F496715

General Info

Members Datasets Scaffolds Average Seq Length
2348 622 2341 95

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0028759|Ga0495626_0028759_920_1273
Length 117
Sequence MRRSSGRVAPLSRLERASREPIMSTPNIQLWEVFIRSRNGLAHKHVGSLHAADAALAMQAARDIYTRRGEGLSIWIVPSDTIVASDPAEKDMMFEPALSKIYRHPTFYDVPDEVGHM

Samples

Sample ID Description Type Environment
1 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
2 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
3 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
4 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
5 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
113 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
114 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
115 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
119 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
120 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
137 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
138 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
163 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
164 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
165 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
166 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
167 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
168 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
169 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
170 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
171 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
252 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
253 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
254 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
257 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
259 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
263 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
264 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
265 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
266 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
267 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
268 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
269 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
270 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
271 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
272 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
273 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
276 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
277 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
278 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
279 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
280 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
281 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
282 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
283 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
284 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
285 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
286 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
289 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
292 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
293 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
294 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
295 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
296 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
297 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
298 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
299 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
300 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
301 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
302 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
303 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
304 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
305 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
307 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
308 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
309 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
310 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
311 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
312 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
313 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
314 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
315 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
316 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
318 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
320 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
321 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
322 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
323 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
324 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
325 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
326 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
327 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
328 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
329 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
330 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
331 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
332 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
333 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
334 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
335 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
336 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
337 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
342 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
343 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
348 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
349 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
350 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
351 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
352 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
353 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
354 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
355 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
356 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
357 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
358 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
359 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
360 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
361 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
362 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
363 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
364 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
365 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
366 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
367 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
368 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
369 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
370 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
371 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
372 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
373 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
374 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
375 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
376 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
377 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
378 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
379 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
380 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
381 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
382 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
383 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
384 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
385 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
386 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
387 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
390 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
391 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
392 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
393 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
394 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
395 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
396 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
397 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
398 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
399 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
400 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
401 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
402 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
403 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
404 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
405 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
406 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
407 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
408 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
409 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
410 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
411 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
412 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
413 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
414 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
415 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
416 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
417 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
418 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
419 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
420 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
421 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
422 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
423 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
424 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
425 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
426 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
427 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
428 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
429 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
430 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
431 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
432 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
433 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
434 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
435 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
436 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
437 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
438 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
439 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
440 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
441 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
442 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
443 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
444 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
445 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
446 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
447 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
448 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
449 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
450 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
451 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
452 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
453 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
454 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
455 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
456 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
457 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
458 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
459 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
460 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
461 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
462 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
463 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
464 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
465 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
466 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
467 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
468 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
469 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
470 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
471 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
472 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
473 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
474 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
475 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
476 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
477 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
478 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
479 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
480 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
481 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
482 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
483 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
484 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
485 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
486 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
487 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
488 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
489 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
490 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
491 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
492 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
493 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
494 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
495 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
496 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
497 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
498 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
499 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
500 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
501 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
502 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
503 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
504 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
505 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
506 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
507 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
512 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
522 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
523 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
524 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
525 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
526 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
527 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
528 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
529 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
530 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
531 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
532 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
533 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
536 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
537 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
538 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
539 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
540 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
541 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
542 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
543 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
544 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
545 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
546 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
547 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
548 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
549 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
550 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
551 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
552 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
553 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
554 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
555 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
556 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
557 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
558 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
559 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
560 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
561 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
562 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
563 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
564 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
565 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
566 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
567 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
568 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
569 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
570 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
571 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
572 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
573 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
574 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
575 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
576 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
577 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
578 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
579 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
580 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
581 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
582 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
583 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
584 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
585 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
586 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
587 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
588 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
589 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
590 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
591 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
592 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
593 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
594 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
595 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
596 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
597 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
598 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
599 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
600 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
601 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
602 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
603 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
604 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
605 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
606 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
607 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
608 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
609 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
610 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
611 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
612 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
613 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
614 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
615 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
616 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
617 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
618 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
619 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
620 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
621 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
622 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.85
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.8
Nodule 1.28
Rhizoplane 4.94
Rhizosphere 72.96
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10137440 3300001989 Bacteria 725
2 JGI24739J22299_10153996 3300001989 Bacteria 679
3 JGI24744J21845_10058285 3300002077 Bacteria 707
4 JGI25151J46595_10000400 3300003187 Bacteria 45092
5 JGI25406J46586_10000223 3300003203 Bacteria 25081
6 JGI25406J46586_10197763 3300003203 Bacteria 587
7 JGI25165J46597_1018105 3300003214 Bacteria 933
8 JGI25165J46597_1018157 3300003214 Bacteria 932
9 JGI25153J46596_10002250 3300003215 Bacteria 11239
10 JGI25153J46596_10005183 3300003215 Bacteria 6862
11 JGI25153J46596_10009625 3300003215 Bacteria 4459
12 JGI25153J46596_10033053 3300003215 Bacteria 1714
13 JGI25153J46596_10083309 3300003215 Bacteria 791
14 JGI25153J46596_10132788 3300003215 Bacteria 549
15 JGI25160J50197_1001031 3300003354 Bacteria 14412
16 JGI25160J50197_1002951 3300003354 Bacteria 7774
17 JGI25160J50197_1003809 3300003354 Bacteria 6634
18 JGI25160J50197_1033199 3300003354 Bacteria 1301
19 JGI25404J52841_10018418 3300003659 Bacteria 1514
20 JGI25404J52841_10039011 3300003659 Bacteria 1007
21 JGI25404J52841_10043338 3300003659 Bacteria 951
22 JGI25404J52841_10103902 3300003659 Bacteria 596
23 Ga0055539_1009825 3300003752 Bacteria 1186
24 Ga0055525_1014312 3300003759 Bacteria 671
25 Ga0055543_1001737 3300004625 Bacteria 8164
26 Ga0055543_1030721 3300004625 Bacteria 939
27 Ga0065165_1001202 3300005262 Bacteria 29912
28 Ga0065165_1001214 3300005262 Bacteria 29682
29 Ga0065165_1010203 3300005262 Bacteria 4095
30 Ga0065165_1016608 3300005262 Bacteria 2748
31 Ga0065704_10499915 3300005289 Bacteria 668
32 Ga0065715_10554396 3300005293 Bacteria 738
33 Ga0065715_11083940 3300005293 Bacteria 524
34 Ga0070658_10008337 3300005327 Bacteria 8336
35 Ga0070658_10056829 3300005327 Bacteria 3182
36 Ga0070658_10178655 3300005327 Bacteria 1786
37 Ga0070658_10216137 3300005327 Bacteria 1620
38 Ga0070658_10220782 3300005327 Bacteria 1603
39 Ga0070658_10449289 3300005327 Bacteria 1110
40 Ga0070676_10766281 3300005328 Bacteria 710
41 Ga0070683_100084930 3300005329 Bacteria 2966
42 Ga0070683_100175583 3300005329 Bacteria 2033
43 Ga0070683_100383832 3300005329 Bacteria 1339
44 Ga0070683_102238862 3300005329 Bacteria 524
45 Ga0070690_100213139 3300005330 Bacteria 1350
46 Ga0070690_101227197 3300005330 Bacteria 599
47 Ga0070690_101752381 3300005330 Bacteria 506
48 Ga0070670_100165454 3300005331 Bacteria 1917
49 Ga0070670_100545962 3300005331 Bacteria 1034
50 Ga0070670_100555217 3300005331 Bacteria 1025
51 Ga0068869_100287231 3300005334 Bacteria 1324
52 Ga0068869_100588601 3300005334 Bacteria 938
53 Ga0070666_11018057 3300005335 Bacteria 615
54 Ga0070680_100011788 3300005336 Bacteria 6780
55 Ga0070680_100023435 3300005336 Bacteria 4923
56 Ga0070680_100077214 3300005336 Bacteria 2743
57 Ga0070680_100089684 3300005336 Bacteria 2544
58 Ga0070680_100098481 3300005336 Bacteria 2425
59 Ga0070680_100351827 3300005336 Bacteria 1253
60 Ga0070680_101177156 3300005336 Bacteria 663
61 Ga0070682_100395483 3300005337 Bacteria 1044
62 Ga0070682_100398207 3300005337 Bacteria 1040
63 Ga0068868_100125691 3300005338 Bacteria 2095
64 Ga0068868_100293702 3300005338 Bacteria 1378
65 Ga0068868_100419382 3300005338 Bacteria 1159
66 Ga0068868_100708660 3300005338 Bacteria 901
67 Ga0068868_101526768 3300005338 Bacteria 626
68 Ga0068868_102241871 3300005338 Bacteria 520
69 Ga0070660_100211196 3300005339 Bacteria 1576
70 Ga0070660_100472476 3300005339 Bacteria 1042
71 Ga0070660_100506271 3300005339 Bacteria 1005
72 Ga0070660_100889098 3300005339 Bacteria 751
73 Ga0070660_101343463 3300005339 Bacteria 607
74 Ga0070689_100138724 3300005340 Bacteria 1954
75 Ga0070689_100682566 3300005340 Bacteria 895
76 Ga0070689_100928744 3300005340 Bacteria 771
77 Ga0070691_10180554 3300005341 Bacteria 1099
78 Ga0070691_10527195 3300005341 Bacteria 687
79 Ga0070687_101454545 3300005343 Bacteria 514
80 Ga0070661_100186261 3300005344 Bacteria 1581
81 Ga0070661_100244193 3300005344 Bacteria 1384
82 Ga0070661_100508865 3300005344 Bacteria 965
83 Ga0070661_100704798 3300005344 Bacteria 823
84 Ga0070661_100721953 3300005344 Bacteria 813
85 Ga0070661_101598199 3300005344 Bacteria 551
86 Ga0070692_11322557 3300005345 Bacteria 518
87 Ga0070668_100022289 3300005347 Bacteria 4787
88 Ga0070668_100093371 3300005347 Bacteria 2374
89 Ga0070668_100129427 3300005347 Bacteria 2025
90 Ga0070668_100244859 3300005347 Bacteria 1486
91 Ga0070668_100438041 3300005347 Bacteria 1121
92 Ga0070668_100994013 3300005347 Bacteria 754
93 Ga0070668_101041772 3300005347 Bacteria 737
94 Ga0070675_100624114 3300005354 Bacteria 979
95 Ga0070675_100775116 3300005354 Bacteria 876
96 Ga0070675_100902134 3300005354 Bacteria 810
97 Ga0070671_100085639 3300005355 Bacteria 2637
98 Ga0070671_100834292 3300005355 Bacteria 803
99 Ga0070674_100046094 3300005356 Bacteria 2981
100 Ga0070674_100318216 3300005356 Bacteria 1246
101 Ga0070674_100760330 3300005356 Bacteria 833
102 Ga0070674_101724832 3300005356 Bacteria 567
103 Ga0070673_100646714 3300005364 Bacteria 968
104 Ga0070659_100076811 3300005366 Bacteria 2663
105 Ga0070659_100107474 3300005366 Bacteria 2250
106 Ga0070659_100128341 3300005366 Bacteria 2058
107 Ga0070659_100133379 3300005366 Bacteria 2018
108 Ga0070659_101063687 3300005366 Bacteria 712
109 Ga0070667_100037701 3300005367 Bacteria 4052
110 Ga0070667_100507733 3300005367 Bacteria 1106
111 Ga0070667_100558528 3300005367 Bacteria 1052
112 Ga0070667_100761933 3300005367 Bacteria 898
113 Ga0070667_102120081 3300005367 Bacteria 530
114 Ga0070709_10000748 3300005434 Bacteria 18362
115 Ga0070709_10002033 3300005434 Bacteria 10982
116 Ga0070709_10006994 3300005434 Bacteria 6165
117 Ga0070709_10017477 3300005434 Bacteria 4115
118 Ga0070709_10028748 3300005434 Bacteria 3319
119 Ga0070709_10120786 3300005434 Bacteria 1776
120 Ga0070709_10344992 3300005434 Bacteria 1099
