Ga0500601_000014 3300053737 Bacteria 41972
2124 Ga0501084_0002041 3300054114 Bacteria 16122
2125 Ga0500661_003063 3300055283 Bacteria 3142
2126 Ga0500661_015619 3300055283 Bacteria 1361
2127 Ga0501082_0002604 3300060353 Bacteria 15767
2128 Ga0501082_0013466 3300060353 Bacteria 7025
2129 Ga0501082_0644965 3300060353 Bacteria 927
2130 Ga0466962_0067511 3300061719 Bacteria 1707

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016566248 8016566427 231
2 3300005719 Ga0068861_100153652 Ga0068861_1001536523 248
3 3300005435 Ga0070714_100130606 Ga0070714_1001306063 250
4 3300005530 Ga0070679_100102813 Ga0070679_1001028132 250
5 3300005614 Ga0068856_100196095 Ga0068856_1001960952 250
6 3300005616 Ga0068852_100035255 Ga0068852_1000352553 250
7 3300005616 Ga0068852_100173399 Ga0068852_1001733992 250
8 3300005985 Ga0081539_10199651 Ga0081539_101996511 250
9 3300009551 Ga0105238_10024436 Ga0105238_100244364 250
10 3300013105 Ga0157369_10332266 Ga0157369_103322663 250
11 3300025921 Ga0207652_10489822 Ga0207652_104898222 250
12 3300025924 Ga0207694_10048259 Ga0207694_100482593 250
13 3300025929 Ga0207664_10145266 Ga0207664_101452663 250
14 3300025944 Ga0207661_10470036 Ga0207661_104700361 250
15 3300025949 Ga0207667_10024903 Ga0207667_100249036 250
16 3300025949 Ga0207667_10078368 Ga0207667_100783683 250
17 3300026078 Ga0207702_10031585 Ga0207702_100315852 250
18 3300031595 Ga0265313_10021048 Ga0265313_100210482 250
19 3300031712 Ga0265342_10000131 Ga0265342_1000013147 250
20 3300041512 Ga0451853_0782180 Ga0451853_0782180_287_1123 250
21 3300025294 Ga0209025_1035647 Ga0209025_10356472 251
22 3300025299 Ga0209256_1000330 Ga0209256_10003306 251
23 3300049571 Ga0501034_0041285 Ga0501034_0041285_18_785 252
24 3300049578 Ga0501042_0065421 Ga0501042_0065421_1635_2471 252
25 3300037418 Ga0395900_0098011 Ga0395900_0098011_2009_2776 253
26 3300037466 Ga0395898_0054338 Ga0395898_0054338_2017_2784 253
27 3300038443 Ga0395901_0563583 Ga0395901_0563583_49_816 253
28 3300046477 Ga0495664_0164827 Ga0495664_0164827_17_784 253
29 3300049581 Ga0501047_0000154 Ga0501047_0000154_37812_38630 253
30 3300006175 Ga0070712_100286863 Ga0070712_1002868631 254
31 3300025915 Ga0207693_10228311 Ga0207693_102283112 254
32 3300035116 Ga0373945_0002208 Ga0373945_0002208_4726_5535 254
33 3300021361 Ga0213872_10002065 Ga0213872_100020656 255
34 3300039447 Ga0436361_0869861 Ga0436361_0869861_6321_7175 255
35 3300039450 Ga0436363_1610649 Ga0436363_1610649_3357_4130 255
36 3300005262 Ga0065165_1000368 Ga0065165_10003682 256
37 3300006358 Ga0068871_100320609 Ga0068871_1003206092 256
38 3300025302 Ga0207426_1000289 Ga0207426_1000289113 256
39 3300031731 Ga0307405_10315549 Ga0307405_103155491 256
40 3300032002 Ga0307416_100284635 Ga0307416_1002846352 256
41 3300050489 nmdc:mga03683_213821_c1 nmdc:mga03683_213821_c1_15_791 256
42 3300050492 nmdc:mga0yw44_244705_c1 nmdc:mga0yw44_244705_c1_17_793 256
43 3300005434 Ga0070709_10132374 Ga0070709_101323742 257
44 3300005436 Ga0070713_100020170 Ga0070713_1000201702 257
45 3300005614 Ga0068856_100005034 Ga0068856_10000503411 257
46 3300009093 Ga0105240_10471305 Ga0105240_104713052 257
47 3300021361 Ga0213872_10011223 Ga0213872_100112232 257
48 3300021361 Ga0213872_10064933 Ga0213872_100649331 257
49 3300025928 Ga0207700_10101172 Ga0207700_101011722 257
50 3300025981 Ga0207640_10000024 Ga0207640_1000002439 257
51 3300026078 Ga0207702_10084485 Ga0207702_100844853 257
52 3300039447 Ga0436361_0151792 Ga0436361_0151792_28_852 257
53 3300039447 Ga0436361_0523670 Ga0436361_0523670_682_1506 257
54 3300037471 Ga0395905_0130273 Ga0395905_0130273_595_1404 258
55 3300049588 Ga0501072_0172336 Ga0501072_0172336_410_1228 258
56 3300025909 Ga0207705_10087687 Ga0207705_100876873 259
57 3300025919 Ga0207657_10039797 Ga0207657_100397972 259
58 3300028573 Ga0265334_10045433 Ga0265334_100454332 259
59 3300028794 Ga0307515_10144305 Ga0307515_101443051 259
60 3300032002 Ga0307416_100236820 Ga0307416_1002368201 259
61 3300033180 Ga0307510_10148617 Ga0307510_101486172 259
62 3300046471 Ga0495650_0025394 Ga0495650_0025394_37_822 259
63 3300046680 Ga0495646_0102307 Ga0495646_0102307_11_796 259
64 3300047444 Ga0495675_0378012 Ga0495675_0378012_31_816 259
65 3300006028 Ga0070717_10431354 Ga0070717_104313542 260
66 3300021358 Ga0213873_10000702 Ga0213873_100007023 260
67 3300021377 Ga0213874_10000116 Ga0213874_100001166 260
68 3300025929 Ga0207664_10054799 Ga0207664_100547992 260
69 3300030760 Ga0265762_1010074 Ga0265762_10100742 260
70 3300039437 Ga0436365_1030657 Ga0436365_1030657_4349_5137 260
71 3300039437 Ga0436365_1541048 Ga0436365_1541048_171_959 260
72 3300039447 Ga0436361_0950110 Ga0436361_0950110_711_1499 260
73 3300039450 Ga0436363_0634802 Ga0436363_0634802_31113_31901 260
74 3300039450 Ga0436363_1153269 Ga0436363_1153269_15_803 260
75 3300039453 Ga0436362_0379214 Ga0436362_0379214_1364_2152 260
76 3300044684 Ga0466966_0018263 Ga0466966_0018263_988_1776 260
77 3300044694 Ga0466963_0175690 Ga0466963_0175690_23_811 260
78 3300044719 Ga0466971_0067718 Ga0466971_0067718_568_1356 260
79 3300044842 Ga0466957_0114925 Ga0466957_0114925_484_1272 260
80 3300045976 Ga0466967_0030661 Ga0466967_0030661_3035_3823 260
81 3300048909 Ga0496106_0456658 Ga0496106_0456658_149_937 260
82 3300048912 Ga0496109_0069006 Ga0496109_0069006_640_1428 260
83 3300049577 Ga0501041_0361396 Ga0501041_0361396_114_902 260
84 3300050509 nmdc:mga0qj67_237550_c1 nmdc:mga0qj67_237550_c1_285_1115 260
85 3300021441 Ga0213871_10040830 Ga0213871_100408302 261
86 3300031852 Ga0307410_10142856 Ga0307410_101428562 261
87 3300041496 Ga0451839_1350009 Ga0451839_1350009_50_847 261
88 3300002774 JGI25150J39212_1002872 JGI25150J39212_10028723 262
89 3300003771 Ga0055526_1000104 Ga0055526_10001047 262
90 3300025245 Ga0207425_1000244 Ga0207425_100024418 262
91 3300025294 Ga0209025_1002411 Ga0209025_100241111 262
92 3300025295 Ga0209564_1000141 Ga0209564_100014163 262
93 3300025297 Ga0209758_1003895 Ga0209758_10038954 262
94 3300025944 Ga0207661_10207545 Ga0207661_102075453 262
95 3300037418 Ga0395900_0231566 Ga0395900_0231566_374_1183 262
96 3300046460 Ga0495638_0198653 Ga0495638_0198653_34_876 262
97 3300046471 Ga0495650_0000230 Ga0495650_0000230_64977_65777 262
98 3300046474 Ga0495605_0000071 Ga0495605_0000071_75844_76644 262
99 3300046501 Ga0495607_0054467 Ga0495607_0054467_526_1326 262
100 3300046507 Ga0495606_0000077 Ga0495606_0000077_54444_55244 262
101 3300046512 Ga0495610_0004699 Ga0495610_0004699_6018_6818 262
102 3300046522 Ga0495643_0050056 Ga0495643_0050056_359_1159 262
103 3300046558 Ga0495633_0000682 Ga0495633_0000682_1256_2056 262
104 3300046616 Ga0495668_0000064 Ga0495668_0000064_76250_77050 262
105 3300046616 Ga0495668_0003739 Ga0495668_0003739_3965_4765 262
106 3300047472 Ga0495686_0004694 Ga0495686_0004694_3346_4146 262
107 3300048927 Ga0496124_0016823 Ga0496124_0016823_1505_2305 262
108 3300048928 Ga0496125_0260186 Ga0496125_0260186_107_907 262
109 3300053139 Ga0500568_0001309 Ga0500568_0001309_1617_2459 262
110 3300053145 Ga0500586_002729 Ga0500586_002729_2386_3228 262
111 3300053151 Ga0500604_0026562 Ga0500604_0026562_38_880 262
112 3300005341 Ga0070691_10002854 Ga0070691_100028542 263
113 3300005356 Ga0070674_100229094 Ga0070674_1002290942 263
114 3300005457 Ga0070662_100310415 Ga0070662_1003104152 263
115 3300005459 Ga0068867_100349792 Ga0068867_1003497922 263
116 3300005530 Ga0070679_100369681 Ga0070679_1003696812 263
117 3300005544 Ga0070686_100074623 Ga0070686_1000746232 263
118 3300005719 Ga0068861_100184415 Ga0068861_1001844152 263
119 3300005842 Ga0068858_100258344 Ga0068858_1002583442 263
120 3300005937 Ga0081455_10069205 Ga0081455_100692052 263
121 3300005983 Ga0081540_1022082 Ga0081540_10220824 263
122 3300006058 Ga0075432_10007816 Ga0075432_100078164 263
123 3300006237 Ga0097621_100158478 Ga0097621_1001584782 263
124 3300006358 Ga0068871_100031492 Ga0068871_1000314923 263
125 3300006844 Ga0075428_100039764 Ga0075428_1000397644 263
126 3300006846 Ga0075430_100000534 Ga0075430_10000053430 263
127 3300006847 Ga0075431_100032436 Ga0075431_1000324365 263
128 3300006852 Ga0075433_10003127 Ga0075433_1000312710 263
129 3300006852 Ga0075433_10431746 Ga0075433_104317462 263
130 3300006871 Ga0075434_100002106 Ga0075434_1000021065 263
131 3300006880 Ga0075429_100000200 Ga0075429_10000020035 263
132 3300006881 Ga0068865_100119517 Ga0068865_1001195172 263
133 3300007076 Ga0075435_100016695 Ga0075435_1000166954 263
134 3300007076 Ga0075435_100152299 Ga0075435_1001522993 263
135 3300009094 Ga0111539_10012366 Ga0111539_100123667 263
136 3300009094 Ga0111539_10313824 Ga0111539_103138243 263
137 3300009098 Ga0105245_10163250 Ga0105245_101632502 263
138 3300009147 Ga0114129_10011646 Ga0114129_100116468 263
139 3300009147 Ga0114129_10226999 Ga0114129_102269992 263
140 3300009176 Ga0105242_10012513 Ga0105242_100125136 263
141 3300009176 Ga0105242_10324652 Ga0105242_103246522 263
142 3300009177 Ga0105248_10576570 Ga0105248_105765702 263
143 3300009551 Ga0105238_10242693 Ga0105238_102426932 263
144 3300013104 Ga0157370_10038514 Ga0157370_100385144 263
145 3300013306 Ga0163162_10007077 Ga0163162_100070779 263
146 3300013307 Ga0157372_10355368 Ga0157372_103553683 263
147 3300013308 Ga0157375_10635269 Ga0157375_106352692 263
148 3300021361 Ga0213872_10053333 Ga0213872_100533331 263
149 3300025898 Ga0207692_10278002 Ga0207692_102780022 263
150 3300025899 Ga0207642_10120723 Ga0207642_101207232 263
151 3300025915 Ga0207693_10005581 Ga0207693_100055814 263
152 3300025921 Ga0207652_10310722 Ga0207652_103107222 263
153 3300025927 Ga0207687_10066128 Ga0207687_100661282 263
154 3300025934 Ga0207686_10521112 Ga0207686_105211122 263
155 3300025938 Ga0207704_10016958 Ga0207704_100169583 263
156 3300025961 Ga0207712_10153755 Ga0207712_101537553 263
157 3300026035 Ga0207703_10092531 Ga0207703_100925312 263
158 3300026121 Ga0207683_10000315 Ga0207683_1000031531 263
159 3300027907 Ga0207428_10000094 Ga0207428_100000948 263
160 3300027907 Ga0207428_10036101 Ga0207428_100361012 263
161 3300027907 Ga0207428_10134025 Ga0207428_101340252 263
162 3300027907 Ga0207428_10288383 Ga0207428_102883832 263
163 3300028379 Ga0268266_10049467 Ga0268266_100494672 263
164 3300031548 Ga0307408_100269743 Ga0307408_1002697432 263
165 3300031852 Ga0307410_10036744 Ga0307410_100367444 263
166 3300031995 Ga0307409_100361686 Ga0307409_1003616862 263
167 3300039447 Ga0436361_0303744 Ga0436361_0303744_1230_2084 263
168 3300046525 Ga0495663_0000244 Ga0495663_0000244_12527_13381 263
169 3300046615 Ga0495656_0001211 Ga0495656_0001211_706_1560 263
170 3300048090 Ga0495615_0026386 Ga0495615_0026386_458_1312 263
171 3300048904 Ga0496101_0107022 Ga0496101_0107022_129_938 263
172 3300048905 Ga0496102_0130845 Ga0496102_0130845_305_1114 263
173 3300048908 Ga0496105_0109410 Ga0496105_0109410_352_1161 263
174 3300048909 Ga0496106_0100459 Ga0496106_0100459_1163_1972 263
175 3300048911 Ga0496108_0054660 Ga0496108_0054660_2396_3205 263
176 3300048915 Ga0496112_0150135 Ga0496112_0150135_368_1177 263
177 3300048916 Ga0496113_0063987 Ga0496113_0063987_852_1661 263
178 3300048918 Ga0496115_0098033 Ga0496115_0098033_123_932 263
179 3300048924 Ga0496121_0174499 Ga0496121_0174499_321_1130 263
180 3300049579 Ga0501043_0030154 Ga0501043_0030154_1430_2227 263
181 3300049586 Ga0501070_0125744 Ga0501070_0125744_486_1289 263
182 3300049823 Ga0501044_0048505 Ga0501044_0048505_1014_1817 263
183 3300049823 Ga0501044_0273692 Ga0501044_0273692_30_827 263
184 3300050507 nmdc:mga05p37_168433_c1 nmdc:mga05p37_168433_c1_123_932 263
185 3300050507 nmdc:mga05p37_3152_c1 nmdc:mga05p37_3152_c1_13537_14346 263
186 3300050508 nmdc:mga09592_8789_c1 nmdc:mga09592_8789_c1_2336_3145 263
187 3300050509 nmdc:mga0qj67_1524_c1 nmdc:mga0qj67_1524_c1_4843_5652 263
188 3300050510 nmdc:mga06r32_139_c1 nmdc:mga06r32_139_c1_47479_48288 263
189 3300050511 nmdc:mga08y16_36453_c1 nmdc:mga08y16_36453_c1_1820_2656 263
190 3300050511 nmdc:mga08y16_43379_c1 nmdc:mga08y16_43379_c1_2697_3506 263
191 3300050511 nmdc:mga08y16_6788_c1 nmdc:mga08y16_6788_c1_6255_7064 263
192 3300050512 nmdc:mga0n895_2094_c1 nmdc:mga0n895_2094_c1_5076_5885 263
193 3300050512 nmdc:mga0n895_40277_c1 nmdc:mga0n895_40277_c1_127_936 263
194 3300050513 nmdc:mga0rr50_15563_c1 nmdc:mga0rr50_15563_c1_3747_4556 263
195 3300050515 nmdc:mga0a205_31493_c1 nmdc:mga0a205_31493_c1_1423_2232 263
196 3300050515 nmdc:mga0a205_830_c1 nmdc:mga0a205_830_c1_23694_24503 263
197 3300060353 Ga0501082_0644965 Ga0501082_0644965_49_879 263
198 iso_pu_bacteria 2896429255 2896429293 263
199 3300003322 rootL2_10023171 rootL2_100231712 264
200 3300005354 Ga0070675_100001425 Ga0070675_1000014252 264
201 3300005435 Ga0070714_100192269 Ga0070714_1001922692 264
202 3300005539 Ga0068853_100218220 Ga0068853_1002182203 264
203 3300005544 Ga0070686_100535947 Ga0070686_1005359471 264
204 3300009093 Ga0105240_10008642 Ga0105240_1000864215 264
205 3300009148 Ga0105243_10001009 Ga0105243_1000100918 264
206 3300014325 Ga0163163_10128078 Ga0163163_101280783 264
207 3300021361 Ga0213872_10000018 Ga0213872_10000018111 264
208 3300025913 Ga0207695_10006972 Ga0207695_1000697215 264
209 3300025926 Ga0207659_10000728 Ga0207659_1000072817 264
210 3300035724 Ga0373933_0000225 Ga0373933_0000225_5957_6760 264
211 3300035725 Ga0373947_0008433 Ga0373947_0008433_1600_2418 264
212 3300038443 Ga0395901_0033917 Ga0395901_0033917_2622_3431 264
213 3300039447 Ga0436361_0336849 Ga0436361_0336849_674_1513 264
214 3300039447 Ga0436361_0677882 Ga0436361_0677882_112091_112930 264
215 3300044683 Ga0466965_0112543 Ga0466965_0112543_534_1346 264
216 3300047319 Ga0495674_0160871 Ga0495674_0160871_17_832 264
217 3300048916 Ga0496113_0634733 Ga0496113_0634733_12_827 264
218 3300048917 Ga0496114_0386513 Ga0496114_0386513_411_1220 264
219 3300048918 Ga0496115_0058680 Ga0496115_0058680_2246_3049 264
220 3300049571 Ga0501034_0089183 Ga0501034_0089183_1011_1817 264
221 3300049571 Ga0501034_0094099 Ga0501034_0094099_2053_2865 264
222 3300049586 Ga0501070_0161410 Ga0501070_0161410_464_1276 264
223 3300050492 nmdc:mga0yw44_67720_c1 nmdc:mga0yw44_67720_c1_51_866 264
224 3300050493 nmdc:mga0k408_151890_c1 nmdc:mga0k408_151890_c1_15_827 264
225 3300050510 nmdc:mga06r32_392781_c1 nmdc:mga06r32_392781_c1_325_1143 264
226 3300050515 nmdc:mga0a205_294871_c2 nmdc:mga0a205_294871_c2_154_969 264
227 3300053091 Ga0500647_0040972 Ga0500647_0040972_759_1562 264
228 3300053094 Ga0500566_0001046 Ga0500566_0001046_5738_6541 264
229 3300053095 Ga0500640_000873 Ga0500640_000873_891_1694 264
230 3300053111 Ga0500572_000474 Ga0500572_000474_12484_13287 264
231 3300053122 Ga0500608_030294 Ga0500608_030294_1273_2076 264
232 3300053123 Ga0500614_002313 Ga0500614_002313_866_1669 264
233 3300053136 Ga0500559_0003297 Ga0500559_0003297_3906_4709 264
234 3300053150 Ga0500603_000501 Ga0500603_000501_8631_9434 264
235 3300053159 Ga0500630_002780 Ga0500630_002780_7577_8380 264
236 3300053162 Ga0500638_030195 Ga0500638_030195_1768_2571 264
237 3300053163 Ga0500639_000112 Ga0500639_000112_28501_29304 264
238 3300053177 Ga0500636_0051194 Ga0500636_0051194_1487_2302 264
239 iso_pu_bacteria 2738541337 2739058078 264
240 3300005334 Ga0068869_100313676 Ga0068869_1003136762 265
241 3300005336 Ga0070680_100086504 Ga0070680_1000865042 265
242 3300005459 Ga0068867_100000285 Ga0068867_1000002856 265
243 3300005547 Ga0070693_100247563 Ga0070693_1002475631 265
244 3300005563 Ga0068855_100007683 Ga0068855_1000076837 265
245 3300005616 Ga0068852_100040905 Ga0068852_1000409052 265
246 3300005985 Ga0081539_10000115 Ga0081539_1000011573 265
247 3300006038 Ga0075365_10021071 Ga0075365_100210712 265
248 3300006177 Ga0075362_10077020 Ga0075362_100770202 265
249 3300009093 Ga0105240_10034973 Ga0105240_100349737 265
250 3300009551 Ga0105238_10520468 Ga0105238_105204682 265
251 3300014745 Ga0157377_10000226 Ga0157377_100002262 265
252 3300014968 Ga0157379_10006804 Ga0157379_100068043 265
253 3300014968 Ga0157379_10207663 Ga0157379_102076632 265
254 3300025912 Ga0207707_10248773 Ga0207707_102487731 265
255 3300025913 Ga0207695_10243096 Ga0207695_102430962 265
256 3300025917 Ga0207660_10036788 Ga0207660_100367884 265
257 3300025919 Ga0207657_10044542 Ga0207657_100445422 265
258 3300025921 Ga0207652_10059606 Ga0207652_100596062 265
259 3300025921 Ga0207652_10158790 Ga0207652_101587902 265
260 3300025935 Ga0207709_10003465 Ga0207709_100034652 265
261 3300025949 Ga0207667_10433782 Ga0207667_104337821 265
262 3300026089 Ga0207648_10000421 Ga0207648_100004216 265
263 3300026142 Ga0207698_10029514 Ga0207698_100295143 265
264 3300028381 Ga0268264_10473321 Ga0268264_104733212 265
265 3300031239 Ga0265328_10028391 Ga0265328_100283913 265
266 3300031250 Ga0265331_10024351 Ga0265331_100243513 265
267 3300031712 Ga0265342_10069837 Ga0265342_100698373 265
268 3300031901 Ga0307406_10207649 Ga0307406_102076492 265
269 3300032002 Ga0307416_100133243 Ga0307416_1001332432 265
270 3300032126 Ga0307415_100029071 Ga0307415_1000290713 265
271 3300035084 Ga0373928_0016902 Ga0373928_0016902_589_1410 265
272 3300037418 Ga0395900_0031192 Ga0395900_0031192_1862_2722 265
273 3300037471 Ga0395905_0109426 Ga0395905_0109426_1346_2206 265
274 3300037471 Ga0395905_0118840 Ga0395905_0118840_461_1321 265
275 3300038443 Ga0395901_0380884 Ga0395901_0380884_349_1206 265
276 3300047317 Ga0495604_0109157 Ga0495604_0109157_369_1187 265
277 3300048088 Ga0495602_0072832 Ga0495602_0072832_1834_2652 265
278 3300049571 Ga0501034_0041167 Ga0501034_0041167_586_1440 265
279 3300049573 Ga0501037_0030882 Ga0501037_0030882_1286_2140 265
280 3300049580 Ga0501046_0047426 Ga0501046_0047426_2395_3249 265
281 iso_pu_bacteria 2643221654 2644301996 265
282 iso_pu_bacteria 2885427238 2885427301 265
283 3300006058 Ga0075432_10019337 Ga0075432_100193372 266
284 3300006852 Ga0075433_10037592 Ga0075433_100375923 266
285 3300009093 Ga0105240_10012019 Ga0105240_100120197 266
286 3300009545 Ga0105237_10138637 Ga0105237_101386372 266
287 3300010375 Ga0105239_10039382 Ga0105239_100393822 266
288 3300025949 Ga0207667_10004603 Ga0207667_1000460310 266
289 3300027907 Ga0207428_10150755 Ga0207428_101507552 266