121 Ga0070709_11695730 3300005434 Bacteria 516
122 Ga0070714_100003573 3300005435 Bacteria 11628
123 Ga0070714_100011382 3300005435 Bacteria 7058
124 Ga0070714_100107256 3300005435 Bacteria 2468
125 Ga0070714_100288020 3300005435 Bacteria 1528
126 Ga0070714_100487140 3300005435 Bacteria 1175
127 Ga0070714_100617729 3300005435 Bacteria 1042
128 Ga0070714_100824767 3300005435 Bacteria 899
129 Ga0070714_100997887 3300005435 Bacteria 815
130 Ga0070714_101192209 3300005435 Bacteria 743
131 Ga0070714_101772680 3300005435 Bacteria 603
132 Ga0070713_100046189 3300005436 Bacteria 3572
133 Ga0070713_100078828 3300005436 Bacteria 2805
134 Ga0070713_100102249 3300005436 Bacteria 2485
135 Ga0070713_100854741 3300005436 Bacteria 874
136 Ga0070713_101394107 3300005436 Bacteria 680
137 Ga0070713_101560269 3300005436 Bacteria 641
138 Ga0070713_101565392 3300005436 Bacteria 640
139 Ga0070710_10002333 3300005437 Bacteria 8983
140 Ga0070710_10043234 3300005437 Bacteria 2494
141 Ga0070710_11180735 3300005437 Bacteria 565
142 Ga0070701_10345787 3300005438 Bacteria 927
143 Ga0070701_11084904 3300005438 Bacteria 563
144 Ga0070711_100003247 3300005439 Bacteria 9446
145 Ga0070711_100006251 3300005439 Bacteria 7171
146 Ga0070711_100024755 3300005439 Bacteria 3920
147 Ga0070711_100109445 3300005439 Bacteria 2026
148 Ga0070711_100354309 3300005439 Bacteria 1181
149 Ga0070711_100383161 3300005439 Bacteria 1137
150 Ga0070711_100415590 3300005439 Bacteria 1095
151 Ga0070711_101305610 3300005439 Bacteria 630
152 Ga0070711_101866430 3300005439 Bacteria 528
153 Ga0070700_100421228 3300005441 Bacteria 1009
154 Ga0070700_101732274 3300005441 Bacteria 537
155 Ga0070694_100324648 3300005444 Bacteria 1185
156 Ga0070663_100007024 3300005455 Bacteria 6822
157 Ga0070663_100075171 3300005455 Bacteria 2468
158 Ga0070663_100123171 3300005455 Bacteria 1961
159 Ga0070663_100151133 3300005455 Bacteria 1780
160 Ga0070663_100170149 3300005455 Bacteria 1683
161 Ga0070663_100406839 3300005455 Bacteria 1113
162 Ga0070663_100421315 3300005455 Bacteria 1095
163 Ga0070663_100457169 3300005455 Bacteria 1053
164 Ga0070663_100538191 3300005455 Bacteria 974
165 Ga0070663_100759602 3300005455 Bacteria 828
166 Ga0070663_100865727 3300005455 Bacteria 779
167 Ga0070663_100914448 3300005455 Bacteria 759
168 Ga0070663_100984186 3300005455 Bacteria 732
169 Ga0070663_100984238 3300005455 Bacteria 732
170 Ga0070663_101062059 3300005455 Bacteria 706
171 Ga0070678_100045513 3300005456 Bacteria 3141
172 Ga0070678_100050698 3300005456 Bacteria 3005
173 Ga0070678_100102038 3300005456 Bacteria 2225
174 Ga0070678_100268259 3300005456 Bacteria 1438
175 Ga0070678_100516893 3300005456 Bacteria 1056
176 Ga0070678_100595396 3300005456 Bacteria 986
177 Ga0070678_101413263 3300005456 Bacteria 650
178 Ga0070662_100116191 3300005457 Bacteria 2044
179 Ga0070662_100182170 3300005457 Bacteria 1656
180 Ga0070662_100337282 3300005457 Bacteria 1232
181 Ga0070662_100447595 3300005457 Bacteria 1072
182 Ga0070662_100497276 3300005457 Bacteria 1017
183 Ga0070681_10000756 3300005458 Bacteria 26836
184 Ga0070681_10008357 3300005458 Bacteria 10139
185 Ga0070681_10054611 3300005458 Bacteria 3981
186 Ga0070681_10148647 3300005458 Bacteria 2270
187 Ga0070681_10170337 3300005458 Bacteria 2099
188 Ga0070681_10717460 3300005458 Bacteria 916
189 Ga0070681_10743173 3300005458 Bacteria 897
190 Ga0070681_10795598 3300005458 Bacteria 863
191 Ga0068867_100253916 3300005459 Bacteria 1431
192 Ga0068867_100268187 3300005459 Bacteria 1394
193 Ga0068867_100457672 3300005459 Bacteria 1089
194 Ga0068867_100908653 3300005459 Bacteria 793
195 Ga0068867_101231143 3300005459 Bacteria 689
196 Ga0070685_11294156 3300005466 Bacteria 557
197 Ga0070706_100313408 3300005467 Bacteria 1463
198 Ga0070707_100738374 3300005468 Bacteria 948
199 Ga0070707_100870007 3300005468 Bacteria 865
200 Ga0070698_101008894 3300005471 Bacteria 780
201 Ga0070698_101188355 3300005471 Bacteria 712
202 Ga0070698_101764411 3300005471 Bacteria 571
203 Ga0070699_100375677 3300005518 Bacteria 1283
204 Ga0070679_100012531 3300005530 Bacteria 8109
205 Ga0070679_100030670 3300005530 Bacteria 5310
206 Ga0070679_100036615 3300005530 Bacteria 4870
207 Ga0070679_100147944 3300005530 Bacteria 2326
208 Ga0070679_100216296 3300005530 Bacteria 1878
209 Ga0070679_100220982 3300005530 Bacteria 1855
210 Ga0070679_100273498 3300005530 Bacteria 1643
211 Ga0070679_100536413 3300005530 Bacteria 1114
212 Ga0070679_100708797 3300005530 Bacteria 949
213 Ga0070679_100838304 3300005530 Bacteria 863
214 Ga0070679_101624332 3300005530 Bacteria 594
215 Ga0070684_100050418 3300005535 Bacteria 3615
216 Ga0070684_100460469 3300005535 Bacteria 1176
217 Ga0070684_100907112 3300005535 Bacteria 826
218 Ga0070697_100005182 3300005536 Bacteria 10015
219 Ga0070697_100273428 3300005536 Bacteria 1448
220 Ga0070697_100631395 3300005536 Bacteria 943
221 Ga0070697_101763293 3300005536 Bacteria 554
222 Ga0068853_100022507 3300005539 Bacteria 5264
223 Ga0068853_100254169 3300005539 Bacteria 1613
224 Ga0068853_100319636 3300005539 Bacteria 1439
225 Ga0068853_100330343 3300005539 Bacteria 1415
226 Ga0068853_100413788 3300005539 Bacteria 1263
227 Ga0068853_100460016 3300005539 Bacteria 1197
228 Ga0068853_101423286 3300005539 Bacteria 671
229 Ga0070672_100333137 3300005543 Bacteria 1291
230 Ga0070672_100630186 3300005543 Bacteria 935
231 Ga0070672_100805542 3300005543 Bacteria 827
232 Ga0070672_101005708 3300005543 Bacteria 739
233 Ga0070686_100969823 3300005544 Bacteria 695
234 Ga0070695_101477690 3300005545 Bacteria 565
235 Ga0070696_100801664 3300005546 Bacteria 775
236 Ga0070665_100027464 3300005548 Bacteria 5733
237 Ga0070665_100129523 3300005548 Bacteria 2525
238 Ga0070665_100283924 3300005548 Bacteria 1657
239 Ga0070665_100640988 3300005548 Bacteria 1075
240 Ga0070665_100647485 3300005548 Bacteria 1070
241 Ga0070665_101140986 3300005548 Bacteria 791
242 Ga0070704_100546244 3300005549 Bacteria 1012
243 Ga0068855_100010153 3300005563 Bacteria 11349
244 Ga0068855_100048449 3300005563 Bacteria 5014
245 Ga0068855_100075449 3300005563 Bacteria 3915
246 Ga0068855_100192460 3300005563 Bacteria 2300
247 Ga0068855_100219146 3300005563 Bacteria 2135
248 Ga0068855_100287043 3300005563 Bacteria 1825
249 Ga0068855_100425349 3300005563 Bacteria 1452
250 Ga0068855_100544188 3300005563 Bacteria 1257
251 Ga0068855_101672513 3300005563 Bacteria 650
252 Ga0068855_101798686 3300005563 Bacteria 623
253 Ga0068855_102484732 3300005563 Bacteria 516
254 Ga0070664_100993749 3300005564 Bacteria 788
255 Ga0070664_101259493 3300005564 Bacteria 698
256 Ga0068857_100013829 3300005577 Bacteria 7028
257 Ga0068857_100124560 3300005577 Bacteria 2322
258 Ga0068857_100256345 3300005577 Bacteria 1605
259 Ga0068857_100317228 3300005577 Bacteria 1439
260 Ga0068857_100570412 3300005577 Bacteria 1067
261 Ga0068854_100047130 3300005578 Bacteria 3071
262 Ga0068854_100471208 3300005578 Bacteria 1053
263 Ga0068854_100549238 3300005578 Bacteria 979
264 Ga0068854_100621365 3300005578 Bacteria 925
265 Ga0068854_102092201 3300005578 Bacteria 523
266 Ga0068856_100000340 3300005614 Bacteria 51206
267 Ga0068856_100075874 3300005614 Bacteria 3330
268 Ga0068856_100113257 3300005614 Bacteria 2711
269 Ga0068856_100203464 3300005614 Bacteria 1994
270 Ga0068856_100354560 3300005614 Bacteria 1486
271 Ga0068856_100494682 3300005614 Bacteria 1244
272 Ga0068856_100915719 3300005614 Bacteria 895
273 Ga0068856_101106271 3300005614 Bacteria 810
274 Ga0070702_100080642 3300005615 Bacteria 1948
275 Ga0070702_100225166 3300005615 Bacteria 1257
276 Ga0070702_100425654 3300005615 Bacteria 956
277 Ga0068852_100014563 3300005616 Bacteria 6060
278 Ga0068852_100100234 3300005616 Bacteria 2613
279 Ga0068852_100159857 3300005616 Bacteria 2103
280 Ga0068852_100167378 3300005616 Bacteria 2058
281 Ga0068852_100224058 3300005616 Bacteria 1789
282 Ga0068852_100960876 3300005616 Bacteria 872
283 Ga0068852_101583076 3300005616 Bacteria 678
284 Ga0068859_100347740 3300005617 Bacteria 1577
285 Ga0068859_101305315 3300005617 Bacteria 800
286 Ga0068859_101651415 3300005617 Bacteria 708
287 Ga0068859_102701238 3300005617 Bacteria 546
288 Ga0068864_100409756 3300005618 Bacteria 1289
289 Ga0068864_100794424 3300005618 Bacteria 930
290 Ga0068864_101270967 3300005618 Bacteria 736
291 Ga0068864_101292076 3300005618 Bacteria 730
292 Ga0068864_101993556 3300005618 Bacteria 587
293 Ga0068866_10452753 3300005718 Bacteria 840
294 Ga0068866_10624114 3300005718 Bacteria 731
295 Ga0068861_100315399 3300005719 Bacteria 1360
296 Ga0068861_100887357 3300005719 Bacteria 843
297 Ga0068861_102040221 3300005719 Bacteria 573
298 Ga0068851_10587199 3300005834 Bacteria 677
299 Ga0068863_100816119 3300005841 Bacteria 931
300 Ga0068863_101244247 3300005841 Bacteria 751
301 Ga0068858_100572140 3300005842 Bacteria 1095
302 Ga0068858_100820858 3300005842 Bacteria 907
303 Ga0068858_101687583 3300005842 Bacteria 626
304 Ga0068860_100000081 3300005843 Bacteria 170066
305 Ga0068860_100350657 3300005843 Bacteria 1452
306 Ga0068860_101174553 3300005843 Bacteria 788
307 Ga0068860_101707118 3300005843 Bacteria 652
308 Ga0068862_100054213 3300005844 Bacteria 3433
309 Ga0068862_100073298 3300005844 Bacteria 2959
310 Ga0068862_100520820 3300005844 Bacteria 1131
311 Ga0068862_100732229 3300005844 Bacteria 960
312 Ga0068862_101239374 3300005844 Bacteria 745
313 Ga0068862_101424671 3300005844 Bacteria 697
314 Ga0081455_10013421 3300005937 Bacteria 8099
315 Ga0081455_10032257 3300005937 Bacteria 4723
316 Ga0081455_10052827 3300005937 Bacteria 3476
317 Ga0081455_10105945 3300005937 Bacteria 2246
318 Ga0081455_10444013 3300005937 Bacteria 888
319 Ga0081455_10832608 3300005937 Bacteria 577
320 Ga0081538_10170423 3300005981 Bacteria 951
321 Ga0081540_1002354 3300005983 Bacteria 15445
322 Ga0081540_1002428 3300005983 Bacteria 15177
323 Ga0081540_1008459 3300005983 Bacteria 7186
324 Ga0081540_1010807 3300005983 Bacteria 6137
325 Ga0081540_1013331 3300005983 Bacteria 5350
326 Ga0081540_1014134 3300005983 Bacteria 5137
327 Ga0081540_1029188 3300005983 Bacteria 3079
328 Ga0081540_1093850 3300005983 Bacteria 1313
329 Ga0081540_1108413 3300005983 Bacteria 1180
330 Ga0081540_1164047 3300005983 Bacteria 857
331 Ga0081539_10000325 3300005985 Bacteria 106431
332 Ga0081539_10000542 3300005985 Bacteria 78012
333 Ga0081539_10025073 3300005985 Bacteria 3852
334 Ga0081539_10066123 3300005985 Bacteria 1961
335 Ga0081539_10069341 3300005985 Bacteria 1898
336 Ga0081539_10104265 3300005985 Bacteria 1440
337 Ga0081539_10233968 3300005985 Bacteria 827
338 Ga0070717_10005461 3300006028 Bacteria 9284
339 Ga0070717_10189257 3300006028 Bacteria 1798
340 Ga0070717_10606682 3300006028 Bacteria 993
341 Ga0070717_10634117 3300006028 Bacteria 970
342 Ga0070717_11030212 3300006028 Bacteria 750
343 Ga0070717_11114569 3300006028 Bacteria 719
344 Ga0070717_12134168 3300006028 Bacteria 504
345 Ga0075365_10008590 3300006038 Bacteria 5814
346 Ga0075365_10065483 3300006038 Bacteria 2436
347 Ga0075365_10077673 3300006038 Bacteria 2243
348 Ga0075365_10189495 3300006038 Bacteria 1439
349 Ga0075365_10207139 3300006038 Bacteria 1375
350 Ga0075365_10250937 3300006038 Bacteria 1243
351 Ga0075365_10304064 3300006038 Bacteria 1123
352 Ga0075365_10310726 3300006038 Bacteria 1110
353 Ga0075365_10449816 3300006038 Bacteria 909
354 Ga0075365_10489071 3300006038 Bacteria 869
355 Ga0075365_10635043 3300006038 Bacteria 755
356 Ga0075365_10653026 3300006038 Bacteria 743
357 Ga0075365_11040824 3300006038 Bacteria 576
358 Ga0075365_11053910 3300006038 Bacteria 573
359 Ga0075368_10006026 3300006042 Bacteria 4208
360 Ga0075368_10037555 3300006042 Bacteria 1894
361 Ga0075368_10109003 3300006042 Bacteria 1140
362 Ga0075368_10139292 3300006042 Bacteria 1011
363 Ga0075368_10462685 3300006042 Bacteria 563
364 Ga0075363_100004003 3300006048 Bacteria 6374
365 Ga0075363_100015710 3300006048 Bacteria 3727
366 Ga0075363_100152885 3300006048 Bacteria 1303
367 Ga0075363_100195882 3300006048 Bacteria 1153
368 Ga0075363_100216567 3300006048 Bacteria 1097
369 Ga0075363_100273078 3300006048 Bacteria 977
370 Ga0075363_100317081 3300006048 Bacteria 907
371 Ga0075363_100342231 3300006048 Bacteria 872
372 Ga0075364_10022884 3300006051 Bacteria 3951
373 Ga0075364_10308479 3300006051 Bacteria 1078
374 Ga0075364_10351469 3300006051 Bacteria 1005
375 Ga0075364_10515384 3300006051 Bacteria 817
376 Ga0075364_10531962 3300006051 Bacteria 803
377 Ga0070715_10110095 3300006163 Bacteria 1298
378 Ga0070715_10515534 3300006163 Bacteria 687
379 Ga0070716_100009609 3300006173 Bacteria 4823
380 Ga0070716_100099708 3300006173 Bacteria 1778
381 Ga0070716_100144601 3300006173 Bacteria 1522
382 Ga0070716_100389351 3300006173 Bacteria 999
383 Ga0070716_100471783 3300006173 Bacteria 920
384 Ga0070716_100527933 3300006173 Bacteria 876
385 Ga0070716_100569244 3300006173 Bacteria 848
386 Ga0070716_101160450 3300006173 Bacteria 619
387 Ga0070712_100006504 3300006175 Bacteria 7252
388 Ga0070712_100074012 3300006175 Bacteria 2445
389 Ga0070712_100246370 3300006175 Bacteria 1426
390 Ga0070712_100281888 3300006175 Bacteria 1339
391 Ga0070712_100532078 3300006175 Bacteria 988
392 Ga0070712_100562569 3300006175 Bacteria 962
393 Ga0070712_100798349 3300006175 Bacteria 810
394 Ga0070712_101198350 3300006175 Bacteria 660
395 Ga0070712_101596607 3300006175 Bacteria 570
396 Ga0070712_101638495 3300006175 Bacteria 563
397 Ga0075362_10039169 3300006177 Bacteria 2083
398 Ga0075362_10267786 3300006177 Bacteria 843
399 Ga0075362_10472788 3300006177 Bacteria 639
400 Ga0075362_10604979 3300006177 Bacteria 567
401 Ga0075362_10702168 3300006177 Bacteria 528
402 Ga0075367_10016373 3300006178 Bacteria 4049
403 Ga0075367_10058054 3300006178 Bacteria 2302
404 Ga0075367_10124748 3300006178 Bacteria 1588
405 Ga0075367_10504827 3300006178 Bacteria 767
406 Ga0075367_10649780 3300006178 Bacteria 671
407 Ga0075367_11039215 3300006178 Bacteria 523
408 Ga0075369_10038578 3300006186 Bacteria 2038
409 Ga0075369_10122681 3300006186 Bacteria 1177
410 Ga0075369_10161588 3300006186 Bacteria 1027
411 Ga0075369_10171839 3300006186 Bacteria 995
412 Ga0075369_10269993 3300006186 Bacteria 791
413 Ga0075369_10317145 3300006186 Bacteria 729
414 Ga0075369_10409480 3300006186 Bacteria 640
415 Ga0075366_10058783 3300006195 Bacteria 2284
416 Ga0075366_10062965 3300006195 Bacteria 2204
417 Ga0075366_10160204 3300006195 Bacteria 1363
418 Ga0075366_10254526 3300006195 Bacteria 1071
419 Ga0075366_10363193 3300006195 Bacteria 889
420 Ga0097621_100056702 3300006237 Bacteria 3201
421 Ga0097621_100283553 3300006237 Bacteria 1459
422 Ga0097621_100472158 3300006237 Bacteria 1133
423 Ga0097621_100988935 3300006237 Bacteria 787
424 Ga0097621_101625336 3300006237 Bacteria 614
425 Ga0075370_10060035 3300006353 Bacteria 2166
426 Ga0075370_10124127 3300006353 Bacteria 1504
427 Ga0075370_10141541 3300006353 Bacteria 1406
428 Ga0075370_10226482 3300006353 Bacteria 1106
429 Ga0075370_10400055 3300006353 Bacteria 824
430 Ga0075370_10405839 3300006353 Bacteria 818
431 Ga0075370_10478990 3300006353 Bacteria 750
432 Ga0075370_10814524 3300006353 Bacteria 569
433 Ga0068871_100091873 3300006358 Bacteria 2530
434 Ga0068871_100464125 3300006358 Bacteria 1137
435 Ga0068871_100947686 3300006358 Bacteria 800
436 Ga0068871_101419648 3300006358 Bacteria 655
437 Ga0075428_100096364 3300006844 Bacteria 3224
438 Ga0075428_100446122 3300006844 Bacteria 1386
439 Ga0075428_101088806 3300006844 Bacteria 844
440 Ga0075433_11576114 3300006852 Bacteria 567
441 Ga0075434_100005333 3300006871 Bacteria 11699
442 Ga0075434_100629591 3300006871 Bacteria 1091
443 Ga0068865_100204573 3300006881 Bacteria 1535
444 Ga0068865_100578433 3300006881 Bacteria 947
445 Ga0075436_100035523 3300006914 Bacteria 3438
446 Ga0075436_101316059 3300006914 Bacteria 547
447 Ga0097620_100347751 3300006931 Bacteria 1577
448 Ga0097620_101305335 3300006931 Bacteria 800
449 Ga0097620_101651560 3300006931 Bacteria 708
450 Ga0097620_102701186 3300006931 Bacteria 546
451 Ga0099825_1058498 3300006941 Bacteria 692
452 Ga0099824_1006123 3300006942 Bacteria 16665
453 Ga0099824_1015027 3300006942 Bacteria 7484
454 Ga0099822_1000072 3300006943 Bacteria 55118
455 Ga0099823_1039314 3300006944 Bacteria 3481
456 Ga0075435_100071016 3300007076 Bacteria 2843
457 Ga0075435_100264652 3300007076 Bacteria 1465
458 Ga0075435_101297087 3300007076 Bacteria 638
459 Ga0099794_10686510 3300007265 Bacteria 545
460 Ga0099794_10716427 3300007265 Bacteria 533
461 Ga0105251_10340629 3300009011 Bacteria 683
462 Ga0105251_10383622 3300009011 Bacteria 644
463 Ga0105251_10533368 3300009011 Bacteria 551
464 Ga0105244_10280143 3300009036 Bacteria 773
465 Ga0105250_10371574 3300009092 Bacteria 629
466 Ga0105240_10083219 3300009093 Bacteria 3927
467 Ga0105240_10184089 3300009093 Bacteria 2462
468 Ga0105240_10188232 3300009093 Bacteria 2429
469 Ga0105240_10238997 3300009093 Bacteria 2107
470 Ga0105240_10347679 3300009093 Bacteria 1683
471 Ga0105240_10420605 3300009093 Bacteria 1501
472 Ga0105240_10435122 3300009093 Bacteria 1471
473 Ga0105240_10617448 3300009093 Bacteria 1192
474 Ga0105240_11617902 3300009093 Bacteria 677
475 Ga0111539_10293929 3300009094 Bacteria 1890
476 Ga0111539_10314106 3300009094 Bacteria 1824
477 Ga0111539_12760663 3300009094 Bacteria 569
478 Ga0105245_10086519 3300009098 Bacteria 2875
479 Ga0105245_10577399 3300009098 Bacteria 1148
480 Ga0105245_11425993 3300009098 Bacteria 743
481 Ga0105245_12407030 3300009098 Bacteria 580
482 Ga0105245_12583568 3300009098 Bacteria 561
483 Ga0105247_10064250 3300009101 Bacteria 2280
484 Ga0105247_10098814 3300009101 Bacteria 1863
485 Ga0105247_10304643 3300009101 Bacteria 1106
486 Ga0105247_10716879 3300009101 Bacteria 754
487 Ga0114129_10162673 3300009147 Bacteria 3047
488 Ga0114129_13099982 3300009147 Bacteria 543
489 Ga0105243_10379502 3300009148 Bacteria 1307
490 Ga0105243_10863823 3300009148 Bacteria 897
491 Ga0105243_11241377 3300009148 Bacteria 760
492 Ga0105243_12155312 3300009148 Bacteria 594
493 Ga0105243_12700209 3300009148 Bacteria 537
494 Ga0105241_10216483 3300009174 Bacteria 1607
495 Ga0105241_10446986 3300009174 Bacteria 1143
496 Ga0105241_11041489 3300009174 Bacteria 768
497 Ga0105241_11698003 3300009174 Bacteria 613
498 Ga0105242_10214177 3300009176 Bacteria 1718
499 Ga0105242_11692003 3300009176 Bacteria 669
500 Ga0105242_12001271 3300009176 Bacteria 622
501 Ga0105248_10142516 3300009177 Bacteria 2704
502 Ga0105248_10216665 3300009177 Bacteria 2156
503 Ga0105248_10557501 3300009177 Bacteria 1293
504 Ga0105248_10677101 3300009177 Bacteria 1164
505 Ga0105248_10993800 3300009177 Bacteria 948
506 Ga0105248_11230502 3300009177 Bacteria 847
507 Ga0105248_11591241 3300009177 Bacteria 740
508 Ga0105248_12181415 3300009177 Bacteria 630
509 Ga0105248_12610820 3300009177 Bacteria 576
510 Ga0105237_10005969 3300009545 Bacteria 13645
511 Ga0105237_10006335 3300009545 Bacteria 13154
512 Ga0105237_10037729 3300009545 Bacteria 4883
513 Ga0105237_10092892 3300009545 Bacteria 3007
514 Ga0105237_10162288 3300009545 Bacteria 2233
515 Ga0105237_10372045 3300009545 Bacteria 1434
516 Ga0105237_10492788 3300009545 Bacteria 1232
517 Ga0105237_10511176 3300009545 Bacteria 1208
518 Ga0105237_10576665 3300009545 Bacteria 1132
519 Ga0105237_10852278 3300009545 Bacteria 918
520 Ga0105237_11103107 3300009545 Bacteria 800
521 Ga0105237_11319100 3300009545 Bacteria 728
522 Ga0105237_11390331 3300009545 Bacteria 708
523 Ga0105237_11425095 3300009545 Bacteria 699
524 Ga0105238_10045743 3300009551 Bacteria 4421
525 Ga0105238_10086686 3300009551 Bacteria 3118
526 Ga0105238_10132700 3300009551 Bacteria 2469
527 Ga0105238_10136516 3300009551 Bacteria 2430
528 Ga0105238_10187781 3300009551 Bacteria 2043
529 Ga0105238_10206708 3300009551 Bacteria 1939
530 Ga0105238_10310323 3300009551 Bacteria 1562
531 Ga0105238_10575966 3300009551 Bacteria 1132
532 Ga0105238_10868338 3300009551 Bacteria 920
533 Ga0105238_11139302 3300009551 Bacteria 803
534 Ga0105238_12030915 3300009551 Bacteria 609
535 Ga0105249_10796532 3300009553 Bacteria 1009
536 Ga0105249_11350377 3300009553 Bacteria 784
537 Ga0105249_11523904 3300009553 Bacteria 741
538 Ga0105249_12211402 3300009553 Bacteria 623
539 Ga0105249_12410703 3300009553 Bacteria 599
540 Ga0105249_12868960 3300009553 Bacteria 553
541 Ga0099796_10027046 3300010159 Bacteria 1828
542 Ga0099796_10090015 3300010159 Bacteria 1139
543 Ga0099796_10238471 3300010159 Bacteria 751
544 Ga0099796_10266264 3300010159 Bacteria 716
545 Ga0105239_10000300 3300010375 Bacteria 73306
546 Ga0105239_10340595 3300010375 Bacteria 1692
547 Ga0105239_10554999 3300010375 Bacteria 1308
548 Ga0105239_10604438 3300010375 Bacteria 1251
549 Ga0105239_10947648 3300010375 Bacteria 989
550 Ga0105239_11132942 3300010375 Bacteria 901
551 Ga0105239_11210327 3300010375 Bacteria 870
552 Ga0105239_11989357 3300010375 Bacteria 675
553 Ga0105246_10150907 3300011119 Bacteria 1759
554 Ga0105246_10219047 3300011119 Bacteria 1491
555 Ga0105246_10375485 3300011119 Bacteria 1173
556 Ga0105246_10459642 3300011119 Bacteria 1072
557 Ga0105246_10721264 3300011119 Bacteria 876
558 Ga0105246_10826820 3300011119 Bacteria 824
559 Ga0105246_10980116 3300011119 Bacteria 764
560 Ga0105246_11057461 3300011119 Bacteria 738
561 Ga0105246_11243634 3300011119 Bacteria 687
562 Ga0105246_11247255 3300011119 Bacteria 686
563 Ga0105246_12340320 3300011119 Bacteria 523
564 Ga0157328_1008626 3300012478 Bacteria 670
565 Ga0157341_1014278 3300012494 Bacteria 719
566 Ga0157326_1066558 3300012513 Bacteria 562
567 Ga0157373_10185813 3300013100 Bacteria 1464
568 Ga0157373_11048397 3300013100 Bacteria 610
569 Ga0157373_11174213 3300013100 Bacteria 578
570 Ga0157371_10014591 3300013102 Bacteria 5923
571 Ga0157371_10138267 3300013102 Bacteria 1735
572 Ga0157371_10542384 3300013102 Bacteria 862
573 Ga0157370_10064604 3300013104 Bacteria 3464
574 Ga0157370_10157550 3300013104 Bacteria 2113
575 Ga0157370_10407177 3300013104 Bacteria 1252
576 Ga0157370_10508295 3300013104 Bacteria 1106
577 Ga0157370_11013138 3300013104 Bacteria 751
578 Ga0157369_10013821 3300013105 Bacteria 9125
579 Ga0157369_10015377 3300013105 Bacteria 8628
580 Ga0157369_10016472 3300013105 Bacteria 8313
581 Ga0157369_10079236 3300013105 Bacteria 3518
582 Ga0157369_10577391 3300013105 Bacteria 1161
583 Ga0157369_10612235 3300013105 Bacteria 1124
584 Ga0157369_10940007 3300013105 Bacteria 886
585 Ga0157369_11149840 3300013105 Bacteria 793
586 Ga0157374_10090035 3300013296 Bacteria 2924
587 Ga0157374_10221916 3300013296 Bacteria 1855
588 Ga0157374_11333834 3300013296 Bacteria 740
589 Ga0157378_10015018 3300013297 Bacteria 6779
590 Ga0157378_10053685 3300013297 Bacteria 3588
591 Ga0157378_10245170 3300013297 Bacteria 1713
592 Ga0157378_10580012 3300013297 Bacteria 1130
593 Ga0157378_10809430 3300013297 Bacteria 963
594 Ga0157378_11755731 3300013297 Bacteria 668
595 Ga0157378_12681153 3300013297 Bacteria 551
596 Ga0157378_13238719 3300013297 Bacteria 506
597 Ga0163162_10017977 3300013306 Bacteria 6919
598 Ga0163162_10146711 3300013306 Bacteria 2476
599 Ga0163162_10555763 3300013306 Bacteria 1276
600 Ga0163162_10911632 3300013306 Bacteria 992
601 Ga0163162_11530010 3300013306 Bacteria 760
602 Ga0163162_11930074 3300013306 Bacteria 676
603 Ga0163162_12134259 3300013306 Bacteria 643
604 Ga0157372_10082303 3300013307 Bacteria 3644
605 Ga0157372_10356625 3300013307 Bacteria 1704
606 Ga0157372_10470931 3300013307 Bacteria 1464
607 Ga0157372_11055295 3300013307 Bacteria 940
608 Ga0157372_12197328 3300013307 Bacteria 634
609 Ga0157375_11115363 3300013308 Bacteria 924
610 Ga0157375_11569157 3300013308 Bacteria 778
611 Ga0157375_11661407 3300013308 Bacteria 756
612 Ga0157375_12188957 3300013308 Bacteria 659
613 Ga0163163_10008335 3300014325 Bacteria 9203
614 Ga0163163_10081274 3300014325 Bacteria 3242
615 Ga0163163_10098156 3300014325 Bacteria 2950
616 Ga0163163_10320053 3300014325 Bacteria 1605
617 Ga0163163_10597566 3300014325 Bacteria 1167
618 Ga0163163_10931455 3300014325 Bacteria 932
619 Ga0157380_10589137 3300014326 Bacteria 1098
620 Ga0157380_10946878 3300014326 Bacteria 891
621 Ga0157380_11228917 3300014326 Bacteria 794
622 Ga0157380_11713645 3300014326 Bacteria 686
623 Ga0157380_11793569 3300014326 Bacteria 673
624 Ga0182008_10451200 3300014497 Bacteria 699
625 Ga0182008_10557601 3300014497 Bacteria 637
626 Ga0182008_10720084 3300014497 Bacteria 572
627 Ga0157377_10697727 3300014745 Bacteria 736
628 Ga0157377_10741474 3300014745 Bacteria 718
629 Ga0157379_10341724 3300014968 Bacteria 1369
630 Ga0157379_10686585 3300014968 Bacteria 960
631 Ga0157379_11006762 3300014968 Bacteria 795
632 Ga0157376_11359720 3300014969 Bacteria 741
633 Ga0157376_11391074 3300014969 Bacteria 733
634 Ga0157376_11496398 3300014969 Bacteria 708
635 Ga0157376_12156236 3300014969 Bacteria 596
636 Ga0157376_12272841 3300014969 Bacteria 581
637 Ga0157376_12467873 3300014969 Bacteria 559
638 Ga0182007_10344024 3300015262 Bacteria 558
639 Ga0163161_10325654 3300017792 Bacteria 1216
640 Ga0163161_11662578 3300017792 Bacteria 565
641 Ga0197907_10271294 3300020069 Bacteria 653
642 Ga0206356_10577626 3300020070 Bacteria 1284
643 Ga0206356_11213340 3300020070 Bacteria 550
644 Ga0206352_10294202 3300020078 Bacteria 539
645 Ga0206350_10075550 3300020080 Bacteria 598
646 Ga0206350_10286740 3300020080 Bacteria 654
647 Ga0206350_11409165 3300020080 Bacteria 1112
648 Ga0206354_10618544 3300020081 Bacteria 829
649 Ga0206353_10237312 3300020082 Bacteria 550
650 Ga0206353_10370279 3300020082 Bacteria 2694
651 Ga0206353_10529886 3300020082 Bacteria 790
652 Ga0214544_1000001 3300021320 Bacteria 783667
653 Ga0214544_1031159 3300021320 Bacteria 1781
654 Ga0214542_1000037 3300021321 Bacteria 159256
655 Ga0214542_1030806 3300021321 Bacteria 2051
656 Ga0214542_1033003 3300021321 Bacteria 1782
657 Ga0214545_1000003 3300021324 Bacteria 720274
658 Ga0214545_1026887 3300021324 Bacteria 3026
659 Ga0214543_1002913 3300021327 Bacteria 33625
660 Ga0214543_1040381 3300021327 Bacteria 1247
661 Ga0213873_10009061 3300021358 Bacteria 2054
662 Ga0213872_10087542 3300021361 Bacteria 1395
663 Ga0213872_10124231 3300021361 Bacteria 1140
664 Ga0213872_10360902 3300021361 Bacteria 595
665 Ga0213874_10068430 3300021377 Bacteria 1127
666 Ga0213876_10099344 3300021384 Bacteria 1543
667 Ga0213876_10188074 3300021384 Bacteria 1098
668 Ga0213876_10240480 3300021384 Bacteria 962
669 Ga0213876_10247865 3300021384 Bacteria 947
670 Ga0213875_10029011 3300021388 Bacteria 2623
671 Ga0213875_10229605 3300021388 Bacteria 874
672 Ga0213875_10417102 3300021388 Bacteria 641
673 Ga0213871_10005326 3300021441 Bacteria 2643
674 Ga0213871_10045747 3300021441 Bacteria 1187
675 Ga0224712_10045861 3300022467 Bacteria 1675
676 Ga0224712_10071680 3300022467 Bacteria 1408
677 Ga0224712_10199616 3300022467 Bacteria 909
678 Ga0224712_10223100 3300022467 Bacteria 863
679 Ga0209563_102616 3300025230 Bacteria 3993
680 Ga0209677_100864 3300025253 Bacteria 14950
681 Ga0209677_102633 3300025253 Bacteria 6522
682 Ga0209148_1000347 3300025254 Bacteria 60370
683 Ga0209148_1022300 3300025254 Bacteria 1019
684 Ga0209233_1004395 3300025261 Bacteria 4801
685 Ga0209233_1019537 3300025261 Bacteria 1799
686 Ga0209233_1053869 3300025261 Bacteria 805
687 Ga0209455_1002846 3300025272 Bacteria 6418
688 Ga0209455_1005515 3300025272 Bacteria 3893
689 Ga0209455_1005697 3300025272 Bacteria 3799
690 Ga0209455_1024703 3300025272 Bacteria 1106
691 Ga0209673_1031606 3300025273 Bacteria 1644
692 Ga0209025_1000486 3300025294 Bacteria 76804
693 Ga0209564_1005446 3300025295 Bacteria 7272
694 Ga0209564_1032247 3300025295 Bacteria 1582
695 Ga0209564_1092614 3300025295 Bacteria 548
696 Ga0209758_1000133 3300025297 Bacteria 182442
697 Ga0209758_1000651 3300025297 Bacteria 52531
698 Ga0209758_1002089 3300025297 Bacteria 21240
699 Ga0209758_1003759 3300025297 Bacteria 13424
700 Ga0209758_1004578 3300025297 Bacteria 11395
701 Ga0209758_1004997 3300025297 Bacteria 10594
702 Ga0209758_1008659 3300025297 Bacteria 6529
703 Ga0209758_1023499 3300025297 Bacteria 2786
704 Ga0209758_1029337 3300025297 Bacteria 2303
705 Ga0209256_1009928 3300025299 Bacteria 4084
706 Ga0209256_1046417 3300025299 Bacteria 1074
707 Ga0207426_1000270 3300025302 Bacteria 108404
708 Ga0207426_1000800 3300025302 Bacteria 34038
709 Ga0207426_1004676 3300025302 Bacteria 6574
710 Ga0207426_1049446 3300025302 Bacteria 1258
711 Ga0207426_1131110 3300025302 Bacteria 607
712 Ga0207426_1148845 3300025302 Bacteria 548
713 Ga0209257_1023146 3300025304 Bacteria 2193
714 Ga0209257_1027855 3300025304 Bacteria 1871
715 Ga0207656_10414096 3300025321 Bacteria 678
716 Ga0207696_1146367 3300025711 Bacteria 632
717 Ga0207682_10382504 3300025893 Bacteria 664
718 Ga0207692_10000987 3300025898 Bacteria 10377
719 Ga0207692_10019898 3300025898 Bacteria 3043
720 Ga0207642_10060594 3300025899 Bacteria 1756
721 Ga0207642_10378936 3300025899 Bacteria 841
722 Ga0207642_11030183 3300025899 Bacteria 531
723 Ga0207710_10067814 3300025900 Bacteria 1630
724 Ga0207710_10152690 3300025900 Bacteria 1121
725 Ga0207710_10256688 3300025900 Bacteria 875
726 Ga0207688_10019453 3300025901 Bacteria 3701
727 Ga0207688_10245375 3300025901 Bacteria 1084
728 Ga0207680_11180892 3300025903 Bacteria 546
729 Ga0207647_10012647 3300025904 Bacteria 5866
730 Ga0207647_10077264 3300025904 Bacteria 2001
731 Ga0207647_10330299 3300025904 Bacteria 865
732 Ga0207647_10547975 3300025904 Bacteria 642
733 Ga0207685_10052756 3300025905 Bacteria 1576
734 Ga0207699_10000435 3300025906 Bacteria 21275
735 Ga0207699_10022841 3300025906 Bacteria 3396
736 Ga0207699_10029636 3300025906 Bacteria 3054
737 Ga0207699_10117630 3300025906 Bacteria 1714
738 Ga0207699_10340137 3300025906 Bacteria 1057
739 Ga0207699_10491816 3300025906 Bacteria 885
740 Ga0207699_10572272 3300025906 Bacteria 821
741 Ga0207645_10652023 3300025907 Bacteria 715
742 Ga0207643_10174369 3300025908 Bacteria 1299
743 Ga0207705_10013516 3300025909 Bacteria 5891
744 Ga0207705_10107292 3300025909 Bacteria 2060
745 Ga0207705_10178360 3300025909 Bacteria 1602
746 Ga0207705_10332922 3300025909 Bacteria 1168
747 Ga0207705_10333617 3300025909 Bacteria 1167
748 Ga0207705_10388613 3300025909 Bacteria 1078
749 Ga0207705_10439968 3300025909 Bacteria 1010
750 Ga0207705_10966201 3300025909 Bacteria 659
751 Ga0207684_10040661 3300025910 Bacteria 3941
752 Ga0207684_10668253 3300025910 Bacteria 884
753 Ga0207684_11045812 3300025910 Bacteria 681
754 Ga0207654_10120875 3300025911 Bacteria 1644
755 Ga0207654_10143535 3300025911 Bacteria 1525
756 Ga0207654_10627977 3300025911 Bacteria 768
757 Ga0207654_10984678 3300025911 Bacteria 613
758 Ga0207654_11404905 3300025911 Bacteria 509
759 Ga0207707_10000605 3300025912 Bacteria 36107
760 Ga0207707_10021006 3300025912 Bacteria 5703
761 Ga0207707_10072757 3300025912 Bacteria 2996
762 Ga0207707_10081043 3300025912 Bacteria 2833
763 Ga0207707_10114428 3300025912 Bacteria 2357
764 Ga0207707_10298934 3300025912 Bacteria 1392
765 Ga0207707_10955521 3300025912 Bacteria 705
766 Ga0207707_11121845 3300025912 Bacteria 640
767 Ga0207695_10000008 3300025913 Bacteria 1058268
768 Ga0207695_10087874 3300025913 Bacteria 3130
769 Ga0207695_10109794 3300025913 Bacteria 2739
770 Ga0207695_10122066 3300025913 Bacteria 2572
771 Ga0207695_10152809 3300025913 Bacteria 2246
772 Ga0207695_10171235 3300025913 Bacteria 2097
773 Ga0207695_10419991 3300025913 Bacteria 1221
774 Ga0207695_10692869 3300025913 Bacteria 899
775 Ga0207695_10714659 3300025913 Bacteria 882
776 Ga0207671_10004779 3300025914 Bacteria 12768
777 Ga0207671_10008416 3300025914 Bacteria 8752
778 Ga0207671_10197133 3300025914 Bacteria 1571
779 Ga0207671_10252637 3300025914 Bacteria 1386
780 Ga0207671_10321253 3300025914 Bacteria 1225
781 Ga0207671_10581256 3300025914 Bacteria 893
782 Ga0207671_10730253 3300025914 Bacteria 787
783 Ga0207671_11065008 3300025914 Bacteria 636
784 Ga0207693_10025498 3300025915 Bacteria 4687
785 Ga0207693_10039884 3300025915 Bacteria 3698
786 Ga0207693_10075478 3300025915 Bacteria 2640
787 Ga0207693_10091190 3300025915 Bacteria 2389
788 Ga0207693_10508124 3300025915 Bacteria 941
789 Ga0207693_10733855 3300025915 Bacteria 764
790 Ga0207663_10002427 3300025916 Bacteria 8953
791 Ga0207663_10006759 3300025916 Bacteria 5901
792 Ga0207663_10038528 3300025916 Bacteria 2890
793 Ga0207663_10132763 3300025916 Bacteria 1723
794 Ga0207663_10260326 3300025916 Bacteria 1281
795 Ga0207663_10283814 3300025916 Bacteria 1231
796 Ga0207663_11621751 3300025916 Bacteria 521
797 Ga0207660_10010489 3300025917 Bacteria 6017
798 Ga0207660_10102184 3300025917 Bacteria 2142
799 Ga0207660_10208444 3300025917 Bacteria 1529
800 Ga0207660_10247257 3300025917 Bacteria 1407
801 Ga0207660_10378751 3300025917 Bacteria 1137
802 Ga0207660_10432439 3300025917 Bacteria 1063
803 Ga0207660_10566193 3300025917 Bacteria 925
804 Ga0207660_10722465 3300025917 Bacteria 813
805 Ga0207660_11128833 3300025917 Bacteria 638
806 Ga0207660_11319780 3300025917 Bacteria 586
807 Ga0207660_11605387 3300025917 Bacteria 524
808 Ga0207662_10236132 3300025918 Bacteria 1195
809 Ga0207662_10727525 3300025918 Bacteria 697
810 Ga0207657_10047956 3300025919 Bacteria 3731
811 Ga0207657_10200080 3300025919 Bacteria 1607
812 Ga0207657_10355323 3300025919 Bacteria 1155
813 Ga0207657_10436945 3300025919 Bacteria 1028
814 Ga0207657_11060001 3300025919 Bacteria 620
815 Ga0207649_10271283 3300025920 Bacteria 1230
816 Ga0207649_10385893 3300025920 Bacteria 1045
817 Ga0207649_11225233 3300025920 Bacteria 593
818 Ga0207652_10036652 3300025921 Bacteria 4146
819 Ga0207652_10062784 3300025921 Bacteria 3211
820 Ga0207652_10376542 3300025921 Bacteria 1281
821 Ga0207652_10757790 3300025921 Bacteria 864
822 Ga0207652_11144208 3300025921 Bacteria 679
823 Ga0207652_11160684 3300025921 Bacteria 674
824 Ga0207652_11462060 3300025921 Bacteria 587
825 Ga0207646_10906837 3300025922 Bacteria 782
826 Ga0207681_10902490 3300025923 Bacteria 740
827 Ga0207694_10089308 3300025924 Bacteria 2430
828 Ga0207694_10100084 3300025924 Bacteria 2296
829 Ga0207694_10245861 3300025924 Bacteria 1463
830 Ga0207694_10375101 3300025924 Bacteria 1180
831 Ga0207694_10410568 3300025924 Bacteria 1127
832 Ga0207694_10898033 3300025924 Bacteria 749
833 Ga0207694_10972703 3300025924 Bacteria 718
834 Ga0207694_11438392 3300025924 Bacteria 582
835 Ga0207650_10059675 3300025925 Bacteria 2844
836 Ga0207650_10116674 3300025925 Bacteria 2073
837 Ga0207650_10319661 3300025925 Bacteria 1271
838 Ga0207659_10439215 3300025926 Bacteria 1097
839 Ga0207659_10776563 3300025926 Bacteria 823
840 Ga0207659_11615852 3300025926 Bacteria 553
841 Ga0207687_10085241 3300025927 Bacteria 2291
842 Ga0207687_10094567 3300025927 Bacteria 2187
843 Ga0207687_10123001 3300025927 Bacteria 1943
844 Ga0207687_10142227 3300025927 Bacteria 1821
845 Ga0207687_11171961 3300025927 Bacteria 660
846 Ga0207687_11249270 3300025927 Bacteria 638
847 Ga0207700_10007806 3300025928 Bacteria 6575
848 Ga0207700_10026732 3300025928 Bacteria 4029
849 Ga0207700_10043162 3300025928 Bacteria 3311
850 Ga0207700_10087324 3300025928 Bacteria 2453
851 Ga0207700_10750834 3300025928 Bacteria 872
852 Ga0207700_11206368 3300025928 Bacteria 675
853 Ga0207700_11507855 3300025928 Bacteria 596
854 Ga0207664_10005062 3300025929 Bacteria 8977
855 Ga0207664_10092312 3300025929 Bacteria 2485
856 Ga0207664_10636997 3300025929 Bacteria 958
857 Ga0207664_10658085 3300025929 Bacteria 942
858 Ga0207664_10990786 3300025929 Bacteria 753
859 Ga0207644_10521666 3300025931 Bacteria 981
860 Ga0207644_10597154 3300025931 Bacteria 916
861 Ga0207644_10726895 3300025931 Bacteria 829
862 Ga0207644_10739773 3300025931 Bacteria 821
863 Ga0207690_10124017 3300025932 Bacteria 1881
864 Ga0207690_10321204 3300025932 Bacteria 1217
865 Ga0207690_10517284 3300025932 Bacteria 967
866 Ga0207690_10654680 3300025932 Bacteria 861
867 Ga0207690_10781250 3300025932 Bacteria 788
868 Ga0207690_11091665 3300025932 Bacteria 665
869 Ga0207690_11327247 3300025932 Bacteria 601
870 Ga0207706_10054980 3300025933 Bacteria 3512
871 Ga0207706_10212882 3300025933 Bacteria 1693
872 Ga0207706_11371997 3300025933 Bacteria 581
873 Ga0207709_10094764 3300025935 Bacteria 1960
874 Ga0207709_10325146 3300025935 Bacteria 1153
875 Ga0207709_10642343 3300025935 Bacteria 844
876 Ga0207670_10101417 3300025936 Bacteria 2056
877 Ga0207670_10196428 3300025936 Bacteria 1530
878 Ga0207670_10716665 3300025936 Bacteria 829
879 Ga0207670_11651057 3300025936 Bacteria 545
880 Ga0207669_10023150 3300025937 Bacteria 3313
881 Ga0207669_10032232 3300025937 Bacteria 2940
882 Ga0207669_10094032 3300025937 Bacteria 1960
883 Ga0207669_10106170 3300025937 Bacteria 1870
884 Ga0207669_11142998 3300025937 Bacteria 658
885 Ga0207669_11914865 3300025937 Bacteria 507
886 Ga0207704_10066994 3300025938 Bacteria 2257
887 Ga0207704_10636260 3300025938 Bacteria 877
888 Ga0207704_10957460 3300025938 Bacteria 722
889 Ga0207665_10013322 3300025939 Bacteria 5404
890 Ga0207665_10124708 3300025939 Bacteria 1822
891 Ga0207665_10193527 3300025939 Bacteria 1478
892 Ga0207665_10213216 3300025939 Bacteria 1412
893 Ga0207665_10249168 3300025939 Bacteria 1312
894 Ga0207665_10277085 3300025939 Bacteria 1247
895 Ga0207665_10353338 3300025939 Bacteria 1110
896 Ga0207691_10351260 3300025940 Bacteria 1261
897 Ga0207691_10411563 3300025940 Bacteria 1153
898 Ga0207691_10427676 3300025940 Bacteria 1128
899 Ga0207711_10100091 3300025941 Bacteria 2563
900 Ga0207711_10559859 3300025941 Bacteria 1066
901 Ga0207711_10598593 3300025941 Bacteria 1029
902 Ga0207711_10893130 3300025941 Bacteria 826
903 Ga0207711_11575691 3300025941 Bacteria 600
904 Ga0207689_10093390 3300025942 Bacteria 2471
905 Ga0207689_10216042 3300025942 Bacteria 1584
906 Ga0207689_10216105 3300025942 Bacteria 1584
907 Ga0207689_10427043 3300025942 Bacteria 1106
908 Ga0207689_10965954 3300025942 Bacteria 719
909 Ga0207661_10004990 3300025944 Bacteria 9302
910 Ga0207661_10768349 3300025944 Bacteria 887
911 Ga0207661_10832379 3300025944 Bacteria 850
912 Ga0207661_11510533 3300025944 Bacteria 615
913 Ga0207679_10039514 3300025945 Bacteria 3370
914 Ga0207679_10210664 3300025945 Bacteria 1629
915 Ga0207679_11143253 3300025945 Bacteria 714
916 Ga0207667_10016171 3300025949 Bacteria 8437
917 Ga0207667_10116497 3300025949 Bacteria 2753
918 Ga0207667_10167984 3300025949 Bacteria 2255
919 Ga0207667_10195176 3300025949 Bacteria 2077
920 Ga0207667_10196205 3300025949 Bacteria 2071
921 Ga0207667_10279901 3300025949 Bacteria 1705
922 Ga0207667_10374022 3300025949 Bacteria 1452
923 Ga0207667_10709073 3300025949 Bacteria 1008
924 Ga0207667_11200288 3300025949 Bacteria 738
925 Ga0207667_11457439 3300025949 Bacteria 657
926 Ga0207667_11621310 3300025949 Bacteria 615
927 Ga0207667_12056768 3300025949 Bacteria 530
928 Ga0207651_10051453 3300025960 Bacteria 2803
929 Ga0207651_10490162 3300025960 Bacteria 1061
930 Ga0207712_10879577 3300025961 Bacteria 791
931 Ga0207712_10999786 3300025961 Bacteria 742
932 Ga0207712_11196782 3300025961 Bacteria 678
933 Ga0207712_11381789 3300025961 Bacteria 630
934 Ga0207668_10003848 3300025972 Bacteria 8846
935 Ga0207668_10022600 3300025972 Bacteria 4029
936 Ga0207668_10037005 3300025972 Bacteria 3262
937 Ga0207668_10378141 3300025972 Bacteria 1191
938 Ga0207668_10897827 3300025972 Bacteria 788
939 Ga0207640_10618307 3300025981 Bacteria 919
940 Ga0207640_10755973 3300025981 Bacteria 838
941 Ga0207640_10965050 3300025981 Bacteria 748
942 Ga0207640_11522483 3300025981 Bacteria 601
943 Ga0207658_10320728 3300025986 Bacteria 1341
944 Ga0207658_10453064 3300025986 Bacteria 1136
945 Ga0207658_10643883 3300025986 Bacteria 955
946 Ga0207658_10679141 3300025986 Bacteria 930
947 Ga0207658_11083320 3300025986 Bacteria 732
948 Ga0207658_12089699 3300025986 Bacteria 515
949 Ga0207677_10183595 3300026023 Bacteria 1647
950 Ga0207677_11192639 3300026023 Bacteria 697
951 Ga0207677_11195411 3300026023 Bacteria 696
952 Ga0207677_11250950 3300026023 Bacteria 681
953 Ga0207703_10126347 3300026035 Bacteria 2202
954 Ga0207703_10150741 3300026035 Bacteria 2027
955 Ga0207703_10203385 3300026035 Bacteria 1761
956 Ga0207703_10873705 3300026035 Bacteria 860
957 Ga0207703_11249349 3300026035 Bacteria 714
958 Ga0207639_10258852 3300026041 Bacteria 1521
959 Ga0207639_10260819 3300026041 Bacteria 1516
960 Ga0207639_10439711 3300026041 Bacteria 1182
961 Ga0207639_10626617 3300026041 Bacteria 993
962 Ga0207639_10893204 3300026041 Bacteria 830
963 Ga0207639_11131865 3300026041 Bacteria 734
964 Ga0207639_11712855 3300026041 Bacteria 589
965 Ga0207639_11951931 3300026041 Bacteria 548
966 Ga0207678_10006578 3300026067 Bacteria 10303
967 Ga0207678_10037538 3300026067 Bacteria 4213
968 Ga0207678_10114782 3300026067 Bacteria 2297
969 Ga0207678_10139263 3300026067 Bacteria 2071
970 Ga0207678_10144094 3300026067 Bacteria 2033
971 Ga0207678_10145123 3300026067 Bacteria 2026
972 Ga0207678_10347935 3300026067 Bacteria 1278
973 Ga0207678_10623794 3300026067 Bacteria 946
974 Ga0207678_10720939 3300026067 Bacteria 878
975 Ga0207678_10845401 3300026067 Bacteria 809
976 Ga0207678_11072061 3300026067 Bacteria 713
977 Ga0207708_10289865 3300026075 Bacteria 1328
978 Ga0207708_10427307 3300026075 Bacteria 1099
979 Ga0207708_10880690 3300026075 Bacteria 774
980 Ga0207708_11556502 3300026075 Bacteria 581
981 Ga0207702_10000371 3300026078 Bacteria 51217
982 Ga0207702_10070252 3300026078 Bacteria 3012
983 Ga0207702_10071916 3300026078 Bacteria 2980
984 Ga0207702_10088133 3300026078 Bacteria 2711
985 Ga0207702_10231155 3300026078 Bacteria 1728
986 Ga0207702_10605193 3300026078 Bacteria 1076
987 Ga0207702_10748664 3300026078 Bacteria 965
988 Ga0207702_10885186 3300026078 Bacteria 884
989 Ga0207702_10916150 3300026078 Bacteria 869
990 Ga0207641_10194534 3300026088 Bacteria 1866
991 Ga0207641_10978614 3300026088 Bacteria 842
992 Ga0207648_10059458 3300026089 Bacteria 3333
993 Ga0207648_10513987 3300026089 Bacteria 1097
994 Ga0207648_10861735 3300026089 Bacteria 845
995 Ga0207648_11013536 3300026089 Bacteria 778
996 Ga0207648_11824891 3300026089 Bacteria 570
997 Ga0207648_12020101 3300026089 Bacteria 538
998 Ga0207676_10416998 3300026095 Bacteria 1258
999 Ga0207676_10638829 3300026095 Bacteria 1026
1000 Ga0207676_10649040 3300026095 Bacteria 1018
1001 Ga0207676_10758068 3300026095 Bacteria 944
1002 Ga0207676_11444510 3300026095 Bacteria 684
1003 Ga0207676_11587681 3300026095 Bacteria 652
1004 Ga0207676_11706095 3300026095 Bacteria 628
1005 Ga0207674_10010283 3300026116 Bacteria 10616
1006 Ga0207674_10323800 3300026116 Bacteria 1491
1007 Ga0207674_10340669 3300026116 Bacteria 1450
1008 Ga0207675_100176847 3300026118 Bacteria 2042
1009 Ga0207675_100490515 3300026118 Bacteria 1222
1010 Ga0207675_100780445 3300026118 Bacteria 968
1011 Ga0207675_100818408 3300026118 Bacteria 945
1012 Ga0207683_10010044 3300026121 Bacteria 8078
1013 Ga0207683_10035624 3300026121 Bacteria 4329
1014 Ga0207683_10085162 3300026121 Bacteria 2810
1015 Ga0207683_10139205 3300026121 Bacteria 2186
1016 Ga0207683_10188700 3300026121 Bacteria 1871
1017 Ga0207683_10391646 3300026121 Bacteria 1278
1018 Ga0207683_10436867 3300026121 Bacteria 1206
1019 Ga0207683_10608625 3300026121 Bacteria 1011
1020 Ga0207683_10762782 3300026121 Bacteria 898
1021 Ga0207683_11301271 3300026121 Bacteria 673
1022 Ga0207698_10236663 3300026142 Bacteria 1661
1023 Ga0207698_10787589 3300026142 Bacteria 952
1024 Ga0207698_11204794 3300026142 Bacteria 771
1025 Ga0207698_11736068 3300026142 Bacteria 639
1026 Ga0207698_11959511 3300026142 Bacteria 600
1027 Ga0207698_12525354 3300026142 Bacteria 524
1028 Ga0207698_12630929 3300026142 Bacteria 512
1029 Ga0209389_1000001 3300027296 Bacteria 463799
1030 Ga0209389_1000014 3300027296 Bacteria 188621
1031 Ga0209589_1000011 3300027357 Bacteria 236981
1032 Ga0209589_1000020 3300027357 Bacteria 188617
1033 Ga0209489_100012 3300027361 Bacteria 236981
1034 Ga0209489_100060 3300027361 Bacteria 147091
1035 Ga0209489_102213 3300027361 Bacteria 39761
1036 Ga0209700_100007 3300027363 Bacteria 454608
1037 Ga0209700_100019 3300027363 Bacteria 236981
1038 Ga0209588_1231160 3300027671 Bacteria 569
1039 Ga0209813_10044494 3300027866 Bacteria 1364
1040 Ga0209813_10261358 3300027866 Bacteria 661
1041 Ga0209813_10482390 3300027866 Bacteria 512
1042 Ga0209974_10378294 3300027876 Bacteria 553
1043 Ga0207428_10130415 3300027907 Bacteria 1924
1044 Ga0268266_10003223 3300028379 Bacteria 16485
1045 Ga0268266_10004652 3300028379 Bacteria 13078
1046 Ga0268266_10056422 3300028379 Bacteria 3379
1047 Ga0268266_10101828 3300028379 Bacteria 2532
1048 Ga0268266_10118807 3300028379 Bacteria 2350
1049 Ga0268266_10666723 3300028379 Bacteria 1001
1050 Ga0268266_10743819 3300028379 Bacteria 946
1051 Ga0268266_11046032 3300028379 Bacteria 790
1052 Ga0268266_11062181 3300028379 Bacteria 783
1053 Ga0268266_11668055 3300028379 Bacteria 613
1054 Ga0268265_10371579 3300028380 Bacteria 1312
1055 Ga0268265_10451027 3300028380 Bacteria 1201
1056 Ga0268265_10464517 3300028380 Bacteria 1185
1057 Ga0268265_10469232 3300028380 Bacteria 1179
1058 Ga0268265_11479417 3300028380 Bacteria 682
1059 Ga0268265_11745845 3300028380 Bacteria 628
1060 Ga0268265_11994229 3300028380 Bacteria 587
1061 Ga0268264_10000048 3300028381 Bacteria 334457
1062 Ga0268264_10438182 3300028381 Bacteria 1263
1063 Ga0268264_10647265 3300028381 Bacteria 1046
1064 Ga0268264_10753632 3300028381 Bacteria 970
1065 Ga0268264_11085186 3300028381 Bacteria 809
1066 Ga0268264_11651498 3300028381 Bacteria 651
1067 Ga0268264_12423976 3300028381 Bacteria 530
1068 Ga0265337_1038032 3300028556 Bacteria 1397
1069 Ga0265326_10004901 3300028558 Bacteria 4242
1070 Ga0265319_1062457 3300028563 Bacteria 1206
1071 Ga0265334_10010029 3300028573 Bacteria 4002
1072 Ga0265318_10014576 3300028577 Bacteria 3296
1073 Ga0265323_10002347 3300028653 Bacteria 8737
1074 Ga0265336_10000427 3300028666 Bacteria 26128
1075 Ga0307517_10002778 3300028786 Bacteria 27841
1076 Ga0307517_10060218 3300028786 Bacteria 3619
1077 Ga0307517_10242645 3300028786 Bacteria 1067
1078 Ga0307515_10025133 3300028794 Bacteria 10327
1079 Ga0307515_10190478 3300028794 Bacteria 1963
1080 Ga0307515_10523608 3300028794 Bacteria 795
1081 Ga0307515_10772173 3300028794 Bacteria 581
1082 Ga0265338_10000582 3300028800 Bacteria 64301
1083 Ga0265338_10206468 3300028800 Bacteria 1478
1084 Ga0265338_10360034 3300028800 Bacteria 1044
1085 Ga0265338_11116333 3300028800 Bacteria 531
1086 Ga0307511_10111069 3300030521 Bacteria 1744
1087 Ga0307511_10127429 3300030521 Bacteria 1547
1088 Ga0265773_1040049 3300031018 Bacteria 534
1089 Ga0265760_10327978 3300031090 Bacteria 545
1090 Ga0265330_10014164 3300031235 Bacteria 3701
1091 Ga0265330_10360114 3300031235 Bacteria 614
1092 Ga0265332_10051238 3300031238 Bacteria 1773
1093 Ga0265332_10130240 3300031238 Bacteria 1055
1094 Ga0265325_10018025 3300031241 Bacteria 3917
1095 Ga0265340_10110687 3300031247 Bacteria 1270
1096 Ga0265340_10137673 3300031247 Bacteria 1117
1097 Ga0265339_10041383 3300031249 Bacteria 2558
1098 Ga0265331_10051237 3300031250 Bacteria 1976
1099 Ga0265331_10063430 3300031250 Bacteria 1741
1100 Ga0307513_10053911 3300031456 Bacteria 4317
1101 Ga0307513_10145947 3300031456 Bacteria 2284
1102 Ga0307513_10279625 3300031456 Bacteria 1447
1103 Ga0307513_10815925 3300031456 Bacteria 639
1104 Ga0307509_10011398 3300031507 Bacteria 10768
1105 Ga0307509_10103359 3300031507 Bacteria 2877
1106 Ga0307509_10210401 3300031507 Bacteria 1770
1107 Ga0307408_100170159 3300031548 Bacteria 1739
1108 Ga0307408_100368829 3300031548 Bacteria 1224
1109 Ga0307408_101039666 3300031548 Bacteria 757
1110 Ga0307408_101743475 3300031548 Bacteria 594
1111 Ga0307408_102368906 3300031548 Bacteria 515
1112 Ga0265313_10009997 3300031595 Bacteria 6076
1113 Ga0265313_10024626 3300031595 Bacteria 3211
1114 Ga0307508_10000015 3300031616 Bacteria 210182
1115 Ga0307508_10055392 3300031616 Bacteria 3512
1116 Ga0307508_10061684 3300031616 Bacteria 3312
1117 Ga0307508_10732840 3300031616 Bacteria 600
1118 Ga0307508_10756961 3300031616 Bacteria 585
1119 Ga0307514_10534745 3300031649 Bacteria 546
1120 Ga0265314_10003429 3300031711 Bacteria 15321
1121 Ga0265314_10115643 3300031711 Bacteria 1697
1122 Ga0265314_10168707 3300031711 Bacteria 1324
1123 Ga0265342_10000319 3300031712 Bacteria 54575
1124 Ga0265342_10019885 3300031712 Bacteria 4319
1125 Ga0307516_10009565 3300031730 Bacteria 10796
1126 Ga0307516_10061224 3300031730 Bacteria 3653
1127 Ga0307516_10126081 3300031730 Bacteria 2345
1128 Ga0307516_10144616 3300031730 Bacteria 2144
1129 Ga0307516_10477859 3300031730 Bacteria 901
1130 Ga0307516_10829822 3300031730 Bacteria 587
1131 Ga0307516_10843343 3300031730 Bacteria 580
1132 Ga0307405_11094009 3300031731 Bacteria 685
1133 Ga0307405_11379128 3300031731 Bacteria 616
1134 Ga0307413_10766798 3300031824 Bacteria 808
1135 Ga0307410_10634669 3300031852 Bacteria 894
1136 Ga0307410_10762878 3300031852 Bacteria 820
1137 Ga0326468_10009688 3300031889 Bacteria 960
1138 Ga0307406_10067272 3300031901 Bacteria 2335
1139 Ga0307406_10626187 3300031901 Bacteria 890
1140 Ga0307406_10767685 3300031901 Bacteria 811
1141 Ga0307412_10048124 3300031911 Bacteria 2803
1142 Ga0307412_10403297 3300031911 Bacteria 1114
1143 Ga0307412_11375425 3300031911 Bacteria 638
1144 Ga0307412_11749960 3300031911 Bacteria 571
1145 Ga0307409_100902338 3300031995 Bacteria 897
1146 Ga0307409_101877401 3300031995 Bacteria 628
1147 Ga0307409_102508064 3300031995 Bacteria 544
1148 Ga0307416_100549828 3300032002 Bacteria 1228
1149 Ga0307416_100916211 3300032002 Bacteria 977
1150 Ga0307416_101462354 3300032002 Bacteria 789
1151 Ga0307414_11919494 3300032004 Bacteria 553
1152 Ga0307411_10036600 3300032005 Bacteria 3077
1153 Ga0307411_10717015 3300032005 Bacteria 873
1154 Ga0307415_100071301 3300032126 Bacteria 2443
1155 Ga0307415_100211267 3300032126 Bacteria 1548
1156 Ga0307415_102512534 3300032126 Unclassified 507
1157 Ga0316583_10000299 3300032133 Bacteria 13887
1158 Ga0307507_10006824 3300033179 Bacteria 17074
1159 Ga0307510_10001397 3300033180 Bacteria 26495
1160 Ga0307510_10070491 3300033180 Bacteria 3490
1161 Ga0307510_10133008 3300033180 Bacteria 2153
1162 Ga0307510_10255175 3300033180 Bacteria 1238
1163 Ga0307510_10292462 3300033180 Bacteria 1094
1164 Ga0307510_10377739 3300033180 Bacteria 863
1165 Ga0307510_10379321 3300033180 Bacteria 859
1166 Ga0307510_10567114 3300033180 Bacteria 583
1167 Ga0315911_1000002 3300033442 Bacteria 926833
1168 Ga0316587_1051704 3300033529 Bacteria 753
1169 Ga0316215_1011073 3300033544 Bacteria 892
1170 Ga0373930_0012374 3300034816 Bacteria 1556
1171 Ga0373958_0202226 3300034819 Bacteria 521
1172 Ga0373959_0173060 3300034820 Bacteria 557
1173 Ga0373938_0070580 3300034957 Bacteria 834
1174 Ga0373938_0149410 3300034957 Bacteria 621
1175 Ga0373926_0013987 3300035083 Bacteria 2726
1176 Ga0373928_0211653 3300035084 Bacteria 563
1177 Ga0373934_0042367 3300035086 Bacteria 1798
1178 Ga0373934_0258567 3300035086 Bacteria 720
1179 Ga0373949_0173072 3300035090 Bacteria 636
1180 Ga0373951_0219560 3300035091 Bacteria 561
1181 Ga0373923_0002203 3300035111 Bacteria 5923
1182 Ga0373923_0022049 3300035111 Bacteria 2493
1183 Ga0373923_0026186 3300035111 Bacteria 2318
1184 Ga0373932_0147633 3300035112 Bacteria 804
1185 Ga0373932_0159292 3300035112 Bacteria 780
1186 Ga0373932_0328232 3300035112 Bacteria 577
1187 Ga0373936_0001362 3300035113 Bacteria 8866
1188 Ga0373936_0027014 3300035113 Bacteria 2251
1189 Ga0373936_0163711 3300035113 Bacteria 970
1190 Ga0373936_0364204 3300035113 Bacteria 660
1191 Ga0373939_0453552 3300035114 Bacteria 540
1192 Ga0373941_0234290 3300035115 Bacteria 711
1193 Ga0373945_0019585 3300035116 Bacteria 2312
1194 Ga0373945_0079995 3300035116 Bacteria 1251
1195 Ga0373945_0212374 3300035116 Bacteria 807
1196 Ga0373945_0264421 3300035116 Bacteria 730
1197 Ga0373953_0001226 3300035117 Bacteria 7311
1198 Ga0373953_0009986 3300035117 Bacteria 3290
1199 Ga0373953_0062179 3300035117 Bacteria 1528
1200 Ga0373953_0081221 3300035117 Bacteria 1348
1201 Ga0373953_0495638 3300035117 Bacteria 541
1202 Ga0373954_0001566 3300035118 Bacteria 9324
1203 Ga0373954_0063682 3300035118 Bacteria 1742
1204 Ga0373954_0094690 3300035118 Bacteria 1437
1205 Ga0373954_0337931 3300035118 Bacteria 744
1206 Ga0373956_0002664 3300035119 Bacteria 7219
1207 Ga0373956_0034441 3300035119 Bacteria 2230
1208 Ga0373956_0103803 3300035119 Bacteria 1320
1209 Ga0373957_0151701 3300035120 Bacteria 951
1210 Ga0373943_0002814 3300035170 Bacteria 7910
1211 Ga0373943_0031042 3300035170 Bacteria 2533
1212 Ga0373943_0205439 3300035170 Bacteria 1092
1213 Ga0373946_0004615 3300035171 Bacteria 4940
1214 Ga0373946_0027212 3300035171 Bacteria 2260
1215 Ga0373955_0006932 3300035172 Bacteria 5183
1216 Ga0373955_0018896 3300035172 Bacteria 3436
1217 Ga0373955_0031168 3300035172 Bacteria 2792
1218 Ga0373955_0041407 3300035172 Bacteria 2469
1219 Ga0373955_0058094 3300035172 Bacteria 2127
1220 Ga0373961_0214284 3300035241 Bacteria 684
1221 Ga0373962_0170487 3300035242 Bacteria 723
1222 Ga0373924_0003477 3300035410 Bacteria 5423
1223 Ga0373924_0035242 3300035410 Bacteria 2029
1224 Ga0373931_0009495 3300035691 Bacteria 4653
1225 Ga0373931_0289271 3300035691 Bacteria 1009
1226 Ga0373931_0427508 3300035691 Bacteria 843
1227 Ga0373931_0754907 3300035691 Bacteria 646
1228 Ga0373935_0012964 3300035692 Bacteria 5024
1229 Ga0373935_0042087 3300035692 Bacteria 2871
1230 Ga0373935_0441945 3300035692 Bacteria 938
1231 Ga0373935_0742266 3300035692 Bacteria 723
1232 Ga0373935_0811599 3300035692 Bacteria 691