290 3300044656 Ga0466969_0002344 Ga0466969_0002344_1121_1933 266
291 3300044684 Ga0466966_0084161 Ga0466966_0084161_694_1506 266
292 3300045049 Ga0466959_0003809 Ga0466959_0003809_4553_5365 266
293 3300046499 Ga0495594_0000342 Ga0495594_0000342_6704_7531 266
294 3300050507 nmdc:mga05p37_213047_c1 nmdc:mga05p37_213047_c1_445_1257 266
295 3300050515 nmdc:mga0a205_17040_c1 nmdc:mga0a205_17040_c1_2373_3185 266
296 iso_pu_bacteria 2773857925 2774874419 266
297 iso_pu_bacteria 2821443989 2821445689 266
298 iso_pu_bacteria 2844533157 2844533805 266
299 iso_pu_bacteria 2882456835 2882459310 266
300 3300005327 Ga0070658_10000029 Ga0070658_1000002962 267
301 3300005327 Ga0070658_10062936 Ga0070658_100629364 267
302 3300005336 Ga0070680_100001995 Ga0070680_1000019952 267
303 3300005336 Ga0070680_100099818 Ga0070680_1000998182 267
304 3300005338 Ga0068868_100000005 Ga0068868_10000000561 267
305 3300005339 Ga0070660_100003372 Ga0070660_1000033724 267
306 3300005345 Ga0070692_10001329 Ga0070692_100013297 267
307 3300005366 Ga0070659_100000011 Ga0070659_100000011185 267
308 3300005366 Ga0070659_100000968 Ga0070659_10000096824 267
309 3300005458 Ga0070681_10041251 Ga0070681_100412514 267
310 3300005530 Ga0070679_100000007 Ga0070679_100000007151 267
311 3300005530 Ga0070679_100003827 Ga0070679_10000382712 267
312 3300005530 Ga0070679_100654731 Ga0070679_1006547312 267
313 3300005548 Ga0070665_100095605 Ga0070665_1000956052 267
314 3300005548 Ga0070665_100522529 Ga0070665_1005225292 267
315 3300006844 Ga0075428_100707426 Ga0075428_1007074262 267
316 3300006881 Ga0068865_100033834 Ga0068865_1000338344 267
317 3300009093 Ga0105240_10017488 Ga0105240_100174885 267
318 3300009174 Ga0105241_10072272 Ga0105241_100722724 267
319 3300009551 Ga0105238_10021641 Ga0105238_100216415 267
320 3300009551 Ga0105238_10206214 Ga0105238_102062143 267
321 3300014969 Ga0157376_10276079 Ga0157376_102760792 267
322 3300020081 Ga0206354_11011613 Ga0206354_110116132 267
323 3300020082 Ga0206353_10844025 Ga0206353_108440254 267
324 3300021384 Ga0213876_10000739 Ga0213876_1000073916 267
325 3300025909 Ga0207705_10000002 Ga0207705_10000002795 267
326 3300025909 Ga0207705_10224070 Ga0207705_102240702 267
327 3300025909 Ga0207705_10313401 Ga0207705_103134012 267
328 3300025912 Ga0207707_10016413 Ga0207707_100164136 267
329 3300025913 Ga0207695_10035319 Ga0207695_100353191 267
330 3300025914 Ga0207671_10036268 Ga0207671_100362684 267
331 3300025917 Ga0207660_10001628 Ga0207660_100016282 267
332 3300025917 Ga0207660_10250685 Ga0207660_102506852 267
333 3300025918 Ga0207662_10122103 Ga0207662_101221032 267
334 3300025919 Ga0207657_10005795 Ga0207657_100057959 267
335 3300025919 Ga0207657_10006465 Ga0207657_100064654 267
336 3300025921 Ga0207652_10000001 Ga0207652_10000001738 267
337 3300025924 Ga0207694_10232074 Ga0207694_102320742 267
338 3300025926 Ga0207659_10209002 Ga0207659_102090022 267
339 3300025927 Ga0207687_10290627 Ga0207687_102906272 267
340 3300025932 Ga0207690_10000005 Ga0207690_1000000525 267
341 3300025932 Ga0207690_10002077 Ga0207690_100020772 267
342 3300026023 Ga0207677_10000845 Ga0207677_100008455 267
343 3300028379 Ga0268266_10009538 Ga0268266_100095385 267
344 3300028379 Ga0268266_10126627 Ga0268266_101266274 267
345 3300031548 Ga0307408_100060812 Ga0307408_1000608124 267
346 3300031727 Ga0316576_10012107 Ga0316576_100121072 267
347 3300031733 Ga0316577_10046142 Ga0316577_100461423 267
348 3300031824 Ga0307413_10047505 Ga0307413_100475052 267
349 3300031852 Ga0307410_10209595 Ga0307410_102095951 267
350 3300031901 Ga0307406_10068791 Ga0307406_100687912 267
351 3300031903 Ga0307407_10015574 Ga0307407_100155745 267
352 3300031911 Ga0307412_10099944 Ga0307412_100999442 267
353 3300031911 Ga0307412_10206278 Ga0307412_102062782 267
354 3300031911 Ga0307412_10443495 Ga0307412_104434952 267
355 3300032002 Ga0307416_100194922 Ga0307416_1001949222 267
356 3300032004 Ga0307414_10046289 Ga0307414_100462892 267
357 3300032004 Ga0307414_10061749 Ga0307414_100617493 267
358 3300032004 Ga0307414_10219148 Ga0307414_102191482 267
359 3300032004 Ga0307414_10244514 Ga0307414_102445142 267
360 3300032004 Ga0307414_10298064 Ga0307414_102980642 267
361 3300032005 Ga0307411_10368417 Ga0307411_103684172 267
362 3300032126 Ga0307415_100046152 Ga0307415_1000461521 267
363 3300032126 Ga0307415_100140143 Ga0307415_1001401432 267
364 3300035398 Ga0316574_0048820 Ga0316574_0048820_17_829 267
365 3300036647 Ga0316582_0183242 Ga0316582_0183242_467_1279 267
366 3300036712 Ga0316584_0014162 Ga0316584_0014162_1655_2467 267
367 3300039437 Ga0436365_0876968 Ga0436365_0876968_32976_33785 267
368 3300046660 Ga0495625_0046907 Ga0495625_0046907_1088_1897 267
369 3300049583 Ga0501067_0304339 Ga0501067_0304339_39_848 267
370 3300053079 Ga0500610_0000004 Ga0500610_0000004_85367_86176 267
371 3300053087 Ga0500643_028911 Ga0500643_028911_73_882 267
372 3300053151 Ga0500604_0000021 Ga0500604_0000021_61411_62220 267
373 iso_pu_bacteria 2507262055 2507510600 267
374 iso_pu_bacteria 2508501009 2508544402 267
375 iso_pu_bacteria 2508501042 2508697457 267
376 iso_pu_bacteria 2508501050 2508729086 267
377 iso_pu_bacteria 2508501114 2509078107 267
378 iso_pu_bacteria 2508501128 2509148597 267
379 iso_pu_bacteria 2511231028 2511396329 267
380 iso_pu_bacteria 2513237092 2513628811 267
381 iso_pu_bacteria 2513237094 2513640206 267
382 iso_pu_bacteria 2513237095 2513650757 267
383 iso_pu_bacteria 2513237101 2513693819 267
384 iso_pu_bacteria 2513237102 2513703836 267
385 iso_pu_bacteria 2513237104 2513715866 267
386 iso_pu_bacteria 2513237139 2513877756 267
387 iso_pu_bacteria 2513237141 2513888396 267
388 iso_pu_bacteria 2513237161 2514015053 267
389 iso_pu_bacteria 2515154112 2515628652 267
390 iso_pu_bacteria 2517093001 2517105524 267
391 iso_pu_bacteria 2524023205 2524437003 267
392 iso_pu_bacteria 2528768022 2528852294 267
393 iso_pu_bacteria 2617270735 2617350017 267
394 iso_pu_bacteria 2617270741 2617378696 267
395 iso_pu_bacteria 2721755755 2723843391 267
396 iso_pu_bacteria 2744054633 2745076167 267
397 iso_pu_bacteria 2775506901 2776258954 267
398 iso_pu_bacteria 2791355196 2793063365 267
399 iso_pu_bacteria 2791355199 2793077883 267
400 iso_pu_bacteria 2802429603 2805917116 267
401 iso_pu_bacteria 2816332527 2818243561 267
402 iso_pu_bacteria 2824600985 2824603912 267
403 iso_pu_bacteria 2824609381 2824612553 267
404 iso_pu_bacteria 2824617872 2824621729 267
405 iso_pu_bacteria 2824626560 2824630802 267
406 iso_pu_bacteria 2824635225 2824637433 267
407 iso_pu_bacteria 2824644064 2824646318 267
408 iso_pu_bacteria 2824653114 2824655616 267
409 iso_pu_bacteria 2824661429 2824662432 267
410 iso_pu_bacteria 2824671348 2824676057 267
411 iso_pu_bacteria 2824679649 2824682334 267
412 iso_pu_bacteria 2824687955 2824692180 267
413 iso_pu_bacteria 2824696289 2824696588 267
414 iso_pu_bacteria 2824704595 2824705700 267
415 iso_pu_bacteria 2824714736 2824717482 267
416 iso_pu_bacteria 2824723954 2824726722 267
417 iso_pu_bacteria 2824732956 2824733677 267
418 iso_pu_bacteria 2824746037 2824747965 267
419 iso_pu_bacteria 2824753945 2824756382 267
420 iso_pu_bacteria 2824763712 2824764067 267
421 iso_pu_bacteria 2824773399 2824776743 267
422 iso_pu_bacteria 2835312727 2835312738 267
423 iso_pu_bacteria 2838122688 2838125400 267
424 iso_pu_bacteria 2841941048 2841941940 267
425 iso_pu_bacteria 2841949485 2841951374 267
426 iso_pu_bacteria 2841957949 2841958943 267
427 iso_pu_bacteria 2841966195 2841968627 267
428 iso_pu_bacteria 2841974524 2841976172 267
429 iso_pu_bacteria 2841983080 2841987537 267
430 iso_pu_bacteria 2842038055 2842045090 267
431 iso_pu_bacteria 2842045827 2842049249 267
432 iso_pu_bacteria 2844315083 2844317328 267
433 iso_pu_bacteria 2847930680 2847934033 267
434 iso_pu_bacteria 2847939898 2847944691 267
435 iso_pu_bacteria 2849076700 2849081082 267
436 iso_pu_bacteria 2857509624 2857516145 267
437 iso_pu_bacteria 2874590934 2874594760 267
438 iso_pu_bacteria 2874604998 2874611697 267
439 iso_pu_bacteria 2874612657 2874612938 267
440 iso_pu_bacteria 2874620515 2874620663 267
441 iso_pu_bacteria 2874628541 2874634739 267
442 iso_pu_bacteria 2874645413 2874646879 267
443 iso_pu_bacteria 2876761206 2876769398 267
444 iso_pu_bacteria 2876771140 2876774398 267
445 iso_pu_bacteria 2876808645 2876812112 267
446 iso_pu_bacteria 2876818435 2876822812 267
447 iso_pu_bacteria 2879074833 2879078552 267
448 iso_pu_bacteria 2879083081 2879086879 267
449 iso_pu_bacteria 2879099564 2879109764 267
450 iso_pu_bacteria 2879110137 2879114936 267
451 iso_pu_bacteria 2879127579 2879129882 267
452 iso_pu_bacteria 2879142872 2879146207 267
453 iso_pu_bacteria 2881364244 2881369194 267
454 iso_pu_bacteria 2881665667 2881667627 267
455 iso_pu_bacteria 2881927736 2881929255 267
456 iso_pu_bacteria 2884298095 2884300091 267
457 iso_pu_bacteria 2885366525 2885367421 267
458 iso_pu_bacteria 2885409591 2885417659 267
459 iso_pu_bacteria 2888388044 2888388637 267
460 iso_pu_bacteria 2888419890 2888422631 267
461 iso_pu_bacteria 2889033259 2889037713 267
462 iso_pu_bacteria 2894232714 2894237226 267
463 iso_pu_bacteria 2903727486 2903733286 267
464 iso_pu_bacteria 2904666416 2904666586 267
465 iso_pu_bacteria 2904711408 2904720350 267
466 iso_pu_bacteria 2906602504 2906606252 267
467 iso_pu_bacteria 2906626472 2906634091 267
468 iso_pu_bacteria 2906643746 2906647538 267
469 iso_pu_bacteria 2908775508 2908778269 267
470 iso_pu_bacteria 2922361189 2922361660 267
471 iso_pu_bacteria 2922368715 2922371965 267
472 iso_pu_bacteria 2922386360 2922387086 267
473 iso_pu_bacteria 2922393267 2922399294 267
474 iso_pu_bacteria 2929615660 2929616693 267
475 iso_pu_bacteria 2929624759 2929625437 267
476 iso_pu_bacteria 2932784394 2932793113 267
477 iso_pu_bacteria 2932794094 2932801245 267
478 iso_pu_bacteria 2932801729 2932803627 267
479 iso_pu_bacteria 2932809354 2932814581 267
480 iso_pu_bacteria 2932818245 2932824646 267
481 iso_pu_bacteria 2932828146 2932836573 267
482 iso_pu_bacteria 2933577622 2933578024 267
483 iso_pu_bacteria 2935608549 2935610667 267
484 iso_pu_bacteria 2935616580 2935623306 267
485 iso_pu_bacteria 2935638405 2935646696 267
486 iso_pu_bacteria 2935648319 2935652438 267
487 iso_pu_bacteria 2935656913 2935661020 267
488 iso_pu_bacteria 2935665750 2935672634 267
489 iso_pu_bacteria 2935675223 2935682507 267
490 iso_pu_bacteria 2935684952 2935691711 267
491 iso_pu_bacteria 2935694250 2935699580 267
492 iso_pu_bacteria 2935703347 2935707817 267
493 iso_pu_bacteria 2935713505 2935719545 267
494 iso_pu_bacteria 2935722832 2935728853 267
495 iso_pu_bacteria 2935732158 2935737905 267
496 iso_pu_bacteria 2935741537 2935747280 267
497 iso_pu_bacteria 2935750917 2935757919 267
498 iso_pu_bacteria 2935760218 2935761712 267
499 iso_pu_bacteria 2935769743 2935770553 267
500 iso_pu_bacteria 2935777560 2935782786 267
501 iso_pu_bacteria 2935785616 2935787162 267
502 iso_pu_bacteria 2935793552 2935795210 267
503 iso_pu_bacteria 2935801545 2935810092 267
504 iso_pu_bacteria 2935810662 2935819024 267
505 iso_pu_bacteria 2935819856 2935820164 267
506 iso_pu_bacteria 2935827899 2935835963 267
507 iso_pu_bacteria 2935837841 2935844913 267
508 iso_pu_bacteria 2935847175 2935849825 267
509 iso_pu_bacteria 2935855204 2935861694 267
510 iso_pu_bacteria 2935864058 2935870733 267
511 iso_pu_bacteria 2935873716 2935881394 267
512 iso_pu_bacteria 2935883170 2935887898 267
513 iso_pu_bacteria 2935908558 2935914485 267
514 iso_pu_bacteria 2935916978 2935919035 267
515 iso_pu_bacteria 2935926038 2935932134 267
516 iso_pu_bacteria 2935934488 2935940732 267
517 iso_pu_bacteria 2935942939 2935948681 267
518 iso_pu_bacteria 2935951376 2935957212 267
519 iso_pu_bacteria 2935959822 2935963642 267
520 iso_pu_bacteria 2935967501 2935973816 267
521 iso_pu_bacteria 2935975950 2935979688 267
522 iso_pu_bacteria 2935984226 2935988943 267
523 iso_pu_bacteria 2935992306 2936000424 267
524 iso_pu_bacteria 2936002035 2936005441 267
525 iso_pu_bacteria 2936011229 2936015077 267
526 iso_pu_bacteria 2936019824 2936023222 267
527 iso_pu_bacteria 2936028420 2936032325 267
528 iso_pu_bacteria 2936037263 2936041980 267
529 iso_pu_bacteria 2936046547 2936050186 267
530 iso_pu_bacteria 2936055302 2936061106 267
531 iso_pu_bacteria 2940556831 2940564169 267
532 iso_pu_bacteria 2941531003 2941535150 267
533 iso_pu_bacteria 2941538514 2941546720 267
534 iso_pu_bacteria 3005483717 3005486324 267
535 iso_pu_bacteria 3005506211 3005512151 267
536 iso_pu_bacteria 3005587118 3005593652 267
537 iso_pu_bacteria 3005594810 3005597024 267
538 iso_pu_bacteria 3005710791 3005713096 267
539 iso_pu_bacteria 3005718088 3005720456 267
540 iso_pu_bacteria 8006926726 8006932403 267
541 iso_pu_bacteria 8006964411 8006966769 267
542 iso_pu_bacteria 8006984368 8006984723 267
543 iso_pu_bacteria 8006994254 8006994714 267
544 iso_pu_bacteria 8016511872 8016515709 267
545 iso_pu_bacteria 8016522445 8016523274 267
546 iso_pu_bacteria 8016530956 8016536764 267
547 iso_pu_bacteria 8016539877 8016541039 267
548 iso_pu_bacteria 8016548790 8016552215 267
549 iso_pu_bacteria 8016557553 8016560594 267
550 iso_pu_bacteria 8016575299 8016579175 267
551 iso_pu_bacteria 8016583857 8016590069 267
552 iso_pu_bacteria 8016595262 8016598489 267
553 iso_pu_bacteria 8016603502 8016612648 267
554 iso_pu_bacteria 8016613128 8016621174 267
555 iso_pu_bacteria 8016622563 8016628847 267
556 iso_pu_bacteria 8016630954 8016633374 267
557 iso_pu_bacteria 8017057580 8017060790 267
558 iso_pu_bacteria 8019530166 8019536464 267
559 iso_pu_bacteria 8019538911 8019542985 267
560 iso_pu_bacteria 8019576017 8019580313 267
561 iso_pu_bacteria 8019586578 8019588032 267
562 iso_pu_bacteria 8019597564 8019603305 267
563 iso_pu_bacteria 8019629233 8019636458 267
564 iso_pu_bacteria 8019638758 8019643176 267
565 iso_pu_bacteria 8019648815 8019656007 267
566 iso_pu_bacteria 8019659431 8019664238 267
567 iso_pu_bacteria 8019668869 8019673822 267
568 iso_pu_bacteria 8019678201 8019682283 267
569 iso_pu_bacteria 8019687851 8019687984 267
570 iso_pu_bacteria 8055742211 8055748339 267
571 iso_pu_bacteria 8056673599 8056680811 267
572 iso_pu_bacteria 8056967851 8056971961 267
573 3300003187 JGI25151J46595_10000332 JGI25151J46595_100003325 268
574 3300003187 JGI25151J46595_10002370 JGI25151J46595_1000237011 268
575 3300003771 Ga0055526_1000102 Ga0055526_10001022 268
576 3300005329 Ga0070683_100161233 Ga0070683_1001612332 268
577 3300005333 Ga0070677_10021259 Ga0070677_100212592 268
578 3300005338 Ga0068868_100203468 Ga0068868_1002034682 268
579 3300005339 Ga0070660_100452773 Ga0070660_1004527731 268
580 3300005347 Ga0070668_100084992 Ga0070668_1000849921 268
581 3300005353 Ga0070669_100353281 Ga0070669_1003532811 268
582 3300005365 Ga0070688_100127320 Ga0070688_1001273202 268
583 3300005439 Ga0070711_100015153 Ga0070711_1000151534 268
584 3300005456 Ga0070678_100520181 Ga0070678_1005201812 268
585 3300005458 Ga0070681_10107243 Ga0070681_101072433 268
586 3300005459 Ga0068867_100075533 Ga0068867_1000755332 268
587 3300005467 Ga0070706_100220047 Ga0070706_1002200473 268
588 3300005468 Ga0070707_100064812 Ga0070707_1000648122 268
589 3300005468 Ga0070707_100101632 Ga0070707_1001016323 268
590 3300005518 Ga0070699_100008958 Ga0070699_1000089586 268
591 3300005563 Ga0068855_100004718 Ga0068855_1000047189 268
592 3300005563 Ga0068855_100082424 Ga0068855_1000824245 268
593 3300005577 Ga0068857_100054029 Ga0068857_1000540295 268
594 3300005617 Ga0068859_100269639 Ga0068859_1002696392 268
595 3300005618 Ga0068864_100713358 Ga0068864_1007133582 268
596 3300005983 Ga0081540_1000085 Ga0081540_100008565 268
597 3300005985 Ga0081539_10000785 Ga0081539_1000078553 268
598 3300006028 Ga0070717_10114498 Ga0070717_101144982 268
599 3300006038 Ga0075365_10210133 Ga0075365_102101332 268
600 3300006042 Ga0075368_10005521 Ga0075368_100055214 268
601 3300006173 Ga0070716_100014236 Ga0070716_1000142364 268
602 3300006178 Ga0075367_10050940 Ga0075367_100509401 268
603 3300006237 Ga0097621_100002807 Ga0097621_1000028077 268
604 3300006353 Ga0075370_10032898 Ga0075370_100328983 268
605 3300006358 Ga0068871_100035550 Ga0068871_1000355502 268
606 3300006844 Ga0075428_100001052 Ga0075428_1000010529 268
607 3300006846 Ga0075430_100029014 Ga0075430_1000290144 268
608 3300006847 Ga0075431_100000254 Ga0075431_10000025424 268
609 3300006880 Ga0075429_100006359 Ga0075429_10000635910 268
610 3300006881 Ga0068865_100006815 Ga0068865_1000068152 268
611 3300006931 Ga0097620_100269638 Ga0097620_1002696382 268
612 3300007076 Ga0075435_100119440 Ga0075435_1001194402 268
613 3300009093 Ga0105240_10008091 Ga0105240_100080916 268
614 3300009093 Ga0105240_10090511 Ga0105240_100905112 268
615 3300009094 Ga0111539_10000564 Ga0111539_1000056437 268
616 3300009094 Ga0111539_10070747 Ga0111539_100707472 268
617 3300009094 Ga0111539_10082393 Ga0111539_100823932 268
618 3300009147 Ga0114129_10000401 Ga0114129_1000040135 268
619 3300009176 Ga0105242_10002274 Ga0105242_100022744 268
620 3300009545 Ga0105237_10006394 Ga0105237_100063946 268
621 3300009551 Ga0105238_10018146 Ga0105238_100181464 268
622 3300010375 Ga0105239_10006372 Ga0105239_100063723 268
623 3300011119 Ga0105246_10003387 Ga0105246_100033872 268
624 3300013104 Ga0157370_10002015 Ga0157370_100020158 268
625 3300013296 Ga0157374_10007579 Ga0157374_100075796 268
626 3300013296 Ga0157374_10227860 Ga0157374_102278602 268
627 3300013297 Ga0157378_10032048 Ga0157378_100320485 268
628 3300013306 Ga0163162_10029211 Ga0163162_100292115 268
629 3300013307 Ga0157372_10720877 Ga0157372_107208772 268
630 3300013308 Ga0157375_10068425 Ga0157375_100684254 268
631 3300014325 Ga0163163_10311256 Ga0163163_103112562 268
632 3300014325 Ga0163163_10559056 Ga0163163_105590562 268
633 3300025284 Ga0209130_1003103 Ga0209130_10031035 268
634 3300025294 Ga0209025_1000265 Ga0209025_100026511 268
635 3300025295 Ga0209564_1000023 Ga0209564_100002352 268
636 3300025297 Ga0209758_1002263 Ga0209758_100226310 268
637 3300025302 Ga0207426_1000287 Ga0207426_100028766 268
638 3300025900 Ga0207710_10018385 Ga0207710_100183853 268
639 3300025910 Ga0207684_10039712 Ga0207684_100397125 268