1233 Ga0373935_1382902 3300035692 Bacteria 526
1234 Ga0373927_0000437 3300035695 Bacteria 31976
1235 Ga0373927_0040990 3300035695 Bacteria 3003
1236 Ga0373927_0127240 3300035695 Bacteria 1663
1237 Ga0373927_0140125 3300035695 Bacteria 1581
1238 Ga0373927_0147752 3300035695 Bacteria 1539
1239 Ga0373927_0462833 3300035695 Bacteria 838
1240 Ga0373927_0830928 3300035695 Bacteria 610
1241 Ga0373927_1174372 3300035695 Bacteria 506
1242 Ga0373933_0000296 3300035724 Bacteria 32065
1243 Ga0373933_0006277 3300035724 Bacteria 6469
1244 Ga0373933_0213697 3300035724 Bacteria 1236
1245 Ga0373933_0339869 3300035724 Bacteria 974
1246 Ga0373947_0000180 3300035725 Bacteria 34668
1247 Ga0373947_0061864 3300035725 Bacteria 2276
1248 Ga0373947_0089999 3300035725 Bacteria 1912
1249 Ga0373947_0422522 3300035725 Bacteria 901
1250 Ga0310104_15268 3300036242 Bacteria 595
1251 Ga0373937_0001389 3300036401 Bacteria 20240
1252 Ga0373937_0029494 3300036401 Bacteria 4968
1253 Ga0373937_0281867 3300036401 Bacteria 1569
1254 Ga0373937_0380078 3300036401 Bacteria 1339
1255 Ga0373937_0514771 3300036401 Bacteria 1137
1256 Ga0373937_0901578 3300036401 Bacteria 833
1257 Ga0373937_1273202 3300036401 Bacteria 683
1258 Ga0373937_1747994 3300036401 Bacteria 569
1259 Ga0372808_023002 3300036459 Bacteria 895
1260 Ga0373925_0000647 3300037068 Bacteria 32747
1261 Ga0373925_0026930 3300037068 Bacteria 4209
1262 Ga0373925_0033668 3300037068 Bacteria 3775
1263 Ga0373925_0064428 3300037068 Bacteria 2759
1264 Ga0373925_0555408 3300037068 Bacteria 944
1265 Ga0373925_0577189 3300037068 Bacteria 925
1266 Ga0373925_0617968 3300037068 Bacteria 893
1267 Ga0373925_0925630 3300037068 Bacteria 718
1268 Ga0373925_0946531 3300037068 Bacteria 710
1269 Ga0395899_0048670 3300037312 Bacteria 3154
1270 Ga0395899_0132212 3300037312 Bacteria 1781
1271 Ga0395899_0372916 3300037312 Bacteria 950
1272 Ga0395900_0000939 3300037418 Bacteria 38089
1273 Ga0395900_0141415 3300037418 Bacteria 2464
1274 Ga0395900_0545260 3300037418 Bacteria 1105
1275 Ga0395900_0580051 3300037418 Bacteria 1063
1276 Ga0395900_0727827 3300037418 Bacteria 924
1277 Ga0395900_0749669 3300037418 Bacteria 907
1278 Ga0395900_0956669 3300037418 Bacteria 778
1279 Ga0395900_1068269 3300037418 Bacteria 725
1280 Ga0395898_0002686 3300037466 Bacteria 20580
1281 Ga0395898_0095865 3300037466 Bacteria 2850
1282 Ga0395898_0165219 3300037466 Bacteria 2117
1283 Ga0395898_0597306 3300037466 Bacteria 1046
1284 Ga0395898_1775849 3300037466 Bacteria 538
1285 Ga0395905_0010169 3300037471 Bacteria 9169
1286 Ga0395905_0128876 3300037471 Bacteria 2379
1287 Ga0395905_0288701 3300037471 Bacteria 1527
1288 Ga0395905_0339833 3300037471 Bacteria 1392
1289 Ga0395905_0539483 3300037471 Bacteria 1067
1290 Ga0395905_1281866 3300037471 Bacteria 636
1291 Ga0436364_0262085 3300037853 Bacteria 656
1292 Ga0436364_0389980 3300037853 Bacteria 7087
1293 Ga0436364_0469624 3300037853 Bacteria 5147
1294 Ga0436364_0883924 3300037853 Bacteria 598
1295 Ga0436364_1039552 3300037853 Bacteria 879
1296 Ga0436364_1051854 3300037853 Bacteria 2057
1297 Ga0436364_1337182 3300037853 Bacteria 534
1298 Ga0395901_0044498 3300038443 Bacteria 4605
1299 Ga0395901_0066133 3300038443 Bacteria 3766
1300 Ga0395901_0115419 3300038443 Bacteria 2820
1301 Ga0395901_0403117 3300038443 Bacteria 1405
1302 Ga0395901_0459392 3300038443 Bacteria 1301
1303 Ga0395901_0681538 3300038443 Bacteria 1028
1304 Ga0395901_0809185 3300038443 Bacteria 925
1305 Ga0395901_0882505 3300038443 Bacteria 877
1306 Ga0395901_1011117 3300038443 Bacteria 807
1307 Ga0436365_0023438 3300039437 Bacteria 1046
1308 Ga0436365_0058760 3300039437 Bacteria 15659
1309 Ga0436365_0273270 3300039437 Bacteria 547
1310 Ga0436365_0393166 3300039437 Bacteria 1228
1311 Ga0436365_0641442 3300039437 Bacteria 794
1312 Ga0436365_0731674 3300039437 Bacteria 838
1313 Ga0436365_0753258 3300039437 Bacteria 699
1314 Ga0436365_0786238 3300039437 Bacteria 2146
1315 Ga0436365_0945878 3300039437 Bacteria 5495
1316 Ga0436365_1038374 3300039437 Bacteria 1840
1317 Ga0436365_1347117 3300039437 Bacteria 724
1318 Ga0436365_1401065 3300039437 Bacteria 526
1319 Ga0436365_1468095 3300039437 Bacteria 642
1320 Ga0436365_1843415 3300039437 Bacteria 1174
1321 Ga0436360_0051234 3300039438 Bacteria 689
1322 Ga0436360_0074660 3300039438 Bacteria 4170
1323 Ga0436360_0095674 3300039438 Bacteria 904
1324 Ga0436360_0164437 3300039438 Bacteria 2747
1325 Ga0436360_0228796 3300039438 Bacteria 697
1326 Ga0436360_0489436 3300039438 Bacteria 2058
1327 Ga0436360_0622393 3300039438 Bacteria 943
1328 Ga0436360_0806470 3300039438 Bacteria 1727
1329 Ga0436360_0856114 3300039438 Bacteria 1831
1330 Ga0436360_1038357 3300039438 Bacteria 797
1331 Ga0436360_1087550 3300039438 Bacteria 599
1332 Ga0436361_0066787 3300039447 Bacteria 510
1333 Ga0436361_0089349 3300039447 Bacteria 2021
1334 Ga0436361_0347476 3300039447 Bacteria 4025
1335 Ga0436361_0407254 3300039447 Bacteria 1151
1336 Ga0436361_1069958 3300039447 Bacteria 4910
1337 Ga0436361_1162394 3300039447 Bacteria 862
1338 Ga0436363_0024152 3300039450 Bacteria 661
1339 Ga0436363_0245423 3300039450 Bacteria 853
1340 Ga0436363_0292293 3300039450 Bacteria 613
1341 Ga0436363_0488686 3300039450 Bacteria 2137
1342 Ga0436363_0746113 3300039450 Bacteria 1908
1343 Ga0436363_0860393 3300039450 Bacteria 513
1344 Ga0436363_1147036 3300039450 Bacteria 901
1345 Ga0436363_1151944 3300039450 Bacteria 1056
1346 Ga0436363_1325372 3300039450 Bacteria 669
1347 Ga0436363_1327462 3300039450 Bacteria 1230
1348 Ga0436363_1420085 3300039450 Bacteria 617
1349 Ga0436363_1490924 3300039450 Bacteria 822
1350 Ga0436362_0725727 3300039453 Bacteria 3298
1351 Ga0436362_0892675 3300039453 Bacteria 577
1352 Ga0436362_1011511 3300039453 Bacteria 719
1353 Ga0436362_1281461 3300039453 Bacteria 4226
1354 Ga0439465_0136595 3300041413 Bacteria 869
1355 Ga0439465_0262470 3300041413 Bacteria 641
1356 Ga0439465_0303754 3300041413 Bacteria 597
1357 Ga0451789_1005947 3300041443 Bacteria 527
1358 Ga0451797_0388595 3300041453 Bacteria 1037
1359 Ga0451797_1345892 3300041453 Bacteria 528
1360 Ga0451802_1389911 3300041460 Bacteria 575
1361 Ga0451802_1476848 3300041460 Bacteria 695
1362 Ga0451833_0690599 3300041491 Bacteria 669
1363 Ga0451837_1510067 3300041494 Bacteria 933
1364 Ga0451839_0066429 3300041496 Bacteria 755
1365 Ga0451839_0833549 3300041496 Bacteria 566
1366 Ga0451841_1201480 3300041498 Bacteria 531
1367 Ga0451851_0434122 3300041507 Bacteria 642
1368 Ga0451853_2769112 3300041512 Bacteria 566
1369 Ga0439431_0012839 3300041997 Bacteria 1929
1370 Ga0439431_0186396 3300041997 Bacteria 601
1371 Ga0439448_0200998 3300042005 Bacteria 699
1372 Ga0439432_183404 3300042006 Bacteria 609
1373 Ga0450907_009226 3300042146 Bacteria 1636
1374 Ga0439434_0374281 3300042435 Bacteria 500
1375 Ga0439460_0038738 3300042461 Bacteria 1391
1376 Ga0439440_0248862 3300042993 Bacteria 541
1377 Ga0466969_0358480 3300044656 Bacteria 660
1378 Ga0466969_0376301 3300044656 Bacteria 644
1379 Ga0466972_0000134 3300044658 Bacteria 61802
1380 Ga0466972_0007510 3300044658 Bacteria 5473
1381 Ga0466965_0327063 3300044683 Bacteria 836
1382 Ga0466965_0524089 3300044683 Bacteria 667
1383 Ga0466966_0470563 3300044684 Bacteria 756
1384 Ga0466966_0531975 3300044684 Bacteria 707
1385 Ga0466961_0052077 3300044693 Bacteria 2612
1386 Ga0466961_0162460 3300044693 Bacteria 1392
1387 Ga0466963_0013966 3300044694 Bacteria 4946
1388 Ga0466963_0268214 3300044694 Bacteria 1199
1389 Ga0466963_0413880 3300044694 Bacteria 951
1390 Ga0466964_0089741 3300044706 Bacteria 1336
1391 Ga0466964_0092924 3300044706 Bacteria 1316
1392 Ga0466964_0454484 3300044706 Bacteria 680
1393 Ga0466964_0914794 3300044706 Bacteria 503
1394 Ga0453684_0013576 3300044712 Bacteria 13207
1395 Ga0453684_2531852 3300044712 Bacteria 506
1396 Ga0466971_0010102 3300044719 Bacteria 4123
1397 Ga0466968_0027313 3300044735 Bacteria 2348
1398 Ga0466968_0066339 3300044735 Bacteria 1563
1399 Ga0466968_0259619 3300044735 Bacteria 827
1400 Ga0466968_0367032 3300044735 Bacteria 701
1401 Ga0466970_0231202 3300044765 Bacteria 1033
1402 Ga0466970_0314781 3300044765 Bacteria 884
1403 Ga0466970_0489356 3300044765 Bacteria 708
1404 Ga0466970_0864898 3300044765 Bacteria 531
1405 Ga0466957_0055018 3300044842 Bacteria 2431
1406 Ga0466957_0944028 3300044842 Bacteria 618
1407 Ga0466957_0953943 3300044842 Bacteria 615
1408 Ga0466960_0029543 3300044901 Bacteria 2516
1409 Ga0466960_0079917 3300044901 Bacteria 1645
1410 Ga0466960_0188560 3300044901 Bacteria 1121
1411 Ga0466960_0379974 3300044901 Bacteria 810
1412 Ga0466959_0080111 3300045049 Bacteria 2354
1413 Ga0466959_0195136 3300045049 Bacteria 1411
1414 Ga0466959_0437229 3300045049 Bacteria 887
1415 Ga0451576_0006385 3300045051 Bacteria 14478
1416 Ga0451576_2168656 3300045051 Bacteria 571
1417 Ga0466967_0087185 3300045976 Bacteria 2829
1418 Ga0466967_0231430 3300045976 Bacteria 1760
1419 Ga0466967_0270652 3300045976 Bacteria 1628
1420 Ga0466967_0438323 3300045976 Bacteria 1275
1421 Ga0466967_0500641 3300045976 Bacteria 1192
1422 Ga0466967_0507103 3300045976 Bacteria 1184
1423 Ga0466967_0795068 3300045976 Bacteria 939
1424 Ga0466967_0795928 3300045976 Bacteria 939
1425 Ga0466967_0967597 3300045976 Bacteria 847
1426 Ga0466967_2085661 3300045976 Bacteria 563
1427 Ga0495617_006364 3300046452 Bacteria 4145
1428 Ga0495617_280127 3300046452 Bacteria 511
1429 Ga0495592_0003196 3300046454 Bacteria 11749
1430 Ga0495592_0013905 3300046454 Bacteria 6115
1431 Ga0495592_0023651 3300046454 Bacteria 4673
1432 Ga0495592_0043232 3300046454 Bacteria 3371
1433 Ga0495592_0066877 3300046454 Bacteria 2628
1434 Ga0495603_0000040 3300046455 Bacteria 55056
1435 Ga0495603_0028569 3300046455 Bacteria 3364
1436 Ga0495603_0059173 3300046455 Bacteria 2265
1437 Ga0495603_0137274 3300046455 Bacteria 1423
1438 Ga0495603_0349373 3300046455 Bacteria 848
1439 Ga0495590_0125906 3300046457 Bacteria 920
1440 Ga0495590_0209921 3300046457 Bacteria 717
1441 Ga0495629_0000077 3300046459 Bacteria 85931
1442 Ga0495629_0000165 3300046459 Bacteria 58366
1443 Ga0495629_0032235 3300046459 Bacteria 3710
1444 Ga0495629_0051114 3300046459 Bacteria 2893
1445 Ga0495629_0130610 3300046459 Bacteria 1749
1446 Ga0495629_0234241 3300046459 Bacteria 1265
1447 Ga0495629_0432130 3300046459 Bacteria 893
1448 Ga0495638_0018836 3300046460 Bacteria 4578
1449 Ga0495638_0049627 3300046460 Bacteria 2623
1450 Ga0495641_0001743 3300046461 Bacteria 18153
1451 Ga0495641_0040460 3300046461 Bacteria 2167
1452 Ga0495641_0048551 3300046461 Bacteria 1946
1453 Ga0495641_0300732 3300046461 Bacteria 723
1454 Ga0495641_0585416 3300046461 Bacteria 510
1455 Ga0495651_0009285 3300046462 Bacteria 7547
1456 Ga0495651_0021594 3300046462 Bacteria 5003
1457 Ga0495651_0081482 3300046462 Bacteria 2443
1458 Ga0495651_0104715 3300046462 Bacteria 2100
1459 Ga0495651_0180665 3300046462 Bacteria 1493
1460 Ga0495651_0330767 3300046462 Bacteria 1013
1461 Ga0495651_0719773 3300046462 Bacteria 621
1462 Ga0495653_0004859 3300046463 Bacteria 10901
1463 Ga0495653_0011489 3300046463 Bacteria 7235
1464 Ga0495653_0433369 3300046463 Bacteria 830
1465 Ga0495653_0443639 3300046463 Bacteria 817
1466 Ga0495650_0155125 3300046471 Bacteria 820
1467 Ga0495650_0212158 3300046471 Bacteria 669
1468 Ga0495580_0000537 3300046472 Bacteria 32003
1469 Ga0495580_0004083 3300046472 Bacteria 12310
1470 Ga0495580_0009466 3300046472 Bacteria 7663
1471 Ga0495580_0104654 3300046472 Bacteria 1967
1472 Ga0495580_0348612 3300046472 Bacteria 1003
1473 Ga0495580_0740928 3300046472 Bacteria 641
1474 Ga0495582_0000020 3300046473 Bacteria 88349
1475 Ga0495582_0005892 3300046473 Bacteria 6829
1476 Ga0495582_0082501 3300046473 Bacteria 1786
1477 Ga0495582_0114525 3300046473 Bacteria 1516
1478 Ga0495582_0468467 3300046473 Bacteria 728
1479 Ga0495605_0163040 3300046474 Bacteria 989
1480 Ga0495605_0258906 3300046474 Bacteria 743
1481 Ga0495639_0000011 3300046475 Bacteria 92268
1482 Ga0495639_0010989 3300046475 Bacteria 3899
1483 Ga0495639_0124389 3300046475 Bacteria 1232
1484 Ga0495639_0356467 3300046475 Bacteria 735
1485 Ga0495639_0376504 3300046475 Bacteria 715
1486 Ga0495639_0627332 3300046475 Bacteria 553
1487 Ga0495639_0708528 3300046475 Bacteria 520
1488 Ga0495662_0027255 3300046476 Bacteria 2761
1489 Ga0495662_0131896 3300046476 Bacteria 1229
1490 Ga0495662_0160432 3300046476 Bacteria 1108
1491 Ga0495662_0307468 3300046476 Bacteria 780
1492 Ga0495664_0002999 3300046477 Bacteria 9129
1493 Ga0495664_0009652 3300046477 Bacteria 5403
1494 Ga0495664_0010302 3300046477 Bacteria 5246
1495 Ga0495664_0071547 3300046477 Bacteria 2071
1496 Ga0495664_0103554 3300046477 Bacteria 1716
1497 Ga0495664_0168704 3300046477 Bacteria 1328
1498 Ga0495664_0312652 3300046477 Bacteria 948
1499 Ga0495584_0331962 3300046491 Bacteria 772
1500 Ga0495584_0417730 3300046491 Bacteria 682
1501 Ga0495585_0070271 3300046492 Bacteria 1910
1502 Ga0495585_0189717 3300046492 Bacteria 1052
1503 Ga0495585_0225779 3300046492 Bacteria 943
1504 Ga0495585_0232178 3300046492 Bacteria 927
1505 Ga0495585_0426092 3300046492 Bacteria 637
1506 Ga0495585_0612520 3300046492 Bacteria 511
1507 Ga0495594_0000081 3300046499 Bacteria 42803
1508 Ga0495594_0031029 3300046499 Bacteria 2896
1509 Ga0495594_0597901 3300046499 Bacteria 625
1510 Ga0495596_0055356 3300046500 Bacteria 1550
1511 Ga0495596_0381364 3300046500 Bacteria 549
1512 Ga0495607_0198798 3300046501 Bacteria 994
1513 Ga0495607_0204879 3300046501 Bacteria 974
1514 Ga0495583_0027663 3300046506 Bacteria 2796
1515 Ga0495583_0084436 3300046506 Bacteria 1376
1516 Ga0495606_0004894 3300046507 Bacteria 13113
1517 Ga0495606_0049268 3300046507 Bacteria 2764
1518 Ga0495606_0174994 3300046507 Bacteria 1242
1519 Ga0495606_0218227 3300046507 Bacteria 1076
1520 Ga0495608_0026954 3300046511 Bacteria 3913
1521 Ga0495608_0060907 3300046511 Bacteria 2483
1522 Ga0495608_0077498 3300046511 Bacteria 2164
1523 Ga0495608_0346646 3300046511 Bacteria 914
1524 Ga0495608_0730430 3300046511 Bacteria 588
1525 Ga0495608_0735292 3300046511 Bacteria 585
1526 Ga0495610_0008458 3300046512 Bacteria 6667
1527 Ga0495610_0077672 3300046512 Bacteria 1533
1528 Ga0495616_0163589 3300046513 Bacteria 999
1529 Ga0495618_0082641 3300046514 Bacteria 2051
1530 Ga0495618_0090465 3300046514 Bacteria 1957
1531 Ga0495618_0337979 3300046514 Bacteria 930
1532 Ga0495618_0773089 3300046514 Bacteria 561
1533 Ga0495620_0098928 3300046515 Bacteria 1164
1534 Ga0495628_0029543 3300046516 Bacteria 4443
1535 Ga0495628_0031457 3300046516 Bacteria 4292
1536 Ga0495628_0068148 3300046516 Bacteria 2777
1537 Ga0495628_0132867 3300046516 Bacteria 1903
1538 Ga0495628_0231629 3300046516 Bacteria 1384
1539 Ga0495628_0641146 3300046516 Bacteria 755
1540 Ga0495628_0936741 3300046516 Bacteria 599
1541 Ga0495628_1069817 3300046516 Bacteria 552
1542 Ga0495630_0004121 3300046517 Bacteria 10183
1543 Ga0495630_0124688 3300046517 Bacteria 1954
1544 Ga0495630_0234861 3300046517 Bacteria 1401
1545 Ga0495630_1521238 3300046517 Bacteria 502
1546 Ga0495631_0068625 3300046518 Bacteria 1533
1547 Ga0495631_0520582 3300046518 Bacteria 507
1548 Ga0495632_0140052 3300046519 Bacteria 1122
1549 Ga0495632_0187933 3300046519 Bacteria 944
1550 Ga0495632_0243967 3300046519 Bacteria 807
1551 Ga0495643_0054116 3300046522 Bacteria 2150
1552 Ga0495643_0085479 3300046522 Bacteria 1635
1553 Ga0495643_0165034 3300046522 Bacteria 1087
1554 Ga0495643_0263794 3300046522 Bacteria 799
1555 Ga0495643_0412591 3300046522 Bacteria 594
1556 Ga0495644_0017733 3300046523 Bacteria 2720
1557 Ga0495644_0030765 3300046523 Bacteria 2027
1558 Ga0495648_0003326 3300046524 Bacteria 14178
1559 Ga0495648_0009249 3300046524 Bacteria 7659
1560 Ga0495648_0029631 3300046524 Bacteria 3630
1561 Ga0495648_0152172 3300046524 Bacteria 1206
1562 Ga0495648_0170225 3300046524 Bacteria 1117
1563 Ga0495648_0382742 3300046524 Bacteria 634
1564 Ga0495666_0039170 3300046526 Bacteria 2302
1565 Ga0495666_0130240 3300046526 Bacteria 1176
1566 Ga0495666_0229685 3300046526 Bacteria 848
1567 Ga0495666_0262863 3300046526 Bacteria 785
1568 Ga0495652_0000938 3300046529 Bacteria 33434
1569 Ga0495652_0005699 3300046529 Bacteria 11663
1570 Ga0495652_0031849 3300046529 Bacteria 4616
1571 Ga0495652_0342076 3300046529 Bacteria 1074
1572 Ga0495652_0373677 3300046529 Bacteria 1015
1573 Ga0495654_0244355 3300046530 Bacteria 750
1574 Ga0495654_0379005 3300046530 Bacteria 565
1575 Ga0495665_0000035 3300046531 Bacteria 53229
1576 Ga0495665_0464861 3300046531 Bacteria 639
1577 Ga0495640_0003879 3300046533 Bacteria 11967
1578 Ga0495640_0014952 3300046533 Bacteria 5853
1579 Ga0495640_0050554 3300046533 Bacteria 2863
1580 Ga0495640_0074369 3300046533 Bacteria 2272
1581 Ga0495640_0075716 3300046533 Bacteria 2247
1582 Ga0495640_0971653 3300046533 Bacteria 501
1583 Ga0495586_0031123 3300046535 Bacteria 2857
1584 Ga0495586_0510217 3300046535 Bacteria 694
1585 Ga0495587_0003189 3300046536 Bacteria 10949
1586 Ga0495587_0042145 3300046536 Bacteria 2723
1587 Ga0495587_0111177 3300046536 Bacteria 1574
1588 Ga0495587_0461243 3300046536 Bacteria 703
1589 Ga0495598_0147660 3300046537 Bacteria 818
1590 Ga0495609_0190895 3300046538 Bacteria 859
1591 Ga0495609_0446246 3300046538 Bacteria 514
1592 Ga0495621_0201541 3300046539 Bacteria 801
1593 Ga0495621_0230841 3300046539 Bacteria 751
1594 Ga0495621_0394375 3300046539 Bacteria 586
1595 Ga0495597_0312632 3300046542 Bacteria 608
1596 Ga0495645_0034770 3300046543 Bacteria 3674
1597 Ga0495645_0036700 3300046543 Bacteria 3572
1598 Ga0495645_0269487 3300046543 Bacteria 1124
1599 Ga0495645_0831945 3300046543 Bacteria 552
1600 Ga0495622_0000778 3300046557 Bacteria 17769
1601 Ga0495622_0006010 3300046557 Bacteria 5637
1602 Ga0495622_0013909 3300046557 Bacteria 3734
1603 Ga0495622_0227970 3300046557 Bacteria 824
1604 Ga0495622_0345859 3300046557 Bacteria 644
1605 Ga0495622_0369571 3300046557 Bacteria 620
1606 Ga0495633_0075476 3300046558 Bacteria 1570
1607 Ga0495667_0013074 3300046559 Bacteria 5622
1608 Ga0495667_0019765 3300046559 Bacteria 4546
1609 Ga0495667_0152450 3300046559 Bacteria 1488
1610 Ga0495667_0164390 3300046559 Bacteria 1427
1611 Ga0495656_0019632 3300046615 Bacteria 2611
1612 Ga0495656_0081927 3300046615 Bacteria 1458
1613 Ga0495656_0091838 3300046615 Bacteria 1389
1614 Ga0495656_0361825 3300046615 Bacteria 753
1615 Ga0495668_0055669 3300046616 Bacteria 2184
1616 Ga0495668_0196218 3300046616 Bacteria 1105
1617 Ga0495668_0353540 3300046616 Bacteria 806
1618 Ga0495668_0617326 3300046616 Bacteria 599
1619 Ga0495634_0000553 3300046642 Bacteria 36653
1620 Ga0495634_0009258 3300046642 Bacteria 7270
1621 Ga0495634_0097796 3300046642 Bacteria 1899
1622 Ga0495634_0188253 3300046642 Bacteria 1289
1623 Ga0495611_0071591 3300046648 Bacteria 1585
1624 Ga0495611_0220689 3300046648 Bacteria 882
1625 Ga0495611_0291622 3300046648 Bacteria 753
1626 Ga0495611_0301889 3300046648 Bacteria 738
1627 Ga0495611_0400732 3300046648 Bacteria 627
1628 Ga0495625_0068462 3300046660 Bacteria 2495
1629 Ga0495625_0136577 3300046660 Bacteria 1657
1630 Ga0495625_0720587 3300046660 Bacteria 587
1631 Ga0495635_0000196 3300046663 Bacteria 38194
1632 Ga0495635_0000348 3300046663 Bacteria 29392
1633 Ga0495635_0028688 3300046663 Bacteria 3868
1634 Ga0495635_0095817 3300046663 Bacteria 2028
1635 Ga0495635_0145984 3300046663 Bacteria 1610
1636 Ga0495635_0160008 3300046663 Bacteria 1532
1637 Ga0495659_0071618 3300046664 Bacteria 1299
1638 Ga0495659_0510652 3300046664 Bacteria 527
1639 Ga0495661_0127451 3300046665 Bacteria 1399
1640 Ga0495661_0215302 3300046665 Bacteria 998
1641 Ga0495661_0323598 3300046665 Bacteria 766
1642 Ga0495661_0555394 3300046665 Bacteria 543
1643 Ga0495588_0020663 3300046674 Bacteria 3239
1644 Ga0495588_0043053 3300046674 Bacteria 2309
1645 Ga0495588_0050692 3300046674 Bacteria 2136
1646 Ga0495588_0396910 3300046674 Bacteria 724
1647 Ga0495588_0489429 3300046674 Bacteria 645
1648 Ga0495588_0534096 3300046674 Bacteria 615
1649 Ga0495657_0001933 3300046675 Bacteria 17662
1650 Ga0495657_0003343 3300046675 Bacteria 13122
1651 Ga0495657_0004507 3300046675 Bacteria 11139
1652 Ga0495657_0068033 3300046675 Bacteria 2336
1653 Ga0495657_0265297 3300046675 Bacteria 1031
1654 Ga0495599_0003155 3300046678 Bacteria 9598
1655 Ga0495599_0031277 3300046678 Bacteria 3341
1656 Ga0495599_0058092 3300046678 Bacteria 2420
1657 Ga0495599_0331481 3300046678 Bacteria 915
1658 Ga0495623_0005172 3300046679 Bacteria 8558
1659 Ga0495623_0032653 3300046679 Bacteria 3344
1660 Ga0495623_0238971 3300046679 Bacteria 1027
1661 Ga0495623_0250225 3300046679 Bacteria 997
1662 Ga0495623_0398838 3300046679 Bacteria 740
1663 Ga0495623_0593533 3300046679 Bacteria 576
1664 Ga0495646_0003641 3300046680 Bacteria 9611
1665 Ga0495646_0021027 3300046680 Bacteria 4125
1666 Ga0495646_0076600 3300046680 Bacteria 1958
1667 Ga0495646_0096378 3300046680 Bacteria 1701
1668 Ga0495647_0006868 3300046681 Bacteria 3789
1669 Ga0495647_0025522 3300046681 Bacteria 2159
1670 Ga0495647_0040165 3300046681 Bacteria 1777
1671 Ga0495658_0000609 3300046683 Bacteria 19496
1672 Ga0495658_0001680 3300046683 Bacteria 11515
1673 Ga0495658_0015458 3300046683 Bacteria 3916
1674 Ga0495669_0004250 3300046684 Bacteria 5901
1675 Ga0495669_0050040 3300046684 Bacteria 1873
1676 Ga0495669_0108107 3300046684 Bacteria 1297
1677 Ga0495669_0120953 3300046684 Bacteria 1227
1678 Ga0495669_0151196 3300046684 Bacteria 1099
1679 Ga0495669_0293547 3300046684 Bacteria 783
1680 Ga0495613_0000907 3300046689 Bacteria 22778
1681 Ga0495613_0101904 3300046689 Bacteria 2073
1682 Ga0495613_0510368 3300046689 Bacteria 809
1683 Ga0495613_0602041 3300046689 Bacteria 731
1684 Ga0495613_0672962 3300046689 Bacteria 683
1685 Ga0495624_0000379 3300046690 Bacteria 35446
1686 Ga0495624_0163030 3300046690 Bacteria 1361
1687 Ga0495624_0166561 3300046690 Bacteria 1345
1688 Ga0495624_0203294 3300046690 Bacteria 1203
1689 Ga0495624_0249075 3300046690 Bacteria 1074
1690 Ga0495624_0498795 3300046690 Bacteria 728
1691 Ga0495670_0143536 3300046691 Bacteria 1250
1692 Ga0495671_0182052 3300046692 Bacteria 1021
1693 Ga0495671_0211482 3300046692 Bacteria 940
1694 Ga0495671_0214347 3300046692 Bacteria 933
1695 Ga0495671_0291333 3300046692 Bacteria 786
1696 Ga0495649_0060583 3300046694 Bacteria 2036
1697 Ga0495649_0074839 3300046694 Bacteria 1814
1698 Ga0495649_0247920 3300046694 Bacteria 915
1699 Ga0495649_0516137 3300046694 Bacteria 593
1700 Ga0495649_0692113 3300046694 Bacteria 500
1701 Ga0495589_0332900 3300046794 Bacteria 701
1702 Ga0495589_0533508 3300046794 Bacteria 535
1703 Ga0495600_0000323 3300046809 Bacteria 25342
1704 Ga0495600_0029070 3300046809 Bacteria 3578
1705 Ga0495600_0066129 3300046809 Bacteria 2363
1706 Ga0495600_0153199 3300046809 Bacteria 1492
1707 Ga0495600_0184648 3300046809 Bacteria 1343
1708 Ga0495600_0198087 3300046809 Bacteria 1290
1709 Ga0495600_0474369 3300046809 Bacteria 771
1710 Ga0495660_0303851 3300046810 Bacteria 722
1711 Ga0495581_0000001 3300047315 Bacteria 104278
1712 Ga0495581_0031900 3300047315 Bacteria 3053
1713 Ga0495581_0073603 3300047315 Bacteria 1977
1714 Ga0495581_0193688 3300047315 Bacteria 1189
1715 Ga0495581_0459085 3300047315 Bacteria 742
1716 Ga0495581_0510998 3300047315 Bacteria 698
1717 Ga0495581_0565766 3300047315 Bacteria 659
1718 Ga0495604_0003325 3300047317 Bacteria 12811
1719 Ga0495604_0003557 3300047317 Bacteria 12433
1720 Ga0495604_0004601 3300047317 Bacteria 10931
1721 Ga0495604_0022993 3300047317 Bacteria 4974
1722 Ga0495604_0166344 3300047317 Bacteria 1555
1723 Ga0495636_0020511 3300047318 Bacteria 2663
1724 Ga0495636_0407744 3300047318 Bacteria 648
1725 Ga0495674_0003721 3300047319 Bacteria 14831
1726 Ga0495674_0016137 3300047319 Bacteria 6971
1727 Ga0495674_0020192 3300047319 Bacteria 6171
1728 Ga0495674_0025082 3300047319 Bacteria 5472
1729 Ga0495674_0386015 3300047319 Bacteria 1132
1730 Ga0495674_0779306 3300047319 Bacteria 745
1731 Ga0495674_1219125 3300047319 Bacteria 568
1732 Ga0495672_0312446 3300047320 Bacteria 741
1733 Ga0495672_0452903 3300047320 Bacteria 578
1734 Ga0495672_0459206 3300047320 Bacteria 573
1735 Ga0495676_0021328 3300047321 Bacteria 5661
1736 Ga0495676_0508897 3300047321 Bacteria 790
1737 Ga0495676_0560222 3300047321 Bacteria 746
1738 Ga0495676_0690233 3300047321 Bacteria 661
1739 Ga0495676_0718170 3300047321 Bacteria 646
1740 Ga0495680_0002305 3300047322 Bacteria 19603
1741 Ga0495680_0005416 3300047322 Bacteria 12022
1742 Ga0495680_0111527 3300047322 Bacteria 2026
1743 Ga0495680_0224127 3300047322 Bacteria 1341
1744 Ga0495680_0260009 3300047322 Bacteria 1228
1745 Ga0495680_0355359 3300047322 Bacteria 1019
1746 Ga0495680_0665036 3300047322 Bacteria 691
1747 Ga0495680_0750261 3300047322 Bacteria 641
1748 Ga0495683_0145856 3300047323 Bacteria 1106
1749 Ga0495683_0179805 3300047323 Bacteria 967
1750 Ga0495683_0210576 3300047323 Bacteria 872
1751 Ga0495687_007841 3300047443 Bacteria 6211
1752 Ga0495675_0009211 3300047444 Bacteria 6140
1753 Ga0495675_0026374 3300047444 Bacteria 3705
1754 Ga0495675_0132502 3300047444 Bacteria 1548
1755 Ga0495675_0531106 3300047444 Bacteria 673
1756 Ga0495677_0283641 3300047445 Bacteria 650
1757 Ga0495677_0362414 3300047445 Bacteria 572
1758 Ga0495677_0442185 3300047445 Bacteria 515
1759 Ga0495685_153302 3300047447 Bacteria 748
1760 Ga0495673_0047867 3300047469 Bacteria 1888
1761 Ga0495673_0194329 3300047469 Bacteria 762
1762 Ga0495681_0143221 3300047470 Bacteria 1008
1763 Ga0495681_0237519 3300047470 Bacteria 725
1764 Ga0495684_0000068 3300047471 Bacteria 70808
1765 Ga0495684_0003924 3300047471 Bacteria 11587
1766 Ga0495684_0007928 3300047471 Bacteria 8213
1767 Ga0495684_0037353 3300047471 Bacteria 3725
1768 Ga0495684_0475131 3300047471 Bacteria 864
1769 Ga0495684_0873068 3300047471 Bacteria 582
1770 Ga0495686_0158211 3300047472 Bacteria 1325
1771 Ga0495686_0382836 3300047472 Bacteria 759
1772 Ga0495686_0421754 3300047472 Bacteria 713
1773 Ga0495593_0000006 3300047673 Bacteria 90370
1774 Ga0495593_0000215 3300047673 Bacteria 30493
1775 Ga0495593_0100084 3300047673 Bacteria 1487
1776 Ga0495593_0207943 3300047673 Bacteria 983
1777 Ga0495593_0285089 3300047673 Bacteria 826
1778 Ga0495602_0019107 3300048088 Bacteria 6816
1779 Ga0495602_0031066 3300048088 Bacteria 5055
1780 Ga0495602_0043046 3300048088 Bacteria 4109
1781 Ga0495602_0179921 3300048088 Bacteria 1632
1782 Ga0495602_0321022 3300048088 Bacteria 1127
1783 Ga0495602_0384823 3300048088 Bacteria 1004
1784 Ga0495602_0433098 3300048088 Bacteria 931
1785 Ga0495614_0025788 3300048089 Bacteria 2535
1786 Ga0495614_0075936 3300048089 Bacteria 1452
1787 Ga0495626_0028759 3300048091 Bacteria 2691
1788 Ga0495626_0110688 3300048091 Bacteria 1190
1789 Ga0496100_0015171 3300048903 Bacteria 4495
1790 Ga0496100_0036571 3300048903 Bacteria 3098
1791 Ga0496100_0089601 3300048903 Bacteria 2096
1792 Ga0496100_0407326 3300048903 Bacteria 1037
1793 Ga0496100_0413529 3300048903 Bacteria 1029
1794 Ga0496100_0760173 3300048903 Bacteria 758
1795 Ga0496100_1684505 3300048903 Bacteria 501
1796 Ga0496101_0001159 3300048904 Bacteria 15769
1797 Ga0496101_0100259 3300048904 Bacteria 2166
1798 Ga0496101_0159657 3300048904 Bacteria 1728
1799 Ga0496101_0254464 3300048904 Bacteria 1369
1800 Ga0496101_0320843 3300048904 Bacteria 1215
1801 Ga0496101_0467638 3300048904 Bacteria 995
1802 Ga0496101_1605481 3300048904 Bacteria 505
1803 Ga0496102_0011986 3300048905 Bacteria 7489
1804 Ga0496102_0130187 3300048905 Bacteria 2354
1805 Ga0496102_0283221 3300048905 Bacteria 1562
1806 Ga0496102_0296878 3300048905 Bacteria 1523
1807 Ga0496102_0429549 3300048905 Bacteria 1240
1808 Ga0496102_0452961 3300048905 Bacteria 1204
1809 Ga0496102_1440672 3300048905 Bacteria 608
1810 Ga0496102_1454739 3300048905 Bacteria 604
1811 Ga0496102_1539619 3300048905 Bacteria 583
1812 Ga0496103_0046054 3300048906 Bacteria 2692
1813 Ga0496103_0122790 3300048906 Bacteria 1655
1814 Ga0496103_0143524 3300048906 Bacteria 1528
1815 Ga0496103_0948001 3300048906 Bacteria 538
1816 Ga0496104_0004108 3300048907 Bacteria 12638
1817 Ga0496104_0077101 3300048907 Bacteria 3175
1818 Ga0496104_0101404 3300048907 Bacteria 2756
1819 Ga0496104_0108087 3300048907 Bacteria 2665
1820 Ga0496104_0127604 3300048907 Bacteria 2442
1821 Ga0496104_0306170 3300048907 Bacteria 1501
1822 Ga0496104_0462960 3300048907 Bacteria 1179
1823 Ga0496104_0779858 3300048907 Bacteria 862
1824 Ga0496104_0950562 3300048907 Bacteria 764
1825 Ga0496104_1510856 3300048907 Bacteria 574
1826 Ga0496105_0017252 3300048908 Bacteria 5783
1827 Ga0496105_0067069 3300048908 Bacteria 2962
1828 Ga0496105_0307023 3300048908 Bacteria 1274
1829 Ga0496106_0003069 3300048909 Bacteria 12452
1830 Ga0496106_0007508 3300048909 Bacteria 8059
1831 Ga0496106_0010549 3300048909 Bacteria 6825
1832 Ga0496106_0016349 3300048909 Bacteria 5489
1833 Ga0496106_0246198 3300048909 Bacteria 1429
1834 Ga0496106_0275664 3300048909 Bacteria 1347
1835 Ga0496106_0934696 3300048909 Bacteria 684
1836 Ga0496106_1557946 3300048909 Bacteria 507
1837 Ga0496107_0003589 3300048910 Bacteria 10403
1838 Ga0496107_0025544 3300048910 Bacteria 4183
1839 Ga0496107_0187264 3300048910 Bacteria 1537
1840 Ga0496107_0215756 3300048910 Bacteria 1427
1841 Ga0496107_0234097 3300048910 Bacteria 1367
1842 Ga0496107_0906519 3300048910 Bacteria 642
1843 Ga0496107_0949394 3300048910 Bacteria 625
1844 Ga0496108_0019187 3300048911 Bacteria 5613
1845 Ga0496108_0033963 3300048911 Bacteria 4237
1846 Ga0496108_0316275 3300048911 Bacteria 1361
1847 Ga0496108_0327145 3300048911 Bacteria 1336
1848 Ga0496108_0385443 3300048911 Bacteria 1224
1849 Ga0496108_0437840 3300048911 Bacteria 1142
1850 Ga0496108_0576502 3300048911 Bacteria 981
1851 Ga0496108_1253939 3300048911 Bacteria 625
1852 Ga0496109_0000250 3300048912 Bacteria 51687
1853 Ga0496109_0139783 3300048912 Bacteria 2264
1854 Ga0496109_0235400 3300048912 Bacteria 1723
1855 Ga0496109_0427785 3300048912 Bacteria 1251
1856 Ga0496109_0672623 3300048912 Bacteria 972
1857 Ga0496110_0011301 3300048913 Bacteria 7300
1858 Ga0496110_0038816 3300048913 Bacteria 4145
1859 Ga0496110_0099371 3300048913 Bacteria 2609
1860 Ga0496110_0157712 3300048913 Bacteria 2056
1861 Ga0496110_0204934 3300048913 Bacteria 1792
1862 Ga0496110_0244300 3300048913 Bacteria 1634
1863 Ga0496110_0364156 3300048913 Bacteria 1317
1864 Ga0496110_0886120 3300048913 Bacteria 798
1865 Ga0496110_1660762 3300048913 Bacteria 549
1866 Ga0496111_0107284 3300048914 Bacteria 2056
1867 Ga0496111_0145604 3300048914 Bacteria 1756
1868 Ga0496111_0685396 3300048914 Bacteria 746
1869 Ga0496111_0876424 3300048914 Bacteria 647
1870 Ga0496112_0000044 3300048915 Bacteria 86865
1871 Ga0496112_0007524 3300048915 Bacteria 9669
1872 Ga0496112_0012690 3300048915 Bacteria 7749
1873 Ga0496112_0017262 3300048915 Bacteria 6776
1874 Ga0496112_0021397 3300048915 Bacteria 6150
1875 Ga0496112_0064223 3300048915 Bacteria 3622
1876 Ga0496112_0082922 3300048915 Bacteria 3170
1877 Ga0496112_0133358 3300048915 Bacteria 2454
1878 Ga0496112_0160576 3300048915 Bacteria 2214
1879 Ga0496112_0161330 3300048915 Bacteria 2208
1880 Ga0496113_0036053 3300048916 Bacteria 3622
1881 Ga0496113_0041517 3300048916 Bacteria 3395
1882 Ga0496113_0085558 3300048916 Bacteria 2422
1883 Ga0496113_0099870 3300048916 Bacteria 2248
1884 Ga0496113_0270730 3300048916 Bacteria 1357
1885 Ga0496113_1107108 3300048916 Bacteria 621
1886 Ga0496113_1508498 3300048916 Bacteria 519
1887 Ga0496114_0028062 3300048917 Bacteria 4616
1888 Ga0496114_0188992 3300048917 Bacteria 1801
1889 Ga0496114_0400391 3300048917 Bacteria 1215
1890 Ga0496114_0976084 3300048917 Bacteria 730
1891 Ga0496115_0001185 3300048918 Bacteria 18687
1892 Ga0496115_0015033 3300048918 Bacteria 5866
1893 Ga0496115_0091121 3300048918 Bacteria 2491
1894 Ga0496115_0187739 3300048918 Bacteria 1708
1895 Ga0496115_0434256 3300048918 Bacteria 1062
1896 Ga0496115_0541455 3300048918 Bacteria 931
1897 Ga0496115_0741166 3300048918 Bacteria 769
1898 Ga0496115_0835835 3300048918 Bacteria 714
1899 Ga0496115_1311967 3300048918 Bacteria 538
1900 Ga0496116_0150200 3300048919 Bacteria 1296
1901 Ga0496116_0396387 3300048919 Bacteria 613
1902 Ga0496116_0449015 3300048919 Bacteria 553
1903 Ga0496117_0079372 3300048920 Bacteria 2163
1904 Ga0496117_0095575 3300048920 Bacteria 1898
1905 Ga0496117_0171061 3300048920 Bacteria 1261
1906 Ga0496117_0176847 3300048920 Bacteria 1232
1907 Ga0496117_0262276 3300048920 Bacteria 936
1908 Ga0496118_0003016 3300048921 Bacteria 21744
1909 Ga0496118_0039641 3300048921 Bacteria 3756
1910 Ga0496118_0112001 3300048921 Bacteria 1808
1911 Ga0496118_0158646 3300048921 Bacteria 1403
1912 Ga0496118_0186498 3300048921 Bacteria 1246
1913 Ga0496118_0227539 3300048921 Bacteria 1079
1914 Ga0496118_0304693 3300048921 Bacteria 873
1915 Ga0496118_0568866 3300048921 Bacteria 549
1916 Ga0496119_0015793 3300048922 Bacteria 5784
1917 Ga0496119_0026363 3300048922 Bacteria 4031
1918 Ga0496119_0038363 3300048922 Bacteria 3097
1919 Ga0496119_0191033 3300048922 Bacteria 1067
1920 Ga0496119_0286632 3300048922 Bacteria 817
1921 Ga0496120_0024028 3300048923 Bacteria 3807
1922 Ga0496120_0129994 3300048923 Bacteria 1291
1923 Ga0496120_0226667 3300048923 Bacteria 890
1924 Ga0496121_0000041 3300048924 Bacteria 346686
1925 Ga0496121_0000643 3300048924 Bacteria 65217
1926 Ga0496121_0003467 3300048924 Bacteria 22478
1927 Ga0496121_0018262 3300048924 Bacteria 7085
1928 Ga0496121_0019164 3300048924 Bacteria 6856
1929 Ga0496121_0028124 3300048924 Bacteria 5241
1930 Ga0496121_0028955 3300048924 Bacteria 5140
1931 Ga0496121_0032744 3300048924 Bacteria 4718
1932 Ga0496121_0059096 3300048924 Bacteria 3163
1933 Ga0496121_0134334 3300048924 Bacteria 1845
1934 Ga0496121_0181239 3300048924 Bacteria 1520
1935 Ga0496121_0232362 3300048924 Bacteria 1291
1936 Ga0496121_0280122 3300048924 Bacteria 1141
1937 Ga0496121_0325480 3300048924 Bacteria 1033
1938 Ga0496121_0453732 3300048924 Bacteria 825
1939 Ga0496121_0738183 3300048924 Bacteria 587
1940 Ga0496122_0111930 3300048925 Bacteria 1789
1941 Ga0496122_0267507 3300048925 Bacteria 944
1942 Ga0496123_0122194 3300048926 Bacteria 1462
1943 Ga0496123_0460637 3300048926 Bacteria 564
1944 Ga0496124_0007272 3300048927 Bacteria 11809
1945 Ga0496124_0080603 3300048927 Bacteria 2678
1946 Ga0496124_0228578 3300048927 Bacteria 1393
1947 Ga0496124_0516005 3300048927 Bacteria 797
1948 Ga0496124_0550897 3300048927 Bacteria 761
1949 Ga0496124_0681154 3300048927 Bacteria 655
1950 Ga0496124_0747205 3300048927 Bacteria 613
1951 Ga0496125_0000578 3300048928 Bacteria 62666
1952 Ga0496125_0188520 3300048928 Bacteria 1365
1953 Ga0496125_0246826 3300048928 Bacteria 1129
1954 Ga0496125_0357683 3300048928 Bacteria 869
1955 Ga0496125_0422027 3300048928 Bacteria 773
1956 Ga0496125_0697017 3300048928 Bacteria 540
1957 Ga0496126_0009677 3300048929 Bacteria 10214
1958 Ga0496126_0012003 3300048929 Bacteria 8903
1959 Ga0496126_0014128 3300048929 Bacteria 8085
1960 Ga0496126_0036950 3300048929 Bacteria 4562
1961 Ga0496126_0039833 3300048929 Bacteria 4357
1962 Ga0496126_0076682 3300048929 Bacteria 2965
1963 Ga0496126_0226191 3300048929 Bacteria 1569
1964 Ga0496126_0242665 3300048929 Bacteria 1504
1965 Ga0496126_0243238 3300048929 Bacteria 1502
1966 Ga0496126_0262096 3300048929 Bacteria 1437
1967 Ga0496126_0289644 3300048929 Bacteria 1354
1968 Ga0496126_0346442 3300048929 Bacteria 1216
1969 Ga0496126_0382877 3300048929 Bacteria 1145
1970 Ga0496126_0412397 3300048929 Bacteria 1093
1971 Ga0496126_0513466 3300048929 Bacteria 956
1972 Ga0496126_0733851 3300048929 Bacteria 764
1973 Ga0496126_0752367 3300048929 Bacteria 752
1974 Ga0496126_0817492 3300048929 Bacteria 713
1975 Ga0495682_0035863 3300049460 Bacteria 1826
1976 Ga0495682_0221107 3300049460 Bacteria 671
1977 Ga0495682_0324394 3300049460 Bacteria 543
1978 Ga0495682_0355242 3300049460 Bacteria 516
1979 Ga0495682_0373590 3300049460 Bacteria 502
1980 Ga0501031_0000652 3300049568 Bacteria 20544
1981 Ga0501031_0006542 3300049568 Bacteria 7597
1982 Ga0501032_0000046 3300049569 Bacteria 109405
1983 Ga0501032_0008287 3300049569 Bacteria 7573
1984 Ga0501032_0074850 3300049569 Bacteria 2256
1985 Ga0501032_0394987 3300049569 Bacteria 889
1986 Ga0501033_0000091 3300049570 Bacteria 85666
1987 Ga0501033_0000232 3300049570 Bacteria 53703
1988 Ga0501033_0202762 3300049570 Bacteria 1416
1989 Ga0501033_0229469 3300049570 Bacteria 1319
1990 Ga0501033_0385211 3300049570 Bacteria 979
1991 Ga0501033_1183280 3300049570 Bacteria 507
1992 Ga0501034_0000039 3300049571 Bacteria 237357
1993 Ga0501034_0000704 3300049571 Bacteria 50735
1994 Ga0501034_0041940 3300049571 Bacteria 4631
1995 Ga0501034_0073466 3300049571 Bacteria 3429
1996 Ga0501034_0485172 3300049571 Bacteria 1151
1997 Ga0501034_0529392 3300049571 Bacteria 1090
1998 Ga0501034_0565716 3300049571 Bacteria 1045
1999 Ga0501034_1096816 3300049571 Bacteria 677
2000 Ga0501034_1400699 3300049571 Bacteria 574
2001 Ga0501036_0000007 3300049572 Bacteria 240500
2002 Ga0501036_0000052 3300049572 Bacteria 74795
2003 Ga0501036_0613644 3300049572 Bacteria 902
2004 Ga0501036_1361374 3300049572 Bacteria 576
2005 Ga0501036_1434623 3300049572 Bacteria 559
2006 Ga0501036_1614410 3300049572 Bacteria 523
2007 Ga0501037_0000025 3300049573 Bacteria 143276
2008 Ga0501037_0000550 3300049573 Bacteria 29844
2009 Ga0501038_0000026 3300049574 Bacteria 146493
2010 Ga0501038_0001467 3300049574 Bacteria 21697
2011 Ga0501038_0286798 3300049574 Bacteria 1295
2012 Ga0501038_0980705 3300049574 Bacteria 621
2013 Ga0501038_1305721 3300049574 Bacteria 524
2014 Ga0501039_0000005 3300049575 Bacteria 295471
2015 Ga0501039_0000719 3300049575 Bacteria 23853
2016 Ga0501039_0900412 3300049575 Bacteria 689
2017 Ga0501040_0702180 3300049576 Bacteria 732
2018 Ga0501042_0294891 3300049578 Bacteria 1171
2019 Ga0501043_0000036 3300049579 Bacteria 132959
2020 Ga0501043_0003933 3300049579 Bacteria 12187
2021 Ga0501043_0024382 3300049579 Bacteria 4747
2022 Ga0501043_0114870 3300049579 Bacteria 2113
2023 Ga0501043_0506475 3300049579 Bacteria 901
2024 Ga0501046_0000147 3300049580 Bacteria 74186
2025 Ga0501046_0000231 3300049580 Bacteria 57655
2026 Ga0501046_0130234 3300049580 Bacteria 1908
2027 Ga0501046_0188160 3300049580 Bacteria 1541
2028 Ga0501047_0000101 3300049581 Bacteria 104950
2029 Ga0501047_0000457 3300049581 Bacteria 45136
2030 Ga0501047_0020324 3300049581 Bacteria 6376
2031 Ga0501047_0035146 3300049581 Bacteria 4841
2032 Ga0501047_0061023 3300049581 Bacteria 3638
2033 Ga0501047_0096339 3300049581 Bacteria 2837
2034 Ga0501047_0467379 3300049581 Bacteria 1090
2035 Ga0501047_1179482 3300049581 Bacteria 579
2036 Ga0501047_1244723 3300049581 Bacteria 558
2037 Ga0501048_0006581 3300049582 Bacteria 8832
2038 Ga0501048_0362112 3300049582 Bacteria 1035
2039 Ga0501048_0826763 3300049582 Bacteria 666
2040 Ga0501067_0019194 3300049583 Bacteria 3784
2041 Ga0501067_0021998 3300049583 Bacteria 3528
2042 Ga0501067_0103626 3300049583 Bacteria 1581
2043 Ga0501067_0550195 3300049583 Bacteria 646
2044 Ga0501068_0001352 3300049584 Bacteria 12996
2045 Ga0501068_0027461 3300049584 Bacteria 3361
2046 Ga0501068_1149979 3300049584 Bacteria 514
2047 Ga0501068_1173230 3300049584 Bacteria 509
2048 Ga0501069_0004096 3300049585 Bacteria 7521
2049 Ga0501070_0000297 3300049586 Bacteria 46317
2050 Ga0501070_0003647 3300049586 Bacteria 13317
2051 Ga0501070_0067053 3300049586 Bacteria 2972
2052 Ga0501070_0199997 3300049586 Bacteria 1641
2053 Ga0501070_0635895 3300049586 Bacteria 848
2054 Ga0501070_0684894 3300049586 Bacteria 812
2055 Ga0501070_0750510 3300049586 Bacteria 769
2056 Ga0501070_1063515 3300049586 Bacteria 625
2057 Ga0501071_0021622 3300049587 Bacteria 4482
2058 Ga0501072_0005648 3300049588 Bacteria 9524
2059 Ga0501072_0770408 3300049588 Bacteria 754
2060 Ga0501073_0000877 3300049589 Bacteria 21517
2061 Ga0501073_0037404 3300049589 Bacteria 3446
2062 Ga0501073_0841887 3300049589 Bacteria 632
2063 Ga0501074_0005054 3300049590 Bacteria 9464
2064 Ga0501074_0051846 3300049590 Bacteria 2961
2065 Ga0501074_0377557 3300049590 Bacteria 1006
2066 Ga0501074_0499960 3300049590 Bacteria 861
2067 Ga0501079_0093370 3300049741 Bacteria 2331
2068 Ga0501079_0162536 3300049741 Bacteria 1741
2069 Ga0501080_0000124 3300049742 Bacteria 54519
2070 Ga0501080_0000382 3300049742 Bacteria 34121
2071 Ga0501080_1080328 3300049742 Bacteria 693
2072 Ga0501080_1178709 3300049742 Bacteria 659
2073 Ga0501080_1465750 3300049742 Bacteria 581
2074 Ga0501080_1620591 3300049742 Bacteria 548
2075 Ga0501083_0000929 3300049744 Bacteria 19443
2076 Ga0501083_0324842 3300049744 Bacteria 1001
2077 Ga0501267_043493 3300049764 Bacteria 567
2078 Ga0501035_0000052 3300049822 Bacteria 143038
2079 Ga0501035_0001237 3300049822 Bacteria 26512
2080 Ga0501035_0081438 3300049822 Bacteria 2857
2081 Ga0501035_0251644 3300049822 Bacteria 1500
2082 Ga0501035_0256897 3300049822 Bacteria 1482
2083 Ga0501035_0392703 3300049822 Bacteria 1155
2084 Ga0501035_1096282 3300049822 Bacteria 622
2085 Ga0501044_0000217 3300049823 Bacteria 73242
2086 Ga0501044_0000366 3300049823 Bacteria 56832
2087 Ga0501044_0022498 3300049823 Bacteria 6716
2088 Ga0501044_0056626 3300049823 Bacteria 4025
2089 Ga0501044_0060176 3300049823 Bacteria 3890
2090 Ga0501044_0172671 3300049823 Bacteria 2132
2091 Ga0501044_0232962 3300049823 Bacteria 1788
2092 Ga0501044_0280774 3300049823 Bacteria 1599
2093 Ga0501044_0367799 3300049823 Bacteria 1355
2094 Ga0501044_0507246 3300049823 Bacteria 1107
2095 Ga0501044_0550894 3300049823 Bacteria 1050
2096 Ga0501044_0570969 3300049823 Bacteria 1026
2097 Ga0501044_0663802 3300049823 Bacteria 931
2098 Ga0501044_1251831 3300049823 Bacteria 609
2099 Ga0501045_0009980 3300049824 Bacteria 6641
2100 Ga0501045_0046654 3300049824 Bacteria 3155
2101 nmdc:mga03683_313740_c1 3300050489 Bacteria 737
2102 nmdc:mga03683_79868_c1 3300050489 Bacteria 1411
2103 nmdc:mga03n38_121508_c1 3300050490 Bacteria 1284
2104 nmdc:mga03n38_1240_c1 3300050490 Bacteria 7174
2105 nmdc:mga03n38_335316_c1 3300050490 Bacteria 820
2106 nmdc:mga03n38_364542_c1 3300050490 Bacteria 789
2107 nmdc:mga03n38_51358_c1 3300050490 Bacteria 1841
2108 nmdc:mga03n38_86681_c1 3300050490 Bacteria 1482
2109 nmdc:mga00v17_125857_c1 3300050491 Bacteria 1635
2110 nmdc:mga00v17_20822_c1 3300050491 Bacteria 3762
2111 nmdc:mga00v17_221836_c1 3300050491 Bacteria 1224
2112 nmdc:mga00v17_330924_c1 3300050491 Bacteria 990
2113 nmdc:mga0yw44_16875_c1 3300050492 Bacteria 3956
2114 nmdc:mga0yw44_214731_c1 3300050492 Bacteria 1273
2115 nmdc:mga0yw44_253139_c1 3300050492 Bacteria 1173
2116 nmdc:mga0yw44_269525_c1 3300050492 Bacteria 1136
2117 nmdc:mga0yw44_398332_c1 3300050492 Bacteria 931
2118 nmdc:mga0yw44_47694_c1 3300050492 Bacteria 2580
2119 nmdc:mga0yw44_60824_c1 3300050492 Bacteria 2315
2120 nmdc:mga0yw44_839926_c1 3300050492 Bacteria 623
2121 nmdc:mga0yw44_861874_c1 3300050492 Bacteria 615
2122 nmdc:mga0yw44_909013_c1 3300050492 Bacteria 597
2123 nmdc:mga0k408_126071_c1 3300050493 Bacteria 1519
2124 nmdc:mga0k408_42687_c1 3300050493 Bacteria 2612
2125 nmdc:mga0k408_562967_c1 3300050493 Bacteria 673
2126 nmdc:mga0k408_835182_c1 3300050493 Bacteria 536
2127 nmdc:mga06z11_1013503_c1 3300050494 Bacteria 506
2128 nmdc:mga06z11_163242_c1 3300050494 Bacteria 1275
2129 nmdc:mga06z11_2124_c1 3300050494 Bacteria 7515
2130 nmdc:mga06z11_238606_c1 3300050494 Bacteria 1067
2131 nmdc:mga06z11_276552_c1 3300050494 Bacteria 994
2132 nmdc:mga06z11_304692_c1 3300050494 Bacteria 948
2133 nmdc:mga06z11_593010_c1 3300050494 Bacteria 674
2134 nmdc:mga06z11_855150_c1 3300050494 Bacteria 554
2135 nmdc:mga06z11_862023_c1 3300050494 Bacteria 552
2136 nmdc:mga04h51_117958_c1 3300050495 Bacteria 986
2137 nmdc:mga04h51_140852_c1 3300050495 Bacteria 915
2138 nmdc:mga04h51_145486_c1 3300050495 Bacteria 902
2139 nmdc:mga04h51_293332_c1 3300050495 Bacteria 661
2140 nmdc:mga07m45_10503_c1 3300050496 Bacteria 4838
2141 nmdc:mga07m45_24533_c1 3300050496 Bacteria 3305
2142 nmdc:mga07m45_431991_c1 3300050496 Bacteria 764
2143 nmdc:mga07m45_438638_c1 3300050496 Bacteria 757
2144 nmdc:mga07m45_5369_c1 3300050496 Bacteria 6379
2145 nmdc:mga07m45_94253_c1 3300050496 Bacteria 1717
2146 nmdc:mga05p37_149693_c1 3300050507 Bacteria 2856
2147 nmdc:mga05p37_2246975_c1 3300050507 Bacteria 504
2148 nmdc:mga08y16_105399_c1 3300050511 Bacteria 2935
2149 nmdc:mga08y16_273475_c1 3300050511 Bacteria 1743
2150 nmdc:mga0n895_4334_c1 3300050512 Bacteria 11629
2151 nmdc:mga0rr50_109474_c1 3300050513 Bacteria 2184
2152 nmdc:mga0rr50_287538_c1 3300050513 Bacteria 1373
2153 nmdc:mga0rr50_642623_c1 3300050513 Bacteria 905
2154 nmdc:mga0rr50_651752_c1 3300050513 Bacteria 898
2155 nmdc:mga08x19_162520_c1 3300050514 Bacteria 1517
2156 nmdc:mga08x19_167838_c1 3300050514 Bacteria 1493
2157 nmdc:mga0a205_434695_c1 3300050515 Bacteria 1173
2158 nmdc:mga0sz30_13512_c1 3300050516 Bacteria 2762
2159 nmdc:mga0sz30_173900_c1 3300050516 Bacteria 955
2160 nmdc:mga0sz30_280339_c1 3300050516 Bacteria 743
2161 nmdc:mga0sz30_4476_c1 3300050516 Bacteria 5053
2162 nmdc:mga0sz30_62031_c1 3300050516 Bacteria 1598
2163 Ga0495601_0056584 3300053077 Bacteria 2484
2164 Ga0495601_0058736 3300053077 Bacteria 2438
2165 Ga0495601_0144307 3300053077 Bacteria 1553
2166 Ga0495601_0163428 3300053077 Bacteria 1455
2167 Ga0495601_0982238 3300053077 Bacteria 531
2168 Ga0495612_0055802 3300053078 Bacteria 1629
2169 Ga0495612_0169009 3300053078 Bacteria 957
2170 Ga0495612_0184575 3300053078 Bacteria 917
2171 Ga0500610_0401615 3300053079 Bacteria 557
2172 Ga0500635_0162773 3300053080 Bacteria 856
2173 Ga0500635_0338901 3300053080 Bacteria 595
2174 Ga0495655_0018385 3300053083 Bacteria 1535
2175 Ga0495655_0120559 3300053083 Bacteria 798
2176 Ga0495595_0005974 3300053084 Bacteria 4942
2177 Ga0495595_0008598 3300053084 Bacteria 4198
2178 Ga0495595_0099485 3300053084 Bacteria 1402
2179 Ga0495595_0133640 3300053084 Bacteria 1214
2180 Ga0495619_0000711 3300053085 Bacteria 21704
2181 Ga0495619_0128788 3300053085 Bacteria 1738
2182 Ga0495619_0323619 3300053085 Bacteria 1067
2183 Ga0495619_0395181 3300053085 Bacteria 955
2184 Ga0495619_0796690 3300053085 Bacteria 639
2185 Ga0495619_0827275 3300053085 Bacteria 625
2186 Ga0500578_0089111 3300053086 Bacteria 1959
2187 Ga0500578_0101708 3300053086 Bacteria 1818
2188 Ga0500578_0195004 3300053086 Bacteria 1242
2189 Ga0500578_0556067 3300053086 Bacteria 637
2190 Ga0500578_0694932 3300053086 Bacteria 548
2191 Ga0500643_000069 3300053087 Bacteria 116366
2192 Ga0500644_0436010 3300053088 Bacteria 573
2193 Ga0500646_0088326 3300053090 Bacteria 956
2194 Ga0500647_0017088 3300053091 Bacteria 3341
2195 Ga0500647_0037133 3300053091 Bacteria 2330
2196 Ga0500647_0093665 3300053091 Bacteria 1437
2197 Ga0500647_0321716 3300053091 Bacteria 654
2198 Ga0500583_0094842 3300053092 Bacteria 1455
2199 Ga0500583_0350973 3300053092 Bacteria 715
2200 Ga0500651_0000824 3300053093 Bacteria 15193
2201 Ga0500651_0062542 3300053093 Bacteria 2324
2202 Ga0500651_0325465 3300053093 Bacteria 877
2203 Ga0500651_0557538 3300053093 Bacteria 626
2204 Ga0500651_0749879 3300053093 Bacteria 518
2205 Ga0500566_0000608 3300053094 Bacteria 20128
2206 Ga0500566_0003815 3300053094 Bacteria 8982
2207 Ga0500566_0004782 3300053094 Bacteria 8069
2208 Ga0500566_0005056 3300053094 Bacteria 7864
2209 Ga0500566_0011120 3300053094 Bacteria 5302
2210 Ga0500566_0068687 3300053094 Bacteria 1992
2211 Ga0500640_018353 3300053095 Bacteria 2982
2212 Ga0500640_085847 3300053095 Bacteria 1327
2213 Ga0500641_0003947 3300053096 Bacteria 5243
2214 Ga0500641_0004337 3300053096 Bacteria 5005
2215 Ga0500641_0361133 3300053096 Bacteria 581
2216 Ga0500648_380166 3300053097 Bacteria 552
2217 Ga0500554_007221 3300053102 Bacteria 2542
2218 Ga0500554_078200 3300053102 Bacteria 1086
2219 Ga0500555_004853 3300053103 Bacteria 3815
2220 Ga0500555_139789 3300053103 Bacteria 597
2221 Ga0500556_0009103 3300053104 Bacteria 2879
2222 Ga0500557_000003 3300053105 Bacteria 228429
2223 Ga0500558_222791 3300053106 Bacteria 640
2224 Ga0500562_019809 3300053108 Bacteria 1744
2225 Ga0500562_064884 3300053108 Bacteria 983
2226 Ga0500569_022899 3300053109 Bacteria 1671
2227 Ga0500569_075342 3300053109 Bacteria 1070
2228 Ga0500569_128954 3300053109 Bacteria 846
2229 Ga0500572_000104 3300053111 Bacteria 27828
2230 Ga0500572_000220 3300053111 Bacteria 20281
2231 Ga0500572_004858 3300053111 Bacteria 3043
2232 Ga0500572_065576 3300053111 Bacteria 1112
2233 Ga0500591_036508 3300053115 Bacteria 2357
2234 Ga0500595_000200 3300053119 Bacteria 40977
2235 Ga0500595_000875 3300053119 Bacteria 17178
2236 Ga0500595_002551 3300053119 Bacteria 8923
2237 Ga0500595_004958 3300053119 Bacteria 5878
2238 Ga0500595_008437 3300053119 Bacteria 4208
2239 Ga0500595_066609 3300053119 Bacteria 1076
2240 Ga0500595_074685 3300053119 Bacteria 1001
2241 Ga0500595_106602 3300053119 Bacteria 799
2242 Ga0500607_065380 3300053121 Bacteria 1890
2243 Ga0500608_012547 3300053122 Bacteria 3720
2244 Ga0500608_025531 3300053122 Bacteria 2766
2245 Ga0500608_230500 3300053122 Bacteria 739
2246 Ga0500614_003064 3300053123 Bacteria 3632
2247 Ga0500614_170743 3300053123 Bacteria 662
2248 Ga0500642_0000051 3300053130 Bacteria 77123
2249 Ga0500642_0003167 3300053130 Bacteria 4936
2250 Ga0500642_0048786 3300053130 Bacteria 1861
2251 Ga0500655_014210 3300053133 Bacteria 1456
2252 Ga0500655_062547 3300053133 Bacteria 751
2253 Ga0500658_0024537 3300053134 Bacteria 2310
2254 Ga0500658_0323797 3300053134 Bacteria 708
2255 Ga0500559_0000907 3300053136 Bacteria 18879
2256 Ga0500559_0000932 3300053136 Bacteria 18458
2257 Ga0500559_0007519 3300053136 Bacteria 4819
2258 Ga0500559_0018715 3300053136 Bacteria 2925
2259 Ga0500559_0040143 3300053136 Bacteria 2037
2260 Ga0500559_0218519 3300053136 Bacteria 899
2261 Ga0500559_0295429 3300053136 Bacteria 761
2262 Ga0500559_0535449 3300053136 Bacteria 535
2263 Ga0500564_162552 3300053138 Bacteria 944
2264 Ga0500568_0000268 3300053139 Bacteria 44102
2265 Ga0500568_0040806 3300053139 Bacteria 1867
2266 Ga0500568_0090890 3300053139 Bacteria 1151
2267 Ga0500568_0105734 3300053139 Bacteria 1054
2268 Ga0500568_0112834 3300053139 Bacteria 1015
2269 Ga0500573_0338042 3300053140 Bacteria 736
2270 Ga0500577_0197950 3300053142 Bacteria 866
2271 Ga0500577_0402486 3300053142 Bacteria 599
2272 Ga0500588_0027983 3300053146 Bacteria 1594
2273 Ga0500589_172020 3300053147 Bacteria 860
2274 Ga0500589_181400 3300053147 Bacteria 827
2275 Ga0500589_235415 3300053147 Bacteria 681
2276 Ga0500590_093815 3300053148 Bacteria 1453
2277 Ga0500590_126032 3300053148 Bacteria 1192
2278 Ga0500590_327498 3300053148 Bacteria 560
2279 Ga0500603_000137 3300053150 Bacteria 17488
2280 Ga0500603_000240 3300053150 Bacteria 14346
2281 Ga0500603_100510 3300053150 Bacteria 859
2282 Ga0500604_0182591 3300053151 Bacteria 719
2283 Ga0500616_0000028 3300053153 Bacteria 435722
2284 Ga0500616_0015823 3300053153 Bacteria 4307
2285 Ga0500616_0154289 3300053153 Bacteria 1060
2286 Ga0500616_0200182 3300053153 Bacteria 885
2287 Ga0500619_214535 3300053154 Bacteria 642
2288 Ga0500620_032096 3300053155 Bacteria 1670
2289 Ga0500620_110952 3300053155 Bacteria 960
2290 Ga0500622_0009323 3300053156 Bacteria 5439
2291 Ga0500627_0037154 3300053158 Bacteria 2077
2292 Ga0500627_0179988 3300053158 Bacteria 951
2293 Ga0500627_0413630 3300053158 Bacteria 573
2294 Ga0500630_002999 3300053159 Bacteria 8154
2295 Ga0500633_0258537 3300053160 Bacteria 646
2296 Ga0500634_0111726 3300053161 Bacteria 1347
2297 Ga0500638_015970 3300053162 Bacteria 3455
2298 Ga0500638_039878 3300053162 Bacteria 2280
2299 Ga0500638_045446 3300053162 Bacteria 2131
2300 Ga0500638_308264 3300053162 Bacteria 607
2301 Ga0500639_000071 3300053163 Bacteria 46808
2302 Ga0500639_007676 3300053163 Bacteria 5608
2303 Ga0500639_059159 3300053163 Bacteria 1979
2304 Ga0500636_0000166 3300053177 Bacteria 34574
2305 Ga0500636_0001770 3300053177 Bacteria 11833
2306 Ga0500636_0027127 3300053177 Bacteria 3382
2307 Ga0500636_0091798 3300053177 Bacteria 1738
2308 Ga0500636_0240712 3300053177 Bacteria 929
2309 Ga0500636_0251260 3300053177 Bacteria 901
2310 Ga0500637_0000144 3300053178 Bacteria 26094
2311 Ga0500637_0044593 3300053178 Bacteria 2513
2312 Ga0500637_0081623 3300053178 Bacteria 1867
2313 Ga0500637_0088641 3300053178 Bacteria 1790
2314 Ga0500637_0515925 3300053178 Bacteria 588
2315 Ga0500649_133568 3300053722 Bacteria 924
2316 Ga0500576_130409 3300053725 Bacteria 974
2317 Ga0500576_231663 3300053725 Bacteria 594
2318 Ga0500611_055120 3300053727 Bacteria 924
2319 Ga0500657_073300 3300053728 Bacteria 1493
2320 Ga0500625_007957 3300053729 Bacteria 4642
2321 Ga0500625_157424 3300053729 Bacteria 841
2322 Ga0500645_013058 3300053730 Bacteria 2674
2323 Ga0500645_017503 3300053730 Bacteria 2245
2324 Ga0500552_029933 3300053733 Bacteria 832
2325 Ga0500552_070706 3300053733 Bacteria 626
2326 Ga0500596_001829 3300053735 Bacteria 4278
2327 Ga0500596_012156 3300053735 Bacteria 1309
2328 Ga0500596_019220 3300053735 Bacteria 1026
2329 Ga0500596_049359 3300053735 Bacteria 685
2330 Ga0500599_001634 3300053736 Bacteria 2609
2331 Ga0500601_000090 3300053737 Bacteria 18998
2332 Ga0500601_002582 3300053737 Bacteria 1941
2333 Ga0501084_0000683 3300054114 Bacteria 25896
2334 Ga0501084_0608474 3300054114 Bacteria 923
2335 Ga0501084_1453798 3300054114 Bacteria 574
2336 Ga0500661_029156 3300055283 Bacteria 974
2337 Ga0501082_0128046 3300060353 Bacteria 2202
2338 Ga0501082_0727055 3300060353 Bacteria 869
2339 Ga0501082_1758048 3300060353 Bacteria 541
2340 Ga0466962_0062122 3300061719 Bacteria 1783
2341 Ga0466962_0142351 3300061719 Bacteria 1162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100902134 Ga0070675_1009021342 94
2 3300005471 Ga0070698_101188355 Ga0070698_1011883552 94