640 3300025911 Ga0207654_10020194 Ga0207654_100201943 268
641 3300025912 Ga0207707_10356729 Ga0207707_103567292 268
642 3300025913 Ga0207695_10004391 Ga0207695_1000439110 268
643 3300025914 Ga0207671_10005591 Ga0207671_100055913 268
644 3300025914 Ga0207671_10248068 Ga0207671_102480682 268
645 3300025916 Ga0207663_10010962 Ga0207663_100109624 268
646 3300025922 Ga0207646_10005973 Ga0207646_100059739 268
647 3300025922 Ga0207646_10106774 Ga0207646_101067742 268
648 3300025923 Ga0207681_10259592 Ga0207681_102595922 268
649 3300025924 Ga0207694_10002889 Ga0207694_1000288915 268
650 3300025934 Ga0207686_10003755 Ga0207686_100037552 268
651 3300025937 Ga0207669_10007280 Ga0207669_100072803 268
652 3300025938 Ga0207704_10012151 Ga0207704_100121512 268
653 3300025940 Ga0207691_10013936 Ga0207691_100139363 268
654 3300025942 Ga0207689_10063968 Ga0207689_100639683 268
655 3300025945 Ga0207679_10071622 Ga0207679_100716223 268
656 3300025949 Ga0207667_10002854 Ga0207667_100028547 268
657 3300026035 Ga0207703_10045380 Ga0207703_100453802 268
658 3300026089 Ga0207648_10030619 Ga0207648_100306191 268
659 3300026089 Ga0207648_10059352 Ga0207648_100593524 268
660 3300026095 Ga0207676_10015791 Ga0207676_100157913 268
661 3300026095 Ga0207676_10166326 Ga0207676_101663262 268
662 3300026116 Ga0207674_10063613 Ga0207674_100636132 268
663 3300026116 Ga0207674_10081339 Ga0207674_100813393 268
664 3300026121 Ga0207683_10009082 Ga0207683_100090829 268
665 3300026142 Ga0207698_10160760 Ga0207698_101607601 268
666 3300027866 Ga0209813_10097043 Ga0209813_100970431 268
667 3300027907 Ga0207428_10006429 Ga0207428_100064298 268
668 3300028016 Ga0265354_1002569 Ga0265354_10025693 268
669 3300028023 Ga0265357_1002524 Ga0265357_10025242 268
670 3300028379 Ga0268266_10381941 Ga0268266_103819412 268
671 3300030878 Ga0265770_1000021 Ga0265770_10000217 268
672 3300031238 Ga0265332_10001225 Ga0265332_100012257 268
673 3300031239 Ga0265328_10106874 Ga0265328_101068742 268
674 3300031247 Ga0265340_10000669 Ga0265340_100006695 268
675 3300031247 Ga0265340_10024686 Ga0265340_100246862 268
676 3300031249 Ga0265339_10000253 Ga0265339_1000025332 268
677 3300031344 Ga0265316_10205982 Ga0265316_102059822 268
678 3300031456 Ga0307513_10128769 Ga0307513_101287692 268
679 3300031456 Ga0307513_10182218 Ga0307513_101822182 268
680 3300031711 Ga0265314_10021311 Ga0265314_100213114 268
681 3300031712 Ga0265342_10000039 Ga0265342_1000003984 268
682 3300035695 Ga0373927_0067413 Ga0373927_0067413_323_1156 268
683 3300036401 Ga0373937_0310771 Ga0373937_0310771_259_1092 268
684 3300037068 Ga0373925_0084812 Ga0373925_0084812_322_1155 268
685 3300037853 Ga0436364_0806555 Ga0436364_0806555_1839_2669 268
686 3300039450 Ga0436363_1261345 Ga0436363_1261345_367_1200 268
687 3300042156 Ga0439446_0044634 Ga0439446_0044634_184_1014 268
688 3300042436 Ga0439435_0002525 Ga0439435_0002525_711_1541 268
689 3300042438 Ga0439459_0024458 Ga0439459_0024458_171_1004 268
690 3300046454 Ga0495592_0086216 Ga0495592_0086216_491_1348 268
691 3300046460 Ga0495638_0004143 Ga0495638_0004143_8029_8859 268
692 3300046512 Ga0495610_0046624 Ga0495610_0046624_404_1234 268
693 3300046678 Ga0495599_0138971 Ga0495599_0138971_245_1102 268
694 3300046694 Ga0495649_0136631 Ga0495649_0136631_216_1046 268
695 3300047319 Ga0495674_0144466 Ga0495674_0144466_818_1651 268
696 3300047319 Ga0495674_0164583 Ga0495674_0164583_933_1790 268
697 3300048088 Ga0495602_0308361 Ga0495602_0308361_250_1083 268
698 3300048929 Ga0496126_0106036 Ga0496126_0106036_92_925 268
699 3300049589 Ga0501073_0109839 Ga0501073_0109839_97_930 268
700 3300050494 nmdc:mga06z11_172160_c1 nmdc:mga06z11_172160_c1_118_951 268
701 3300050496 nmdc:mga07m45_110346_c1 nmdc:mga07m45_110346_c1_521_1354 268
702 3300050507 nmdc:mga05p37_293_c1 nmdc:mga05p37_293_c1_27197_28030 268
703 3300050508 nmdc:mga09592_1602_c1 nmdc:mga09592_1602_c1_5833_6666 268
704 3300050508 nmdc:mga09592_306541_c1 nmdc:mga09592_306541_c1_101_931 268
705 3300050509 nmdc:mga0qj67_17595_c2 nmdc:mga0qj67_17595_c2_1940_2773 268
706 3300050510 nmdc:mga06r32_70_c1 nmdc:mga06r32_70_c1_26600_27433 268
707 3300050511 nmdc:mga08y16_81_c1 nmdc:mga08y16_81_c1_6135_6968 268
708 3300050511 nmdc:mga08y16_88943_c1 nmdc:mga08y16_88943_c1_992_1825 268
709 3300050513 nmdc:mga0rr50_555731_c1 nmdc:mga0rr50_555731_c1_40_873 268
710 3300053096 Ga0500641_0010047 Ga0500641_0010047_2488_3318 268
711 3300053096 Ga0500641_0014080 Ga0500641_0014080_247_1080 268
712 3300053099 Ga0500654_077221 Ga0500654_077221_391_1221 268
713 3300053131 Ga0500652_000004 Ga0500652_000004_132153_132986 268
714 3300053153 Ga0500616_0009002 Ga0500616_0009002_770_1609 268
715 3300053153 Ga0500616_0094571 Ga0500616_0094571_136_975 268
716 3300053158 Ga0500627_0055392 Ga0500627_0055392_629_1462 268
717 3300053177 Ga0500636_0023642 Ga0500636_0023642_647_1480 268
718 3300001989 JGI24739J22299_10011385 JGI24739J22299_100113854 269
719 3300001989 JGI24739J22299_10025926 JGI24739J22299_100259263 269
720 3300001990 JGI24737J22298_10003686 JGI24737J22298_100036866 269
721 3300001991 JGI24743J22301_10002134 JGI24743J22301_100021342 269
722 3300002067 JGI24735J21928_10027784 JGI24735J21928_100277842 269
723 3300002773 JGI25152J39213_1003814 JGI25152J39213_10038144 269
724 3300003203 JGI25406J46586_10000224 JGI25406J46586_100002246 269
725 3300003203 JGI25406J46586_10001185 JGI25406J46586_1000118512 269
726 3300003214 JGI25165J46597_1004828 JGI25165J46597_10048282 269
727 3300003215 JGI25153J46596_10000110 JGI25153J46596_1000011039 269
728 3300003215 JGI25153J46596_10000161 JGI25153J46596_1000016177 269
729 3300003215 JGI25153J46596_10000725 JGI25153J46596_1000072517 269
730 3300003215 JGI25153J46596_10001735 JGI25153J46596_100017356 269
731 3300003215 JGI25153J46596_10003973 JGI25153J46596_100039733 269
732 3300003215 JGI25153J46596_10033295 JGI25153J46596_100332952 269
733 3300003354 JGI25160J50197_1002211 JGI25160J50197_10022114 269
734 3300003354 JGI25160J50197_1002809 JGI25160J50197_10028098 269
735 3300003354 JGI25160J50197_1008188 JGI25160J50197_10081881 269
736 3300003374 JGI25161J50226_1009901 JGI25161J50226_10099012 269
737 3300003578 Ga0006562J51391_1115764 Ga0006562J51391_11157642 269
738 3300003578 Ga0006562J51391_1115765 Ga0006562J51391_11157652 269
739 3300003659 JGI25404J52841_10004559 JGI25404J52841_100045592 269
740 3300003761 Ga0055535_1000874 Ga0055535_100087412 269
741 3300003762 Ga0055542_1000003 Ga0055542_100000348 269
742 3300003781 Ga0055536_1003234 Ga0055536_10032345 269
743 3300003784 Ga0055534_1006690 Ga0055534_10066902 269
744 3300003791 Ga0055530_10000292 Ga0055530_100002925 269
745 3300003792 Ga0055540_1023025 Ga0055540_10230252 269
746 3300003794 Ga0055531_10004166 Ga0055531_100041663 269
747 3300003794 Ga0055531_10022600 Ga0055531_100226003 269
748 3300003794 Ga0055531_10024346 Ga0055531_100243463 269
749 3300004625 Ga0055543_1002636 Ga0055543_10026366 269
750 3300004625 Ga0055543_1009855 Ga0055543_10098552 269
751 3300005262 Ga0065165_1000244 Ga0065165_100024494 269
752 3300005262 Ga0065165_1005521 Ga0065165_10055216 269
753 3300005262 Ga0065165_1024612 Ga0065165_10246122 269
754 3300005293 Ga0065715_10001629 Ga0065715_100016292 269
755 3300005327 Ga0070658_10009418 Ga0070658_100094187 269
756 3300005327 Ga0070658_10036717 Ga0070658_100367174 269
757 3300005327 Ga0070658_10056840 Ga0070658_100568403 269
758 3300005328 Ga0070676_10107924 Ga0070676_101079242 269
759 3300005329 Ga0070683_100016648 Ga0070683_1000166482 269
760 3300005329 Ga0070683_100019922 Ga0070683_1000199226 269
761 3300005329 Ga0070683_100544406 Ga0070683_1005444062 269
762 3300005330 Ga0070690_100284451 Ga0070690_1002844511 269
763 3300005331 Ga0070670_100009818 Ga0070670_1000098182 269
764 3300005331 Ga0070670_100033220 Ga0070670_1000332203 269
765 3300005331 Ga0070670_100061218 Ga0070670_1000612182 269
766 3300005333 Ga0070677_10009599 Ga0070677_100095994 269
767 3300005333 Ga0070677_10019880 Ga0070677_100198803 269
768 3300005333 Ga0070677_10139572 Ga0070677_101395722 269
769 3300005334 Ga0068869_100103869 Ga0068869_1001038692 269
770 3300005334 Ga0068869_100491093 Ga0068869_1004910931 269
771 3300005335 Ga0070666_10107047 Ga0070666_101070472 269
772 3300005335 Ga0070666_10145219 Ga0070666_101452192 269
773 3300005335 Ga0070666_10234772 Ga0070666_102347722 269
774 3300005336 Ga0070680_100053429 Ga0070680_1000534293 269
775 3300005336 Ga0070680_100184215 Ga0070680_1001842152 269
776 3300005336 Ga0070680_100195563 Ga0070680_1001955632 269
777 3300005338 Ga0068868_100008462 Ga0068868_1000084629 269
778 3300005338 Ga0068868_100061484 Ga0068868_1000614842 269
779 3300005338 Ga0068868_100159091 Ga0068868_1001590912 269
780 3300005339 Ga0070660_100003340 Ga0070660_1000033409 269
781 3300005339 Ga0070660_100027919 Ga0070660_1000279194 269
782 3300005339 Ga0070660_100053813 Ga0070660_1000538131 269
783 3300005339 Ga0070660_100087222 Ga0070660_1000872221 269
784 3300005339 Ga0070660_100101200 Ga0070660_1001012002 269
785 3300005339 Ga0070660_100176875 Ga0070660_1001768752 269
786 3300005340 Ga0070689_100269658 Ga0070689_1002696581 269
787 3300005340 Ga0070689_100400099 Ga0070689_1004000992 269
788 3300005343 Ga0070687_100134621 Ga0070687_1001346212 269
789 3300005344 Ga0070661_100012406 Ga0070661_1000124062 269
790 3300005344 Ga0070661_100040022 Ga0070661_1000400224 269
791 3300005344 Ga0070661_100076796 Ga0070661_1000767962 269
792 3300005344 Ga0070661_100082171 Ga0070661_1000821712 269
793 3300005344 Ga0070661_100316497 Ga0070661_1003164971 269
794 3300005344 Ga0070661_100457904 Ga0070661_1004579041 269
795 3300005347 Ga0070668_100002567 Ga0070668_1000025676 269
796 3300005347 Ga0070668_100086608 Ga0070668_1000866082 269
797 3300005347 Ga0070668_100115435 Ga0070668_1001154352 269
798 3300005347 Ga0070668_100158902 Ga0070668_1001589022 269
799 3300005347 Ga0070668_100199720 Ga0070668_1001997201 269
800 3300005347 Ga0070668_100461574 Ga0070668_1004615742 269
801 3300005347 Ga0070668_100470019 Ga0070668_1004700191 269
802 3300005353 Ga0070669_100003020 Ga0070669_10000302013 269
803 3300005353 Ga0070669_100018096 Ga0070669_1000180964 269
804 3300005353 Ga0070669_100025367 Ga0070669_1000253673 269
805 3300005353 Ga0070669_100061056 Ga0070669_1000610562 269
806 3300005353 Ga0070669_100248902 Ga0070669_1002489022 269
807 3300005353 Ga0070669_100322007 Ga0070669_1003220072 269
808 3300005353 Ga0070669_100419944 Ga0070669_1004199442 269
809 3300005353 Ga0070669_100596703 Ga0070669_1005967031 269
810 3300005354 Ga0070675_100012081 Ga0070675_1000120814 269
811 3300005354 Ga0070675_100033049 Ga0070675_1000330494 269
812 3300005354 Ga0070675_100229226 Ga0070675_1002292262 269
813 3300005354 Ga0070675_100269558 Ga0070675_1002695582 269
814 3300005354 Ga0070675_100398498 Ga0070675_1003984982 269
815 3300005355 Ga0070671_100116660 Ga0070671_1001166602 269
816 3300005355 Ga0070671_100311675 Ga0070671_1003116752 269
817 3300005356 Ga0070674_100018354 Ga0070674_1000183542 269
818 3300005356 Ga0070674_100024025 Ga0070674_1000240253 269
819 3300005364 Ga0070673_100007540 Ga0070673_1000075404 269
820 3300005364 Ga0070673_100053106 Ga0070673_1000531064 269
821 3300005364 Ga0070673_100062072 Ga0070673_1000620722 269
822 3300005364 Ga0070673_100276446 Ga0070673_1002764461 269
823 3300005364 Ga0070673_100328445 Ga0070673_1003284451 269
824 3300005364 Ga0070673_100365801 Ga0070673_1003658012 269
825 3300005365 Ga0070688_100139361 Ga0070688_1001393611 269
826 3300005365 Ga0070688_100562113 Ga0070688_1005621131 269
827 3300005366 Ga0070659_100006463 Ga0070659_1000064633 269
828 3300005366 Ga0070659_100021021 Ga0070659_1000210215 269
829 3300005366 Ga0070659_100026467 Ga0070659_1000264672 269
830 3300005366 Ga0070659_100045117 Ga0070659_1000451172 269
831 3300005366 Ga0070659_100096750 Ga0070659_1000967502 269
832 3300005366 Ga0070659_100108965 Ga0070659_1001089652 269
833 3300005366 Ga0070659_100184351 Ga0070659_1001843512 269
834 3300005366 Ga0070659_100247864 Ga0070659_1002478641 269
835 3300005366 Ga0070659_100377970 Ga0070659_1003779701 269
836 3300005367 Ga0070667_100022671 Ga0070667_1000226714 269
837 3300005367 Ga0070667_100023212 Ga0070667_1000232122 269
838 3300005367 Ga0070667_100410524 Ga0070667_1004105242 269
839 3300005367 Ga0070667_100435448 Ga0070667_1004354481 269
840 3300005434 Ga0070709_10001991 Ga0070709_100019914 269
841 3300005435 Ga0070714_100042921 Ga0070714_1000429212 269
842 3300005435 Ga0070714_100628752 Ga0070714_1006287522 269
843 3300005436 Ga0070713_100000921 Ga0070713_10000092110 269
844 3300005436 Ga0070713_100018458 Ga0070713_1000184584 269
845 3300005436 Ga0070713_100034285 Ga0070713_1000342853 269
846 3300005436 Ga0070713_100047162 Ga0070713_1000471622 269
847 3300005436 Ga0070713_100048195 Ga0070713_1000481953 269
848 3300005436 Ga0070713_100049692 Ga0070713_1000496923 269
849 3300005437 Ga0070710_10000965 Ga0070710_1000096512 269
850 3300005437 Ga0070710_10002824 Ga0070710_100028242 269
851 3300005439 Ga0070711_100001902 Ga0070711_10000190212 269
852 3300005439 Ga0070711_100009556 Ga0070711_1000095567 269
853 3300005439 Ga0070711_100012353 Ga0070711_1000123533 269
854 3300005439 Ga0070711_100016194 Ga0070711_1000161945 269
855 3300005439 Ga0070711_100151945 Ga0070711_1001519452 269
856 3300005439 Ga0070711_100308984 Ga0070711_1003089842 269
857 3300005444 Ga0070694_100004766 Ga0070694_1000047668 269
858 3300005444 Ga0070694_100285477 Ga0070694_1002854771 269
859 3300005444 Ga0070694_100501941 Ga0070694_1005019411 269
860 3300005445 Ga0070708_100138030 Ga0070708_1001380302 269
861 3300005455 Ga0070663_100081745 Ga0070663_1000817452 269
862 3300005455 Ga0070663_100109870 Ga0070663_1001098702 269
863 3300005455 Ga0070663_100147387 Ga0070663_1001473872 269
864 3300005455 Ga0070663_100255185 Ga0070663_1002551851 269
865 3300005455 Ga0070663_100352031 Ga0070663_1003520312 269
866 3300005456 Ga0070678_100018801 Ga0070678_1000188013 269
867 3300005456 Ga0070678_100041156 Ga0070678_1000411562 269
868 3300005456 Ga0070678_100073083 Ga0070678_1000730832 269
869 3300005456 Ga0070678_100101718 Ga0070678_1001017182 269
870 3300005456 Ga0070678_100192228 Ga0070678_1001922282 269
871 3300005456 Ga0070678_100215430 Ga0070678_1002154301 269
872 3300005456 Ga0070678_100428401 Ga0070678_1004284011 269
873 3300005456 Ga0070678_100517960 Ga0070678_1005179601 269
874 3300005457 Ga0070662_100004215 Ga0070662_1000042154 269
875 3300005457 Ga0070662_100013471 Ga0070662_1000134712 269
876 3300005457 Ga0070662_100017872 Ga0070662_1000178724 269
877 3300005457 Ga0070662_100047168 Ga0070662_1000471684 269
878 3300005457 Ga0070662_100064068 Ga0070662_1000640682 269
879 3300005457 Ga0070662_100099585 Ga0070662_1000995852 269
880 3300005457 Ga0070662_100178278 Ga0070662_1001782782 269
881 3300005457 Ga0070662_100229187 Ga0070662_1002291872 269
882 3300005457 Ga0070662_100337326 Ga0070662_1003373261 269
883 3300005458 Ga0070681_10028028 Ga0070681_100280286 269
884 3300005458 Ga0070681_10046096 Ga0070681_100460962 269
885 3300005458 Ga0070681_10195409 Ga0070681_101954092 269
886 3300005459 Ga0068867_100033571 Ga0068867_1000335714 269
887 3300005459 Ga0068867_100108796 Ga0068867_1001087961 269
888 3300005459 Ga0068867_100301498 Ga0068867_1003014982 269
889 3300005466 Ga0070685_10065060 Ga0070685_100650602 269
890 3300005468 Ga0070707_100042282 Ga0070707_1000422822 269
891 3300005468 Ga0070707_100043146 Ga0070707_1000431463 269
892 3300005530 Ga0070679_100021536 Ga0070679_1000215363 269
893 3300005530 Ga0070679_100032253 Ga0070679_1000322532 269
894 3300005530 Ga0070679_100036859 Ga0070679_1000368594 269
895 3300005530 Ga0070679_100067766 Ga0070679_1000677662 269
896 3300005530 Ga0070679_100287187 Ga0070679_1002871872 269
897 3300005530 Ga0070679_100341473 Ga0070679_1003414731 269
898 3300005535 Ga0070684_100041168 Ga0070684_1000411684 269
899 3300005536 Ga0070697_100016393 Ga0070697_1000163932 269
900 3300005536 Ga0070697_100337114 Ga0070697_1003371141 269
901 3300005539 Ga0068853_100017303 Ga0068853_1000173035 269
902 3300005539 Ga0068853_100064981 Ga0068853_1000649814 269
903 3300005539 Ga0068853_100092671 Ga0068853_1000926712 269
904 3300005539 Ga0068853_100180221 Ga0068853_1001802212 269
905 3300005539 Ga0068853_100595522 Ga0068853_1005955221 269
906 3300005543 Ga0070672_100001070 Ga0070672_10000107015 269
907 3300005543 Ga0070672_100080622 Ga0070672_1000806223 269
908 3300005543 Ga0070672_100135539 Ga0070672_1001355392 269
909 3300005543 Ga0070672_100142885 Ga0070672_1001428852 269
910 3300005543 Ga0070672_100360406 Ga0070672_1003604061 269
911 3300005546 Ga0070696_100011158 Ga0070696_1000111583 269
912 3300005546 Ga0070696_100013451 Ga0070696_1000134514 269
913 3300005546 Ga0070696_100077454 Ga0070696_1000774543 269
914 3300005546 Ga0070696_100114521 Ga0070696_1001145212 269
915 3300005547 Ga0070693_100069589 Ga0070693_1000695892 269
916 3300005548 Ga0070665_100000380 Ga0070665_10000038069 269
917 3300005548 Ga0070665_100013089 Ga0070665_1000130892 269
918 3300005548 Ga0070665_100025378 Ga0070665_1000253785 269
919 3300005548 Ga0070665_100027447 Ga0070665_1000274477 269
920 3300005548 Ga0070665_100051209 Ga0070665_1000512093 269
921 3300005548 Ga0070665_100059843 Ga0070665_1000598432 269
922 3300005548 Ga0070665_100188831 Ga0070665_1001888312 269
923 3300005548 Ga0070665_100190426 Ga0070665_1001904262 269
924 3300005548 Ga0070665_100207744 Ga0070665_1002077441 269
925 3300005548 Ga0070665_100215214 Ga0070665_1002152142 269
926 3300005548 Ga0070665_100330690 Ga0070665_1003306902 269
927 3300005563 Ga0068855_100019660 Ga0068855_10001966010 269
928 3300005563 Ga0068855_100032183 Ga0068855_1000321834 269
929 3300005563 Ga0068855_100043191 Ga0068855_1000431912 269
930 3300005563 Ga0068855_100057975 Ga0068855_1000579752 269
931 3300005563 Ga0068855_100138623 Ga0068855_1001386232 269
932 3300005563 Ga0068855_100629260 Ga0068855_1006292602 269
933 3300005564 Ga0070664_100004242 Ga0070664_1000042424 269
934 3300005564 Ga0070664_100044608 Ga0070664_1000446084 269
935 3300005564 Ga0070664_100063796 Ga0070664_1000637962 269
936 3300005564 Ga0070664_100102590 Ga0070664_1001025902 269
937 3300005564 Ga0070664_100280293 Ga0070664_1002802932 269
938 3300005564 Ga0070664_100341577 Ga0070664_1003415772 269
939 3300005564 Ga0070664_100353660 Ga0070664_1003536601 269
940 3300005564 Ga0070664_100446003 Ga0070664_1004460032 269
941 3300005564 Ga0070664_100760195 Ga0070664_1007601951 269
942 3300005577 Ga0068857_100053451 Ga0068857_1000534512 269
943 3300005577 Ga0068857_100068647 Ga0068857_1000686472 269
944 3300005578 Ga0068854_100040820 Ga0068854_1000408202 269
945 3300005578 Ga0068854_100079018 Ga0068854_1000790184 269
946 3300005578 Ga0068854_100189799 Ga0068854_1001897992 269
947 3300005578 Ga0068854_100221032 Ga0068854_1002210322 269
948 3300005578 Ga0068854_100261181 Ga0068854_1002611812 269
949 3300005578 Ga0068854_100264672 Ga0068854_1002646722 269
950 3300005614 Ga0068856_100000147 Ga0068856_10000014751 269
951 3300005614 Ga0068856_100069833 Ga0068856_1000698331 269
952 3300005614 Ga0068856_100162305 Ga0068856_1001623052 269
953 3300005614 Ga0068856_100330638 Ga0068856_1003306381 269
954 3300005614 Ga0068856_100473303 Ga0068856_1004733032 269
955 3300005615 Ga0070702_100086925 Ga0070702_1000869252 269
956 3300005616 Ga0068852_100022132 Ga0068852_1000221322 269
957 3300005616 Ga0068852_100030238 Ga0068852_1000302382 269
958 3300005616 Ga0068852_100050969 Ga0068852_1000509694 269
959 3300005616 Ga0068852_100148554 Ga0068852_1001485542 269
960 3300005616 Ga0068852_100180522 Ga0068852_1001805222 269
961 3300005616 Ga0068852_100215312 Ga0068852_1002153121 269
962 3300005617 Ga0068859_100005527 Ga0068859_1000055272 269
963 3300005617 Ga0068859_100050860 Ga0068859_1000508604 269
964 3300005617 Ga0068859_100057981 Ga0068859_1000579812 269
965 3300005617 Ga0068859_100125347 Ga0068859_1001253472 269
966 3300005618 Ga0068864_100023922 Ga0068864_1000239226 269
967 3300005618 Ga0068864_100071279 Ga0068864_1000712792 269
968 3300005618 Ga0068864_100094335 Ga0068864_1000943352 269
969 3300005618 Ga0068864_100153816 Ga0068864_1001538161 269
970 3300005718 Ga0068866_10054748 Ga0068866_100547482 269
971 3300005719 Ga0068861_100037014 Ga0068861_1000370143 269
972 3300005834 Ga0068851_10007825 Ga0068851_100078254 269
973 3300005834 Ga0068851_10009284 Ga0068851_100092843 269
974 3300005834 Ga0068851_10183801 Ga0068851_101838012 269
975 3300005841 Ga0068863_100015315 Ga0068863_1000153158 269
976 3300005841 Ga0068863_100526180 Ga0068863_1005261801 269
977 3300005842 Ga0068858_100011350 Ga0068858_1000113507 269
978 3300005842 Ga0068858_100030269 Ga0068858_1000302694 269
979 3300005842 Ga0068858_100118424 Ga0068858_1001184242 269
980 3300005842 Ga0068858_100141648 Ga0068858_1001416482 269
981 3300005842 Ga0068858_100617325 Ga0068858_1006173251 269
982 3300005843 Ga0068860_100000302 Ga0068860_10000030242 269
983 3300005843 Ga0068860_100037214 Ga0068860_1000372142 269
984 3300005843 Ga0068860_100037514 Ga0068860_1000375145 269
985 3300005843 Ga0068860_100139851 Ga0068860_1001398512 269
986 3300005843 Ga0068860_100218011 Ga0068860_1002180112 269
987 3300005843 Ga0068860_100418110 Ga0068860_1004181102 269
988 3300005843 Ga0068860_100449261 Ga0068860_1004492612 269
989 3300005844 Ga0068862_100033548 Ga0068862_1000335482 269
990 3300005844 Ga0068862_100046319 Ga0068862_1000463194 269
991 3300005844 Ga0068862_100056187 Ga0068862_1000561873 269
992 3300005844 Ga0068862_100066590 Ga0068862_1000665902 269
993 3300005844 Ga0068862_100541415 Ga0068862_1005414151 269
994 3300005937 Ga0081455_10000715 Ga0081455_1000071542 269
995 3300005937 Ga0081455_10167403 Ga0081455_101674032 269
996 3300005983 Ga0081540_1005117 Ga0081540_10051178 269
997 3300005983 Ga0081540_1005134 Ga0081540_10051345 269
998 3300005983 Ga0081540_1006569 Ga0081540_10065699 269
999 3300005983 Ga0081540_1014622 Ga0081540_10146222 269
1000 3300005983 Ga0081540_1014909 Ga0081540_10149092 269
1001 3300005983 Ga0081540_1024701 Ga0081540_10247012 269
1002 3300005983 Ga0081540_1032477 Ga0081540_10324773 269
1003 3300005983 Ga0081540_1082270 Ga0081540_10822701 269
1004 3300005985 Ga0081539_10000172 Ga0081539_10000172105 269
1005 3300005985 Ga0081539_10000199 Ga0081539_10000199115 269
1006 3300005985 Ga0081539_10105036 Ga0081539_101050361 269
1007 3300006028 Ga0070717_10001544 Ga0070717_100015444 269
1008 3300006028 Ga0070717_10004489 Ga0070717_100044897 269
1009 3300006028 Ga0070717_10039248 Ga0070717_100392482 269
1010 3300006028 Ga0070717_10062109 Ga0070717_100621092 269
1011 3300006038 Ga0075365_10014062 Ga0075365_100140622 269
1012 3300006038 Ga0075365_10028542 Ga0075365_100285422 269
1013 3300006038 Ga0075365_10031524 Ga0075365_100315242 269
1014 3300006038 Ga0075365_10059673 Ga0075365_100596733 269
1015 3300006038 Ga0075365_10209485 Ga0075365_102094851 269
1016 3300006038 Ga0075365_10282271 Ga0075365_102822711 269
1017 3300006042 Ga0075368_10013315 Ga0075368_100133152 269
1018 3300006042 Ga0075368_10017067 Ga0075368_100170672 269
1019 3300006048 Ga0075363_100004092 Ga0075363_1000040925 269
1020 3300006048 Ga0075363_100009121 Ga0075363_1000091214 269
1021 3300006048 Ga0075363_100088365 Ga0075363_1000883652 269
1022 3300006048 Ga0075363_100099858 Ga0075363_1000998582 269
1023 3300006051 Ga0075364_10005255 Ga0075364_100052554 269
1024 3300006051 Ga0075364_10013415 Ga0075364_100134155 269
1025 3300006051 Ga0075364_10052670 Ga0075364_100526702 269
1026 3300006051 Ga0075364_10069176 Ga0075364_100691762 269
1027 3300006163 Ga0070715_10002681 Ga0070715_100026813 269
1028 3300006173 Ga0070716_100001142 Ga0070716_1000011427 269
1029 3300006173 Ga0070716_100046158 Ga0070716_1000461582 269
1030 3300006173 Ga0070716_100097542 Ga0070716_1000975421 269
1031 3300006173 Ga0070716_100100009 Ga0070716_1001000092 269
1032 3300006175 Ga0070712_100024007 Ga0070712_1000240073 269
1033 3300006175 Ga0070712_100067121 Ga0070712_1000671212 269
1034 3300006177 Ga0075362_10019216 Ga0075362_100192163 269
1035 3300006177 Ga0075362_10042466 Ga0075362_100424662 269
1036 3300006177 Ga0075362_10046250 Ga0075362_100462501 269
1037 3300006177 Ga0075362_10093559 Ga0075362_100935592 269
1038 3300006178 Ga0075367_10022968 Ga0075367_100229683 269
1039 3300006178 Ga0075367_10069015 Ga0075367_100690152 269
1040 3300006186 Ga0075369_10001488 Ga0075369_100014883 269
1041 3300006186 Ga0075369_10045018 Ga0075369_100450182 269
1042 3300006186 Ga0075369_10045822 Ga0075369_100458222 269
1043 3300006186 Ga0075369_10131036 Ga0075369_101310362 269
1044 3300006195 Ga0075366_10005712 Ga0075366_100057123 269
1045 3300006195 Ga0075366_10013458 Ga0075366_100134584 269
1046 3300006237 Ga0097621_100033028 Ga0097621_1000330281 269
1047 3300006237 Ga0097621_100137832 Ga0097621_1001378322 269
1048 3300006353 Ga0075370_10006725 Ga0075370_100067253 269
1049 3300006353 Ga0075370_10016448 Ga0075370_100164482 269
1050 3300006353 Ga0075370_10061359 Ga0075370_100613592 269
1051 3300006358 Ga0068871_100079198 Ga0068871_1000791982 269
1052 3300006358 Ga0068871_100122118 Ga0068871_1001221183 269
1053 3300006358 Ga0068871_100211413 Ga0068871_1002114131 269
1054 3300006844 Ga0075428_100164641 Ga0075428_1001646412 269
1055 3300006847 Ga0075431_100545098 Ga0075431_1005450981 269
1056 3300006880 Ga0075429_100419214 Ga0075429_1004192142 269
1057 3300006881 Ga0068865_100072880 Ga0068865_1000728803 269
1058 3300006881 Ga0068865_100192161 Ga0068865_1001921612 269
1059 3300006881 Ga0068865_100395507 Ga0068865_1003955071 269
1060 3300006931 Ga0097620_100005527 Ga0097620_1000055272 269
1061 3300006931 Ga0097620_100050860 Ga0097620_1000508602 269
1062 3300006931 Ga0097620_100057981 Ga0097620_1000579814 269
1063 3300006931 Ga0097620_100125338 Ga0097620_1001253382 269
1064 3300006941 Ga0099825_1027246 Ga0099825_10272464 269
1065 3300006942 Ga0099824_1016349 Ga0099824_10163494 269
1066 3300006946 Ga0079104_1000724 Ga0079104_100072427 269
1067 3300007076 Ga0075435_100170922 Ga0075435_1001709222 269
1068 3300007265 Ga0099794_10008728 Ga0099794_100087284 269
1069 3300009092 Ga0105250_10112414 Ga0105250_101124142 269
1070 3300009093 Ga0105240_10004412 Ga0105240_1000441218 269
1071 3300009093 Ga0105240_10010045 Ga0105240_100100451 269
1072 3300009093 Ga0105240_10015247 Ga0105240_100152478 269
1073 3300009093 Ga0105240_10090434 Ga0105240_100904345 269
1074 3300009093 Ga0105240_10106678 Ga0105240_101066782 269
1075 3300009093 Ga0105240_10108292 Ga0105240_101082921 269
1076 3300009093 Ga0105240_10760145 Ga0105240_107601451 269
1077 3300009094 Ga0111539_10089824 Ga0111539_100898242 269
1078 3300009094 Ga0111539_10094281 Ga0111539_100942813 269
1079 3300009094 Ga0111539_10193811 Ga0111539_101938112 269
1080 3300009094 Ga0111539_10244053 Ga0111539_102440532 269
1081 3300009098 Ga0105245_10040531 Ga0105245_100405312 269
1082 3300009098 Ga0105245_10189152 Ga0105245_101891522 269
1083 3300009098 Ga0105245_10229063 Ga0105245_102290632 269
1084 3300009098 Ga0105245_10543751 Ga0105245_105437512 269
1085 3300009101 Ga0105247_10073195 Ga0105247_100731952 269
1086 3300009101 Ga0105247_10108294 Ga0105247_101082942 269
1087 3300009101 Ga0105247_10122189 Ga0105247_101221892 269
1088 3300009147 Ga0114129_10647731 Ga0114129_106477312 269
1089 3300009148 Ga0105243_10006328 Ga0105243_100063283 269
1090 3300009148 Ga0105243_10108321 Ga0105243_101083212 269
1091 3300009148 Ga0105243_10285668 Ga0105243_102856682 269
1092 3300009148 Ga0105243_10324969 Ga0105243_103249692 269
1093 3300009148 Ga0105243_10457638 Ga0105243_104576382 269
1094 3300009148 Ga0105243_10512711 Ga0105243_105127112 269
1095 3300009148 Ga0105243_10590422 Ga0105243_105904222 269
1096 3300009174 Ga0105241_10004915 Ga0105241_100049154 269
1097 3300009174 Ga0105241_10024079 Ga0105241_100240793 269
1098 3300009174 Ga0105241_10145832 Ga0105241_101458322 269
1099 3300009176 Ga0105242_10141549 Ga0105242_101415493 269
1100 3300009176 Ga0105242_10264759 Ga0105242_102647592 269
1101 3300009176 Ga0105242_10334141 Ga0105242_103341412 269
1102 3300009176 Ga0105242_10652965 Ga0105242_106529652 269
1103 3300009177 Ga0105248_10028788 Ga0105248_100287883 269
1104 3300009177 Ga0105248_10041091 Ga0105248_100410912 269
1105 3300009177 Ga0105248_10089860 Ga0105248_100898604 269
1106 3300009177 Ga0105248_10111773 Ga0105248_101117732 269
1107 3300009177 Ga0105248_10392028 Ga0105248_103920282 269
1108 3300009177 Ga0105248_10552465 Ga0105248_105524652 269
1109 3300009545 Ga0105237_10000892 Ga0105237_1000089223 269
1110 3300009545 Ga0105237_10007390 Ga0105237_100073904 269
1111 3300009545 Ga0105237_10087486 Ga0105237_100874862 269
1112 3300009545 Ga0105237_10097877 Ga0105237_100978775 269
1113 3300009545 Ga0105237_10119279 Ga0105237_101192792 269
1114 3300009545 Ga0105237_10125521 Ga0105237_101255212 269
1115 3300009545 Ga0105237_10362669 Ga0105237_103626692 269
1116 3300009545 Ga0105237_10492705 Ga0105237_104927052 269
1117 3300009551 Ga0105238_10026218 Ga0105238_100262182 269
1118 3300009551 Ga0105238_10113334 Ga0105238_101133342 269
1119 3300009551 Ga0105238_10192185 Ga0105238_101921852 269
1120 3300009551 Ga0105238_10396505 Ga0105238_103965052 269
1121 3300009551 Ga0105238_10450042 Ga0105238_104500421 269
1122 3300009553 Ga0105249_10006166 Ga0105249_100061665 269
1123 3300009553 Ga0105249_10153100 Ga0105249_101531002 269
1124 3300009553 Ga0105249_10246814 Ga0105249_102468142 269
1125 3300009553 Ga0105249_10280156 Ga0105249_102801562 269
1126 3300010159 Ga0099796_10023926 Ga0099796_100239261 269
1127 3300010375 Ga0105239_10031875 Ga0105239_100318755 269
1128 3300010375 Ga0105239_10038605 Ga0105239_100386055 269
1129 3300010375 Ga0105239_10083653 Ga0105239_100836532 269
1130 3300010375 Ga0105239_10384083 Ga0105239_103840832 269
1131 3300010375 Ga0105239_10838527 Ga0105239_108385272 269
1132 3300011119 Ga0105246_10025946 Ga0105246_100259462 269
1133 3300011119 Ga0105246_10074656 Ga0105246_100746563 269
1134 3300011119 Ga0105246_10094126 Ga0105246_100941262 269
1135 3300011119 Ga0105246_10140827 Ga0105246_101408272 269
1136 3300012507 Ga0157342_1008141 Ga0157342_10081411 269
1137 3300013100 Ga0157373_10029298 Ga0157373_100292984 269
1138 3300013100 Ga0157373_10049807 Ga0157373_100498072 269
1139 3300013100 Ga0157373_10053043 Ga0157373_100530432 269
1140 3300013102 Ga0157371_10066941 Ga0157371_100669413 269
1141 3300013104 Ga0157370_10068482 Ga0157370_100684822 269
1142 3300013104 Ga0157370_10084692 Ga0157370_100846923 269
1143 3300013104 Ga0157370_10144763 Ga0157370_101447631 269
1144 3300013104 Ga0157370_10239308 Ga0157370_102393082 269
1145 3300013105 Ga0157369_10012743 Ga0157369_100127433 269
1146 3300013105 Ga0157369_10016806 Ga0157369_100168065 269
1147 3300013105 Ga0157369_10066983 Ga0157369_100669832 269
1148 3300013296 Ga0157374_10004594 Ga0157374_1000459411 269
1149 3300013296 Ga0157374_10035746 Ga0157374_100357462 269
1150 3300013296 Ga0157374_10173041 Ga0157374_101730412 269
1151 3300013296 Ga0157374_10199058 Ga0157374_101990582 269
1152 3300013296 Ga0157374_10403583 Ga0157374_104035831 269
1153 3300013297 Ga0157378_10053721 Ga0157378_100537212 269
1154 3300013297 Ga0157378_10101211 Ga0157378_101012112 269
1155 3300013297 Ga0157378_10169792 Ga0157378_101697922 269
1156 3300013306 Ga0163162_10080781 Ga0163162_100807814 269
1157 3300013306 Ga0163162_10140829 Ga0163162_101408292 269
1158 3300013306 Ga0163162_10395262 Ga0163162_103952621 269
1159 3300013307 Ga0157372_10057177 Ga0157372_100571772 269
1160 3300013307 Ga0157372_10092400 Ga0157372_100924002 269
1161 3300013308 Ga0157375_10016147 Ga0157375_100161475 269
1162 3300013308 Ga0157375_10115048 Ga0157375_101150484 269
1163 3300013308 Ga0157375_10123080 Ga0157375_101230803 269
1164 3300013308 Ga0157375_10232686 Ga0157375_102326862 269
1165 3300014325 Ga0163163_10005130 Ga0163163_1000513010 269
1166 3300014325 Ga0163163_10227834 Ga0163163_102278342 269
1167 3300014325 Ga0163163_10251131 Ga0163163_102511311 269
1168 3300014325 Ga0163163_10266619 Ga0163163_102666192 269
1169 3300014326 Ga0157380_10543291 Ga0157380_105432911 269
1170 3300014497 Ga0182008_10001406 Ga0182008_1000140612 269
1171 3300014497 Ga0182008_10034814 Ga0182008_100348143 269
1172 3300014745 Ga0157377_10285272 Ga0157377_102852722 269
1173 3300014968 Ga0157379_10006836 Ga0157379_100068369 269
1174 3300014969 Ga0157376_10019350 Ga0157376_100193503 269
1175 3300017792 Ga0163161_10009467 Ga0163161_100094674 269
1176 3300017792 Ga0163161_10100605 Ga0163161_101006052 269
1177 3300021320 Ga0214544_1000055 Ga0214544_100005577 269
1178 3300021321 Ga0214542_1003337 Ga0214542_100333719 269
1179 3300021321 Ga0214542_1026901 Ga0214542_10269012 269
1180 3300021324 Ga0214545_1000028 Ga0214545_1000028104 269
1181 3300021324 Ga0214545_1026201 Ga0214545_10262014 269
1182 3300021327 Ga0214543_1000044 Ga0214543_100004460 269
1183 3300021327 Ga0214543_1028673 Ga0214543_10286731 269
1184 3300021358 Ga0213873_10022236 Ga0213873_100222362 269
1185 3300021384 Ga0213876_10077582 Ga0213876_100775822 269
1186 3300021384 Ga0213876_10085625 Ga0213876_100856251 269
1187 3300021384 Ga0213876_10110427 Ga0213876_101104271 269
1188 3300021384 Ga0213876_10136138 Ga0213876_101361382 269
1189 3300025228 Ga0209672_100460 Ga0209672_1004604 269
1190 3300025229 Ga0209147_100840 Ga0209147_10084011 269
1191 3300025242 Ga0209258_100015 Ga0209258_100015166 269
1192 3300025245 Ga0207425_1002150 Ga0207425_10021505 269
1193 3300025253 Ga0209677_100280 Ga0209677_10028027 269
1194 3300025253 Ga0209677_103878 Ga0209677_1038782 269
1195 3300025254 Ga0209148_1000028 Ga0209148_1000028502 269
1196 3300025254 Ga0209148_1000224 Ga0209148_100022422 269
1197 3300025258 Ga0209129_1000049 Ga0209129_1000049171 269
1198 3300025258 Ga0209129_1000908 Ga0209129_100090812 269
1199 3300025258 Ga0209129_1010353 Ga0209129_10103533 269
1200 3300025261 Ga0209233_1001356 Ga0209233_10013564 269
1201 3300025261 Ga0209233_1003282 Ga0209233_10032824 269
1202 3300025261 Ga0209233_1024180 Ga0209233_10241802 269
1203 3300025263 Ga0209565_1000862 Ga0209565_10008626 269
1204 3300025263 Ga0209565_1001345 Ga0209565_10013458 269
1205 3300025272 Ga0209455_1000635 Ga0209455_100063512 269
1206 3300025272 Ga0209455_1008356 Ga0209455_10083562 269
1207 3300025273 Ga0209673_1000477 Ga0209673_100047757 269
1208 3300025273 Ga0209673_1002692 Ga0209673_10026925 269
1209 3300025284 Ga0209130_1000267 Ga0209130_10002676 269
1210 3300025284 Ga0209130_1005512 Ga0209130_10055123 269
1211 3300025291 Ga0209675_1005805 Ga0209675_10058053 269
1212 3300025292 Ga0209676_1000026 Ga0209676_1000026175 269
1213 3300025292 Ga0209676_1000137 Ga0209676_100013712 269
1214 3300025292 Ga0209676_1016289 Ga0209676_10162893 269
1215 3300025294 Ga0209025_1000481 Ga0209025_100048169 269
1216 3300025294 Ga0209025_1039009 Ga0209025_10390093 269
1217 3300025295 Ga0209564_1000936 Ga0209564_100093628 269
1218 3300025295 Ga0209564_1001368 Ga0209564_10013688 269
1219 3300025295 Ga0209564_1001413 Ga0209564_100141320 269
1220 3300025295 Ga0209564_1016873 Ga0209564_10168732 269
1221 3300025295 Ga0209564_1031662 Ga0209564_10316622 269
1222 3300025295 Ga0209564_1033997 Ga0209564_10339972 269
1223 3300025297 Ga0209758_1000075 Ga0209758_100007585 269
1224 3300025297 Ga0209758_1000087 Ga0209758_1000087157 269
1225 3300025297 Ga0209758_1000135 Ga0209758_10001356 269
1226 3300025297 Ga0209758_1001472 Ga0209758_100147214 269
1227 3300025297 Ga0209758_1004550 Ga0209758_10045503 269
1228 3300025297 Ga0209758_1006443 Ga0209758_10064436 269
1229 3300025297 Ga0209758_1009361 Ga0209758_10093613 269
1230 3300025297 Ga0209758_1012485 Ga0209758_10124853 269
1231 3300025297 Ga0209758_1014095 Ga0209758_10140952 269
1232 3300025297 Ga0209758_1035129 Ga0209758_10351292 269
1233 3300025298 Ga0209050_1000015 Ga0209050_1000015168 269
1234 3300025298 Ga0209050_1038483 Ga0209050_10384832 269
1235 3300025299 Ga0209256_1000129 Ga0209256_10001296 269
1236 3300025299 Ga0209256_1000604 Ga0209256_100060442 269
1237 3300025299 Ga0209256_1006248 Ga0209256_10062485 269
1238 3300025302 Ga0207426_1000160 Ga0207426_10001608 269
1239 3300025302 Ga0207426_1000171 Ga0207426_10001716 269
1240 3300025302 Ga0207426_1000185 Ga0207426_10001856 269
1241 3300025302 Ga0207426_1002426 Ga0207426_10024266 269
1242 3300025302 Ga0207426_1047672 Ga0207426_10476722 269
1243 3300025303 Ga0209051_1000010 Ga0209051_1000010168 269