3 3300006038 Ga0075365_11053910 Ga0075365_110539102 94
4 3300009093 Ga0105240_10083219 Ga0105240_100832192 94
5 3300009093 Ga0105240_10617448 Ga0105240_106174482 94
6 3300009174 Ga0105241_10216483 Ga0105241_102164833 94
7 3300009545 Ga0105237_10092892 Ga0105237_100928925 94
8 3300009551 Ga0105238_10136516 Ga0105238_101365164 94
9 3300010375 Ga0105239_10000300 Ga0105239_1000030025 94
10 3300013297 Ga0157378_13238719 Ga0157378_132387192 94
11 3300025911 Ga0207654_10120875 Ga0207654_101208752 94
12 3300025913 Ga0207695_10087874 Ga0207695_100878742 94
13 3300025913 Ga0207695_10419991 Ga0207695_104199912 94
14 3300025914 Ga0207671_10197133 Ga0207671_101971333 94
15 3300025924 Ga0207694_10089308 Ga0207694_100893081 94
16 3300028794 Ga0307515_10772173 Ga0307515_107721731 94
17 3300028800 Ga0265338_10360034 Ga0265338_103600342 94
18 3300031456 Ga0307513_10145947 Ga0307513_101459472 94
19 3300035116 Ga0373945_0212374 Ga0373945_0212374_94_378 94
20 3300035725 Ga0373947_0422522 Ga0373947_0422522_314_598 94
21 3300037418 Ga0395900_1068269 Ga0395900_1068269_62_346 94
22 3300038443 Ga0395901_0809185 Ga0395901_0809185_345_629 94
23 3300039450 Ga0436363_0024152 Ga0436363_0024152_290_574 94
24 3300039450 Ga0436363_0860393 Ga0436363_0860393_104_388 94
25 3300039453 Ga0436362_1011511 Ga0436362_1011511_37_321 94
26 3300042006 Ga0439432_183404 Ga0439432_183404_45_329 94
27 3300042435 Ga0439434_0374281 Ga0439434_0374281_151_435 94
28 3300046459 Ga0495629_0130610 Ga0495629_0130610_902_1186 94
29 3300046472 Ga0495580_0004083 Ga0495580_0004083_546_830 94
30 3300046473 Ga0495582_0005892 Ga0495582_0005892_3166_3450 94
31 3300046506 Ga0495583_0027663 Ga0495583_0027663_1430_1714 94
32 3300046683 Ga0495658_0001680 Ga0495658_0001680_318_602 94
33 3300047315 Ga0495581_0031900 Ga0495581_0031900_1103_1387 94
34 3300053085 Ga0495619_0323619 Ga0495619_0323619_253_537 94
35 3300001989 JGI24739J22299_10137440 JGI24739J22299_101374402 95
36 3300001989 JGI24739J22299_10153996 JGI24739J22299_101539961 95
37 3300002077 JGI24744J21845_10058285 JGI24744J21845_100582852 95
38 3300003187 JGI25151J46595_10000400 JGI25151J46595_1000040027 95
39 3300003203 JGI25406J46586_10000223 JGI25406J46586_1000022315 95
40 3300003203 JGI25406J46586_10197763 JGI25406J46586_101977631 95
41 3300003214 JGI25165J46597_1018105 JGI25165J46597_10181052 95
42 3300003214 JGI25165J46597_1018157 JGI25165J46597_10181571 95
43 3300003215 JGI25153J46596_10002250 JGI25153J46596_100022508 95
44 3300003215 JGI25153J46596_10005183 JGI25153J46596_100051836 95
45 3300003215 JGI25153J46596_10009625 JGI25153J46596_100096253 95
46 3300003215 JGI25153J46596_10033053 JGI25153J46596_100330532 95
47 3300003215 JGI25153J46596_10083309 JGI25153J46596_100833091 95
48 3300003215 JGI25153J46596_10132788 JGI25153J46596_101327881 95
49 3300003354 JGI25160J50197_1001031 JGI25160J50197_10010314 95
50 3300003354 JGI25160J50197_1002951 JGI25160J50197_10029515 95
51 3300003354 JGI25160J50197_1003809 JGI25160J50197_10038092 95
52 3300003354 JGI25160J50197_1033199 JGI25160J50197_10331992 95
53 3300003659 JGI25404J52841_10018418 JGI25404J52841_100184182 95
54 3300003659 JGI25404J52841_10039011 JGI25404J52841_100390112 95
55 3300003659 JGI25404J52841_10043338 JGI25404J52841_100433382 95
56 3300003659 JGI25404J52841_10103902 JGI25404J52841_101039022 95
57 3300003752 Ga0055539_1009825 Ga0055539_10098251 95
58 3300003759 Ga0055525_1014312 Ga0055525_10143121 95
59 3300004625 Ga0055543_1001737 Ga0055543_10017376 95
60 3300004625 Ga0055543_1030721 Ga0055543_10307212 95
61 3300005262 Ga0065165_1001202 Ga0065165_100120214 95
62 3300005262 Ga0065165_1001214 Ga0065165_100121414 95
63 3300005262 Ga0065165_1010203 Ga0065165_10102034 95
64 3300005262 Ga0065165_1016608 Ga0065165_10166083 95
65 3300005289 Ga0065704_10499915 Ga0065704_104999152 95
66 3300005293 Ga0065715_10554396 Ga0065715_105543962 95
67 3300005293 Ga0065715_11083940 Ga0065715_110839401 95
68 3300005327 Ga0070658_10008337 Ga0070658_100083375 95
69 3300005327 Ga0070658_10056829 Ga0070658_100568292 95
70 3300005327 Ga0070658_10178655 Ga0070658_101786552 95
71 3300005327 Ga0070658_10216137 Ga0070658_102161372 95
72 3300005327 Ga0070658_10220782 Ga0070658_102207822 95
73 3300005327 Ga0070658_10449289 Ga0070658_104492892 95
74 3300005328 Ga0070676_10766281 Ga0070676_107662812 95
75 3300005329 Ga0070683_100084930 Ga0070683_1000849303 95
76 3300005329 Ga0070683_100175583 Ga0070683_1001755832 95
77 3300005329 Ga0070683_100383832 Ga0070683_1003838321 95
78 3300005329 Ga0070683_102238862 Ga0070683_1022388621 95
79 3300005330 Ga0070690_100213139 Ga0070690_1002131392 95
80 3300005330 Ga0070690_101227197 Ga0070690_1012271972 95
81 3300005330 Ga0070690_101752381 Ga0070690_1017523811 95
82 3300005331 Ga0070670_100165454 Ga0070670_1001654544 95
83 3300005331 Ga0070670_100545962 Ga0070670_1005459622 95
84 3300005331 Ga0070670_100555217 Ga0070670_1005552172 95
85 3300005334 Ga0068869_100287231 Ga0068869_1002872312 95
86 3300005334 Ga0068869_100588601 Ga0068869_1005886011 95
87 3300005335 Ga0070666_11018057 Ga0070666_110180571 95
88 3300005336 Ga0070680_100011788 Ga0070680_1000117884 95
89 3300005336 Ga0070680_100023435 Ga0070680_1000234354 95
90 3300005336 Ga0070680_100077214 Ga0070680_1000772142 95
91 3300005336 Ga0070680_100089684 Ga0070680_1000896841 95
92 3300005336 Ga0070680_100098481 Ga0070680_1000984812 95
93 3300005336 Ga0070680_100351827 Ga0070680_1003518271 95
94 3300005336 Ga0070680_101177156 Ga0070680_1011771562 95
95 3300005337 Ga0070682_100395483 Ga0070682_1003954832 95
96 3300005337 Ga0070682_100398207 Ga0070682_1003982071 95
97 3300005338 Ga0068868_100125691 Ga0068868_1001256912 95
98 3300005338 Ga0068868_100293702 Ga0068868_1002937022 95
99 3300005338 Ga0068868_100419382 Ga0068868_1004193822 95
100 3300005338 Ga0068868_100708660 Ga0068868_1007086601 95
101 3300005338 Ga0068868_101526768 Ga0068868_1015267682 95
102 3300005338 Ga0068868_102241871 Ga0068868_1022418712 95
103 3300005339 Ga0070660_100211196 Ga0070660_1002111962 95
104 3300005339 Ga0070660_100472476 Ga0070660_1004724762 95
105 3300005339 Ga0070660_100506271 Ga0070660_1005062712 95
106 3300005339 Ga0070660_100889098 Ga0070660_1008890982 95
107 3300005339 Ga0070660_101343463 Ga0070660_1013434632 95
108 3300005340 Ga0070689_100138724 Ga0070689_1001387243 95
109 3300005340 Ga0070689_100682566 Ga0070689_1006825662 95
110 3300005340 Ga0070689_100928744 Ga0070689_1009287442 95
111 3300005341 Ga0070691_10180554 Ga0070691_101805542 95
112 3300005341 Ga0070691_10527195 Ga0070691_105271952 95
113 3300005343 Ga0070687_101454545 Ga0070687_1014545451 95
114 3300005344 Ga0070661_100186261 Ga0070661_1001862613 95
115 3300005344 Ga0070661_100244193 Ga0070661_1002441932 95
116 3300005344 Ga0070661_100508865 Ga0070661_1005088652 95
117 3300005344 Ga0070661_100704798 Ga0070661_1007047982 95
118 3300005344 Ga0070661_100721953 Ga0070661_1007219532 95
119 3300005344 Ga0070661_101598199 Ga0070661_1015981991 95
120 3300005345 Ga0070692_11322557 Ga0070692_113225571 95
121 3300005347 Ga0070668_100022289 Ga0070668_1000222895 95
122 3300005347 Ga0070668_100093371 Ga0070668_1000933712 95
123 3300005347 Ga0070668_100129427 Ga0070668_1001294272 95
124 3300005347 Ga0070668_100244859 Ga0070668_1002448592 95
125 3300005347 Ga0070668_100438041 Ga0070668_1004380412 95
126 3300005347 Ga0070668_100994013 Ga0070668_1009940131 95
127 3300005347 Ga0070668_101041772 Ga0070668_1010417722 95
128 3300005354 Ga0070675_100624114 Ga0070675_1006241142 95
129 3300005354 Ga0070675_100775116 Ga0070675_1007751162 95
130 3300005355 Ga0070671_100085639 Ga0070671_1000856394 95
131 3300005355 Ga0070671_100834292 Ga0070671_1008342921 95
132 3300005356 Ga0070674_100046094 Ga0070674_1000460942 95
133 3300005356 Ga0070674_100318216 Ga0070674_1003182162 95
134 3300005356 Ga0070674_100760330 Ga0070674_1007603302 95
135 3300005356 Ga0070674_101724832 Ga0070674_1017248321 95
136 3300005364 Ga0070673_100646714 Ga0070673_1006467141 95
137 3300005366 Ga0070659_100076811 Ga0070659_1000768112 95
138 3300005366 Ga0070659_100107474 Ga0070659_1001074742 95
139 3300005366 Ga0070659_100128341 Ga0070659_1001283412 95
140 3300005366 Ga0070659_100133379 Ga0070659_1001333792 95
141 3300005366 Ga0070659_101063687 Ga0070659_1010636872 95
142 3300005367 Ga0070667_100037701 Ga0070667_1000377012 95
143 3300005367 Ga0070667_100507733 Ga0070667_1005077332 95
144 3300005367 Ga0070667_100558528 Ga0070667_1005585282 95
145 3300005367 Ga0070667_100761933 Ga0070667_1007619332 95
146 3300005367 Ga0070667_102120081 Ga0070667_1021200811 95
147 3300005434 Ga0070709_10000748 Ga0070709_100007485 95
148 3300005434 Ga0070709_10002033 Ga0070709_100020338 95
149 3300005434 Ga0070709_10006994 Ga0070709_100069944 95
150 3300005434 Ga0070709_10017477 Ga0070709_100174772 95
151 3300005434 Ga0070709_10028748 Ga0070709_100287482 95
152 3300005434 Ga0070709_10120786 Ga0070709_101207863 95
153 3300005434 Ga0070709_10344992 Ga0070709_103449922 95
154 3300005434 Ga0070709_11695730 Ga0070709_116957302 95
155 3300005435 Ga0070714_100003573 Ga0070714_1000035739 95
156 3300005435 Ga0070714_100011382 Ga0070714_1000113829 95
157 3300005435 Ga0070714_100107256 Ga0070714_1001072562 95
158 3300005435 Ga0070714_100288020 Ga0070714_1002880202 95
159 3300005435 Ga0070714_100487140 Ga0070714_1004871402 95
160 3300005435 Ga0070714_100617729 Ga0070714_1006177292 95
161 3300005435 Ga0070714_100824767 Ga0070714_1008247672 95
162 3300005435 Ga0070714_100997887 Ga0070714_1009978871 95
163 3300005435 Ga0070714_101192209 Ga0070714_1011922092 95
164 3300005435 Ga0070714_101772680 Ga0070714_1017726801 95
165 3300005436 Ga0070713_100046189 Ga0070713_1000461893 95
166 3300005436 Ga0070713_100078828 Ga0070713_1000788282 95
167 3300005436 Ga0070713_100102249 Ga0070713_1001022493 95
168 3300005436 Ga0070713_100854741 Ga0070713_1008547412 95
169 3300005436 Ga0070713_101394107 Ga0070713_1013941071 95
170 3300005436 Ga0070713_101560269 Ga0070713_1015602692 95
171 3300005436 Ga0070713_101565392 Ga0070713_1015653921 95
172 3300005437 Ga0070710_10002333 Ga0070710_100023336 95
173 3300005437 Ga0070710_10043234 Ga0070710_100432342 95
174 3300005437 Ga0070710_11180735 Ga0070710_111807351 95
175 3300005438 Ga0070701_10345787 Ga0070701_103457872 95
176 3300005438 Ga0070701_11084904 Ga0070701_110849042 95
177 3300005439 Ga0070711_100003247 Ga0070711_10000324710 95
178 3300005439 Ga0070711_100006251 Ga0070711_1000062512 95
179 3300005439 Ga0070711_100024755 Ga0070711_1000247553 95
180 3300005439 Ga0070711_100109445 Ga0070711_1001094453 95
181 3300005439 Ga0070711_100354309 Ga0070711_1003543091 95
182 3300005439 Ga0070711_100383161 Ga0070711_1003831612 95
183 3300005439 Ga0070711_100415590 Ga0070711_1004155901 95
184 3300005439 Ga0070711_101305610 Ga0070711_1013056102 95
185 3300005439 Ga0070711_101866430 Ga0070711_1018664302 95
186 3300005441 Ga0070700_100421228 Ga0070700_1004212282 95
187 3300005441 Ga0070700_101732274 Ga0070700_1017322742 95
188 3300005444 Ga0070694_100324648 Ga0070694_1003246481 95
189 3300005455 Ga0070663_100007024 Ga0070663_1000070244 95
190 3300005455 Ga0070663_100075171 Ga0070663_1000751712 95
191 3300005455 Ga0070663_100123171 Ga0070663_1001231713 95
192 3300005455 Ga0070663_100151133 Ga0070663_1001511332 95
193 3300005455 Ga0070663_100170149 Ga0070663_1001701492 95
194 3300005455 Ga0070663_100406839 Ga0070663_1004068392 95
195 3300005455 Ga0070663_100421315 Ga0070663_1004213151 95
196 3300005455 Ga0070663_100457169 Ga0070663_1004571692 95
197 3300005455 Ga0070663_100538191 Ga0070663_1005381912 95
198 3300005455 Ga0070663_100759602 Ga0070663_1007596021 95
199 3300005455 Ga0070663_100865727 Ga0070663_1008657272 95
200 3300005455 Ga0070663_100914448 Ga0070663_1009144481 95
201 3300005455 Ga0070663_100984186 Ga0070663_1009841862 95
202 3300005455 Ga0070663_100984238 Ga0070663_1009842382 95
203 3300005455 Ga0070663_101062059 Ga0070663_1010620592 95
204 3300005456 Ga0070678_100045513 Ga0070678_1000455132 95
205 3300005456 Ga0070678_100050698 Ga0070678_1000506984 95
206 3300005456 Ga0070678_100102038 Ga0070678_1001020382 95
207 3300005456 Ga0070678_100268259 Ga0070678_1002682592 95
208 3300005456 Ga0070678_100516893 Ga0070678_1005168932 95
209 3300005456 Ga0070678_100595396 Ga0070678_1005953962 95
210 3300005456 Ga0070678_101413263 Ga0070678_1014132631 95
211 3300005457 Ga0070662_100116191 Ga0070662_1001161912 95
212 3300005457 Ga0070662_100182170 Ga0070662_1001821702 95
213 3300005457 Ga0070662_100337282 Ga0070662_1003372822 95
214 3300005457 Ga0070662_100447595 Ga0070662_1004475952 95
215 3300005457 Ga0070662_100497276 Ga0070662_1004972762 95
216 3300005458 Ga0070681_10000756 Ga0070681_1000075620 95
217 3300005458 Ga0070681_10008357 Ga0070681_100083579 95
218 3300005458 Ga0070681_10054611 Ga0070681_100546112 95
219 3300005458 Ga0070681_10148647 Ga0070681_101486473 95
220 3300005458 Ga0070681_10170337 Ga0070681_101703373 95
221 3300005458 Ga0070681_10717460 Ga0070681_107174602 95
222 3300005458 Ga0070681_10743173 Ga0070681_107431732 95
223 3300005458 Ga0070681_10795598 Ga0070681_107955981 95
224 3300005459 Ga0068867_100253916 Ga0068867_1002539162 95
225 3300005459 Ga0068867_100268187 Ga0068867_1002681872 95
226 3300005459 Ga0068867_100457672 Ga0068867_1004576722 95
227 3300005459 Ga0068867_100908653 Ga0068867_1009086531 95
228 3300005459 Ga0068867_101231143 Ga0068867_1012311432 95
229 3300005466 Ga0070685_11294156 Ga0070685_112941562 95
230 3300005467 Ga0070706_100313408 Ga0070706_1003134082 95
231 3300005468 Ga0070707_100738374 Ga0070707_1007383741 95
232 3300005468 Ga0070707_100870007 Ga0070707_1008700072 95
233 3300005471 Ga0070698_101008894 Ga0070698_1010088941 95
234 3300005471 Ga0070698_101764411 Ga0070698_1017644111 95
235 3300005518 Ga0070699_100375677 Ga0070699_1003756772 95
236 3300005530 Ga0070679_100012531 Ga0070679_1000125316 95
237 3300005530 Ga0070679_100030670 Ga0070679_1000306705 95
238 3300005530 Ga0070679_100036615 Ga0070679_1000366154 95
239 3300005530 Ga0070679_100147944 Ga0070679_1001479443 95
240 3300005530 Ga0070679_100216296 Ga0070679_1002162962 95
241 3300005530 Ga0070679_100220982 Ga0070679_1002209823 95
242 3300005530 Ga0070679_100273498 Ga0070679_1002734982 95
243 3300005530 Ga0070679_100536413 Ga0070679_1005364132 95
244 3300005530 Ga0070679_100708797 Ga0070679_1007087972 95
245 3300005530 Ga0070679_100838304 Ga0070679_1008383042 95
246 3300005530 Ga0070679_101624332 Ga0070679_1016243321 95
247 3300005535 Ga0070684_100050418 Ga0070684_1000504183 95
248 3300005535 Ga0070684_100460469 Ga0070684_1004604692 95
249 3300005535 Ga0070684_100907112 Ga0070684_1009071122 95
250 3300005536 Ga0070697_100005182 Ga0070697_1000051825 95
251 3300005536 Ga0070697_100273428 Ga0070697_1002734282 95
252 3300005536 Ga0070697_100631395 Ga0070697_1006313952 95
253 3300005536 Ga0070697_101763293 Ga0070697_1017632931 95
254 3300005539 Ga0068853_100022507 Ga0068853_1000225074 95
255 3300005539 Ga0068853_100254169 Ga0068853_1002541691 95
256 3300005539 Ga0068853_100319636 Ga0068853_1003196362 95
257 3300005539 Ga0068853_100330343 Ga0068853_1003303432 95
258 3300005539 Ga0068853_100413788 Ga0068853_1004137882 95
259 3300005539 Ga0068853_100460016 Ga0068853_1004600162 95
260 3300005539 Ga0068853_101423286 Ga0068853_1014232861 95
261 3300005543 Ga0070672_100333137 Ga0070672_1003331372 95
262 3300005543 Ga0070672_100630186 Ga0070672_1006301862 95
263 3300005543 Ga0070672_100805542 Ga0070672_1008055422 95
264 3300005543 Ga0070672_101005708 Ga0070672_1010057082 95
265 3300005544 Ga0070686_100969823 Ga0070686_1009698231 95
266 3300005545 Ga0070695_101477690 Ga0070695_1014776902 95
267 3300005546 Ga0070696_100801664 Ga0070696_1008016642 95
268 3300005548 Ga0070665_100027464 Ga0070665_1000274645 95
269 3300005548 Ga0070665_100129523 Ga0070665_1001295232 95
270 3300005548 Ga0070665_100283924 Ga0070665_1002839242 95
271 3300005548 Ga0070665_100640988 Ga0070665_1006409882 95
272 3300005548 Ga0070665_100647485 Ga0070665_1006474852 95
273 3300005548 Ga0070665_101140986 Ga0070665_1011409862 95
274 3300005549 Ga0070704_100546244 Ga0070704_1005462442 95
275 3300005563 Ga0068855_100010153 Ga0068855_1000101532 95
276 3300005563 Ga0068855_100048449 Ga0068855_1000484494 95
277 3300005563 Ga0068855_100075449 Ga0068855_1000754494 95
278 3300005563 Ga0068855_100192460 Ga0068855_1001924602 95
279 3300005563 Ga0068855_100219146 Ga0068855_1002191463 95
280 3300005563 Ga0068855_100287043 Ga0068855_1002870432 95
281 3300005563 Ga0068855_100425349 Ga0068855_1004253491 95
282 3300005563 Ga0068855_100544188 Ga0068855_1005441882 95
283 3300005563 Ga0068855_101672513 Ga0068855_1016725132 95
284 3300005563 Ga0068855_101798686 Ga0068855_1017986862 95
285 3300005563 Ga0068855_102484732 Ga0068855_1024847321 95
286 3300005564 Ga0070664_100993749 Ga0070664_1009937492 95
287 3300005564 Ga0070664_101259493 Ga0070664_1012594932 95
288 3300005577 Ga0068857_100013829 Ga0068857_1000138297 95
289 3300005577 Ga0068857_100124560 Ga0068857_1001245602 95
290 3300005577 Ga0068857_100256345 Ga0068857_1002563452 95
291 3300005577 Ga0068857_100317228 Ga0068857_1003172283 95
292 3300005577 Ga0068857_100570412 Ga0068857_1005704122 95
293 3300005578 Ga0068854_100047130 Ga0068854_1000471304 95
294 3300005578 Ga0068854_100471208 Ga0068854_1004712082 95
295 3300005578 Ga0068854_100549238 Ga0068854_1005492382 95
296 3300005578 Ga0068854_100621365 Ga0068854_1006213651 95
297 3300005578 Ga0068854_102092201 Ga0068854_1020922011 95
298 3300005614 Ga0068856_100000340 Ga0068856_10000034035 95
299 3300005614 Ga0068856_100075874 Ga0068856_1000758743 95
300 3300005614 Ga0068856_100113257 Ga0068856_1001132572 95
301 3300005614 Ga0068856_100203464 Ga0068856_1002034642 95
302 3300005614 Ga0068856_100354560 Ga0068856_1003545602 95
303 3300005614 Ga0068856_100494682 Ga0068856_1004946822 95
304 3300005614 Ga0068856_100915719 Ga0068856_1009157192 95
305 3300005614 Ga0068856_101106271 Ga0068856_1011062711 95
306 3300005615 Ga0070702_100080642 Ga0070702_1000806422 95
307 3300005615 Ga0070702_100225166 Ga0070702_1002251662 95
308 3300005615 Ga0070702_100425654 Ga0070702_1004256541 95
309 3300005616 Ga0068852_100014563 Ga0068852_1000145632 95
310 3300005616 Ga0068852_100100234 Ga0068852_1001002344 95
311 3300005616 Ga0068852_100159857 Ga0068852_1001598572 95
312 3300005616 Ga0068852_100167378 Ga0068852_1001673782 95
313 3300005616 Ga0068852_100224058 Ga0068852_1002240583 95
314 3300005616 Ga0068852_100960876 Ga0068852_1009608762 95
315 3300005616 Ga0068852_101583076 Ga0068852_1015830761 95
316 3300005617 Ga0068859_100347740 Ga0068859_1003477402 95
317 3300005617 Ga0068859_101305315 Ga0068859_1013053152 95
318 3300005617 Ga0068859_101651415 Ga0068859_1016514152 95
319 3300005617 Ga0068859_102701238 Ga0068859_1027012381 95
320 3300005618 Ga0068864_100409756 Ga0068864_1004097562 95
321 3300005618 Ga0068864_100794424 Ga0068864_1007944242 95
322 3300005618 Ga0068864_101270967 Ga0068864_1012709672 95
323 3300005618 Ga0068864_101292076 Ga0068864_1012920762 95
324 3300005618 Ga0068864_101993556 Ga0068864_1019935561 95
325 3300005718 Ga0068866_10452753 Ga0068866_104527532 95
326 3300005718 Ga0068866_10624114 Ga0068866_106241142 95
327 3300005719 Ga0068861_100315399 Ga0068861_1003153992 95
328 3300005719 Ga0068861_100887357 Ga0068861_1008873572 95
329 3300005719 Ga0068861_102040221 Ga0068861_1020402212 95
330 3300005834 Ga0068851_10587199 Ga0068851_105871991 95
331 3300005841 Ga0068863_100816119 Ga0068863_1008161192 95
332 3300005841 Ga0068863_101244247 Ga0068863_1012442472 95
333 3300005842 Ga0068858_100572140 Ga0068858_1005721402 95
334 3300005842 Ga0068858_100820858 Ga0068858_1008208582 95
335 3300005842 Ga0068858_101687583 Ga0068858_1016875832 95
336 3300005843 Ga0068860_100000081 Ga0068860_10000008112 95
337 3300005843 Ga0068860_100350657 Ga0068860_1003506572 95
338 3300005843 Ga0068860_101174553 Ga0068860_1011745532 95
339 3300005843 Ga0068860_101707118 Ga0068860_1017071182 95
340 3300005844 Ga0068862_100054213 Ga0068862_1000542132 95
341 3300005844 Ga0068862_100073298 Ga0068862_1000732983 95
342 3300005844 Ga0068862_100520820 Ga0068862_1005208202 95
343 3300005844 Ga0068862_100732229 Ga0068862_1007322292 95
344 3300005844 Ga0068862_101239374 Ga0068862_1012393742 95
345 3300005844 Ga0068862_101424671 Ga0068862_1014246712 95
346 3300005937 Ga0081455_10013421 Ga0081455_100134212 95
347 3300005937 Ga0081455_10032257 Ga0081455_100322576 95
348 3300005937 Ga0081455_10052827 Ga0081455_100528274 95
349 3300005937 Ga0081455_10105945 Ga0081455_101059451 95
350 3300005937 Ga0081455_10444013 Ga0081455_104440132 95
351 3300005937 Ga0081455_10832608 Ga0081455_108326082 95
352 3300005981 Ga0081538_10170423 Ga0081538_101704232 95
353 3300005983 Ga0081540_1002354 Ga0081540_10023546 95
354 3300005983 Ga0081540_1002428 Ga0081540_100242813 95
355 3300005983 Ga0081540_1008459 Ga0081540_10084595 95
356 3300005983 Ga0081540_1010807 Ga0081540_10108077 95
357 3300005983 Ga0081540_1013331 Ga0081540_10133316 95
358 3300005983 Ga0081540_1014134 Ga0081540_10141346 95
359 3300005983 Ga0081540_1029188 Ga0081540_10291884 95
360 3300005983 Ga0081540_1093850 Ga0081540_10938501 95
361 3300005983 Ga0081540_1108413 Ga0081540_11084132 95
362 3300005983 Ga0081540_1164047 Ga0081540_11640471 95
363 3300005985 Ga0081539_10000325 Ga0081539_1000032576 95
364 3300005985 Ga0081539_10000542 Ga0081539_1000054259 95
365 3300005985 Ga0081539_10025073 Ga0081539_100250733 95
366 3300005985 Ga0081539_10066123 Ga0081539_100661232 95
367 3300005985 Ga0081539_10069341 Ga0081539_100693412 95
368 3300005985 Ga0081539_10104265 Ga0081539_101042651 95
369 3300005985 Ga0081539_10233968 Ga0081539_102339682 95
370 3300006028 Ga0070717_10005461 Ga0070717_100054617 95
371 3300006028 Ga0070717_10189257 Ga0070717_101892573 95
372 3300006028 Ga0070717_10606682 Ga0070717_106066821 95
373 3300006028 Ga0070717_10634117 Ga0070717_106341172 95
374 3300006028 Ga0070717_11030212 Ga0070717_110302122 95
375 3300006028 Ga0070717_11114569 Ga0070717_111145691 95
376 3300006028 Ga0070717_12134168 Ga0070717_121341682 95
377 3300006038 Ga0075365_10008590 Ga0075365_100085905 95
378 3300006038 Ga0075365_10065483 Ga0075365_100654832 95
379 3300006038 Ga0075365_10077673 Ga0075365_100776733 95
380 3300006038 Ga0075365_10189495 Ga0075365_101894952 95
381 3300006038 Ga0075365_10207139 Ga0075365_102071392 95
382 3300006038 Ga0075365_10250937 Ga0075365_102509371 95
383 3300006038 Ga0075365_10304064 Ga0075365_103040642 95
384 3300006038 Ga0075365_10310726 Ga0075365_103107262 95
385 3300006038 Ga0075365_10449816 Ga0075365_104498162 95
386 3300006038 Ga0075365_10489071 Ga0075365_104890712 95
387 3300006038 Ga0075365_10635043 Ga0075365_106350431 95
388 3300006038 Ga0075365_10653026 Ga0075365_106530262 95
389 3300006038 Ga0075365_11040824 Ga0075365_110408242 95
390 3300006042 Ga0075368_10006026 Ga0075368_100060266 95
391 3300006042 Ga0075368_10037555 Ga0075368_100375554 95
392 3300006042 Ga0075368_10109003 Ga0075368_101090032 95
393 3300006042 Ga0075368_10139292 Ga0075368_101392922 95
394 3300006042 Ga0075368_10462685 Ga0075368_104626852 95
395 3300006048 Ga0075363_100004003 Ga0075363_1000040034 95
396 3300006048 Ga0075363_100015710 Ga0075363_1000157105 95
397 3300006048 Ga0075363_100152885 Ga0075363_1001528852 95
398 3300006048 Ga0075363_100195882 Ga0075363_1001958821 95
399 3300006048 Ga0075363_100216567 Ga0075363_1002165672 95
400 3300006048 Ga0075363_100273078 Ga0075363_1002730782 95
401 3300006048 Ga0075363_100317081 Ga0075363_1003170812 95
402 3300006048 Ga0075363_100342231 Ga0075363_1003422311 95
403 3300006051 Ga0075364_10022884 Ga0075364_100228842 95
404 3300006051 Ga0075364_10308479 Ga0075364_103084792 95
405 3300006051 Ga0075364_10351469 Ga0075364_103514692 95
406 3300006051 Ga0075364_10515384 Ga0075364_105153842 95
407 3300006051 Ga0075364_10531962 Ga0075364_105319622 95
408 3300006163 Ga0070715_10110095 Ga0070715_101100952 95
409 3300006163 Ga0070715_10515534 Ga0070715_105155341 95
410 3300006173 Ga0070716_100009609 Ga0070716_1000096096 95
411 3300006173 Ga0070716_100099708 Ga0070716_1000997082 95
412 3300006173 Ga0070716_100144601 Ga0070716_1001446012 95
413 3300006173 Ga0070716_100389351 Ga0070716_1003893512 95
414 3300006173 Ga0070716_100471783 Ga0070716_1004717831 95
415 3300006173 Ga0070716_100527933 Ga0070716_1005279332 95
416 3300006173 Ga0070716_100569244 Ga0070716_1005692442 95
417 3300006173 Ga0070716_101160450 Ga0070716_1011604502 95
418 3300006175 Ga0070712_100006504 Ga0070712_1000065048 95
419 3300006175 Ga0070712_100074012 Ga0070712_1000740124 95
420 3300006175 Ga0070712_100246370 Ga0070712_1002463702 95
421 3300006175 Ga0070712_100281888 Ga0070712_1002818882 95
422 3300006175 Ga0070712_100532078 Ga0070712_1005320782 95
423 3300006175 Ga0070712_100562569 Ga0070712_1005625692 95
424 3300006175 Ga0070712_100798349 Ga0070712_1007983492 95
425 3300006175 Ga0070712_101198350 Ga0070712_1011983501 95
426 3300006175 Ga0070712_101596607 Ga0070712_1015966072 95
427 3300006175 Ga0070712_101638495 Ga0070712_1016384952 95
428 3300006177 Ga0075362_10039169 Ga0075362_100391692 95
429 3300006177 Ga0075362_10267786 Ga0075362_102677862 95
430 3300006177 Ga0075362_10472788 Ga0075362_104727882 95
431 3300006177 Ga0075362_10604979 Ga0075362_106049792 95
432 3300006177 Ga0075362_10702168 Ga0075362_107021681 95
433 3300006178 Ga0075367_10016373 Ga0075367_100163731 95
434 3300006178 Ga0075367_10058054 Ga0075367_100580544 95
435 3300006178 Ga0075367_10124748 Ga0075367_101247482 95
436 3300006178 Ga0075367_10504827 Ga0075367_105048272 95
437 3300006178 Ga0075367_10649780 Ga0075367_106497801 95
438 3300006178 Ga0075367_11039215 Ga0075367_110392152 95
439 3300006186 Ga0075369_10038578 Ga0075369_100385782 95
440 3300006186 Ga0075369_10122681 Ga0075369_101226812 95
441 3300006186 Ga0075369_10161588 Ga0075369_101615881 95
442 3300006186 Ga0075369_10171839 Ga0075369_101718392 95
443 3300006186 Ga0075369_10269993 Ga0075369_102699932 95
444 3300006186 Ga0075369_10317145 Ga0075369_103171452 95
445 3300006186 Ga0075369_10409480 Ga0075369_104094802 95
446 3300006195 Ga0075366_10058783 Ga0075366_100587833 95
447 3300006195 Ga0075366_10062965 Ga0075366_100629652 95
448 3300006195 Ga0075366_10160204 Ga0075366_101602041 95
449 3300006195 Ga0075366_10254526 Ga0075366_102545262 95
450 3300006195 Ga0075366_10363193 Ga0075366_103631931 95
451 3300006237 Ga0097621_100056702 Ga0097621_1000567022 95
452 3300006237 Ga0097621_100283553 Ga0097621_1002835532 95
453 3300006237 Ga0097621_100472158 Ga0097621_1004721582 95
454 3300006237 Ga0097621_100988935 Ga0097621_1009889352 95
455 3300006237 Ga0097621_101625336 Ga0097621_1016253362 95
456 3300006353 Ga0075370_10060035 Ga0075370_100600353 95
457 3300006353 Ga0075370_10124127 Ga0075370_101241272 95