1244 3300025303 Ga0209051_1027886 Ga0209051_10278862 269
1245 3300025304 Ga0209257_1000026 Ga0209257_1000026510 269
1246 3300025304 Ga0209257_1000382 Ga0209257_100038282 269
1247 3300025315 Ga0207697_10008917 Ga0207697_100089173 269
1248 3300025315 Ga0207697_10013135 Ga0207697_100131352 269
1249 3300025315 Ga0207697_10029703 Ga0207697_100297032 269
1250 3300025315 Ga0207697_10071932 Ga0207697_100719322 269
1251 3300025893 Ga0207682_10002804 Ga0207682_100028043 269
1252 3300025893 Ga0207682_10138857 Ga0207682_101388572 269
1253 3300025898 Ga0207692_10008762 Ga0207692_100087622 269
1254 3300025898 Ga0207692_10030805 Ga0207692_100308052 269
1255 3300025901 Ga0207688_10011258 Ga0207688_100112582 269
1256 3300025901 Ga0207688_10045160 Ga0207688_100451602 269
1257 3300025901 Ga0207688_10094381 Ga0207688_100943811 269
1258 3300025901 Ga0207688_10101948 Ga0207688_101019482 269
1259 3300025904 Ga0207647_10000181 Ga0207647_1000018155 269
1260 3300025904 Ga0207647_10008822 Ga0207647_100088224 269
1261 3300025904 Ga0207647_10028859 Ga0207647_100288594 269
1262 3300025904 Ga0207647_10050867 Ga0207647_100508672 269
1263 3300025904 Ga0207647_10052761 Ga0207647_100527612 269
1264 3300025904 Ga0207647_10249175 Ga0207647_102491752 269
1265 3300025904 Ga0207647_10254112 Ga0207647_102541121 269
1266 3300025905 Ga0207685_10000117 Ga0207685_100001177 269
1267 3300025906 Ga0207699_10000561 Ga0207699_100005618 269
1268 3300025906 Ga0207699_10002981 Ga0207699_100029812 269
1269 3300025906 Ga0207699_10345747 Ga0207699_103457471 269
1270 3300025907 Ga0207645_10021282 Ga0207645_100212824 269
1271 3300025907 Ga0207645_10027095 Ga0207645_100270952 269
1272 3300025907 Ga0207645_10070297 Ga0207645_100702972 269
1273 3300025907 Ga0207645_10102883 Ga0207645_101028832 269
1274 3300025907 Ga0207645_10114768 Ga0207645_101147682 269
1275 3300025908 Ga0207643_10056467 Ga0207643_100564672 269
1276 3300025909 Ga0207705_10002417 Ga0207705_100024174 269
1277 3300025909 Ga0207705_10014317 Ga0207705_100143173 269
1278 3300025909 Ga0207705_10029640 Ga0207705_100296402 269
1279 3300025909 Ga0207705_10038453 Ga0207705_100384532 269
1280 3300025909 Ga0207705_10088868 Ga0207705_100888682 269
1281 3300025909 Ga0207705_10143894 Ga0207705_101438942 269
1282 3300025909 Ga0207705_10231313 Ga0207705_102313132 269
1283 3300025909 Ga0207705_10482578 Ga0207705_104825782 269
1284 3300025910 Ga0207684_10111434 Ga0207684_101114341 269
1285 3300025910 Ga0207684_10125240 Ga0207684_101252402 269
1286 3300025911 Ga0207654_10019399 Ga0207654_100193994 269
1287 3300025911 Ga0207654_10173564 Ga0207654_101735642 269
1288 3300025911 Ga0207654_10250098 Ga0207654_102500982 269
1289 3300025912 Ga0207707_10007110 Ga0207707_100071106 269
1290 3300025912 Ga0207707_10054341 Ga0207707_100543412 269
1291 3300025912 Ga0207707_10058645 Ga0207707_100586454 269
1292 3300025912 Ga0207707_10091506 Ga0207707_100915062 269
1293 3300025912 Ga0207707_10098243 Ga0207707_100982432 269
1294 3300025912 Ga0207707_10105844 Ga0207707_101058442 269
1295 3300025913 Ga0207695_10000029 Ga0207695_10000029497 269
1296 3300025913 Ga0207695_10091535 Ga0207695_100915352 269
1297 3300025913 Ga0207695_10106653 Ga0207695_101066533 269
1298 3300025913 Ga0207695_10155990 Ga0207695_101559903 269
1299 3300025914 Ga0207671_10015933 Ga0207671_100159335 269
1300 3300025914 Ga0207671_10025983 Ga0207671_100259833 269
1301 3300025914 Ga0207671_10091344 Ga0207671_100913442 269
1302 3300025914 Ga0207671_10132033 Ga0207671_101320332 269
1303 3300025914 Ga0207671_10163587 Ga0207671_101635872 269
1304 3300025914 Ga0207671_10260703 Ga0207671_102607031 269
1305 3300025914 Ga0207671_10322926 Ga0207671_103229261 269
1306 3300025915 Ga0207693_10000326 Ga0207693_1000032633 269
1307 3300025915 Ga0207693_10053622 Ga0207693_100536221 269
1308 3300025915 Ga0207693_10097801 Ga0207693_100978012 269
1309 3300025916 Ga0207663_10000362 Ga0207663_1000036211 269
1310 3300025916 Ga0207663_10012171 Ga0207663_100121713 269
1311 3300025916 Ga0207663_10172511 Ga0207663_101725112 269
1312 3300025917 Ga0207660_10049154 Ga0207660_100491544 269
1313 3300025917 Ga0207660_10065702 Ga0207660_100657022 269
1314 3300025917 Ga0207660_10108315 Ga0207660_101083152 269
1315 3300025917 Ga0207660_10298469 Ga0207660_102984691 269
1316 3300025918 Ga0207662_10094697 Ga0207662_100946972 269
1317 3300025919 Ga0207657_10000659 Ga0207657_1000065942 269
1318 3300025919 Ga0207657_10001814 Ga0207657_1000181417 269
1319 3300025919 Ga0207657_10007485 Ga0207657_100074854 269
1320 3300025919 Ga0207657_10013513 Ga0207657_100135134 269
1321 3300025919 Ga0207657_10020740 Ga0207657_100207403 269
1322 3300025919 Ga0207657_10036996 Ga0207657_100369965 269
1323 3300025919 Ga0207657_10048009 Ga0207657_100480093 269
1324 3300025919 Ga0207657_10054494 Ga0207657_100544942 269
1325 3300025919 Ga0207657_10064044 Ga0207657_100640443 269
1326 3300025919 Ga0207657_10089783 Ga0207657_100897832 269
1327 3300025920 Ga0207649_10041654 Ga0207649_100416542 269
1328 3300025920 Ga0207649_10053618 Ga0207649_100536182 269
1329 3300025920 Ga0207649_10092968 Ga0207649_100929682 269
1330 3300025920 Ga0207649_10200893 Ga0207649_102008932 269
1331 3300025920 Ga0207649_10254929 Ga0207649_102549291 269
1332 3300025920 Ga0207649_10394928 Ga0207649_103949281 269
1333 3300025921 Ga0207652_10013066 Ga0207652_100130662 269
1334 3300025921 Ga0207652_10023863 Ga0207652_100238634 269
1335 3300025921 Ga0207652_10026596 Ga0207652_100265965 269
1336 3300025921 Ga0207652_10054634 Ga0207652_100546343 269
1337 3300025921 Ga0207652_10236329 Ga0207652_102363292 269
1338 3300025921 Ga0207652_10447979 Ga0207652_104479792 269
1339 3300025922 Ga0207646_10068196 Ga0207646_100681962 269
1340 3300025922 Ga0207646_10128892 Ga0207646_101288921 269
1341 3300025923 Ga0207681_10002516 Ga0207681_100025168 269
1342 3300025923 Ga0207681_10016135 Ga0207681_100161354 269
1343 3300025923 Ga0207681_10040964 Ga0207681_100409644 269
1344 3300025923 Ga0207681_10075463 Ga0207681_100754633 269
1345 3300025923 Ga0207681_10239877 Ga0207681_102398773 269
1346 3300025923 Ga0207681_10454771 Ga0207681_104547712 269
1347 3300025923 Ga0207681_10458556 Ga0207681_104585562 269
1348 3300025923 Ga0207681_10535428 Ga0207681_105354281 269
1349 3300025924 Ga0207694_10007413 Ga0207694_100074134 269
1350 3300025924 Ga0207694_10184916 Ga0207694_101849162 269
1351 3300025924 Ga0207694_10247543 Ga0207694_102475432 269
1352 3300025924 Ga0207694_10261222 Ga0207694_102612222 269
1353 3300025925 Ga0207650_10008732 Ga0207650_100087326 269
1354 3300025925 Ga0207650_10037599 Ga0207650_100375993 269
1355 3300025925 Ga0207650_10071022 Ga0207650_100710222 269
1356 3300025926 Ga0207659_10023583 Ga0207659_100235833 269
1357 3300025926 Ga0207659_10025581 Ga0207659_100255814 269
1358 3300025926 Ga0207659_10052290 Ga0207659_100522902 269
1359 3300025926 Ga0207659_10059700 Ga0207659_100597002 269
1360 3300025927 Ga0207687_10128342 Ga0207687_101283422 269
1361 3300025927 Ga0207687_10300079 Ga0207687_103000792 269
1362 3300025928 Ga0207700_10023512 Ga0207700_100235122 269
1363 3300025928 Ga0207700_10033458 Ga0207700_100334582 269
1364 3300025928 Ga0207700_10063462 Ga0207700_100634622 269
1365 3300025928 Ga0207700_10068438 Ga0207700_100684383 269
1366 3300025929 Ga0207664_10001455 Ga0207664_100014557 269
1367 3300025929 Ga0207664_10077877 Ga0207664_100778772 269
1368 3300025929 Ga0207664_10168261 Ga0207664_101682612 269
1369 3300025929 Ga0207664_10174619 Ga0207664_101746192 269
1370 3300025931 Ga0207644_10207584 Ga0207644_102075842 269
1371 3300025931 Ga0207644_10630620 Ga0207644_106306201 269
1372 3300025932 Ga0207690_10023248 Ga0207690_100232481 269
1373 3300025932 Ga0207690_10111848 Ga0207690_101118482 269
1374 3300025932 Ga0207690_10159624 Ga0207690_101596242 269
1375 3300025932 Ga0207690_10202669 Ga0207690_102026692 269
1376 3300025932 Ga0207690_10208624 Ga0207690_102086242 269
1377 3300025932 Ga0207690_10261763 Ga0207690_102617632 269
1378 3300025932 Ga0207690_10423770 Ga0207690_104237702 269
1379 3300025933 Ga0207706_10002491 Ga0207706_1000249113 269
1380 3300025933 Ga0207706_10012557 Ga0207706_100125575 269
1381 3300025933 Ga0207706_10028060 Ga0207706_100280604 269
1382 3300025933 Ga0207706_10046173 Ga0207706_100461734 269
1383 3300025933 Ga0207706_10054774 Ga0207706_100547744 269
1384 3300025933 Ga0207706_10060522 Ga0207706_100605224 269
1385 3300025933 Ga0207706_10066703 Ga0207706_100667032 269
1386 3300025933 Ga0207706_10081504 Ga0207706_100815043 269
1387 3300025933 Ga0207706_10124927 Ga0207706_101249272 269
1388 3300025933 Ga0207706_10206678 Ga0207706_102066782 269
1389 3300025933 Ga0207706_10237268 Ga0207706_102372682 269
1390 3300025933 Ga0207706_10249811 Ga0207706_102498112 269
1391 3300025933 Ga0207706_10432815 Ga0207706_104328152 269
1392 3300025933 Ga0207706_10522637 Ga0207706_105226372 269
1393 3300025934 Ga0207686_10031355 Ga0207686_100313554 269
1394 3300025935 Ga0207709_10001388 Ga0207709_1000138816 269
1395 3300025935 Ga0207709_10018084 Ga0207709_100180843 269
1396 3300025935 Ga0207709_10109204 Ga0207709_101092042 269
1397 3300025935 Ga0207709_10158082 Ga0207709_101580822 269
1398 3300025936 Ga0207670_10186242 Ga0207670_101862422 269
1399 3300025936 Ga0207670_10336348 Ga0207670_103363482 269
1400 3300025937 Ga0207669_10057454 Ga0207669_100574542 269
1401 3300025937 Ga0207669_10137518 Ga0207669_101375182 269
1402 3300025937 Ga0207669_10252765 Ga0207669_102527652 269
1403 3300025938 Ga0207704_10265710 Ga0207704_102657102 269
1404 3300025939 Ga0207665_10000194 Ga0207665_1000019431 269
1405 3300025939 Ga0207665_10028096 Ga0207665_100280963 269
1406 3300025939 Ga0207665_10155356 Ga0207665_101553562 269
1407 3300025940 Ga0207691_10004302 Ga0207691_1000430213 269
1408 3300025940 Ga0207691_10047595 Ga0207691_100475952 269
1409 3300025940 Ga0207691_10057577 Ga0207691_100575774 269
1410 3300025940 Ga0207691_10059944 Ga0207691_100599442 269
1411 3300025940 Ga0207691_10080680 Ga0207691_100806804 269
1412 3300025940 Ga0207691_10223872 Ga0207691_102238722 269
1413 3300025941 Ga0207711_10052734 Ga0207711_100527343 269
1414 3300025941 Ga0207711_10062894 Ga0207711_100628942 269
1415 3300025941 Ga0207711_10252160 Ga0207711_102521602 269
1416 3300025941 Ga0207711_10544084 Ga0207711_105440842 269
1417 3300025942 Ga0207689_10031582 Ga0207689_100315824 269
1418 3300025942 Ga0207689_10050489 Ga0207689_100504894 269
1419 3300025942 Ga0207689_10205324 Ga0207689_102053242 269
1420 3300025942 Ga0207689_10225223 Ga0207689_102252231 269
1421 3300025942 Ga0207689_10359730 Ga0207689_103597302 269
1422 3300025942 Ga0207689_10417005 Ga0207689_104170051 269
1423 3300025944 Ga0207661_10026021 Ga0207661_100260214 269
1424 3300025944 Ga0207661_10033925 Ga0207661_100339254 269
1425 3300025944 Ga0207661_10047181 Ga0207661_100471812 269
1426 3300025945 Ga0207679_10016166 Ga0207679_100161664 269
1427 3300025945 Ga0207679_10080112 Ga0207679_100801123 269
1428 3300025945 Ga0207679_10100558 Ga0207679_101005582 269
1429 3300025945 Ga0207679_10327661 Ga0207679_103276611 269
1430 3300025945 Ga0207679_10462479 Ga0207679_104624792 269
1431 3300025949 Ga0207667_10018732 Ga0207667_100187322 269
1432 3300025949 Ga0207667_10026378 Ga0207667_100263784 269
1433 3300025949 Ga0207667_10064921 Ga0207667_100649212 269
1434 3300025949 Ga0207667_10085761 Ga0207667_100857612 269
1435 3300025949 Ga0207667_10092539 Ga0207667_100925392 269
1436 3300025949 Ga0207667_10122480 Ga0207667_101224802 269
1437 3300025949 Ga0207667_10364303 Ga0207667_103643031 269
1438 3300025949 Ga0207667_10527027 Ga0207667_105270271 269
1439 3300025960 Ga0207651_10060955 Ga0207651_100609554 269
1440 3300025960 Ga0207651_10062185 Ga0207651_100621853 269
1441 3300025960 Ga0207651_10275366 Ga0207651_102753662 269
1442 3300025960 Ga0207651_10586741 Ga0207651_105867411 269
1443 3300025961 Ga0207712_10002025 Ga0207712_100020258 269
1444 3300025961 Ga0207712_10063785 Ga0207712_100637852 269
1445 3300025961 Ga0207712_10245022 Ga0207712_102450222 269
1446 3300025972 Ga0207668_10000580 Ga0207668_1000058015 269
1447 3300025972 Ga0207668_10020304 Ga0207668_100203042 269
1448 3300025972 Ga0207668_10077701 Ga0207668_100777012 269
1449 3300025972 Ga0207668_10163641 Ga0207668_101636412 269
1450 3300025972 Ga0207668_10184124 Ga0207668_101841241 269
1451 3300025972 Ga0207668_10385701 Ga0207668_103857012 269
1452 3300025972 Ga0207668_10392227 Ga0207668_103922272 269
1453 3300025972 Ga0207668_10445639 Ga0207668_104456392 269
1454 3300025981 Ga0207640_10179941 Ga0207640_101799412 269
1455 3300025986 Ga0207658_10137690 Ga0207658_101376902 269
1456 3300025986 Ga0207658_10197868 Ga0207658_101978682 269
1457 3300026023 Ga0207677_10030563 Ga0207677_100305632 269
1458 3300026023 Ga0207677_10030598 Ga0207677_100305984 269
1459 3300026023 Ga0207677_10376047 Ga0207677_103760472 269
1460 3300026023 Ga0207677_10388963 Ga0207677_103889631 269
1461 3300026023 Ga0207677_10498893 Ga0207677_104988932 269
1462 3300026035 Ga0207703_10006101 Ga0207703_100061012 269
1463 3300026035 Ga0207703_10042309 Ga0207703_100423092 269
1464 3300026035 Ga0207703_10051821 Ga0207703_100518213 269
1465 3300026035 Ga0207703_10073678 Ga0207703_100736782 269
1466 3300026035 Ga0207703_10170664 Ga0207703_101706642 269
1467 3300026035 Ga0207703_10411687 Ga0207703_104116872 269
1468 3300026041 Ga0207639_10039358 Ga0207639_100393582 269
1469 3300026041 Ga0207639_10205196 Ga0207639_102051962 269
1470 3300026041 Ga0207639_10209611 Ga0207639_102096112 269
1471 3300026041 Ga0207639_10399122 Ga0207639_103991221 269
1472 3300026067 Ga0207678_10033232 Ga0207678_100332324 269
1473 3300026067 Ga0207678_10046104 Ga0207678_100461044 269
1474 3300026067 Ga0207678_10054300 Ga0207678_100543002 269
1475 3300026067 Ga0207678_10063670 Ga0207678_100636703 269
1476 3300026067 Ga0207678_10073540 Ga0207678_100735402 269
1477 3300026067 Ga0207678_10109704 Ga0207678_101097042 269
1478 3300026067 Ga0207678_10117286 Ga0207678_101172862 269
1479 3300026067 Ga0207678_10162784 Ga0207678_101627842 269
1480 3300026067 Ga0207678_10244407 Ga0207678_102444072 269
1481 3300026078 Ga0207702_10001454 Ga0207702_100014548 269
1482 3300026078 Ga0207702_10008316 Ga0207702_100083162 269
1483 3300026078 Ga0207702_10082530 Ga0207702_100825302 269
1484 3300026078 Ga0207702_10139034 Ga0207702_101390342 269
1485 3300026088 Ga0207641_10006863 Ga0207641_100068638 269
1486 3300026088 Ga0207641_10020003 Ga0207641_100200034 269
1487 3300026088 Ga0207641_10258004 Ga0207641_102580042 269
1488 3300026089 Ga0207648_10006730 Ga0207648_100067302 269
1489 3300026089 Ga0207648_10042420 Ga0207648_100424203 269
1490 3300026089 Ga0207648_10095094 Ga0207648_100950944 269
1491 3300026089 Ga0207648_10109752 Ga0207648_101097523 269
1492 3300026089 Ga0207648_10155281 Ga0207648_101552811 269
1493 3300026089 Ga0207648_10163445 Ga0207648_101634452 269
1494 3300026095 Ga0207676_10071808 Ga0207676_100718081 269
1495 3300026095 Ga0207676_10072113 Ga0207676_100721132 269
1496 3300026095 Ga0207676_10245714 Ga0207676_102457142 269
1497 3300026095 Ga0207676_10282285 Ga0207676_102822852 269
1498 3300026116 Ga0207674_10011986 Ga0207674_100119868 269
1499 3300026116 Ga0207674_10018313 Ga0207674_100183137 269
1500 3300026116 Ga0207674_10020525 Ga0207674_100205256 269
1501 3300026116 Ga0207674_10074616 Ga0207674_100746165 269
1502 3300026116 Ga0207674_10090990 Ga0207674_100909903 269
1503 3300026116 Ga0207674_10234157 Ga0207674_102341573 269
1504 3300026118 Ga0207675_100005114 Ga0207675_1000051143 269
1505 3300026118 Ga0207675_100099163 Ga0207675_1000991632 269
1506 3300026118 Ga0207675_100162835 Ga0207675_1001628352 269
1507 3300026118 Ga0207675_100273012 Ga0207675_1002730122 269
1508 3300026118 Ga0207675_100381844 Ga0207675_1003818442 269
1509 3300026121 Ga0207683_10015224 Ga0207683_100152246 269
1510 3300026121 Ga0207683_10016322 Ga0207683_100163227 269
1511 3300026121 Ga0207683_10021620 Ga0207683_100216202 269
1512 3300026121 Ga0207683_10044648 Ga0207683_100446482 269
1513 3300026121 Ga0207683_10083870 Ga0207683_100838702 269
1514 3300026121 Ga0207683_10611465 Ga0207683_106114651 269
1515 3300026142 Ga0207698_10066764 Ga0207698_100667643 269
1516 3300026142 Ga0207698_10200440 Ga0207698_102004402 269
1517 3300026142 Ga0207698_10218767 Ga0207698_102187671 269
1518 3300026142 Ga0207698_10266847 Ga0207698_102668472 269
1519 3300026142 Ga0207698_10684116 Ga0207698_106841161 269
1520 3300027111 Ga0209281_1000020 Ga0209281_1000020522 269
1521 3300027296 Ga0209389_1000137 Ga0209389_100013747 269
1522 3300027296 Ga0209389_1000353 Ga0209389_100035318 269
1523 3300027357 Ga0209589_1003439 Ga0209589_100343918 269
1524 3300027361 Ga0209489_100192 Ga0209489_10019233 269
1525 3300027361 Ga0209489_107326 Ga0209489_1073262 269
1526 3300027361 Ga0209489_107331 Ga0209489_1073312 269
1527 3300027363 Ga0209700_100046 Ga0209700_10004675 269
1528 3300027671 Ga0209588_1010085 Ga0209588_10100854 269
1529 3300027682 Ga0209971_1013049 Ga0209971_10130493 269
1530 3300027682 Ga0209971_1056487 Ga0209971_10564871 269
1531 3300027866 Ga0209813_10002651 Ga0209813_100026512 269
1532 3300027866 Ga0209813_10029173 Ga0209813_100291732 269
1533 3300027876 Ga0209974_10003984 Ga0209974_100039842 269
1534 3300027876 Ga0209974_10066018 Ga0209974_100660182 269
1535 3300028379 Ga0268266_10000256 Ga0268266_1000025633 269
1536 3300028379 Ga0268266_10005499 Ga0268266_1000549912 269
1537 3300028379 Ga0268266_10007711 Ga0268266_100077115 269
1538 3300028379 Ga0268266_10048979 Ga0268266_100489792 269
1539 3300028379 Ga0268266_10096350 Ga0268266_100963503 269
1540 3300028379 Ga0268266_10169766 Ga0268266_101697661 269
1541 3300028379 Ga0268266_10347521 Ga0268266_103475212 269
1542 3300028380 Ga0268265_10018992 Ga0268265_100189922 269
1543 3300028380 Ga0268265_10042854 Ga0268265_100428543 269
1544 3300028380 Ga0268265_10050537 Ga0268265_100505372 269
1545 3300028380 Ga0268265_10181056 Ga0268265_101810562 269
1546 3300028380 Ga0268265_10395865 Ga0268265_103958651 269
1547 3300028381 Ga0268264_10000020 Ga0268264_10000020144 269
1548 3300028381 Ga0268264_10001404 Ga0268264_1000140420 269
1549 3300028381 Ga0268264_10025359 Ga0268264_100253596 269
1550 3300028381 Ga0268264_10070120 Ga0268264_100701202 269
1551 3300028381 Ga0268264_10073701 Ga0268264_100737013 269
1552 3300028381 Ga0268264_10254179 Ga0268264_102541792 269
1553 3300028381 Ga0268264_10498821 Ga0268264_104988212 269
1554 3300028381 Ga0268264_10538420 Ga0268264_105384202 269
1555 3300028556 Ga0265337_1001859 Ga0265337_10018591 269
1556 3300028573 Ga0265334_10000410 Ga0265334_1000041021 269
1557 3300028653 Ga0265323_10000658 Ga0265323_1000065811 269
1558 3300028666 Ga0265336_10000063 Ga0265336_1000006363 269
1559 3300028786 Ga0307517_10000235 Ga0307517_1000023515 269
1560 3300028794 Ga0307515_10037902 Ga0307515_100379022 269
1561 3300028794 Ga0307515_10170842 Ga0307515_101708421 269
1562 3300028794 Ga0307515_10414548 Ga0307515_104145481 269
1563 3300028800 Ga0265338_10000154 Ga0265338_1000015431 269
1564 3300029957 Ga0265324_10002963 Ga0265324_100029633 269
1565 3300030521 Ga0307511_10033177 Ga0307511_100331773 269
1566 3300030745 Ga0316182_1443699 Ga0316182_14436992 269
1567 3300031235 Ga0265330_10147348 Ga0265330_101473481 269
1568 3300031238 Ga0265332_10059636 Ga0265332_100596362 269
1569 3300031247 Ga0265340_10087769 Ga0265340_100877692 269
1570 3300031247 Ga0265340_10159875 Ga0265340_101598751 269
1571 3300031249 Ga0265339_10024827 Ga0265339_100248272 269
1572 3300031250 Ga0265331_10005905 Ga0265331_100059055 269
1573 3300031456 Ga0307513_10089608 Ga0307513_100896082 269
1574 3300031456 Ga0307513_10206786 Ga0307513_102067862 269
1575 3300031456 Ga0307513_10360338 Ga0307513_103603381 269
1576 3300031507 Ga0307509_10065496 Ga0307509_100654963 269
1577 3300031507 Ga0307509_10196714 Ga0307509_101967142 269
1578 3300031507 Ga0307509_10248650 Ga0307509_102486502 269
1579 3300031548 Ga0307408_100042559 Ga0307408_1000425592 269
1580 3300031548 Ga0307408_100065368 Ga0307408_1000653682 269
1581 3300031548 Ga0307408_100160546 Ga0307408_1001605462 269
1582 3300031548 Ga0307408_100277982 Ga0307408_1002779821 269
1583 3300031616 Ga0307508_10000025 Ga0307508_100000258 269
1584 3300031616 Ga0307508_10077767 Ga0307508_100777672 269
1585 3300031616 Ga0307508_10117852 Ga0307508_101178522 269
1586 3300031711 Ga0265314_10005071 Ga0265314_100050713 269
1587 3300031711 Ga0265314_10029059 Ga0265314_100290594 269
1588 3300031711 Ga0265314_10104302 Ga0265314_101043022 269
1589 3300031712 Ga0265342_10003931 Ga0265342_100039317 269
1590 3300031712 Ga0265342_10130696 Ga0265342_101306962 269
1591 3300031730 Ga0307516_10015801 Ga0307516_100158012 269
1592 3300031731 Ga0307405_10006215 Ga0307405_100062155 269
1593 3300031731 Ga0307405_10007256 Ga0307405_100072564 269
1594 3300031731 Ga0307405_10028119 Ga0307405_100281192 269
1595 3300031731 Ga0307405_10030253 Ga0307405_100302533 269
1596 3300031731 Ga0307405_10073494 Ga0307405_100734942 269
1597 3300031731 Ga0307405_10094951 Ga0307405_100949512 269
1598 3300031731 Ga0307405_10219086 Ga0307405_102190862 269
1599 3300031824 Ga0307413_10004158 Ga0307413_100041585 269
1600 3300031824 Ga0307413_10054751 Ga0307413_100547512 269
1601 3300031824 Ga0307413_10060657 Ga0307413_100606572 269
1602 3300031824 Ga0307413_10070387 Ga0307413_100703872 269
1603 3300031824 Ga0307413_10115877 Ga0307413_101158771 269
1604 3300031824 Ga0307413_10274282 Ga0307413_102742822 269
1605 3300031824 Ga0307413_10301388 Ga0307413_103013882 269
1606 3300031852 Ga0307410_10000933 Ga0307410_100009337 269
1607 3300031852 Ga0307410_10006512 Ga0307410_100065122 269
1608 3300031852 Ga0307410_10024224 Ga0307410_100242244 269
1609 3300031852 Ga0307410_10046366 Ga0307410_100463664 269
1610 3300031852 Ga0307410_10110690 Ga0307410_101106902 269
1611 3300031852 Ga0307410_10129125 Ga0307410_101291253 269
1612 3300031852 Ga0307410_10143467 Ga0307410_101434672 269
1613 3300031852 Ga0307410_10309948 Ga0307410_103099482 269
1614 3300031852 Ga0307410_10320733 Ga0307410_103207332 269
1615 3300031852 Ga0307410_10337658 Ga0307410_103376582 269
1616 3300031901 Ga0307406_10014184 Ga0307406_100141845 269
1617 3300031901 Ga0307406_10049555 Ga0307406_100495553 269
1618 3300031901 Ga0307406_10051333 Ga0307406_100513332 269
1619 3300031901 Ga0307406_10058492 Ga0307406_100584922 269
1620 3300031901 Ga0307406_10120650 Ga0307406_101206502 269
1621 3300031901 Ga0307406_10139191 Ga0307406_101391912 269
1622 3300031901 Ga0307406_10483789 Ga0307406_104837892 269
1623 3300031903 Ga0307407_10001131 Ga0307407_100011317 269
1624 3300031903 Ga0307407_10023172 Ga0307407_100231722 269
1625 3300031903 Ga0307407_10042870 Ga0307407_100428703 269
1626 3300031903 Ga0307407_10149980 Ga0307407_101499802 269
1627 3300031903 Ga0307407_10250701 Ga0307407_102507012 269
1628 3300031911 Ga0307412_10002229 Ga0307412_100022294 269
1629 3300031911 Ga0307412_10024471 Ga0307412_100244712 269
1630 3300031911 Ga0307412_10034503 Ga0307412_100345034 269
1631 3300031911 Ga0307412_10046829 Ga0307412_100468293 269
1632 3300031911 Ga0307412_10066764 Ga0307412_100667643 269
1633 3300031995 Ga0307409_100005340 Ga0307409_1000053402 269
1634 3300031995 Ga0307409_100006358 Ga0307409_1000063589 269
1635 3300031995 Ga0307409_100025009 Ga0307409_1000250091 269
1636 3300031995 Ga0307409_100026079 Ga0307409_1000260793 269
1637 3300031995 Ga0307409_100046719 Ga0307409_1000467192 269
1638 3300031995 Ga0307409_100059146 Ga0307409_1000591463 269
1639 3300031995 Ga0307409_100073405 Ga0307409_1000734053 269
1640 3300031995 Ga0307409_100150518 Ga0307409_1001505182 269
1641 3300031995 Ga0307409_100390151 Ga0307409_1003901512 269
1642 3300031995 Ga0307409_100441286 Ga0307409_1004412862 269
1643 3300031995 Ga0307409_100476430 Ga0307409_1004764302 269
1644 3300032002 Ga0307416_100003734 Ga0307416_1000037342 269
1645 3300032002 Ga0307416_100007023 Ga0307416_1000070237 269
1646 3300032002 Ga0307416_100011217 Ga0307416_1000112176 269
1647 3300032002 Ga0307416_100016114 Ga0307416_1000161144 269
1648 3300032002 Ga0307416_100027070 Ga0307416_1000270705 269
1649 3300032002 Ga0307416_100093739 Ga0307416_1000937393 269
1650 3300032002 Ga0307416_100166963 Ga0307416_1001669632 269
1651 3300032002 Ga0307416_100363962 Ga0307416_1003639622 269
1652 3300032002 Ga0307416_100471455 Ga0307416_1004714552 269
1653 3300032002 Ga0307416_100592689 Ga0307416_1005926891 269
1654 3300032004 Ga0307414_10000931 Ga0307414_1000093111 269
1655 3300032004 Ga0307414_10005926 Ga0307414_100059265 269
1656 3300032004 Ga0307414_10020194 Ga0307414_100201945 269
1657 3300032004 Ga0307414_10026614 Ga0307414_100266143 269
1658 3300032004 Ga0307414_10076603 Ga0307414_100766032 269
1659 3300032004 Ga0307414_10081124 Ga0307414_100811241 269
1660 3300032004 Ga0307414_10089507 Ga0307414_100895072 269
1661 3300032004 Ga0307414_10160109 Ga0307414_101601092 269
1662 3300032004 Ga0307414_10211147 Ga0307414_102111471 269
1663 3300032005 Ga0307411_10007133 Ga0307411_100071333 269
1664 3300032005 Ga0307411_10011246 Ga0307411_100112464 269
1665 3300032005 Ga0307411_10018655 Ga0307411_100186553 269
1666 3300032005 Ga0307411_10051801 Ga0307411_100518014 269
1667 3300032005 Ga0307411_10107970 Ga0307411_101079702 269
1668 3300032005 Ga0307411_10122203 Ga0307411_101222032 269
1669 3300032005 Ga0307411_10141433 Ga0307411_101414332 269
1670 3300032005 Ga0307411_10147510 Ga0307411_101475102 269
1671 3300032005 Ga0307411_10236948 Ga0307411_102369482 269
1672 3300032005 Ga0307411_10269047 Ga0307411_102690472 269
1673 3300032005 Ga0307411_10341206 Ga0307411_103412062 269
1674 3300032005 Ga0307411_10356027 Ga0307411_103560272 269
1675 3300032126 Ga0307415_100007681 Ga0307415_1000076814 269
1676 3300032126 Ga0307415_100033565 Ga0307415_1000335653 269
1677 3300032126 Ga0307415_100043110 Ga0307415_1000431104 269
1678 3300032126 Ga0307415_100055671 Ga0307415_1000556713 269
1679 3300032126 Ga0307415_100084756 Ga0307415_1000847562 269
1680 3300032126 Ga0307415_100155561 Ga0307415_1001555611 269
1681 3300033179 Ga0307507_10130911 Ga0307507_101309112 269
1682 3300033180 Ga0307510_10033677 Ga0307510_100336775 269
1683 3300033180 Ga0307510_10050374 Ga0307510_100503742 269
1684 3300033180 Ga0307510_10117291 Ga0307510_101172912 269
1685 3300035083 Ga0373926_0023239 Ga0373926_0023239_337_1173 269
1686 3300035111 Ga0373923_0057453 Ga0373923_0057453_276_1112 269
1687 3300035111 Ga0373923_0100956 Ga0373923_0100956_173_1036 269
1688 3300035111 Ga0373923_0168469 Ga0373923_0168469_53_889 269
1689 3300035113 Ga0373936_0007123 Ga0373936_0007123_367_1203 269
1690 3300035116 Ga0373945_0010335 Ga0373945_0010335_2040_2876 269
1691 3300035116 Ga0373945_0056084 Ga0373945_0056084_611_1447 269
1692 3300035119 Ga0373956_0013934 Ga0373956_0013934_1833_2765 269
1693 3300035120 Ga0373957_0006378 Ga0373957_0006378_827_1759 269
1694 3300035171 Ga0373946_0013149 Ga0373946_0013149_725_1561 269
1695 3300035172 Ga0373955_0035945 Ga0373955_0035945_248_1180 269
1696 3300035172 Ga0373955_0168120 Ga0373955_0168120_391_1227 269
1697 3300035410 Ga0373924_0020428 Ga0373924_0020428_705_1637 269
1698 3300035410 Ga0373924_0051011 Ga0373924_0051011_384_1220 269
1699 3300035691 Ga0373931_0005114 Ga0373931_0005114_4111_4947 269
1700 3300035691 Ga0373931_0111394 Ga0373931_0111394_34_870 269
1701 3300035691 Ga0373931_0180427 Ga0373931_0180427_180_1016 269
1702 3300035691 Ga0373931_0301184 Ga0373931_0301184_116_952 269
1703 3300035692 Ga0373935_0003467 Ga0373935_0003467_4747_5583 269
1704 3300035692 Ga0373935_0054250 Ga0373935_0054250_150_986 269
1705 3300035692 Ga0373935_0098227 Ga0373935_0098227_16_852 269
1706 3300035692 Ga0373935_0165473 Ga0373935_0165473_63_872 269
1707 3300035695 Ga0373927_0010081 Ga0373927_0010081_5099_5935 269
1708 3300035695 Ga0373927_0064985 Ga0373927_0064985_467_1303 269
1709 3300035695 Ga0373927_0088419 Ga0373927_0088419_772_1608 269
1710 3300035695 Ga0373927_0108420 Ga0373927_0108420_893_1729 269
1711 3300035724 Ga0373933_0076538 Ga0373933_0076538_906_1742 269
1712 3300035725 Ga0373947_0002642 Ga0373947_0002642_3859_4695 269
1713 3300035725 Ga0373947_0014002 Ga0373947_0014002_2835_3671 269
1714 3300035725 Ga0373947_0091764 Ga0373947_0091764_959_1795 269
1715 3300036401 Ga0373937_0054286 Ga0373937_0054286_89_925 269
1716 3300036401 Ga0373937_0059352 Ga0373937_0059352_1179_2015 269
1717 3300036401 Ga0373937_0064661 Ga0373937_0064661_1142_1978 269
1718 3300036401 Ga0373937_0655142 Ga0373937_0655142_23_859 269
1719 3300036459 Ga0372808_004872 Ga0372808_004872_26_862 269
1720 3300037068 Ga0373925_0032363 Ga0373925_0032363_1192_2028 269
1721 3300037068 Ga0373925_0077195 Ga0373925_0077195_834_1670 269
1722 3300037068 Ga0373925_0107674 Ga0373925_0107674_840_1676 269
1723 3300037068 Ga0373925_0112446 Ga0373925_0112446_507_1343 269
1724 3300037068 Ga0373925_0177630 Ga0373925_0177630_430_1266 269
1725 3300037068 Ga0373925_0241683 Ga0373925_0241683_13_849 269
1726 3300037312 Ga0395899_0010129 Ga0395899_0010129_4675_5484 269
1727 3300037312 Ga0395899_0011973 Ga0395899_0011973_613_1422 269
1728 3300037312 Ga0395899_0021576 Ga0395899_0021576_3598_4410 269
1729 3300037312 Ga0395899_0072835 Ga0395899_0072835_682_1491 269
1730 3300037312 Ga0395899_0095033 Ga0395899_0095033_586_1395 269
1731 3300037418 Ga0395900_0000943 Ga0395900_0000943_35452_36288 269
1732 3300037418 Ga0395900_0005612 Ga0395900_0005612_8369_9178 269
1733 3300037418 Ga0395900_0008466 Ga0395900_0008466_4537_5346 269
1734 3300037418 Ga0395900_0024575 Ga0395900_0024575_4466_5278 269
1735 3300037418 Ga0395900_0098863 Ga0395900_0098863_1789_2598 269
1736 3300037418 Ga0395900_0131609 Ga0395900_0131609_995_1804 269
1737 3300037418 Ga0395900_0145422 Ga0395900_0145422_932_1741 269
1738 3300037418 Ga0395900_0147368 Ga0395900_0147368_858_1667 269
1739 3300037418 Ga0395900_0341476 Ga0395900_0341476_82_918 269
1740 3300037466 Ga0395898_0002974 Ga0395898_0002974_2870_3706 269
1741 3300037466 Ga0395898_0022005 Ga0395898_0022005_1311_2147 269
1742 3300037466 Ga0395898_0030996 Ga0395898_0030996_2091_2900 269
1743 3300037466 Ga0395898_0335949 Ga0395898_0335949_112_921 269
1744 3300037466 Ga0395898_0449775 Ga0395898_0449775_49_858 269
1745 3300037471 Ga0395905_0001191 Ga0395905_0001191_5685_6497 269
1746 3300037471 Ga0395905_0001314 Ga0395905_0001314_14317_15126 269
1747 3300037471 Ga0395905_0003656 Ga0395905_0003656_1363_2172 269
1748 3300037471 Ga0395905_0027387 Ga0395905_0027387_1427_2263 269
1749 3300037471 Ga0395905_0125672 Ga0395905_0125672_682_1491 269
1750 3300037471 Ga0395905_0140385 Ga0395905_0140385_574_1383 269
1751 3300037471 Ga0395905_0207970 Ga0395905_0207970_258_1094 269
1752 3300037471 Ga0395905_0219105 Ga0395905_0219105_546_1355 269
1753 3300037471 Ga0395905_0380779 Ga0395905_0380779_428_1237 269
1754 3300037853 Ga0436364_1062405 Ga0436364_1062405_71_907 269
1755 3300038443 Ga0395901_0000320 Ga0395901_0000320_4655_5464 269
1756 3300038443 Ga0395901_0001973 Ga0395901_0001973_16262_17098 269
1757 3300038443 Ga0395901_0002693 Ga0395901_0002693_12475_13287 269
1758 3300038443 Ga0395901_0065739 Ga0395901_0065739_1340_2149 269
1759 3300038443 Ga0395901_0083304 Ga0395901_0083304_2508_3317 269
1760 3300038443 Ga0395901_0115492 Ga0395901_0115492_519_1328 269
1761 3300038443 Ga0395901_0139345 Ga0395901_0139345_793_1602 269
1762 3300039437 Ga0436365_1019011 Ga0436365_1019011_104_940 269
1763 3300039437 Ga0436365_1251026 Ga0436365_1251026_53_889 269
1764 3300039438 Ga0436360_0318167 Ga0436360_0318167_756_1592 269
1765 3300039438 Ga0436360_0336060 Ga0436360_0336060_1935_2771 269
1766 3300039447 Ga0436361_0259732 Ga0436361_0259732_752_1588 269
1767 3300039447 Ga0436361_1071877 Ga0436361_1071877_483_1319 269
1768 3300039453 Ga0436362_0423859 Ga0436362_0423859_696_1532 269
1769 3300041406 Ga0439439_0003872 Ga0439439_0003872_1542_2366 269
1770 3300041494 Ga0451837_1440309 Ga0451837_1440309_14_850 269
1771 3300042004 Ga0439445_0000421 Ga0439445_0000421_1528_2337 269
1772 3300042007 Ga0439449_0112431 Ga0439449_0112431_103_912 269
1773 3300042122 Ga0450920_016702 Ga0450920_016702_498_1322 269
1774 3300042124 Ga0450922_003443 Ga0450922_003443_192_1016 269
1775 3300042125 Ga0450923_002117 Ga0450923_002117_1419_2243 269
1776 3300042134 Ga0450898_000749 Ga0450898_000749_2578_3402 269
1777 3300042142 Ga0450905_003404 Ga0450905_003404_748_1557 269
1778 3300042156 Ga0439446_0039325 Ga0439446_0039325_305_1129 269
1779 3300042435 Ga0439434_0008290 Ga0439434_0008290_1371_2195 269
1780 3300042436 Ga0439435_0017240 Ga0439435_0017240_637_1461 269
1781 3300042437 Ga0439444_0001098 Ga0439444_0001098_1972_2796 269
1782 3300042530 Ga0450916_001478 Ga0450916_001478_1069_1893 269
1783 3300044656 Ga0466969_0016377 Ga0466969_0016377_1087_1923 269
1784 3300044658 Ga0466972_0039915 Ga0466972_0039915_474_1310 269
1785 3300044658 Ga0466972_0100953 Ga0466972_0100953_359_1195 269
1786 3300044683 Ga0466965_0036286 Ga0466965_0036286_289_1125 269
1787 3300044683 Ga0466965_0167058 Ga0466965_0167058_251_1087 269
1788 3300044683 Ga0466965_0174577 Ga0466965_0174577_166_1002 269
1789 3300044684 Ga0466966_0000229 Ga0466966_0000229_32500_33336 269
1790 3300044684 Ga0466966_0035952 Ga0466966_0035952_970_1779 269
1791 3300044684 Ga0466966_0246989 Ga0466966_0246989_153_1004 269
1792 3300044693 Ga0466961_0000029 Ga0466961_0000029_55616_56452 269
1793 3300044694 Ga0466963_0000376 Ga0466963_0000376_624_1433 269
1794 3300044694 Ga0466963_0034650 Ga0466963_0034650_59_895 269
1795 3300044706 Ga0466964_0022821 Ga0466964_0022821_127_936 269
1796 3300044706 Ga0466964_0140606 Ga0466964_0140606_80_889 269
1797 3300044719 Ga0466971_0009429 Ga0466971_0009429_2287_3096 269
1798 3300044719 Ga0466971_0013597 Ga0466971_0013597_2470_3279 269
1799 3300044735 Ga0466968_0007268 Ga0466968_0007268_1769_2605 269
1800 3300044735 Ga0466968_0162575 Ga0466968_0162575_148_999 269
1801 3300044765 Ga0466970_0006059 Ga0466970_0006059_2166_2975 269
1802 3300044765 Ga0466970_0048706 Ga0466970_0048706_1076_1960 269
1803 3300044842 Ga0466957_0006077 Ga0466957_0006077_5806_6615 269
1804 3300044842 Ga0466957_0006659 Ga0466957_0006659_3189_4073 269
1805 3300044842 Ga0466957_0018120 Ga0466957_0018120_1057_1866 269
1806 3300044842 Ga0466957_0227562 Ga0466957_0227562_301_1110 269
1807 3300044901 Ga0466960_0128241 Ga0466960_0128241_420_1256 269
1808 3300045049 Ga0466959_0000533 Ga0466959_0000533_8741_9577 269
1809 3300045049 Ga0466959_0019883 Ga0466959_0019883_3785_4651 269
1810 3300045049 Ga0466959_0176034 Ga0466959_0176034_92_901 269
1811 3300045836 Ga0466958_0001039 Ga0466958_0001039_2791_3600 269
1812 3300045836 Ga0466958_0029823 Ga0466958_0029823_1590_2399 269
1813 3300046454 Ga0495592_0013467 Ga0495592_0013467_3315_4151 269
1814 3300046454 Ga0495592_0185120 Ga0495592_0185120_446_1309 269
1815 3300046455 Ga0495603_0000237 Ga0495603_0000237_13913_14749 269
1816 3300046455 Ga0495603_0001754 Ga0495603_0001754_1744_2580 269
1817 3300046455 Ga0495603_0011365 Ga0495603_0011365_3940_4776 269
1818 3300046455 Ga0495603_0025069 Ga0495603_0025069_2443_3279 269
1819 3300046455 Ga0495603_0038759 Ga0495603_0038759_1707_2543 269
1820 3300046455 Ga0495603_0040610 Ga0495603_0040610_642_1478 269
1821 3300046455 Ga0495603_0059521 Ga0495603_0059521_256_1092 269
1822 3300046459 Ga0495629_0000772 Ga0495629_0000772_19450_20286 269
1823 3300046459 Ga0495629_0002337 Ga0495629_0002337_10436_11272 269
1824 3300046459 Ga0495629_0031955 Ga0495629_0031955_246_1082 269
1825 3300046459 Ga0495629_0056707 Ga0495629_0056707_964_1800 269
1826 3300046459 Ga0495629_0170919 Ga0495629_0170919_203_1066 269
1827 3300046459 Ga0495629_0178254 Ga0495629_0178254_28_864 269
1828 3300046460 Ga0495638_0004606 Ga0495638_0004606_2993_3835 269
1829 3300046460 Ga0495638_0005372 Ga0495638_0005372_3998_4834 269
1830 3300046460 Ga0495638_0041430 Ga0495638_0041430_591_1427 269
1831 3300046461 Ga0495641_0012966 Ga0495641_0012966_2867_3703 269
1832 3300046462 Ga0495651_0011651 Ga0495651_0011651_2752_3684 269
1833 3300046462 Ga0495651_0098891 Ga0495651_0098891_178_1014 269
1834 3300046462 Ga0495651_0143868 Ga0495651_0143868_649_1485 269
1835 3300046463 Ga0495653_0022036 Ga0495653_0022036_2506_3369 269
1836 3300046463 Ga0495653_0027863 Ga0495653_0027863_895_1731 269
1837 3300046463 Ga0495653_0217635 Ga0495653_0217635_298_1134 269
1838 3300046472 Ga0495580_0004214 Ga0495580_0004214_3945_4781 269