458 3300006353 Ga0075370_10141541 Ga0075370_101415412 95
459 3300006353 Ga0075370_10226482 Ga0075370_102264822 95
460 3300006353 Ga0075370_10400055 Ga0075370_104000551 95
461 3300006353 Ga0075370_10405839 Ga0075370_104058392 95
462 3300006353 Ga0075370_10478990 Ga0075370_104789902 95
463 3300006353 Ga0075370_10814524 Ga0075370_108145242 95
464 3300006358 Ga0068871_100091873 Ga0068871_1000918734 95
465 3300006358 Ga0068871_100464125 Ga0068871_1004641251 95
466 3300006358 Ga0068871_100947686 Ga0068871_1009476861 95
467 3300006358 Ga0068871_101419648 Ga0068871_1014196482 95
468 3300006844 Ga0075428_100096364 Ga0075428_1000963642 95
469 3300006844 Ga0075428_100446122 Ga0075428_1004461222 95
470 3300006844 Ga0075428_101088806 Ga0075428_1010888062 95
471 3300006852 Ga0075433_11576114 Ga0075433_115761142 95
472 3300006871 Ga0075434_100005333 Ga0075434_10000533314 95
473 3300006871 Ga0075434_100629591 Ga0075434_1006295912 95
474 3300006881 Ga0068865_100204573 Ga0068865_1002045732 95
475 3300006881 Ga0068865_100578433 Ga0068865_1005784332 95
476 3300006914 Ga0075436_100035523 Ga0075436_1000355232 95
477 3300006914 Ga0075436_101316059 Ga0075436_1013160592 95
478 3300006931 Ga0097620_100347751 Ga0097620_1003477512 95
479 3300006931 Ga0097620_101305335 Ga0097620_1013053352 95
480 3300006931 Ga0097620_101651560 Ga0097620_1016515602 95
481 3300006931 Ga0097620_102701186 Ga0097620_1027011861 95
482 3300006941 Ga0099825_1058498 Ga0099825_10584981 95
483 3300006942 Ga0099824_1006123 Ga0099824_100612314 95
484 3300006942 Ga0099824_1015027 Ga0099824_10150279 95
485 3300006943 Ga0099822_1000072 Ga0099822_100007217 95
486 3300006944 Ga0099823_1039314 Ga0099823_10393142 95
487 3300007076 Ga0075435_100071016 Ga0075435_1000710164 95
488 3300007076 Ga0075435_100264652 Ga0075435_1002646522 95
489 3300007076 Ga0075435_101297087 Ga0075435_1012970871 95
490 3300007265 Ga0099794_10686510 Ga0099794_106865102 95
491 3300007265 Ga0099794_10716427 Ga0099794_107164271 95
492 3300009011 Ga0105251_10340629 Ga0105251_103406292 95
493 3300009011 Ga0105251_10383622 Ga0105251_103836221 95
494 3300009011 Ga0105251_10533368 Ga0105251_105333682 95
495 3300009036 Ga0105244_10280143 Ga0105244_102801431 95
496 3300009092 Ga0105250_10371574 Ga0105250_103715742 95
497 3300009093 Ga0105240_10184089 Ga0105240_101840892 95
498 3300009093 Ga0105240_10188232 Ga0105240_101882323 95
499 3300009093 Ga0105240_10238997 Ga0105240_102389973 95
500 3300009093 Ga0105240_10347679 Ga0105240_103476792 95
501 3300009093 Ga0105240_10420605 Ga0105240_104206053 95
502 3300009093 Ga0105240_10435122 Ga0105240_104351222 95
503 3300009093 Ga0105240_11617902 Ga0105240_116179022 95
504 3300009094 Ga0111539_10293929 Ga0111539_102939292 95
505 3300009094 Ga0111539_10314106 Ga0111539_103141062 95
506 3300009094 Ga0111539_12760663 Ga0111539_127606632 95
507 3300009098 Ga0105245_10086519 Ga0105245_100865194 95
508 3300009098 Ga0105245_10577399 Ga0105245_105773992 95
509 3300009098 Ga0105245_11425993 Ga0105245_114259931 95
510 3300009098 Ga0105245_12407030 Ga0105245_124070302 95
511 3300009098 Ga0105245_12583568 Ga0105245_125835682 95
512 3300009101 Ga0105247_10064250 Ga0105247_100642502 95
513 3300009101 Ga0105247_10098814 Ga0105247_100988142 95
514 3300009101 Ga0105247_10304643 Ga0105247_103046432 95
515 3300009101 Ga0105247_10716879 Ga0105247_107168792 95
516 3300009147 Ga0114129_10162673 Ga0114129_101626734 95
517 3300009147 Ga0114129_13099982 Ga0114129_130999821 95
518 3300009148 Ga0105243_10379502 Ga0105243_103795022 95
519 3300009148 Ga0105243_10863823 Ga0105243_108638232 95
520 3300009148 Ga0105243_11241377 Ga0105243_112413772 95
521 3300009148 Ga0105243_12155312 Ga0105243_121553122 95
522 3300009148 Ga0105243_12700209 Ga0105243_127002092 95
523 3300009174 Ga0105241_10446986 Ga0105241_104469862 95
524 3300009174 Ga0105241_11041489 Ga0105241_110414891 95
525 3300009174 Ga0105241_11698003 Ga0105241_116980031 95
526 3300009176 Ga0105242_10214177 Ga0105242_102141771 95
527 3300009176 Ga0105242_11692003 Ga0105242_116920031 95
528 3300009176 Ga0105242_12001271 Ga0105242_120012712 95
529 3300009177 Ga0105248_10142516 Ga0105248_101425162 95
530 3300009177 Ga0105248_10216665 Ga0105248_102166653 95
531 3300009177 Ga0105248_10557501 Ga0105248_105575012 95
532 3300009177 Ga0105248_10677101 Ga0105248_106771012 95
533 3300009177 Ga0105248_10993800 Ga0105248_109938002 95
534 3300009177 Ga0105248_11230502 Ga0105248_112305022 95
535 3300009177 Ga0105248_11591241 Ga0105248_115912411 95
536 3300009177 Ga0105248_12181415 Ga0105248_121814152 95
537 3300009177 Ga0105248_12610820 Ga0105248_126108202 95
538 3300009545 Ga0105237_10005969 Ga0105237_1000596911 95
539 3300009545 Ga0105237_10006335 Ga0105237_100063355 95
540 3300009545 Ga0105237_10037729 Ga0105237_100377295 95
541 3300009545 Ga0105237_10162288 Ga0105237_101622883 95
542 3300009545 Ga0105237_10372045 Ga0105237_103720452 95
543 3300009545 Ga0105237_10492788 Ga0105237_104927882 95
544 3300009545 Ga0105237_10511176 Ga0105237_105111762 95
545 3300009545 Ga0105237_10576665 Ga0105237_105766652 95
546 3300009545 Ga0105237_10852278 Ga0105237_108522782 95
547 3300009545 Ga0105237_11103107 Ga0105237_111031072 95
548 3300009545 Ga0105237_11319100 Ga0105237_113191002 95
549 3300009545 Ga0105237_11390331 Ga0105237_113903311 95
550 3300009545 Ga0105237_11425095 Ga0105237_114250952 95
551 3300009551 Ga0105238_10045743 Ga0105238_100457433 95
552 3300009551 Ga0105238_10086686 Ga0105238_100866863 95
553 3300009551 Ga0105238_10132700 Ga0105238_101327003 95
554 3300009551 Ga0105238_10187781 Ga0105238_101877812 95
555 3300009551 Ga0105238_10206708 Ga0105238_102067082 95
556 3300009551 Ga0105238_10310323 Ga0105238_103103232 95
557 3300009551 Ga0105238_10575966 Ga0105238_105759662 95
558 3300009551 Ga0105238_10868338 Ga0105238_108683382 95
559 3300009551 Ga0105238_11139302 Ga0105238_111393021 95
560 3300009551 Ga0105238_12030915 Ga0105238_120309152 95
561 3300009553 Ga0105249_10796532 Ga0105249_107965322 95
562 3300009553 Ga0105249_11350377 Ga0105249_113503772 95
563 3300009553 Ga0105249_11523904 Ga0105249_115239042 95
564 3300009553 Ga0105249_12211402 Ga0105249_122114022 95
565 3300009553 Ga0105249_12410703 Ga0105249_124107032 95
566 3300009553 Ga0105249_12868960 Ga0105249_128689602 95
567 3300010159 Ga0099796_10027046 Ga0099796_100270462 95
568 3300010159 Ga0099796_10090015 Ga0099796_100900152 95
569 3300010159 Ga0099796_10238471 Ga0099796_102384712 95
570 3300010159 Ga0099796_10266264 Ga0099796_102662641 95
571 3300010375 Ga0105239_10340595 Ga0105239_103405952 95
572 3300010375 Ga0105239_10554999 Ga0105239_105549992 95
573 3300010375 Ga0105239_10604438 Ga0105239_106044382 95
574 3300010375 Ga0105239_10947648 Ga0105239_109476482 95
575 3300010375 Ga0105239_11132942 Ga0105239_111329422 95
576 3300010375 Ga0105239_11210327 Ga0105239_112103272 95
577 3300010375 Ga0105239_11989357 Ga0105239_119893571 95
578 3300011119 Ga0105246_10150907 Ga0105246_101509072 95
579 3300011119 Ga0105246_10219047 Ga0105246_102190472 95
580 3300011119 Ga0105246_10375485 Ga0105246_103754851 95
581 3300011119 Ga0105246_10459642 Ga0105246_104596422 95
582 3300011119 Ga0105246_10721264 Ga0105246_107212642 95
583 3300011119 Ga0105246_10826820 Ga0105246_108268202 95
584 3300011119 Ga0105246_10980116 Ga0105246_109801161 95
585 3300011119 Ga0105246_11057461 Ga0105246_110574612 95
586 3300011119 Ga0105246_11243634 Ga0105246_112436342 95
587 3300011119 Ga0105246_11247255 Ga0105246_112472552 95
588 3300011119 Ga0105246_12340320 Ga0105246_123403201 95
589 3300012478 Ga0157328_1008626 Ga0157328_10086261 95
590 3300012494 Ga0157341_1014278 Ga0157341_10142782 95
591 3300012513 Ga0157326_1066558 Ga0157326_10665582 95
592 3300013100 Ga0157373_10185813 Ga0157373_101858132 95
593 3300013100 Ga0157373_11048397 Ga0157373_110483972 95
594 3300013100 Ga0157373_11174213 Ga0157373_111742132 95
595 3300013102 Ga0157371_10014591 Ga0157371_100145914 95
596 3300013102 Ga0157371_10138267 Ga0157371_101382672 95
597 3300013102 Ga0157371_10542384 Ga0157371_105423842 95
598 3300013104 Ga0157370_10064604 Ga0157370_100646043 95
599 3300013104 Ga0157370_10157550 Ga0157370_101575503 95
600 3300013104 Ga0157370_10407177 Ga0157370_104071771 95
601 3300013104 Ga0157370_10508295 Ga0157370_105082951 95
602 3300013104 Ga0157370_11013138 Ga0157370_110131382 95
603 3300013105 Ga0157369_10013821 Ga0157369_1001382110 95
604 3300013105 Ga0157369_10015377 Ga0157369_100153772 95
605 3300013105 Ga0157369_10016472 Ga0157369_100164724 95
606 3300013105 Ga0157369_10079236 Ga0157369_100792363 95
607 3300013105 Ga0157369_10577391 Ga0157369_105773912 95
608 3300013105 Ga0157369_10612235 Ga0157369_106122352 95
609 3300013105 Ga0157369_10940007 Ga0157369_109400072 95
610 3300013105 Ga0157369_11149840 Ga0157369_111498401 95
611 3300013296 Ga0157374_10090035 Ga0157374_100900354 95
612 3300013296 Ga0157374_10221916 Ga0157374_102219163 95
613 3300013296 Ga0157374_11333834 Ga0157374_113338342 95
614 3300013297 Ga0157378_10015018 Ga0157378_100150184 95
615 3300013297 Ga0157378_10053685 Ga0157378_100536854 95
616 3300013297 Ga0157378_10245170 Ga0157378_102451702 95
617 3300013297 Ga0157378_10580012 Ga0157378_105800122 95
618 3300013297 Ga0157378_10809430 Ga0157378_108094302 95
619 3300013297 Ga0157378_11755731 Ga0157378_117557312 95
620 3300013297 Ga0157378_12681153 Ga0157378_126811532 95
621 3300013306 Ga0163162_10017977 Ga0163162_100179772 95
622 3300013306 Ga0163162_10146711 Ga0163162_101467113 95
623 3300013306 Ga0163162_10555763 Ga0163162_105557631 95
624 3300013306 Ga0163162_10911632 Ga0163162_109116322 95
625 3300013306 Ga0163162_11530010 Ga0163162_115300102 95
626 3300013306 Ga0163162_11930074 Ga0163162_119300742 95
627 3300013306 Ga0163162_12134259 Ga0163162_121342591 95
628 3300013307 Ga0157372_10082303 Ga0157372_100823034 95
629 3300013307 Ga0157372_10356625 Ga0157372_103566252 95
630 3300013307 Ga0157372_10470931 Ga0157372_104709312 95
631 3300013307 Ga0157372_11055295 Ga0157372_110552951 95
632 3300013307 Ga0157372_12197328 Ga0157372_121973281 95
633 3300013308 Ga0157375_11115363 Ga0157375_111153632 95
634 3300013308 Ga0157375_11569157 Ga0157375_115691571 95
635 3300013308 Ga0157375_11661407 Ga0157375_116614072 95
636 3300013308 Ga0157375_12188957 Ga0157375_121889572 95
637 3300014325 Ga0163163_10008335 Ga0163163_100083356 95
638 3300014325 Ga0163163_10081274 Ga0163163_100812741 95
639 3300014325 Ga0163163_10098156 Ga0163163_100981564 95
640 3300014325 Ga0163163_10320053 Ga0163163_103200532 95
641 3300014325 Ga0163163_10597566 Ga0163163_105975662 95
642 3300014325 Ga0163163_10931455 Ga0163163_109314552 95
643 3300014326 Ga0157380_10589137 Ga0157380_105891372 95
644 3300014326 Ga0157380_10946878 Ga0157380_109468781 95
645 3300014326 Ga0157380_11228917 Ga0157380_112289172 95
646 3300014326 Ga0157380_11713645 Ga0157380_117136451 95
647 3300014326 Ga0157380_11793569 Ga0157380_117935692 95
648 3300014497 Ga0182008_10451200 Ga0182008_104512002 95
649 3300014497 Ga0182008_10557601 Ga0182008_105576012 95
650 3300014497 Ga0182008_10720084 Ga0182008_107200842 95
651 3300014745 Ga0157377_10697727 Ga0157377_106977271 95
652 3300014745 Ga0157377_10741474 Ga0157377_107414742 95
653 3300014968 Ga0157379_10341724 Ga0157379_103417242 95
654 3300014968 Ga0157379_10686585 Ga0157379_106865852 95
655 3300014968 Ga0157379_11006762 Ga0157379_110067622 95
656 3300014969 Ga0157376_11359720 Ga0157376_113597201 95
657 3300014969 Ga0157376_11391074 Ga0157376_113910742 95
658 3300014969 Ga0157376_11496398 Ga0157376_114963981 95
659 3300014969 Ga0157376_12156236 Ga0157376_121562361 95
660 3300014969 Ga0157376_12272841 Ga0157376_122728411 95
661 3300014969 Ga0157376_12467873 Ga0157376_124678731 95
662 3300015262 Ga0182007_10344024 Ga0182007_103440242 95
663 3300017792 Ga0163161_10325654 Ga0163161_103256542 95
664 3300017792 Ga0163161_11662578 Ga0163161_116625782 95
665 3300020069 Ga0197907_10271294 Ga0197907_102712942 95
666 3300020070 Ga0206356_10577626 Ga0206356_105776262 95
667 3300020070 Ga0206356_11213340 Ga0206356_112133402 95
668 3300020078 Ga0206352_10294202 Ga0206352_102942022 95
669 3300020080 Ga0206350_10075550 Ga0206350_100755502 95
670 3300020080 Ga0206350_10286740 Ga0206350_102867402 95
671 3300020080 Ga0206350_11409165 Ga0206350_114091652 95
672 3300020081 Ga0206354_10618544 Ga0206354_106185442 95
673 3300020082 Ga0206353_10237312 Ga0206353_102373121 95
674 3300020082 Ga0206353_10370279 Ga0206353_103702792 95
675 3300020082 Ga0206353_10529886 Ga0206353_105298862 95
676 3300021320 Ga0214544_1000001 Ga0214544_1000001704 95
677 3300021320 Ga0214544_1031159 Ga0214544_10311592 95
678 3300021321 Ga0214542_1000037 Ga0214542_100003789 95
679 3300021321 Ga0214542_1030806 Ga0214542_10308062 95
680 3300021321 Ga0214542_1033003 Ga0214542_10330032 95
681 3300021324 Ga0214545_1000003 Ga0214545_100000356 95
682 3300021324 Ga0214545_1026887 Ga0214545_10268873 95
683 3300021327 Ga0214543_1002913 Ga0214543_10029139 95
684 3300021327 Ga0214543_1040381 Ga0214543_10403812 95
685 3300021358 Ga0213873_10009061 Ga0213873_100090612 95
686 3300021361 Ga0213872_10087542 Ga0213872_100875422 95
687 3300021361 Ga0213872_10124231 Ga0213872_101242312 95
688 3300021361 Ga0213872_10360902 Ga0213872_103609022 95
689 3300021377 Ga0213874_10068430 Ga0213874_100684302 95
690 3300021384 Ga0213876_10099344 Ga0213876_100993442 95
691 3300021384 Ga0213876_10188074 Ga0213876_101880742 95
692 3300021384 Ga0213876_10240480 Ga0213876_102404802 95
693 3300021384 Ga0213876_10247865 Ga0213876_102478652 95
694 3300021388 Ga0213875_10029011 Ga0213875_100290113 95
695 3300021388 Ga0213875_10229605 Ga0213875_102296052 95
696 3300021388 Ga0213875_10417102 Ga0213875_104171021 95
697 3300021441 Ga0213871_10005326 Ga0213871_100053263 95
698 3300021441 Ga0213871_10045747 Ga0213871_100457472 95
699 3300022467 Ga0224712_10045861 Ga0224712_100458612 95
700 3300022467 Ga0224712_10071680 Ga0224712_100716802 95
701 3300022467 Ga0224712_10199616 Ga0224712_101996162 95
702 3300022467 Ga0224712_10223100 Ga0224712_102231002 95
703 3300025230 Ga0209563_102616 Ga0209563_1026163 95
704 3300025253 Ga0209677_100864 Ga0209677_1008643 95
705 3300025253 Ga0209677_102633 Ga0209677_1026336 95
706 3300025254 Ga0209148_1000347 Ga0209148_100034714 95
707 3300025254 Ga0209148_1022300 Ga0209148_10223001 95
708 3300025261 Ga0209233_1004395 Ga0209233_10043954 95
709 3300025261 Ga0209233_1019537 Ga0209233_10195372 95
710 3300025261 Ga0209233_1053869 Ga0209233_10538692 95
711 3300025272 Ga0209455_1002846 Ga0209455_10028467 95
712 3300025272 Ga0209455_1005515 Ga0209455_10055154 95
713 3300025272 Ga0209455_1005697 Ga0209455_10056971 95
714 3300025272 Ga0209455_1024703 Ga0209455_10247032 95
715 3300025273 Ga0209673_1031606 Ga0209673_10316063 95
716 3300025294 Ga0209025_1000486 Ga0209025_100048662 95
717 3300025295 Ga0209564_1005446 Ga0209564_10054465 95
718 3300025295 Ga0209564_1032247 Ga0209564_10322472 95
719 3300025295 Ga0209564_1092614 Ga0209564_10926141 95
720 3300025297 Ga0209758_1000133 Ga0209758_1000133114 95
721 3300025297 Ga0209758_1000651 Ga0209758_100065122 95
722 3300025297 Ga0209758_1002089 Ga0209758_100208918 95
723 3300025297 Ga0209758_1003759 Ga0209758_10037598 95
724 3300025297 Ga0209758_1004578 Ga0209758_10045784 95
725 3300025297 Ga0209758_1004997 Ga0209758_10049976 95
726 3300025297 Ga0209758_1008659 Ga0209758_10086598 95
727 3300025297 Ga0209758_1023499 Ga0209758_10234991 95
728 3300025297 Ga0209758_1029337 Ga0209758_10293374 95
729 3300025299 Ga0209256_1009928 Ga0209256_10099282 95
730 3300025299 Ga0209256_1046417 Ga0209256_10464172 95
731 3300025302 Ga0207426_1000270 Ga0207426_100027027 95
732 3300025302 Ga0207426_1000800 Ga0207426_100080018 95
733 3300025302 Ga0207426_1004676 Ga0207426_10046766 95
734 3300025302 Ga0207426_1049446 Ga0207426_10494463 95
735 3300025302 Ga0207426_1131110 Ga0207426_11311102 95
736 3300025302 Ga0207426_1148845 Ga0207426_11488451 95
737 3300025304 Ga0209257_1023146 Ga0209257_10231464 95
738 3300025304 Ga0209257_1027855 Ga0209257_10278553 95
739 3300025321 Ga0207656_10414096 Ga0207656_104140961 95
740 3300025711 Ga0207696_1146367 Ga0207696_11463671 95
741 3300025893 Ga0207682_10382504 Ga0207682_103825042 95
742 3300025898 Ga0207692_10000987 Ga0207692_1000098710 95
743 3300025898 Ga0207692_10019898 Ga0207692_100198984 95
744 3300025899 Ga0207642_10060594 Ga0207642_100605943 95
745 3300025899 Ga0207642_10378936 Ga0207642_103789362 95
746 3300025899 Ga0207642_11030183 Ga0207642_110301832 95
747 3300025900 Ga0207710_10067814 Ga0207710_100678142 95
748 3300025900 Ga0207710_10152690 Ga0207710_101526902 95
749 3300025900 Ga0207710_10256688 Ga0207710_102566882 95
750 3300025901 Ga0207688_10019453 Ga0207688_100194536 95
751 3300025901 Ga0207688_10245375 Ga0207688_102453752 95
752 3300025903 Ga0207680_11180892 Ga0207680_111808922 95
753 3300025904 Ga0207647_10012647 Ga0207647_100126473 95
754 3300025904 Ga0207647_10077264 Ga0207647_100772642 95
755 3300025904 Ga0207647_10330299 Ga0207647_103302992 95
756 3300025904 Ga0207647_10547975 Ga0207647_105479751 95
757 3300025905 Ga0207685_10052756 Ga0207685_100527563 95
758 3300025906 Ga0207699_10000435 Ga0207699_100004355 95
759 3300025906 Ga0207699_10022841 Ga0207699_100228412 95
760 3300025906 Ga0207699_10029636 Ga0207699_100296363 95
761 3300025906 Ga0207699_10117630 Ga0207699_101176301 95
762 3300025906 Ga0207699_10340137 Ga0207699_103401372 95
763 3300025906 Ga0207699_10491816 Ga0207699_104918161 95
764 3300025906 Ga0207699_10572272 Ga0207699_105722721 95
765 3300025907 Ga0207645_10652023 Ga0207645_106520232 95
766 3300025908 Ga0207643_10174369 Ga0207643_101743692 95
767 3300025909 Ga0207705_10013516 Ga0207705_100135167 95
768 3300025909 Ga0207705_10107292 Ga0207705_101072922 95
769 3300025909 Ga0207705_10178360 Ga0207705_101783602 95
770 3300025909 Ga0207705_10332922 Ga0207705_103329222 95
771 3300025909 Ga0207705_10333617 Ga0207705_103336171 95
772 3300025909 Ga0207705_10388613 Ga0207705_103886132 95
773 3300025909 Ga0207705_10439968 Ga0207705_104399682 95
774 3300025909 Ga0207705_10966201 Ga0207705_109662013 95
775 3300025910 Ga0207684_10040661 Ga0207684_100406612 95
776 3300025910 Ga0207684_10668253 Ga0207684_106682532 95
777 3300025910 Ga0207684_11045812 Ga0207684_110458121 95
778 3300025911 Ga0207654_10143535 Ga0207654_101435352 95
779 3300025911 Ga0207654_10627977 Ga0207654_106279772 95
780 3300025911 Ga0207654_10984678 Ga0207654_109846781 95
781 3300025911 Ga0207654_11404905 Ga0207654_114049052 95
782 3300025912 Ga0207707_10000605 Ga0207707_1000060531 95
783 3300025912 Ga0207707_10021006 Ga0207707_100210066 95
784 3300025912 Ga0207707_10072757 Ga0207707_100727573 95
785 3300025912 Ga0207707_10081043 Ga0207707_100810432 95
786 3300025912 Ga0207707_10114428 Ga0207707_101144282 95
787 3300025912 Ga0207707_10298934 Ga0207707_102989342 95
788 3300025912 Ga0207707_10955521 Ga0207707_109555212 95
789 3300025912 Ga0207707_11121845 Ga0207707_111218452 95
790 3300025913 Ga0207695_10000008 Ga0207695_10000008859 95
791 3300025913 Ga0207695_10109794 Ga0207695_101097942 95
792 3300025913 Ga0207695_10122066 Ga0207695_101220663 95
793 3300025913 Ga0207695_10152809 Ga0207695_101528092 95
794 3300025913 Ga0207695_10171235 Ga0207695_101712352 95
795 3300025913 Ga0207695_10692869 Ga0207695_106928692 95
796 3300025913 Ga0207695_10714659 Ga0207695_107146591 95
797 3300025914 Ga0207671_10004779 Ga0207671_1000477912 95
798 3300025914 Ga0207671_10008416 Ga0207671_100084168 95
799 3300025914 Ga0207671_10252637 Ga0207671_102526372 95
800 3300025914 Ga0207671_10321253 Ga0207671_103212531 95
801 3300025914 Ga0207671_10581256 Ga0207671_105812562 95
802 3300025914 Ga0207671_10730253 Ga0207671_107302531 95
803 3300025914 Ga0207671_11065008 Ga0207671_110650082 95
804 3300025915 Ga0207693_10025498 Ga0207693_100254983 95
805 3300025915 Ga0207693_10039884 Ga0207693_100398844 95
806 3300025915 Ga0207693_10075478 Ga0207693_100754783 95
807 3300025915 Ga0207693_10091190 Ga0207693_100911902 95
808 3300025915 Ga0207693_10508124 Ga0207693_105081242 95
809 3300025915 Ga0207693_10733855 Ga0207693_107338552 95
810 3300025916 Ga0207663_10002427 Ga0207663_100024276 95
811 3300025916 Ga0207663_10006759 Ga0207663_100067596 95
812 3300025916 Ga0207663_10038528 Ga0207663_100385284 95
813 3300025916 Ga0207663_10132763 Ga0207663_101327633 95
814 3300025916 Ga0207663_10260326 Ga0207663_102603262 95
815 3300025916 Ga0207663_10283814 Ga0207663_102838142 95
816 3300025916 Ga0207663_11621751 Ga0207663_116217512 95
817 3300025917 Ga0207660_10010489 Ga0207660_100104898 95
818 3300025917 Ga0207660_10102184 Ga0207660_101021844 95
819 3300025917 Ga0207660_10208444 Ga0207660_102084442 95
820 3300025917 Ga0207660_10247257 Ga0207660_102472572 95
821 3300025917 Ga0207660_10378751 Ga0207660_103787512 95
822 3300025917 Ga0207660_10432439 Ga0207660_104324392 95
823 3300025917 Ga0207660_10566193 Ga0207660_105661932 95
824 3300025917 Ga0207660_10722465 Ga0207660_107224652 95
825 3300025917 Ga0207660_11128833 Ga0207660_111288331 95
826 3300025917 Ga0207660_11319780 Ga0207660_113197802 95
827 3300025917 Ga0207660_11605387 Ga0207660_116053872 95
828 3300025918 Ga0207662_10236132 Ga0207662_102361322 95
829 3300025918 Ga0207662_10727525 Ga0207662_107275252 95
830 3300025919 Ga0207657_10047956 Ga0207657_100479565 95
831 3300025919 Ga0207657_10200080 Ga0207657_102000802 95
832 3300025919 Ga0207657_10355323 Ga0207657_103553232 95
833 3300025919 Ga0207657_10436945 Ga0207657_104369452 95
834 3300025919 Ga0207657_11060001 Ga0207657_110600011 95
835 3300025920 Ga0207649_10271283 Ga0207649_102712832 95
836 3300025920 Ga0207649_10385893 Ga0207649_103858932 95
837 3300025920 Ga0207649_11225233 Ga0207649_112252332 95
838 3300025921 Ga0207652_10036652 Ga0207652_100366525 95
839 3300025921 Ga0207652_10062784 Ga0207652_100627844 95
840 3300025921 Ga0207652_10376542 Ga0207652_103765422 95
841 3300025921 Ga0207652_10757790 Ga0207652_107577902 95
842 3300025921 Ga0207652_11144208 Ga0207652_111442081 95
843 3300025921 Ga0207652_11160684 Ga0207652_111606842 95
844 3300025921 Ga0207652_11462060 Ga0207652_114620602 95
845 3300025922 Ga0207646_10906837 Ga0207646_109068372 95
846 3300025923 Ga0207681_10902490 Ga0207681_109024902 95
847 3300025924 Ga0207694_10100084 Ga0207694_101000842 95
848 3300025924 Ga0207694_10245861 Ga0207694_102458611 95
849 3300025924 Ga0207694_10375101 Ga0207694_103751012 95
850 3300025924 Ga0207694_10410568 Ga0207694_104105682 95
851 3300025924 Ga0207694_10898033 Ga0207694_108980331 95
852 3300025924 Ga0207694_10972703 Ga0207694_109727032 95
853 3300025924 Ga0207694_11438392 Ga0207694_114383922 95
854 3300025925 Ga0207650_10059675 Ga0207650_100596752 95
855 3300025925 Ga0207650_10116674 Ga0207650_101166741 95
856 3300025925 Ga0207650_10319661 Ga0207650_103196612 95
857 3300025926 Ga0207659_10439215 Ga0207659_104392151 95
858 3300025926 Ga0207659_10776563 Ga0207659_107765632 95
859 3300025926 Ga0207659_11615852 Ga0207659_116158522 95
860 3300025927 Ga0207687_10085241 Ga0207687_100852412 95
861 3300025927 Ga0207687_10094567 Ga0207687_100945673 95
862 3300025927 Ga0207687_10123001 Ga0207687_101230012 95
863 3300025927 Ga0207687_10142227 Ga0207687_101422272 95
864 3300025927 Ga0207687_11171961 Ga0207687_111719612 95
865 3300025927 Ga0207687_11249270 Ga0207687_112492701 95
866 3300025928 Ga0207700_10007806 Ga0207700_100078064 95
867 3300025928 Ga0207700_10026732 Ga0207700_100267321 95
868 3300025928 Ga0207700_10043162 Ga0207700_100431624 95
869 3300025928 Ga0207700_10087324 Ga0207700_100873244 95
870 3300025928 Ga0207700_10750834 Ga0207700_107508342 95
871 3300025928 Ga0207700_11206368 Ga0207700_112063682 95
872 3300025928 Ga0207700_11507855 Ga0207700_115078552 95
873 3300025929 Ga0207664_10005062 Ga0207664_100050626 95
874 3300025929 Ga0207664_10092312 Ga0207664_100923122 95
875 3300025929 Ga0207664_10636997 Ga0207664_106369971 95
876 3300025929 Ga0207664_10658085 Ga0207664_106580852 95
877 3300025929 Ga0207664_10990786 Ga0207664_109907862 95
878 3300025931 Ga0207644_10521666 Ga0207644_105216662 95
879 3300025931 Ga0207644_10597154 Ga0207644_105971542 95
880 3300025931 Ga0207644_10726895 Ga0207644_107268952 95
881 3300025931 Ga0207644_10739773 Ga0207644_107397732 95
882 3300025932 Ga0207690_10124017 Ga0207690_101240172 95
883 3300025932 Ga0207690_10321204 Ga0207690_103212042 95
884 3300025932 Ga0207690_10517284 Ga0207690_105172842 95
885 3300025932 Ga0207690_10654680 Ga0207690_106546802 95
886 3300025932 Ga0207690_10781250 Ga0207690_107812502 95
887 3300025932 Ga0207690_11091665 Ga0207690_110916652 95
888 3300025932 Ga0207690_11327247 Ga0207690_113272471 95
889 3300025933 Ga0207706_10054980 Ga0207706_100549802 95
890 3300025933 Ga0207706_10212882 Ga0207706_102128822 95
891 3300025933 Ga0207706_11371997 Ga0207706_113719972 95
892 3300025935 Ga0207709_10094764 Ga0207709_100947642 95
893 3300025935 Ga0207709_10325146 Ga0207709_103251462 95
894 3300025935 Ga0207709_10642343 Ga0207709_106423432 95
895 3300025936 Ga0207670_10101417 Ga0207670_101014172 95
896 3300025936 Ga0207670_10196428 Ga0207670_101964283 95
897 3300025936 Ga0207670_10716665 Ga0207670_107166652 95
898 3300025936 Ga0207670_11651057 Ga0207670_116510572 95
899 3300025937 Ga0207669_10023150 Ga0207669_100231504 95
900 3300025937 Ga0207669_10032232 Ga0207669_100322322 95
901 3300025937 Ga0207669_10094032 Ga0207669_100940323 95
902 3300025937 Ga0207669_10106170 Ga0207669_101061703 95
903 3300025937 Ga0207669_11142998 Ga0207669_111429982 95
904 3300025937 Ga0207669_11914865 Ga0207669_119148651 95
905 3300025938 Ga0207704_10066994 Ga0207704_100669943 95
906 3300025938 Ga0207704_10636260 Ga0207704_106362602 95
907 3300025938 Ga0207704_10957460 Ga0207704_109574602 95
908 3300025939 Ga0207665_10013322 Ga0207665_100133222 95
909 3300025939 Ga0207665_10124708 Ga0207665_101247082 95
910 3300025939 Ga0207665_10193527 Ga0207665_101935272 95
911 3300025939 Ga0207665_10213216 Ga0207665_102132162 95
912 3300025939 Ga0207665_10249168 Ga0207665_102491682 95
913 3300025939 Ga0207665_10277085 Ga0207665_102770852 95
914 3300025939 Ga0207665_10353338 Ga0207665_103533382 95
915 3300025940 Ga0207691_10351260 Ga0207691_103512602 95
916 3300025940 Ga0207691_10411563 Ga0207691_104115632 95
917 3300025940 Ga0207691_10427676 Ga0207691_104276762 95
918 3300025941 Ga0207711_10100091 Ga0207711_101000914 95
919 3300025941 Ga0207711_10559859 Ga0207711_105598592 95
920 3300025941 Ga0207711_10598593 Ga0207711_105985931 95
921 3300025941 Ga0207711_10893130 Ga0207711_108931301 95
922 3300025941 Ga0207711_11575691 Ga0207711_115756911 95
923 3300025942 Ga0207689_10093390 Ga0207689_100933903 95
924 3300025942 Ga0207689_10216042 Ga0207689_102160422 95
925 3300025942 Ga0207689_10216105 Ga0207689_102161052 95
926 3300025942 Ga0207689_10427043 Ga0207689_104270432 95