1839 3300046472 Ga0495580_0052612 Ga0495580_0052612_474_1310 269
1840 3300046473 Ga0495582_0000209 Ga0495582_0000209_10519_11355 269
1841 3300046473 Ga0495582_0014036 Ga0495582_0014036_2601_3437 269
1842 3300046473 Ga0495582_0041407 Ga0495582_0041407_163_999 269
1843 3300046474 Ga0495605_0116685 Ga0495605_0116685_61_897 269
1844 3300046474 Ga0495605_0123331 Ga0495605_0123331_271_1107 269
1845 3300046475 Ga0495639_0000387 Ga0495639_0000387_10901_11737 269
1846 3300046476 Ga0495662_0002150 Ga0495662_0002150_8760_9596 269
1847 3300046476 Ga0495662_0065754 Ga0495662_0065754_302_1138 269
1848 3300046477 Ga0495664_0001615 Ga0495664_0001615_8849_9685 269
1849 3300046477 Ga0495664_0020289 Ga0495664_0020289_2253_3089 269
1850 3300046477 Ga0495664_0036970 Ga0495664_0036970_464_1300 269
1851 3300046477 Ga0495664_0224499 Ga0495664_0224499_140_976 269
1852 3300046491 Ga0495584_0112301 Ga0495584_0112301_243_1079 269
1853 3300046492 Ga0495585_0063354 Ga0495585_0063354_19_855 269
1854 3300046492 Ga0495585_0083407 Ga0495585_0083407_355_1191 269
1855 3300046499 Ga0495594_0053255 Ga0495594_0053255_378_1214 269
1856 3300046499 Ga0495594_0245976 Ga0495594_0245976_37_873 269
1857 3300046500 Ga0495596_0075093 Ga0495596_0075093_64_900 269
1858 3300046500 Ga0495596_0096815 Ga0495596_0096815_158_994 269
1859 3300046507 Ga0495606_0002837 Ga0495606_0002837_10032_10868 269
1860 3300046507 Ga0495606_0021044 Ga0495606_0021044_1590_2426 269
1861 3300046507 Ga0495606_0022784 Ga0495606_0022784_1141_1977 269
1862 3300046507 Ga0495606_0176234 Ga0495606_0176234_312_1148 269
1863 3300046511 Ga0495608_0018247 Ga0495608_0018247_3898_4734 269
1864 3300046511 Ga0495608_0030836 Ga0495608_0030836_789_1625 269
1865 3300046512 Ga0495610_0018192 Ga0495610_0018192_2455_3291 269
1866 3300046512 Ga0495610_0029652 Ga0495610_0029652_1809_2651 269
1867 3300046514 Ga0495618_0013641 Ga0495618_0013641_3764_4600 269
1868 3300046514 Ga0495618_0092392 Ga0495618_0092392_583_1419 269
1869 3300046514 Ga0495618_0170990 Ga0495618_0170990_98_961 269
1870 3300046516 Ga0495628_0022291 Ga0495628_0022291_4155_4991 269
1871 3300046516 Ga0495628_0053583 Ga0495628_0053583_1435_2271 269
1872 3300046517 Ga0495630_0001378 Ga0495630_0001378_5587_6423 269
1873 3300046517 Ga0495630_0017390 Ga0495630_0017390_2624_3460 269
1874 3300046517 Ga0495630_0108191 Ga0495630_0108191_549_1385 269
1875 3300046518 Ga0495631_0030198 Ga0495631_0030198_913_1749 269
1876 3300046519 Ga0495632_0060728 Ga0495632_0060728_825_1667 269
1877 3300046519 Ga0495632_0075713 Ga0495632_0075713_178_1014 269
1878 3300046522 Ga0495643_0008539 Ga0495643_0008539_4184_5020 269
1879 3300046523 Ga0495644_0008390 Ga0495644_0008390_864_1700 269
1880 3300046523 Ga0495644_0042265 Ga0495644_0042265_88_924 269
1881 3300046524 Ga0495648_0003600 Ga0495648_0003600_12497_13333 269
1882 3300046524 Ga0495648_0067174 Ga0495648_0067174_966_1802 269
1883 3300046524 Ga0495648_0073583 Ga0495648_0073583_131_973 269
1884 3300046524 Ga0495648_0131370 Ga0495648_0131370_431_1267 269
1885 3300046524 Ga0495648_0221562 Ga0495648_0221562_61_897 269
1886 3300046524 Ga0495648_0223705 Ga0495648_0223705_50_886 269
1887 3300046525 Ga0495663_0004640 Ga0495663_0004640_2735_3544 269
1888 3300046525 Ga0495663_0005899 Ga0495663_0005899_1293_2102 269
1889 3300046525 Ga0495663_0035860 Ga0495663_0035860_262_1071 269
1890 3300046528 Ga0495642_0044451 Ga0495642_0044451_304_1113 269
1891 3300046529 Ga0495652_0005332 Ga0495652_0005332_296_1228 269
1892 3300046529 Ga0495652_0015193 Ga0495652_0015193_809_1645 269
1893 3300046529 Ga0495652_0048216 Ga0495652_0048216_112_948 269
1894 3300046529 Ga0495652_0250060 Ga0495652_0250060_154_990 269
1895 3300046531 Ga0495665_0000280 Ga0495665_0000280_3638_4474 269
1896 3300046533 Ga0495640_0001578 Ga0495640_0001578_13236_14072 269
1897 3300046533 Ga0495640_0009615 Ga0495640_0009615_867_1703 269
1898 3300046533 Ga0495640_0092149 Ga0495640_0092149_238_1074 269
1899 3300046536 Ga0495587_0080106 Ga0495587_0080106_635_1471 269
1900 3300046536 Ga0495587_0089701 Ga0495587_0089701_756_1619 269
1901 3300046537 Ga0495598_0031078 Ga0495598_0031078_455_1330 269
1902 3300046539 Ga0495621_0001420 Ga0495621_0001420_4581_5390 269
1903 3300046539 Ga0495621_0003194 Ga0495621_0003194_804_1613 269
1904 3300046539 Ga0495621_0005820 Ga0495621_0005820_634_1443 269
1905 3300046542 Ga0495597_0024441 Ga0495597_0024441_1683_2519 269
1906 3300046542 Ga0495597_0046672 Ga0495597_0046672_122_964 269
1907 3300046543 Ga0495645_0003978 Ga0495645_0003978_9139_9975 269
1908 3300046543 Ga0495645_0026670 Ga0495645_0026670_860_1792 269
1909 3300046543 Ga0495645_0128905 Ga0495645_0128905_129_965 269
1910 3300046557 Ga0495622_0003837 Ga0495622_0003837_5919_6755 269
1911 3300046557 Ga0495622_0054002 Ga0495622_0054002_585_1421 269
1912 3300046559 Ga0495667_0010850 Ga0495667_0010850_193_1029 269
1913 3300046559 Ga0495667_0021239 Ga0495667_0021239_218_1054 269
1914 3300046559 Ga0495667_0031330 Ga0495667_0031330_1978_2841 269
1915 3300046559 Ga0495667_0124426 Ga0495667_0124426_119_955 269
1916 3300046615 Ga0495656_0022169 Ga0495656_0022169_1266_2102 269
1917 3300046615 Ga0495656_0033251 Ga0495656_0033251_275_1111 269
1918 3300046616 Ga0495668_0004733 Ga0495668_0004733_3770_4579 269
1919 3300046616 Ga0495668_0020880 Ga0495668_0020880_1261_2097 269
1920 3300046616 Ga0495668_0063027 Ga0495668_0063027_1084_1893 269
1921 3300046642 Ga0495634_0000865 Ga0495634_0000865_8844_9680 269
1922 3300046642 Ga0495634_0041615 Ga0495634_0041615_1672_2508 269
1923 3300046642 Ga0495634_0090070 Ga0495634_0090070_743_1675 269
1924 3300046642 Ga0495634_0106789 Ga0495634_0106789_954_1790 269
1925 3300046660 Ga0495625_0098424 Ga0495625_0098424_1018_1854 269
1926 3300046660 Ga0495625_0123908 Ga0495625_0123908_541_1377 269
1927 3300046660 Ga0495625_0354240 Ga0495625_0354240_102_911 269
1928 3300046663 Ga0495635_0001610 Ga0495635_0001610_9026_9862 269
1929 3300046663 Ga0495635_0003974 Ga0495635_0003974_1580_2416 269
1930 3300046663 Ga0495635_0113873 Ga0495635_0113873_634_1470 269
1931 3300046664 Ga0495659_0009267 Ga0495659_0009267_1563_2372 269
1932 3300046664 Ga0495659_0104545 Ga0495659_0104545_41_850 269
1933 3300046665 Ga0495661_0070986 Ga0495661_0070986_1074_1916 269
1934 3300046675 Ga0495657_0004288 Ga0495657_0004288_6523_7455 269
1935 3300046675 Ga0495657_0027394 Ga0495657_0027394_2963_3799 269
1936 3300046675 Ga0495657_0036159 Ga0495657_0036159_1370_2233 269
1937 3300046675 Ga0495657_0072961 Ga0495657_0072961_891_1727 269
1938 3300046678 Ga0495599_0000895 Ga0495599_0000895_6306_7238 269
1939 3300046678 Ga0495599_0042087 Ga0495599_0042087_1515_2351 269
1940 3300046678 Ga0495599_0044019 Ga0495599_0044019_546_1409 269
1941 3300046678 Ga0495599_0071169 Ga0495599_0071169_844_1680 269
1942 3300046679 Ga0495623_0023407 Ga0495623_0023407_182_1018 269
1943 3300046679 Ga0495623_0037031 Ga0495623_0037031_96_959 269
1944 3300046679 Ga0495623_0075975 Ga0495623_0075975_697_1533 269
1945 3300046679 Ga0495623_0140412 Ga0495623_0140412_89_925 269
1946 3300046681 Ga0495647_0000763 Ga0495647_0000763_2142_2978 269
1947 3300046683 Ga0495658_0001222 Ga0495658_0001222_8985_9821 269
1948 3300046683 Ga0495658_0090814 Ga0495658_0090814_921_1757 269
1949 3300046684 Ga0495669_0000425 Ga0495669_0000425_15630_16439 269
1950 3300046684 Ga0495669_0003790 Ga0495669_0003790_4255_5064 269
1951 3300046684 Ga0495669_0038102 Ga0495669_0038102_955_1764 269
1952 3300046684 Ga0495669_0045924 Ga0495669_0045924_977_1786 269
1953 3300046684 Ga0495669_0063315 Ga0495669_0063315_308_1117 269
1954 3300046684 Ga0495669_0091178 Ga0495669_0091178_55_891 269
1955 3300046689 Ga0495613_0058134 Ga0495613_0058134_764_1600 269
1956 3300046689 Ga0495613_0164536 Ga0495613_0164536_485_1321 269
1957 3300046690 Ga0495624_0001082 Ga0495624_0001082_1840_2676 269
1958 3300046691 Ga0495670_0002809 Ga0495670_0002809_1525_2334 269
1959 3300046691 Ga0495670_0018241 Ga0495670_0018241_1354_2163 269
1960 3300046691 Ga0495670_0074944 Ga0495670_0074944_406_1215 269
1961 3300046691 Ga0495670_0165554 Ga0495670_0165554_82_891 269
1962 3300046692 Ga0495671_0102447 Ga0495671_0102447_262_1098 269
1963 3300046692 Ga0495671_0147660 Ga0495671_0147660_49_885 269
1964 3300046794 Ga0495589_0196479 Ga0495589_0196479_72_908 269
1965 3300046809 Ga0495600_0001516 Ga0495600_0001516_6690_7526 269
1966 3300046809 Ga0495600_0008985 Ga0495600_0008985_2579_3415 269
1967 3300046809 Ga0495600_0026432 Ga0495600_0026432_2752_3588 269
1968 3300046809 Ga0495600_0081749 Ga0495600_0081749_517_1380 269
1969 3300046809 Ga0495600_0298963 Ga0495600_0298963_89_925 269
1970 3300047315 Ga0495581_0000969 Ga0495581_0000969_9985_10821 269
1971 3300047315 Ga0495581_0055226 Ga0495581_0055226_50_886 269
1972 3300047315 Ga0495581_0083192 Ga0495581_0083192_50_886 269
1973 3300047317 Ga0495604_0005690 Ga0495604_0005690_6681_7517 269
1974 3300047317 Ga0495604_0009731 Ga0495604_0009731_5986_6918 269
1975 3300047317 Ga0495604_0047249 Ga0495604_0047249_755_1618 269
1976 3300047317 Ga0495604_0110793 Ga0495604_0110793_757_1593 269
1977 3300047317 Ga0495604_0315607 Ga0495604_0315607_89_925 269
1978 3300047319 Ga0495674_0004372 Ga0495674_0004372_288_1124 269
1979 3300047319 Ga0495674_0256672 Ga0495674_0256672_384_1220 269
1980 3300047319 Ga0495674_0418134 Ga0495674_0418134_23_859 269
1981 3300047321 Ga0495676_0009743 Ga0495676_0009743_7448_8284 269
1982 3300047321 Ga0495676_0024919 Ga0495676_0024919_3126_3962 269
1983 3300047321 Ga0495676_0095906 Ga0495676_0095906_968_1804 269
1984 3300047322 Ga0495680_0007239 Ga0495680_0007239_6535_7467 269
1985 3300047322 Ga0495680_0014577 Ga0495680_0014577_3416_4252 269
1986 3300047322 Ga0495680_0158436 Ga0495680_0158436_27_890 269
1987 3300047443 Ga0495687_004926 Ga0495687_004926_7032_7868 269
1988 3300047445 Ga0495677_0012274 Ga0495677_0012274_1477_2286 269
1989 3300047445 Ga0495677_0022919 Ga0495677_0022919_765_1574 269
1990 3300047445 Ga0495677_0049355 Ga0495677_0049355_455_1264 269
1991 3300047447 Ga0495685_054974 Ga0495685_054974_426_1262 269
1992 3300047469 Ga0495673_0003053 Ga0495673_0003053_9248_10084 269
1993 3300047469 Ga0495673_0037524 Ga0495673_0037524_975_1811 269
1994 3300047471 Ga0495684_0028329 Ga0495684_0028329_1296_2132 269
1995 3300047471 Ga0495684_0034887 Ga0495684_0034887_145_981 269
1996 3300047471 Ga0495684_0040228 Ga0495684_0040228_137_973 269
1997 3300047471 Ga0495684_0122080 Ga0495684_0122080_721_1584 269
1998 3300047472 Ga0495686_0018170 Ga0495686_0018170_1700_2536 269
1999 3300047472 Ga0495686_0029770 Ga0495686_0029770_1756_2592 269
2000 3300047472 Ga0495686_0098577 Ga0495686_0098577_373_1209 269
2001 3300047472 Ga0495686_0101275 Ga0495686_0101275_331_1167 269
2002 3300047472 Ga0495686_0102627 Ga0495686_0102627_638_1474 269
2003 3300047673 Ga0495593_0000238 Ga0495593_0000238_19342_20178 269
2004 3300048088 Ga0495602_0054399 Ga0495602_0054399_1706_2542 269
2005 3300048088 Ga0495602_0088952 Ga0495602_0088952_297_1133 269
2006 3300048089 Ga0495614_0050431 Ga0495614_0050431_745_1581 269
2007 3300048091 Ga0495626_0043133 Ga0495626_0043133_570_1406 269
2008 3300048903 Ga0496100_0057279 Ga0496100_0057279_690_1526 269
2009 3300048903 Ga0496100_0420706 Ga0496100_0420706_71_880 269
2010 3300048905 Ga0496102_0001874 Ga0496102_0001874_5988_6824 269
2011 3300048905 Ga0496102_0014235 Ga0496102_0014235_3307_4143 269
2012 3300048905 Ga0496102_0023662 Ga0496102_0023662_2928_3764 269
2013 3300048905 Ga0496102_0027582 Ga0496102_0027582_1745_2554 269
2014 3300048905 Ga0496102_0063502 Ga0496102_0063502_2313_3149 269
2015 3300048905 Ga0496102_0068985 Ga0496102_0068985_883_1719 269
2016 3300048905 Ga0496102_0262361 Ga0496102_0262361_371_1180 269
2017 3300048905 Ga0496102_0519316 Ga0496102_0519316_18_854 269
2018 3300048906 Ga0496103_0005154 Ga0496103_0005154_3909_4745 269
2019 3300048906 Ga0496103_0013419 Ga0496103_0013419_140_949 269
2020 3300048906 Ga0496103_0091118 Ga0496103_0091118_271_1107 269
2021 3300048906 Ga0496103_0113947 Ga0496103_0113947_126_962 269
2022 3300048907 Ga0496104_0002350 Ga0496104_0002350_11112_11948 269
2023 3300048907 Ga0496104_0004135 Ga0496104_0004135_7776_8612 269
2024 3300048907 Ga0496104_0032406 Ga0496104_0032406_3680_4516 269
2025 3300048907 Ga0496104_0063581 Ga0496104_0063581_48_884 269
2026 3300048907 Ga0496104_0066816 Ga0496104_0066816_877_1713 269
2027 3300048907 Ga0496104_0086027 Ga0496104_0086027_1509_2345 269
2028 3300048907 Ga0496104_0109245 Ga0496104_0109245_1566_2375 269
2029 3300048907 Ga0496104_0513955 Ga0496104_0513955_108_944 269
2030 3300048908 Ga0496105_0005457 Ga0496105_0005457_8023_8859 269
2031 3300048908 Ga0496105_0006033 Ga0496105_0006033_4052_4888 269
2032 3300048908 Ga0496105_0031458 Ga0496105_0031458_2858_3694 269
2033 3300048908 Ga0496105_0037552 Ga0496105_0037552_1125_1961 269
2034 3300048908 Ga0496105_0051057 Ga0496105_0051057_387_1223 269
2035 3300048908 Ga0496105_0103946 Ga0496105_0103946_1352_2188 269
2036 3300048908 Ga0496105_0179667 Ga0496105_0179667_10_819 269
2037 3300048909 Ga0496106_0005572 Ga0496106_0005572_5643_6479 269
2038 3300048909 Ga0496106_0032730 Ga0496106_0032730_1171_2031 269
2039 3300048909 Ga0496106_0037383 Ga0496106_0037383_2765_3574 269
2040 3300048910 Ga0496107_0012285 Ga0496107_0012285_146_982 269
2041 3300048910 Ga0496107_0024590 Ga0496107_0024590_2875_3684 269
2042 3300048910 Ga0496107_0048206 Ga0496107_0048206_1103_1912 269
2043 3300048910 Ga0496107_0150166 Ga0496107_0150166_389_1225 269
2044 3300048911 Ga0496108_0004499 Ga0496108_0004499_828_1637 269
2045 3300048912 Ga0496109_0084752 Ga0496109_0084752_1435_2244 269
2046 3300048912 Ga0496109_0089390 Ga0496109_0089390_877_1713 269
2047 3300048912 Ga0496109_0092516 Ga0496109_0092516_782_1618 269
2048 3300048912 Ga0496109_0278350 Ga0496109_0278350_639_1475 269
2049 3300048912 Ga0496109_0311404 Ga0496109_0311404_246_1082 269
2050 3300048913 Ga0496110_0060294 Ga0496110_0060294_1167_2003 269
2051 3300048913 Ga0496110_0124160 Ga0496110_0124160_424_1233 269
2052 3300048913 Ga0496110_0140750 Ga0496110_0140750_977_1813 269
2053 3300048913 Ga0496110_0175342 Ga0496110_0175342_1024_1860 269
2054 3300048913 Ga0496110_0521775 Ga0496110_0521775_26_862 269
2055 3300048914 Ga0496111_0023618 Ga0496111_0023618_2681_3490 269
2056 3300048914 Ga0496111_0105454 Ga0496111_0105454_925_1761 269
2057 3300048914 Ga0496111_0197704 Ga0496111_0197704_422_1258 269
2058 3300048914 Ga0496111_0218049 Ga0496111_0218049_23_859 269
2059 3300048914 Ga0496111_0253803 Ga0496111_0253803_266_1102 269
2060 3300048915 Ga0496112_0000111 Ga0496112_0000111_15427_16263 269
2061 3300048915 Ga0496112_0033792 Ga0496112_0033792_3231_4067 269
2062 3300048915 Ga0496112_0036737 Ga0496112_0036737_34_870 269
2063 3300048915 Ga0496112_0042124 Ga0496112_0042124_2956_3765 269
2064 3300048915 Ga0496112_0077684 Ga0496112_0077684_856_1692 269
2065 3300048915 Ga0496112_0113093 Ga0496112_0113093_62_898 269
2066 3300048915 Ga0496112_0254947 Ga0496112_0254947_277_1113 269
2067 3300048915 Ga0496112_0369215 Ga0496112_0369215_270_1106 269
2068 3300048916 Ga0496113_0247281 Ga0496113_0247281_146_982 269
2069 3300048916 Ga0496113_0309761 Ga0496113_0309761_334_1170 269
2070 3300048916 Ga0496113_0318990 Ga0496113_0318990_20_856 269
2071 3300048917 Ga0496114_0000006 Ga0496114_0000006_460052_460861 269
2072 3300048917 Ga0496114_0010915 Ga0496114_0010915_2006_2815 269
2073 3300048917 Ga0496114_0015072 Ga0496114_0015072_5362_6198 269
2074 3300048917 Ga0496114_0050568 Ga0496114_0050568_651_1487 269
2075 3300048917 Ga0496114_0153699 Ga0496114_0153699_297_1133 269
2076 3300048918 Ga0496115_0065612 Ga0496115_0065612_266_1102 269
2077 3300048918 Ga0496115_0087107 Ga0496115_0087107_617_1453 269
2078 3300048918 Ga0496115_0105574 Ga0496115_0105574_649_1596 269
2079 3300048918 Ga0496115_0145985 Ga0496115_0145985_167_1003 269
2080 3300048918 Ga0496115_0152980 Ga0496115_0152980_888_1724 269
2081 3300048918 Ga0496115_0289354 Ga0496115_0289354_470_1306 269
2082 3300048918 Ga0496115_0365111 Ga0496115_0365111_330_1166 269
2083 3300048918 Ga0496115_0450644 Ga0496115_0450644_140_976 269
2084 3300048919 Ga0496116_0000520 Ga0496116_0000520_12289_13131 269
2085 3300048919 Ga0496116_0017386 Ga0496116_0017386_4108_4944 269
2086 3300048920 Ga0496117_0028383 Ga0496117_0028383_1400_2236 269
2087 3300048920 Ga0496117_0056829 Ga0496117_0056829_47_883 269
2088 3300048920 Ga0496117_0073645 Ga0496117_0073645_399_1235 269
2089 3300048920 Ga0496117_0178549 Ga0496117_0178549_338_1180 269
2090 3300048920 Ga0496117_0229023 Ga0496117_0229023_43_885 269
2091 3300048921 Ga0496118_0010974 Ga0496118_0010974_3520_4356 269
2092 3300048921 Ga0496118_0027793 Ga0496118_0027793_2278_3132 269
2093 3300048921 Ga0496118_0041819 Ga0496118_0041819_1490_2326 269
2094 3300048921 Ga0496118_0060350 Ga0496118_0060350_339_1181 269
2095 3300048921 Ga0496118_0109313 Ga0496118_0109313_259_1095 269
2096 3300048922 Ga0496119_0011955 Ga0496119_0011955_5814_6650 269
2097 3300048922 Ga0496119_0012495 Ga0496119_0012495_3423_4259 269
2098 3300048922 Ga0496119_0028314 Ga0496119_0028314_2794_3630 269
2099 3300048922 Ga0496119_0070076 Ga0496119_0070076_954_1790 269
2100 3300048923 Ga0496120_0061168 Ga0496120_0061168_1223_2059 269
2101 3300048924 Ga0496121_0001361 Ga0496121_0001361_19992_20828 269
2102 3300048924 Ga0496121_0001375 Ga0496121_0001375_22678_23574 269
2103 3300048924 Ga0496121_0009848 Ga0496121_0009848_4429_5265 269
2104 3300048924 Ga0496121_0010696 Ga0496121_0010696_9348_10190 269
2105 3300048924 Ga0496121_0024520 Ga0496121_0024520_4014_4850 269
2106 3300048924 Ga0496121_0029624 Ga0496121_0029624_463_1299 269
2107 3300048924 Ga0496121_0045348 Ga0496121_0045348_898_1734 269
2108 3300048924 Ga0496121_0053239 Ga0496121_0053239_995_1831 269
2109 3300048924 Ga0496121_0074732 Ga0496121_0074732_1855_2691 269
2110 3300048924 Ga0496121_0074837 Ga0496121_0074837_746_1582 269
2111 3300048924 Ga0496121_0105948 Ga0496121_0105948_324_1160 269
2112 3300048924 Ga0496121_0139284 Ga0496121_0139284_53_889 269
2113 3300048924 Ga0496121_0264212 Ga0496121_0264212_327_1163 269
2114 3300048925 Ga0496122_0000317 Ga0496122_0000317_674_1528 269
2115 3300048925 Ga0496122_0064643 Ga0496122_0064643_1676_2518 269
2116 3300048925 Ga0496122_0100311 Ga0496122_0100311_663_1499 269
2117 3300048926 Ga0496123_0000264 Ga0496123_0000264_69609_70463 269
2118 3300048926 Ga0496123_0044466 Ga0496123_0044466_798_1634 269
2119 3300048926 Ga0496123_0055971 Ga0496123_0055971_1651_2502 269
2120 3300048926 Ga0496123_0107425 Ga0496123_0107425_508_1350 269
2121 3300048927 Ga0496124_0010052 Ga0496124_0010052_3692_4528 269
2122 3300048927 Ga0496124_0030133 Ga0496124_0030133_2325_3161 269
2123 3300048927 Ga0496124_0067619 Ga0496124_0067619_982_1818 269
2124 3300048927 Ga0496124_0365101 Ga0496124_0365101_79_915 269
2125 3300048928 Ga0496125_0000202 Ga0496125_0000202_2729_3565 269
2126 3300048928 Ga0496125_0001999 Ga0496125_0001999_12199_13035 269
2127 3300048928 Ga0496125_0011066 Ga0496125_0011066_3662_4498 269
2128 3300048928 Ga0496125_0015391 Ga0496125_0015391_6287_7123 269
2129 3300048928 Ga0496125_0015510 Ga0496125_0015510_2949_3785 269
2130 3300048928 Ga0496125_0043334 Ga0496125_0043334_568_1422 269
2131 3300048928 Ga0496125_0115642 Ga0496125_0115642_354_1196 269
2132 3300048928 Ga0496125_0178586 Ga0496125_0178586_520_1356 269
2133 3300048928 Ga0496125_0208981 Ga0496125_0208981_253_1089 269
2134 3300048929 Ga0496126_0004835 Ga0496126_0004835_9699_10535 269
2135 3300048929 Ga0496126_0012757 Ga0496126_0012757_1115_1951 269
2136 3300048929 Ga0496126_0013430 Ga0496126_0013430_2467_3303 269
2137 3300048929 Ga0496126_0031523 Ga0496126_0031523_2447_3301 269
2138 3300048929 Ga0496126_0060578 Ga0496126_0060578_395_1231 269
2139 3300048929 Ga0496126_0076633 Ga0496126_0076633_1633_2469 269
2140 3300048929 Ga0496126_0086531 Ga0496126_0086531_586_1422 269
2141 3300048929 Ga0496126_0086623 Ga0496126_0086623_710_1546 269
2142 3300048929 Ga0496126_0087691 Ga0496126_0087691_1888_2730 269
2143 3300048929 Ga0496126_0109568 Ga0496126_0109568_395_1231 269
2144 3300048929 Ga0496126_0114059 Ga0496126_0114059_114_950 269
2145 3300048929 Ga0496126_0131831 Ga0496126_0131831_145_1005 269
2146 3300048929 Ga0496126_0175520 Ga0496126_0175520_429_1271 269
2147 3300048929 Ga0496126_0197717 Ga0496126_0197717_803_1639 269
2148 3300048929 Ga0496126_0250560 Ga0496126_0250560_161_997 269
2149 3300049460 Ga0495682_0009656 Ga0495682_0009656_911_1747 269
2150 3300049460 Ga0495682_0089185 Ga0495682_0089185_213_1049 269
2151 3300049568 Ga0501031_0001272 Ga0501031_0001272_2682_3518 269
2152 3300049568 Ga0501031_0009736 Ga0501031_0009736_601_1425 269
2153 3300049569 Ga0501032_0000257 Ga0501032_0000257_16642_17478 269
2154 3300049569 Ga0501032_0002207 Ga0501032_0002207_3673_4509 269
2155 3300049569 Ga0501032_0017662 Ga0501032_0017662_368_1192 269
2156 3300049570 Ga0501033_0000124 Ga0501033_0000124_10856_11692 269
2157 3300049570 Ga0501033_0000244 Ga0501033_0000244_878_1714 269
2158 3300049571 Ga0501034_0000159 Ga0501034_0000159_50518_51354 269
2159 3300049571 Ga0501034_0015413 Ga0501034_0015413_1124_1960 269
2160 3300049572 Ga0501036_0000039 Ga0501036_0000039_51551_52387 269
2161 3300049572 Ga0501036_0007815 Ga0501036_0007815_7100_7936 269
2162 3300049573 Ga0501037_0000247 Ga0501037_0000247_12606_13442 269
2163 3300049573 Ga0501037_0001386 Ga0501037_0001386_16302_17138 269
2164 3300049574 Ga0501038_0000041 Ga0501038_0000041_62376_63212 269
2165 3300049574 Ga0501038_0000207 Ga0501038_0000207_11780_12616 269
2166 3300049574 Ga0501038_0193738 Ga0501038_0193738_117_941 269
2167 3300049575 Ga0501039_0000064 Ga0501039_0000064_6450_7286 269
2168 3300049575 Ga0501039_0000148 Ga0501039_0000148_15058_15894 269
2169 3300049575 Ga0501039_0019776 Ga0501039_0019776_3009_3833 269
2170 3300049576 Ga0501040_0018578 Ga0501040_0018578_925_1749 269
2171 3300049578 Ga0501042_0026466 Ga0501042_0026466_671_1507 269
2172 3300049579 Ga0501043_0000202 Ga0501043_0000202_35418_36254 269
2173 3300049579 Ga0501043_0032864 Ga0501043_0032864_1023_1859 269
2174 3300049579 Ga0501043_0236760 Ga0501043_0236760_507_1379 269
2175 3300049580 Ga0501046_0000185 Ga0501046_0000185_9920_10756 269
2176 3300049580 Ga0501046_0063676 Ga0501046_0063676_1403_2239 269
2177 3300049580 Ga0501046_0224003 Ga0501046_0224003_480_1316 269
2178 3300049581 Ga0501047_0000288 Ga0501047_0000288_883_1719 269
2179 3300049581 Ga0501047_0000392 Ga0501047_0000392_29743_30579 269
2180 3300049581 Ga0501047_0002801 Ga0501047_0002801_4449_5285 269
2181 3300049582 Ga0501048_0000536 Ga0501048_0000536_17884_18720 269
2182 3300049582 Ga0501048_0074941 Ga0501048_0074941_867_1691 269
2183 3300049583 Ga0501067_0000896 Ga0501067_0000896_11914_12750 269
2184 3300049583 Ga0501067_0016856 Ga0501067_0016856_215_1051 269
2185 3300049583 Ga0501067_0065527 Ga0501067_0065527_32_868 269
2186 3300049584 Ga0501068_0002219 Ga0501068_0002219_2135_2971 269
2187 3300049584 Ga0501068_0009442 Ga0501068_0009442_628_1464 269
2188 3300049585 Ga0501069_0003631 Ga0501069_0003631_935_1771 269
2189 3300049585 Ga0501069_0017962 Ga0501069_0017962_818_1654 269
2190 3300049586 Ga0501070_0000175 Ga0501070_0000175_12519_13355 269
2191 3300049586 Ga0501070_0000557 Ga0501070_0000557_14865_15701 269
2192 3300049586 Ga0501070_0003774 Ga0501070_0003774_3348_4184 269
2193 3300049587 Ga0501071_0026378 Ga0501071_0026378_252_1088 269
2194 3300049587 Ga0501071_0306570 Ga0501071_0306570_309_1145 269
2195 3300049588 Ga0501072_0001033 Ga0501072_0001033_9051_9887 269
2196 3300049588 Ga0501072_0241408 Ga0501072_0241408_99_935 269
2197 3300049589 Ga0501073_0000034 Ga0501073_0000034_75833_76669 269
2198 3300049590 Ga0501074_0002163 Ga0501074_0002163_3441_4277 269
2199 3300049590 Ga0501074_0014736 Ga0501074_0014736_3820_4656 269
2200 3300049590 Ga0501074_0067981 Ga0501074_0067981_1413_2249 269
2201 3300049592 Ga0501076_0003638 Ga0501076_0003638_5214_6038 269
2202 3300049592 Ga0501076_0184579 Ga0501076_0184579_576_1412 269
2203 3300049679 Ga0501249_004258 Ga0501249_004258_1545_2354 269
2204 3300049741 Ga0501079_0000773 Ga0501079_0000773_14307_15143 269
2205 3300049741 Ga0501079_0165115 Ga0501079_0165115_710_1546 269
2206 3300049741 Ga0501079_0321504 Ga0501079_0321504_16_852 269
2207 3300049742 Ga0501080_0000805 Ga0501080_0000805_916_1752 269
2208 3300049742 Ga0501080_0001103 Ga0501080_0001103_15672_16508 269
2209 3300049742 Ga0501080_0190860 Ga0501080_0190860_969_1787 269
2210 3300049742 Ga0501080_0213623 Ga0501080_0213623_237_1073 269
2211 3300049743 Ga0501081_0028882 Ga0501081_0028882_2530_3354 269
2212 3300049744 Ga0501083_0000118 Ga0501083_0000118_34794_35630 269
2213 3300049822 Ga0501035_0000137 Ga0501035_0000137_18184_19020 269
2214 3300049822 Ga0501035_0000155 Ga0501035_0000155_43586_44422 269
2215 3300049822 Ga0501035_0013576 Ga0501035_0013576_1200_2024 269
2216 3300049822 Ga0501035_0185462 Ga0501035_0185462_581_1417 269
2217 3300049823 Ga0501044_0000393 Ga0501044_0000393_48381_49217 269
2218 3300049823 Ga0501044_0000431 Ga0501044_0000431_49950_50786 269
2219 3300049823 Ga0501044_0043652 Ga0501044_0043652_2456_3280 269
2220 3300049823 Ga0501044_0184415 Ga0501044_0184415_111_947 269
2221 3300049824 Ga0501045_0005484 Ga0501045_0005484_2212_3036 269
2222 3300049824 Ga0501045_0011293 Ga0501045_0011293_2187_3023 269
2223 3300049824 Ga0501045_0370025 Ga0501045_0370025_21_851 269
2224 3300050489 nmdc:mga03683_18717_c1 nmdc:mga03683_18717_c1_1003_1839 269
2225 3300050489 nmdc:mga03683_79709_c1 nmdc:mga03683_79709_c1_226_1062 269
2226 3300050490 nmdc:mga03n38_11501_c1 nmdc:mga03n38_11501_c1_1187_2041 269
2227 3300050491 nmdc:mga00v17_47706_c1 nmdc:mga00v17_47706_c1_916_1752 269
2228 3300050491 nmdc:mga00v17_49102_c1 nmdc:mga00v17_49102_c1_1038_1874 269
2229 3300050491 nmdc:mga00v17_5677_c1 nmdc:mga00v17_5677_c1_5726_6568 269
2230 3300050492 nmdc:mga0yw44_10115_c1 nmdc:mga0yw44_10115_c1_2174_3010 269
2231 3300050492 nmdc:mga0yw44_49878_c1 nmdc:mga0yw44_49878_c1_1361_2197 269
2232 3300050492 nmdc:mga0yw44_87100_c1 nmdc:mga0yw44_87100_c1_860_1702 269
2233 3300050493 nmdc:mga0k408_26106_c1 nmdc:mga0k408_26106_c1_2272_3126 269
2234 3300050493 nmdc:mga0k408_72426_c1 nmdc:mga0k408_72426_c1_53_889 269
2235 3300050493 nmdc:mga0k408_97542_c1 nmdc:mga0k408_97542_c1_828_1664 269
2236 3300050494 nmdc:mga06z11_140673_c1 nmdc:mga06z11_140673_c1_463_1299 269
2237 3300050494 nmdc:mga06z11_269336_c1 nmdc:mga06z11_269336_c1_16_852 269
2238 3300050494 nmdc:mga06z11_5709_c1 nmdc:mga06z11_5709_c1_135_971 269
2239 3300050494 nmdc:mga06z11_5831_c1 nmdc:mga06z11_5831_c1_3911_4747 269
2240 3300050494 nmdc:mga06z11_62884_c1 nmdc:mga06z11_62884_c1_608_1450 269
2241 3300050496 nmdc:mga07m45_26891_c1 nmdc:mga07m45_26891_c1_333_1169 269
2242 3300050496 nmdc:mga07m45_7680_c1 nmdc:mga07m45_7680_c1_1225_2061 269
2243 3300050507 nmdc:mga05p37_296873_c1 nmdc:mga05p37_296873_c1_433_1269 269
2244 3300050508 nmdc:mga09592_347162_c1 nmdc:mga09592_347162_c1_445_1254 269
2245 3300050510 nmdc:mga06r32_8345_c1 nmdc:mga06r32_8345_c1_3554_4363 269
2246 3300050511 nmdc:mga08y16_210988_c1 nmdc:mga08y16_210988_c1_729_1538 269
2247 3300050511 nmdc:mga08y16_93500_c1 nmdc:mga08y16_93500_c1_1023_1832 269
2248 3300050512 nmdc:mga0n895_262777_c1 nmdc:mga0n895_262777_c1_610_1419 269
2249 3300050513 nmdc:mga0rr50_108497_c1 nmdc:mga0rr50_108497_c1_53_889 269
2250 3300050513 nmdc:mga0rr50_59994_c1 nmdc:mga0rr50_59994_c1_328_1194 269
2251 3300050515 nmdc:mga0a205_29441_c1 nmdc:mga0a205_29441_c1_1852_2661 269
2252 3300050516 nmdc:mga0sz30_15323_c1 nmdc:mga0sz30_15323_c1_898_1734 269
2253 3300050516 nmdc:mga0sz30_3996_c1 nmdc:mga0sz30_3996_c1_1586_2422 269
2254 3300053077 Ga0495601_0296932 Ga0495601_0296932_75_911 269
2255 3300053078 Ga0495612_0034855 Ga0495612_0034855_1111_1947 269
2256 3300053078 Ga0495612_0079508 Ga0495612_0079508_225_1061 269
2257 3300053083 Ga0495655_0054562 Ga0495655_0054562_173_982 269
2258 3300053084 Ga0495595_0070503 Ga0495595_0070503_126_962 269
2259 3300053085 Ga0495619_0015826 Ga0495619_0015826_2645_3481 269
2260 3300053085 Ga0495619_0048033 Ga0495619_0048033_807_1643 269
2261 3300053085 Ga0495619_0127345 Ga0495619_0127345_317_1180 269
2262 3300053086 Ga0500578_0028483 Ga0500578_0028483_141_977 269
2263 3300053087 Ga0500643_000037 Ga0500643_000037_105329_106165 269
2264 3300053087 Ga0500643_027503 Ga0500643_027503_16_852 269
2265 3300053090 Ga0500646_0011894 Ga0500646_0011894_456_1298 269
2266 3300053093 Ga0500651_0001199 Ga0500651_0001199_3706_4542 269
2267 3300053093 Ga0500651_0080305 Ga0500651_0080305_1032_1874 269
2268 3300053094 Ga0500566_0000166 Ga0500566_0000166_18458_19294 269
2269 3300053094 Ga0500566_0001772 Ga0500566_0001772_1460_2296 269
2270 3300053094 Ga0500566_0002306 Ga0500566_0002306_5228_6079 269
2271 3300053094 Ga0500566_0085084 Ga0500566_0085084_867_1703 269
2272 3300053094 Ga0500566_0100525 Ga0500566_0100525_465_1301 269
2273 3300053095 Ga0500640_047604 Ga0500640_047604_790_1626 269
2274 3300053096 Ga0500641_0025121 Ga0500641_0025121_1361_2203 269
2275 3300053096 Ga0500641_0156289 Ga0500641_0156289_10_846 269
2276 3300053102 Ga0500554_000266 Ga0500554_000266_8741_9577 269
2277 3300053103 Ga0500555_000550 Ga0500555_000550_10307_11143 269
2278 3300053104 Ga0500556_0000089 Ga0500556_0000089_17058_17900 269
2279 3300053105 Ga0500557_000047 Ga0500557_000047_11619_12455 269
2280 3300053108 Ga0500562_003706 Ga0500562_003706_551_1387 269
2281 3300053111 Ga0500572_000614 Ga0500572_000614_5227_6063 269
2282 3300053111 Ga0500572_007111 Ga0500572_007111_842_1678 269
2283 3300053119 Ga0500595_000891 Ga0500595_000891_1482_2318 269
2284 3300053119 Ga0500595_002669 Ga0500595_002669_1238_2074 269
2285 3300053119 Ga0500595_004982 Ga0500595_004982_3783_4619 269
2286 3300053119 Ga0500595_007131 Ga0500595_007131_3760_4641 269
2287 3300053121 Ga0500607_009772 Ga0500607_009772_2860_3696 269
2288 3300053122 Ga0500608_000206 Ga0500608_000206_10958_11809 269
2289 3300053128 Ga0500626_064744 Ga0500626_064744_469_1305 269
2290 3300053130 Ga0500642_0000050 Ga0500642_0000050_71054_71896 269
2291 3300053130 Ga0500642_0000071 Ga0500642_0000071_19521_20357 269
2292 3300053131 Ga0500652_009694 Ga0500652_009694_454_1296 269
2293 3300053133 Ga0500655_004071 Ga0500655_004071_984_1820 269
2294 3300053134 Ga0500658_0023361 Ga0500658_0023361_608_1444 269
2295 3300053134 Ga0500658_0091606 Ga0500658_0091606_351_1187 269
2296 3300053134 Ga0500658_0213137 Ga0500658_0213137_20_862 269
2297 3300053136 Ga0500559_0000136 Ga0500559_0000136_39601_40452 269
2298 3300053136 Ga0500559_0001651 Ga0500559_0001651_8744_9577 269
2299 3300053136 Ga0500559_0002659 Ga0500559_0002659_260_1096 269
2300 3300053136 Ga0500559_0008736 Ga0500559_0008736_1255_2109 269
2301 3300053139 Ga0500568_0021334 Ga0500568_0021334_945_1781 269
2302 3300053139 Ga0500568_0026208 Ga0500568_0026208_904_1740 269
2303 3300053139 Ga0500568_0101520 Ga0500568_0101520_194_1030 269
2304 3300053140 Ga0500573_0120136 Ga0500573_0120136_350_1186 269
2305 3300053142 Ga0500577_0000632 Ga0500577_0000632_3655_4491 269
2306 3300053142 Ga0500577_0081718 Ga0500577_0081718_308_1144 269
2307 3300053147 Ga0500589_091596 Ga0500589_091596_25_861 269
2308 3300053150 Ga0500603_001014 Ga0500603_001014_2780_3616 269
2309 3300053150 Ga0500603_008704 Ga0500603_008704_73_909 269
2310 3300053151 Ga0500604_0017071 Ga0500604_0017071_309_1145 269
2311 3300053151 Ga0500604_0113034 Ga0500604_0113034_27_863 269
2312 3300053153 Ga0500616_0000026 Ga0500616_0000026_70980_71822 269
2313 3300053156 Ga0500622_0001149 Ga0500622_0001149_4598_5440 269
2314 3300053156 Ga0500622_0001752 Ga0500622_0001752_712_1548 269
2315 3300053156 Ga0500622_0134081 Ga0500622_0134081_115_951 269
2316 3300053160 Ga0500633_0004613 Ga0500633_0004613_2322_3158 269
2317 3300053162 Ga0500638_023402 Ga0500638_023402_1430_2266 269
2318 3300053162 Ga0500638_051323 Ga0500638_051323_173_1009 269
2319 3300053162 Ga0500638_078689 Ga0500638_078689_501_1337 269
2320 3300053177 Ga0500636_0000880 Ga0500636_0000880_12249_13100 269
2321 3300053177 Ga0500636_0002910 Ga0500636_0002910_4201_5037 269
2322 3300053177 Ga0500636_0023543 Ga0500636_0023543_660_1496 269
2323 3300053177 Ga0500636_0094499 Ga0500636_0094499_496_1332 269
2324 3300053177 Ga0500636_0167953 Ga0500636_0167953_294_1130 269
2325 3300053178 Ga0500637_0000240 Ga0500637_0000240_1484_2320 269
2326 3300053178 Ga0500637_0000582 Ga0500637_0000582_12934_13770 269
2327 3300053178 Ga0500637_0159389 Ga0500637_0159389_197_1048 269
2328 3300053178 Ga0500637_0197576 Ga0500637_0197576_145_981 269
2329 3300053729 Ga0500625_001064 Ga0500625_001064_2680_3516 269
2330 3300053730 Ga0500645_071404 Ga0500645_071404_54_890 269
2331 3300053735 Ga0500596_001425 Ga0500596_001425_918_1754 269
2332 3300053735 Ga0500596_016115 Ga0500596_016115_130_966 269
2333 3300053737 Ga0500601_000014 Ga0500601_000014_24011_24847 269
2334 3300054114 Ga0501084_0002041 Ga0501084_0002041_14531_15367 269
2335 3300055283 Ga0500661_003063 Ga0500661_003063_895_1731 269
2336 3300055283 Ga0500661_015619 Ga0500661_015619_185_1021 269
2337 3300060353 Ga0501082_0002604 Ga0501082_0002604_4454_5290 269
2338 3300060353 Ga0501082_0013466 Ga0501082_0013466_1072_1890 269
2339 3300061719 Ga0466962_0067511 Ga0466962_0067511_225_1034 269
2340 iso_pu_bacteria 2547132374 2548499503 269
2341 iso_pu_bacteria 2599185214 2599621953 269
2342 iso_pu_bacteria 2599185226 2599676883 269
2343 iso_pu_bacteria 2599185227 2599685145 269
2344 iso_pu_bacteria 2599185229 2599691463 269
2345 iso_pu_bacteria 2602042107 2603862518 269
2346 iso_pu_bacteria 2643221570 2643866332 269
2347 iso_pu_bacteria 2643221596 2643994320 269
2348 iso_pu_bacteria 2643221611 2644072492 269
2349 iso_pu_bacteria 2643221652 2644293153 269
2350 iso_pu_bacteria 2643221717 2644648167 269
2351 iso_pu_bacteria 2721755523 2722883059 269
2352 iso_pu_bacteria 2818991446 2819598028 269
2353 iso_pu_bacteria 2831265667 2831269018 269
2354 iso_pu_bacteria 2838054893 2838058444 269
2355 iso_pu_bacteria 2842733646 2842737871 269
2356 iso_pu_bacteria 2842747753 2842752769 269
2357 iso_pu_bacteria 2857524615 2857529858 269
2358 iso_pu_bacteria 2885198086 2885203815 269
2359 iso_pu_bacteria 2885211737 2885217850 269
2360 iso_pu_bacteria 2893066018 2893069495 269
2361 iso_pu_bacteria 2899924645 2899929447 269
2362 iso_pu_bacteria 2904449895 2904451061 269
2363 iso_pu_bacteria 2919073203 2919077286 269
2364 iso_pu_bacteria 2928037797 2928040109 269
2365 iso_pu_bacteria 2928044640 2928047142 269
2366 iso_pu_bacteria 2928051484 2928057655 269
2367 iso_pu_bacteria 2928064002 2928067963 269
2368 iso_pu_bacteria 2928070936 2928072536 269
2369 iso_pu_bacteria 2990710928 2990714387 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

28

126

0.96

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

125

259

0.92

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

23

132

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g64-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from streptomyces coelicolor a3(2) 0.9668 7 269
6sla-assembly2.cif.gz_FFF crystal structure of isomerase paag mutant - d136n with oxepin-coa 0.9526 13 269
3hrx-assembly2.cif.gz_F crystal structure of phenylacetic acid degradation protein paag 0.9521 13 269
5zai-assembly1.cif.gz_D crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula 0.9514 8 268
5zai-assembly1.cif.gz_D crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula 0.9478 8 268
ID Description Score Start End Superfamily
3hrxA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9818 212 269 1.10.12.10
3hrxE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.981 212 269 1.10.12.10
3gowE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9808 212 269 1.10.12.10
3hrxC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9799 212 269 1.10.12.10
3hrxB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9799 212 269 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A7G9L0R4-F1-model_v4 Enoyl-CoA hydratase family protein 0.9979 1 269 GO:0003824
AF-A0A7H0LG70-F1-model_v4 Enoyl-CoA hydratase family protein 0.9975 3 269 GO:0003824
AF-A0A533J185-F1-model_v4 deleted 0.9966 6 158
AF-A0A0D6T924-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9961 6 269 GO:0004300
AF-A0A5C6YAY1-F1-model_v4 deleted 0.9956 6 269

Feature Viewer

pLDDT pTM Quality
95.9 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map