927 3300025942 Ga0207689_10965954 Ga0207689_109659541 95
928 3300025944 Ga0207661_10004990 Ga0207661_100049904 95
929 3300025944 Ga0207661_10768349 Ga0207661_107683491 95
930 3300025944 Ga0207661_10832379 Ga0207661_108323792 95
931 3300025944 Ga0207661_11510533 Ga0207661_115105332 95
932 3300025945 Ga0207679_10039514 Ga0207679_100395142 95
933 3300025945 Ga0207679_10210664 Ga0207679_102106642 95
934 3300025945 Ga0207679_11143253 Ga0207679_111432532 95
935 3300025949 Ga0207667_10016171 Ga0207667_100161714 95
936 3300025949 Ga0207667_10116497 Ga0207667_101164974 95
937 3300025949 Ga0207667_10167984 Ga0207667_101679842 95
938 3300025949 Ga0207667_10195176 Ga0207667_101951762 95
939 3300025949 Ga0207667_10196205 Ga0207667_101962053 95
940 3300025949 Ga0207667_10279901 Ga0207667_102799012 95
941 3300025949 Ga0207667_10374022 Ga0207667_103740221 95
942 3300025949 Ga0207667_10709073 Ga0207667_107090732 95
943 3300025949 Ga0207667_11200288 Ga0207667_112002882 95
944 3300025949 Ga0207667_11457439 Ga0207667_114574392 95
945 3300025949 Ga0207667_11621310 Ga0207667_116213102 95
946 3300025949 Ga0207667_12056768 Ga0207667_120567681 95
947 3300025960 Ga0207651_10051453 Ga0207651_100514534 95
948 3300025960 Ga0207651_10490162 Ga0207651_104901622 95
949 3300025961 Ga0207712_10879577 Ga0207712_108795772 95
950 3300025961 Ga0207712_10999786 Ga0207712_109997862 95
951 3300025961 Ga0207712_11196782 Ga0207712_111967821 95
952 3300025961 Ga0207712_11381789 Ga0207712_113817891 95
953 3300025972 Ga0207668_10003848 Ga0207668_1000384810 95
954 3300025972 Ga0207668_10022600 Ga0207668_100226004 95
955 3300025972 Ga0207668_10037005 Ga0207668_100370052 95
956 3300025972 Ga0207668_10378141 Ga0207668_103781412 95
957 3300025972 Ga0207668_10897827 Ga0207668_108978271 95
958 3300025981 Ga0207640_10618307 Ga0207640_106183072 95
959 3300025981 Ga0207640_10755973 Ga0207640_107559732 95
960 3300025981 Ga0207640_10965050 Ga0207640_109650502 95
961 3300025981 Ga0207640_11522483 Ga0207640_115224832 95
962 3300025986 Ga0207658_10320728 Ga0207658_103207282 95
963 3300025986 Ga0207658_10453064 Ga0207658_104530642 95
964 3300025986 Ga0207658_10643883 Ga0207658_106438832 95
965 3300025986 Ga0207658_10679141 Ga0207658_106791412 95
966 3300025986 Ga0207658_11083320 Ga0207658_110833202 95
967 3300025986 Ga0207658_12089699 Ga0207658_120896991 95
968 3300026023 Ga0207677_10183595 Ga0207677_101835952 95
969 3300026023 Ga0207677_11192639 Ga0207677_111926391 95
970 3300026023 Ga0207677_11195411 Ga0207677_111954112 95
971 3300026023 Ga0207677_11250950 Ga0207677_112509502 95
972 3300026035 Ga0207703_10126347 Ga0207703_101263471 95
973 3300026035 Ga0207703_10150741 Ga0207703_101507413 95
974 3300026035 Ga0207703_10203385 Ga0207703_102033852 95
975 3300026035 Ga0207703_10873705 Ga0207703_108737052 95
976 3300026035 Ga0207703_11249349 Ga0207703_112493492 95
977 3300026041 Ga0207639_10258852 Ga0207639_102588522 95
978 3300026041 Ga0207639_10260819 Ga0207639_102608192 95
979 3300026041 Ga0207639_10439711 Ga0207639_104397112 95
980 3300026041 Ga0207639_10626617 Ga0207639_106266172 95
981 3300026041 Ga0207639_10893204 Ga0207639_108932042 95
982 3300026041 Ga0207639_11131865 Ga0207639_111318652 95
983 3300026041 Ga0207639_11712855 Ga0207639_117128552 95
984 3300026041 Ga0207639_11951931 Ga0207639_119519312 95
985 3300026067 Ga0207678_10006578 Ga0207678_100065789 95
986 3300026067 Ga0207678_10037538 Ga0207678_100375381 95
987 3300026067 Ga0207678_10114782 Ga0207678_101147822 95
988 3300026067 Ga0207678_10139263 Ga0207678_101392631 95
989 3300026067 Ga0207678_10144094 Ga0207678_101440942 95
990 3300026067 Ga0207678_10145123 Ga0207678_101451232 95
991 3300026067 Ga0207678_10347935 Ga0207678_103479352 95
992 3300026067 Ga0207678_10623794 Ga0207678_106237941 95
993 3300026067 Ga0207678_10720939 Ga0207678_107209391 95
994 3300026067 Ga0207678_10845401 Ga0207678_108454011 95
995 3300026067 Ga0207678_11072061 Ga0207678_110720612 95
996 3300026075 Ga0207708_10289865 Ga0207708_102898652 95
997 3300026075 Ga0207708_10427307 Ga0207708_104273072 95
998 3300026075 Ga0207708_10880690 Ga0207708_108806902 95
999 3300026075 Ga0207708_11556502 Ga0207708_115565021 95
1000 3300026078 Ga0207702_10000371 Ga0207702_1000037116 95
1001 3300026078 Ga0207702_10070252 Ga0207702_100702522 95
1002 3300026078 Ga0207702_10071916 Ga0207702_100719164 95
1003 3300026078 Ga0207702_10088133 Ga0207702_100881334 95
1004 3300026078 Ga0207702_10231155 Ga0207702_102311552 95
1005 3300026078 Ga0207702_10605193 Ga0207702_106051931 95
1006 3300026078 Ga0207702_10748664 Ga0207702_107486642 95
1007 3300026078 Ga0207702_10885186 Ga0207702_108851861 95
1008 3300026078 Ga0207702_10916150 Ga0207702_109161502 95
1009 3300026088 Ga0207641_10194534 Ga0207641_101945343 95
1010 3300026088 Ga0207641_10978614 Ga0207641_109786142 95
1011 3300026089 Ga0207648_10059458 Ga0207648_100594582 95
1012 3300026089 Ga0207648_10513987 Ga0207648_105139872 95
1013 3300026089 Ga0207648_10861735 Ga0207648_108617352 95
1014 3300026089 Ga0207648_11013536 Ga0207648_110135362 95
1015 3300026089 Ga0207648_11824891 Ga0207648_118248912 95
1016 3300026089 Ga0207648_12020101 Ga0207648_120201012 95
1017 3300026095 Ga0207676_10416998 Ga0207676_104169983 95
1018 3300026095 Ga0207676_10638829 Ga0207676_106388292 95
1019 3300026095 Ga0207676_10649040 Ga0207676_106490402 95
1020 3300026095 Ga0207676_10758068 Ga0207676_107580682 95
1021 3300026095 Ga0207676_11444510 Ga0207676_114445102 95
1022 3300026095 Ga0207676_11587681 Ga0207676_115876811 95
1023 3300026095 Ga0207676_11706095 Ga0207676_117060952 95
1024 3300026116 Ga0207674_10010283 Ga0207674_100102837 95
1025 3300026116 Ga0207674_10323800 Ga0207674_103238003 95
1026 3300026116 Ga0207674_10340669 Ga0207674_103406692 95
1027 3300026118 Ga0207675_100176847 Ga0207675_1001768472 95
1028 3300026118 Ga0207675_100490515 Ga0207675_1004905152 95
1029 3300026118 Ga0207675_100780445 Ga0207675_1007804452 95
1030 3300026118 Ga0207675_100818408 Ga0207675_1008184082 95
1031 3300026121 Ga0207683_10010044 Ga0207683_1001004411 95
1032 3300026121 Ga0207683_10035624 Ga0207683_100356242 95
1033 3300026121 Ga0207683_10085162 Ga0207683_100851622 95
1034 3300026121 Ga0207683_10139205 Ga0207683_101392052 95
1035 3300026121 Ga0207683_10188700 Ga0207683_101887003 95
1036 3300026121 Ga0207683_10391646 Ga0207683_103916462 95
1037 3300026121 Ga0207683_10436867 Ga0207683_104368671 95
1038 3300026121 Ga0207683_10608625 Ga0207683_106086252 95
1039 3300026121 Ga0207683_10762782 Ga0207683_107627821 95
1040 3300026121 Ga0207683_11301271 Ga0207683_113012712 95
1041 3300026142 Ga0207698_10236663 Ga0207698_102366632 95
1042 3300026142 Ga0207698_10787589 Ga0207698_107875892 95
1043 3300026142 Ga0207698_11204794 Ga0207698_112047942 95
1044 3300026142 Ga0207698_11736068 Ga0207698_117360682 95
1045 3300026142 Ga0207698_11959511 Ga0207698_119595112 95
1046 3300026142 Ga0207698_12525354 Ga0207698_125253541 95
1047 3300026142 Ga0207698_12630929 Ga0207698_126309292 95
1048 3300027296 Ga0209389_1000001 Ga0209389_100000176 95
1049 3300027296 Ga0209389_1000014 Ga0209389_1000014122 95
1050 3300027357 Ga0209589_1000011 Ga0209589_1000011161 95
1051 3300027357 Ga0209589_1000020 Ga0209589_1000020122 95
1052 3300027361 Ga0209489_100012 Ga0209489_100012161 95
1053 3300027361 Ga0209489_100060 Ga0209489_10006081 95
1054 3300027361 Ga0209489_102213 Ga0209489_10221324 95
1055 3300027363 Ga0209700_100007 Ga0209700_100007328 95
1056 3300027363 Ga0209700_100019 Ga0209700_100019161 95
1057 3300027671 Ga0209588_1231160 Ga0209588_12311602 95
1058 3300027866 Ga0209813_10044494 Ga0209813_100444943 95
1059 3300027866 Ga0209813_10261358 Ga0209813_102613582 95
1060 3300027866 Ga0209813_10482390 Ga0209813_104823901 95
1061 3300027876 Ga0209974_10378294 Ga0209974_103782942 95
1062 3300027907 Ga0207428_10130415 Ga0207428_101304152 95
1063 3300028379 Ga0268266_10003223 Ga0268266_100032238 95
1064 3300028379 Ga0268266_10004652 Ga0268266_100046522 95
1065 3300028379 Ga0268266_10056422 Ga0268266_100564223 95
1066 3300028379 Ga0268266_10101828 Ga0268266_101018284 95
1067 3300028379 Ga0268266_10118807 Ga0268266_101188072 95
1068 3300028379 Ga0268266_10666723 Ga0268266_106667232 95
1069 3300028379 Ga0268266_10743819 Ga0268266_107438191 95
1070 3300028379 Ga0268266_11046032 Ga0268266_110460322 95
1071 3300028379 Ga0268266_11062181 Ga0268266_110621812 95
1072 3300028379 Ga0268266_11668055 Ga0268266_116680552 95
1073 3300028380 Ga0268265_10371579 Ga0268265_103715792 95
1074 3300028380 Ga0268265_10451027 Ga0268265_104510272 95
1075 3300028380 Ga0268265_10464517 Ga0268265_104645172 95
1076 3300028380 Ga0268265_10469232 Ga0268265_104692322 95
1077 3300028380 Ga0268265_11479417 Ga0268265_114794172 95
1078 3300028380 Ga0268265_11745845 Ga0268265_117458451 95
1079 3300028380 Ga0268265_11994229 Ga0268265_119942291 95
1080 3300028381 Ga0268264_10000048 Ga0268264_1000004811 95
1081 3300028381 Ga0268264_10438182 Ga0268264_104381822 95
1082 3300028381 Ga0268264_10647265 Ga0268264_106472652 95
1083 3300028381 Ga0268264_10753632 Ga0268264_107536322 95
1084 3300028381 Ga0268264_11085186 Ga0268264_110851862 95
1085 3300028381 Ga0268264_11651498 Ga0268264_116514982 95
1086 3300028381 Ga0268264_12423976 Ga0268264_124239762 95
1087 3300028556 Ga0265337_1038032 Ga0265337_10380322 95
1088 3300028558 Ga0265326_10004901 Ga0265326_100049016 95
1089 3300028563 Ga0265319_1062457 Ga0265319_10624572 95
1090 3300028573 Ga0265334_10010029 Ga0265334_100100292 95
1091 3300028577 Ga0265318_10014576 Ga0265318_100145764 95
1092 3300028653 Ga0265323_10002347 Ga0265323_100023473 95
1093 3300028666 Ga0265336_10000427 Ga0265336_1000042724 95
1094 3300028786 Ga0307517_10002778 Ga0307517_1000277812 95
1095 3300028786 Ga0307517_10060218 Ga0307517_100602183 95
1096 3300028786 Ga0307517_10242645 Ga0307517_102426451 95
1097 3300028794 Ga0307515_10025133 Ga0307515_100251339 95
1098 3300028794 Ga0307515_10190478 Ga0307515_101904782 95
1099 3300028794 Ga0307515_10523608 Ga0307515_105236082 95
1100 3300028800 Ga0265338_10000582 Ga0265338_1000058235 95
1101 3300028800 Ga0265338_10206468 Ga0265338_102064682 95
1102 3300028800 Ga0265338_11116333 Ga0265338_111163332 95
1103 3300030521 Ga0307511_10111069 Ga0307511_101110691 95
1104 3300030521 Ga0307511_10127429 Ga0307511_101274292 95
1105 3300031018 Ga0265773_1040049 Ga0265773_10400491 95
1106 3300031090 Ga0265760_10327978 Ga0265760_103279781 95
1107 3300031235 Ga0265330_10014164 Ga0265330_100141644 95
1108 3300031235 Ga0265330_10360114 Ga0265330_103601141 95
1109 3300031238 Ga0265332_10051238 Ga0265332_100512383 95
1110 3300031238 Ga0265332_10130240 Ga0265332_101302402 95
1111 3300031241 Ga0265325_10018025 Ga0265325_100180252 95
1112 3300031247 Ga0265340_10110687 Ga0265340_101106872 95
1113 3300031247 Ga0265340_10137673 Ga0265340_101376731 95
1114 3300031249 Ga0265339_10041383 Ga0265339_100413833 95
1115 3300031250 Ga0265331_10051237 Ga0265331_100512373 95
1116 3300031250 Ga0265331_10063430 Ga0265331_100634303 95
1117 3300031456 Ga0307513_10053911 Ga0307513_100539112 95
1118 3300031456 Ga0307513_10279625 Ga0307513_102796252 95
1119 3300031456 Ga0307513_10815925 Ga0307513_108159252 95
1120 3300031507 Ga0307509_10011398 Ga0307509_100113986 95
1121 3300031507 Ga0307509_10103359 Ga0307509_101033592 95
1122 3300031507 Ga0307509_10210401 Ga0307509_102104013 95
1123 3300031548 Ga0307408_100170159 Ga0307408_1001701592 95
1124 3300031548 Ga0307408_100368829 Ga0307408_1003688292 95
1125 3300031548 Ga0307408_101039666 Ga0307408_1010396662 95
1126 3300031548 Ga0307408_101743475 Ga0307408_1017434752 95
1127 3300031548 Ga0307408_102368906 Ga0307408_1023689061 95
1128 3300031595 Ga0265313_10009997 Ga0265313_100099972 95
1129 3300031595 Ga0265313_10024626 Ga0265313_100246261 95
1130 3300031616 Ga0307508_10000015 Ga0307508_10000015180 95
1131 3300031616 Ga0307508_10055392 Ga0307508_100553924 95
1132 3300031616 Ga0307508_10061684 Ga0307508_100616842 95
1133 3300031616 Ga0307508_10732840 Ga0307508_107328402 95
1134 3300031616 Ga0307508_10756961 Ga0307508_107569612 95
1135 3300031649 Ga0307514_10534745 Ga0307514_105347451 95
1136 3300031711 Ga0265314_10003429 Ga0265314_100034296 95
1137 3300031711 Ga0265314_10115643 Ga0265314_101156433 95
1138 3300031711 Ga0265314_10168707 Ga0265314_101687072 95
1139 3300031712 Ga0265342_10000319 Ga0265342_1000031939 95
1140 3300031712 Ga0265342_10019885 Ga0265342_100198853 95
1141 3300031730 Ga0307516_10009565 Ga0307516_100095656 95
1142 3300031730 Ga0307516_10061224 Ga0307516_100612243 95
1143 3300031730 Ga0307516_10126081 Ga0307516_101260812 95
1144 3300031730 Ga0307516_10144616 Ga0307516_101446162 95
1145 3300031730 Ga0307516_10477859 Ga0307516_104778592 95
1146 3300031730 Ga0307516_10829822 Ga0307516_108298221 95
1147 3300031730 Ga0307516_10843343 Ga0307516_108433431 95
1148 3300031731 Ga0307405_11094009 Ga0307405_110940091 95
1149 3300031731 Ga0307405_11379128 Ga0307405_113791282 95
1150 3300031824 Ga0307413_10766798 Ga0307413_107667982 95
1151 3300031852 Ga0307410_10634669 Ga0307410_106346692 95
1152 3300031852 Ga0307410_10762878 Ga0307410_107628782 95
1153 3300031889 Ga0326468_10009688 Ga0326468_100096882 95
1154 3300031901 Ga0307406_10067272 Ga0307406_100672722 95
1155 3300031901 Ga0307406_10626187 Ga0307406_106261872 95
1156 3300031901 Ga0307406_10767685 Ga0307406_107676851 95
1157 3300031911 Ga0307412_10048124 Ga0307412_100481243 95
1158 3300031911 Ga0307412_10403297 Ga0307412_104032972 95
1159 3300031911 Ga0307412_11375425 Ga0307412_113754252 95
1160 3300031911 Ga0307412_11749960 Ga0307412_117499601 95
1161 3300031995 Ga0307409_100902338 Ga0307409_1009023382 95
1162 3300031995 Ga0307409_101877401 Ga0307409_1018774012 95
1163 3300031995 Ga0307409_102508064 Ga0307409_1025080641 95
1164 3300032002 Ga0307416_100549828 Ga0307416_1005498282 95
1165 3300032002 Ga0307416_100916211 Ga0307416_1009162112 95
1166 3300032002 Ga0307416_101462354 Ga0307416_1014623541 95
1167 3300032004 Ga0307414_11919494 Ga0307414_119194942 95
1168 3300032005 Ga0307411_10036600 Ga0307411_100366002 95
1169 3300032005 Ga0307411_10717015 Ga0307411_107170152 95
1170 3300032126 Ga0307415_100071301 Ga0307415_1000713013 95
1171 3300032126 Ga0307415_100211267 Ga0307415_1002112672 95
1172 3300032126 Ga0307415_102512534 Ga0307415_1025125341 95
1173 3300032133 Ga0316583_10000299 Ga0316583_100002998 95
1174 3300033179 Ga0307507_10006824 Ga0307507_100068248 95
1175 3300033180 Ga0307510_10001397 Ga0307510_100013979 95
1176 3300033180 Ga0307510_10070491 Ga0307510_100704912 95
1177 3300033180 Ga0307510_10133008 Ga0307510_101330082 95
1178 3300033180 Ga0307510_10255175 Ga0307510_102551752 95
1179 3300033180 Ga0307510_10292462 Ga0307510_102924622 95
1180 3300033180 Ga0307510_10377739 Ga0307510_103777391 95
1181 3300033180 Ga0307510_10379321 Ga0307510_103793212 95
1182 3300033180 Ga0307510_10567114 Ga0307510_105671141 95
1183 3300033442 Ga0315911_1000002 Ga0315911_100000275 95
1184 3300033529 Ga0316587_1051704 Ga0316587_10517042 95
1185 3300033544 Ga0316215_1011073 Ga0316215_10110731 95
1186 3300034816 Ga0373930_0012374 Ga0373930_0012374_368_655 95
1187 3300034819 Ga0373958_0202226 Ga0373958_0202226_117_407 95
1188 3300034820 Ga0373959_0173060 Ga0373959_0173060_45_332 95
1189 3300034957 Ga0373938_0070580 Ga0373938_0070580_365_652 95
1190 3300034957 Ga0373938_0149410 Ga0373938_0149410_214_501 95
1191 3300035083 Ga0373926_0013987 Ga0373926_0013987_946_1233 95
1192 3300035084 Ga0373928_0211653 Ga0373928_0211653_207_494 95
1193 3300035086 Ga0373934_0042367 Ga0373934_0042367_1445_1735 95
1194 3300035086 Ga0373934_0258567 Ga0373934_0258567_240_539 95
1195 3300035090 Ga0373949_0173072 Ga0373949_0173072_238_525 95
1196 3300035091 Ga0373951_0219560 Ga0373951_0219560_230_520 95
1197 3300035111 Ga0373923_0002203 Ga0373923_0002203_4473_4775 95
1198 3300035111 Ga0373923_0022049 Ga0373923_0022049_142_429 95
1199 3300035111 Ga0373923_0026186 Ga0373923_0026186_289_576 95
1200 3300035112 Ga0373932_0147633 Ga0373932_0147633_299_586 95
1201 3300035112 Ga0373932_0159292 Ga0373932_0159292_410_697 95
1202 3300035112 Ga0373932_0328232 Ga0373932_0328232_114_401 95
1203 3300035113 Ga0373936_0001362 Ga0373936_0001362_2019_2306 95
1204 3300035113 Ga0373936_0027014 Ga0373936_0027014_1245_1535 95
1205 3300035113 Ga0373936_0163711 Ga0373936_0163711_315_617 95
1206 3300035113 Ga0373936_0364204 Ga0373936_0364204_281_568 95
1207 3300035114 Ga0373939_0453552 Ga0373939_0453552_116_403 95
1208 3300035115 Ga0373941_0234290 Ga0373941_0234290_332_619 95
1209 3300035116 Ga0373945_0019585 Ga0373945_0019585_1014_1301 95
1210 3300035116 Ga0373945_0079995 Ga0373945_0079995_216_503 95
1211 3300035116 Ga0373945_0264421 Ga0373945_0264421_144_431 95
1212 3300035117 Ga0373953_0001226 Ga0373953_0001226_5608_5910 95
1213 3300035117 Ga0373953_0009986 Ga0373953_0009986_1565_1852 95
1214 3300035117 Ga0373953_0062179 Ga0373953_0062179_446_733 95
1215 3300035117 Ga0373953_0081221 Ga0373953_0081221_646_933 95
1216 3300035117 Ga0373953_0495638 Ga0373953_0495638_220_507 95
1217 3300035118 Ga0373954_0001566 Ga0373954_0001566_467_769 95
1218 3300035118 Ga0373954_0063682 Ga0373954_0063682_1116_1403 95
1219 3300035118 Ga0373954_0094690 Ga0373954_0094690_465_752 95
1220 3300035118 Ga0373954_0337931 Ga0373954_0337931_69_371 95
1221 3300035119 Ga0373956_0002664 Ga0373956_0002664_5427_5729 95
1222 3300035119 Ga0373956_0034441 Ga0373956_0034441_911_1198 95
1223 3300035119 Ga0373956_0103803 Ga0373956_0103803_528_815 95
1224 3300035120 Ga0373957_0151701 Ga0373957_0151701_551_850 95
1225 3300035170 Ga0373943_0002814 Ga0373943_0002814_6889_7176 95
1226 3300035170 Ga0373943_0031042 Ga0373943_0031042_601_888 95
1227 3300035170 Ga0373943_0205439 Ga0373943_0205439_212_502 95
1228 3300035171 Ga0373946_0004615 Ga0373946_0004615_1210_1497 95
1229 3300035171 Ga0373946_0027212 Ga0373946_0027212_931_1218 95
1230 3300035172 Ga0373955_0006932 Ga0373955_0006932_1432_1734 95
1231 3300035172 Ga0373955_0018896 Ga0373955_0018896_1653_1940 95
1232 3300035172 Ga0373955_0031168 Ga0373955_0031168_1927_2214 95
1233 3300035172 Ga0373955_0041407 Ga0373955_0041407_2146_2433 95
1234 3300035172 Ga0373955_0058094 Ga0373955_0058094_609_896 95
1235 3300035241 Ga0373961_0214284 Ga0373961_0214284_82_369 95
1236 3300035242 Ga0373962_0170487 Ga0373962_0170487_280_570 95
1237 3300035410 Ga0373924_0003477 Ga0373924_0003477_2232_2534 95
1238 3300035410 Ga0373924_0035242 Ga0373924_0035242_1672_1959 95
1239 3300035691 Ga0373931_0009495 Ga0373931_0009495_3895_4182 95
1240 3300035691 Ga0373931_0289271 Ga0373931_0289271_615_902 95
1241 3300035691 Ga0373931_0427508 Ga0373931_0427508_143_430 95
1242 3300035691 Ga0373931_0754907 Ga0373931_0754907_343_633 95
1243 3300035692 Ga0373935_0012964 Ga0373935_0012964_1549_1836 95
1244 3300035692 Ga0373935_0042087 Ga0373935_0042087_1169_1456 95
1245 3300035692 Ga0373935_0441945 Ga0373935_0441945_372_659 95
1246 3300035692 Ga0373935_0742266 Ga0373935_0742266_151_453 95
1247 3300035692 Ga0373935_0811599 Ga0373935_0811599_85_375 95
1248 3300035692 Ga0373935_1382902 Ga0373935_1382902_10_297 95
1249 3300035695 Ga0373927_0000437 Ga0373927_0000437_30471_30758 95
1250 3300035695 Ga0373927_0040990 Ga0373927_0040990_2498_2788 95
1251 3300035695 Ga0373927_0127240 Ga0373927_0127240_175_462 95
1252 3300035695 Ga0373927_0140125 Ga0373927_0140125_165_452 95
1253 3300035695 Ga0373927_0147752 Ga0373927_0147752_886_1173 95
1254 3300035695 Ga0373927_0462833 Ga0373927_0462833_243_530 95
1255 3300035695 Ga0373927_0830928 Ga0373927_0830928_288_578 95
1256 3300035695 Ga0373927_1174372 Ga0373927_1174372_192_479 95
1257 3300035724 Ga0373933_0000296 Ga0373933_0000296_4630_4920 95
1258 3300035724 Ga0373933_0006277 Ga0373933_0006277_5164_5466 95
1259 3300035724 Ga0373933_0213697 Ga0373933_0213697_325_612 95
1260 3300035724 Ga0373933_0339869 Ga0373933_0339869_670_957 95
1261 3300035725 Ga0373947_0000180 Ga0373947_0000180_17701_17988 95
1262 3300035725 Ga0373947_0061864 Ga0373947_0061864_142_429 95
1263 3300035725 Ga0373947_0089999 Ga0373947_0089999_1206_1496 95
1264 3300036242 Ga0310104_15268 Ga0310104_15268_191_493 95
1265 3300036401 Ga0373937_0001389 Ga0373937_0001389_12788_13090 95
1266 3300036401 Ga0373937_0029494 Ga0373937_0029494_3243_3530 95
1267 3300036401 Ga0373937_0281867 Ga0373937_0281867_768_1055 95
1268 3300036401 Ga0373937_0380078 Ga0373937_0380078_27_314 95
1269 3300036401 Ga0373937_0514771 Ga0373937_0514771_478_765 95
1270 3300036401 Ga0373937_0901578 Ga0373937_0901578_278_568 95
1271 3300036401 Ga0373937_1273202 Ga0373937_1273202_44_343 95
1272 3300036401 Ga0373937_1747994 Ga0373937_1747994_144_431 95
1273 3300036459 Ga0372808_023002 Ga0372808_023002_79_366 95
1274 3300037068 Ga0373925_0000647 Ga0373925_0000647_27279_27566 95
1275 3300037068 Ga0373925_0026930 Ga0373925_0026930_3627_3917 95
1276 3300037068 Ga0373925_0033668 Ga0373925_0033668_1791_2078 95
1277 3300037068 Ga0373925_0064428 Ga0373925_0064428_303_590 95
1278 3300037068 Ga0373925_0555408 Ga0373925_0555408_523_810 95
1279 3300037068 Ga0373925_0577189 Ga0373925_0577189_135_422 95
1280 3300037068 Ga0373925_0617968 Ga0373925_0617968_391_678 95
1281 3300037068 Ga0373925_0925630 Ga0373925_0925630_299_586 95
1282 3300037068 Ga0373925_0946531 Ga0373925_0946531_279_593 95
1283 3300037312 Ga0395899_0048670 Ga0395899_0048670_1831_2118 95
1284 3300037312 Ga0395899_0132212 Ga0395899_0132212_1384_1671 95
1285 3300037312 Ga0395899_0372916 Ga0395899_0372916_244_531 95
1286 3300037418 Ga0395900_0000939 Ga0395900_0000939_10410_10697 95
1287 3300037418 Ga0395900_0141415 Ga0395900_0141415_862_1149 95
1288 3300037418 Ga0395900_0545260 Ga0395900_0545260_298_585 95
1289 3300037418 Ga0395900_0580051 Ga0395900_0580051_69_356 95
1290 3300037418 Ga0395900_0727827 Ga0395900_0727827_306_593 95
1291 3300037418 Ga0395900_0749669 Ga0395900_0749669_598_885 95
1292 3300037418 Ga0395900_0956669 Ga0395900_0956669_200_490 95
1293 3300037466 Ga0395898_0002686 Ga0395898_0002686_4928_5215 95
1294 3300037466 Ga0395898_0095865 Ga0395898_0095865_2021_2308 95
1295 3300037466 Ga0395898_0165219 Ga0395898_0165219_1693_1980 95
1296 3300037466 Ga0395898_0597306 Ga0395898_0597306_297_584 95
1297 3300037466 Ga0395898_1775849 Ga0395898_1775849_185_472 95
1298 3300037471 Ga0395905_0010169 Ga0395905_0010169_5916_6203 95
1299 3300037471 Ga0395905_0128876 Ga0395905_0128876_1182_1469 95
1300 3300037471 Ga0395905_0288701 Ga0395905_0288701_847_1134 95
1301 3300037471 Ga0395905_0339833 Ga0395905_0339833_837_1124 95
1302 3300037471 Ga0395905_0539483 Ga0395905_0539483_22_312 95
1303 3300037471 Ga0395905_1281866 Ga0395905_1281866_98_385 95
1304 3300037853 Ga0436364_0262085 Ga0436364_0262085_325_612 95
1305 3300037853 Ga0436364_0389980 Ga0436364_0389980_1507_1794 95
1306 3300037853 Ga0436364_0469624 Ga0436364_0469624_2463_2750 95
1307 3300037853 Ga0436364_0883924 Ga0436364_0883924_117_404 95
1308 3300037853 Ga0436364_1039552 Ga0436364_1039552_102_389 95
1309 3300037853 Ga0436364_1051854 Ga0436364_1051854_998_1285 95
1310 3300037853 Ga0436364_1337182 Ga0436364_1337182_189_476 95
1311 3300038443 Ga0395901_0044498 Ga0395901_0044498_2671_2958 95
1312 3300038443 Ga0395901_0066133 Ga0395901_0066133_288_575 95
1313 3300038443 Ga0395901_0115419 Ga0395901_0115419_87_374 95
1314 3300038443 Ga0395901_0403117 Ga0395901_0403117_985_1272 95
1315 3300038443 Ga0395901_0459392 Ga0395901_0459392_119_406 95
1316 3300038443 Ga0395901_0681538 Ga0395901_0681538_395_682 95
1317 3300038443 Ga0395901_0882505 Ga0395901_0882505_430_717 95
1318 3300038443 Ga0395901_1011117 Ga0395901_1011117_36_323 95
1319 3300039437 Ga0436365_0023438 Ga0436365_0023438_627_914 95
1320 3300039437 Ga0436365_0058760 Ga0436365_0058760_14507_14794 95
1321 3300039437 Ga0436365_0273270 Ga0436365_0273270_184_471 95
1322 3300039437 Ga0436365_0393166 Ga0436365_0393166_213_500 95
1323 3300039437 Ga0436365_0641442 Ga0436365_0641442_418_705 95
1324 3300039437 Ga0436365_0731674 Ga0436365_0731674_517_807 95
1325 3300039437 Ga0436365_0753258 Ga0436365_0753258_209_496 95
1326 3300039437 Ga0436365_0786238 Ga0436365_0786238_285_572 95
1327 3300039437 Ga0436365_0945878 Ga0436365_0945878_205_492 95
1328 3300039437 Ga0436365_1038374 Ga0436365_1038374_1353_1640 95
1329 3300039437 Ga0436365_1347117 Ga0436365_1347117_122_409 95
1330 3300039437 Ga0436365_1401065 Ga0436365_1401065_62_349 95
1331 3300039437 Ga0436365_1468095 Ga0436365_1468095_332_619 95
1332 3300039437 Ga0436365_1843415 Ga0436365_1843415_222_509 95
1333 3300039438 Ga0436360_0051234 Ga0436360_0051234_218_505 95
1334 3300039438 Ga0436360_0074660 Ga0436360_0074660_758_1045 95
1335 3300039438 Ga0436360_0095674 Ga0436360_0095674_203_490 95
1336 3300039438 Ga0436360_0164437 Ga0436360_0164437_1248_1535 95
1337 3300039438 Ga0436360_0228796 Ga0436360_0228796_65_352 95
1338 3300039438 Ga0436360_0489436 Ga0436360_0489436_1351_1638 95
1339 3300039438 Ga0436360_0622393 Ga0436360_0622393_175_462 95
1340 3300039438 Ga0436360_0806470 Ga0436360_0806470_915_1202 95
1341 3300039438 Ga0436360_0856114 Ga0436360_0856114_44_331 95
1342 3300039438 Ga0436360_1038357 Ga0436360_1038357_111_398 95
1343 3300039438 Ga0436360_1087550 Ga0436360_1087550_248_535 95
1344 3300039447 Ga0436361_0066787 Ga0436361_0066787_143_430 95
1345 3300039447 Ga0436361_0089349 Ga0436361_0089349_551_838 95
1346 3300039447 Ga0436361_0347476 Ga0436361_0347476_204_491 95
1347 3300039447 Ga0436361_0407254 Ga0436361_0407254_580_867 95
1348 3300039447 Ga0436361_1069958 Ga0436361_1069958_3783_4070 95
1349 3300039447 Ga0436361_1162394 Ga0436361_1162394_32_319 95
1350 3300039450 Ga0436363_0245423 Ga0436363_0245423_56_343 95
1351 3300039450 Ga0436363_0292293 Ga0436363_0292293_135_422 95
1352 3300039450 Ga0436363_0488686 Ga0436363_0488686_1032_1319 95
1353 3300039450 Ga0436363_0746113 Ga0436363_0746113_1580_1867 95
1354 3300039450 Ga0436363_1147036 Ga0436363_1147036_305_592 95
1355 3300039450 Ga0436363_1151944 Ga0436363_1151944_214_501 95
1356 3300039450 Ga0436363_1325372 Ga0436363_1325372_160_447 95
1357 3300039450 Ga0436363_1327462 Ga0436363_1327462_429_716 95
1358 3300039450 Ga0436363_1420085 Ga0436363_1420085_138_425 95
1359 3300039450 Ga0436363_1490924 Ga0436363_1490924_467_754 95
1360 3300039453 Ga0436362_0725727 Ga0436362_0725727_2070_2357 95
1361 3300039453 Ga0436362_0892675 Ga0436362_0892675_251_538 95
1362 3300039453 Ga0436362_1281461 Ga0436362_1281461_1353_1640 95
1363 3300041413 Ga0439465_0136595 Ga0439465_0136595_324_611 95
1364 3300041413 Ga0439465_0262470 Ga0439465_0262470_110_397 95
1365 3300041413 Ga0439465_0303754 Ga0439465_0303754_65_352 95
1366 3300041443 Ga0451789_1005947 Ga0451789_1005947_202_489 95
1367 3300041453 Ga0451797_0388595 Ga0451797_0388595_512_799 95
1368 3300041453 Ga0451797_1345892 Ga0451797_1345892_211_498 95
1369 3300041460 Ga0451802_1389911 Ga0451802_1389911_170_457 95
1370 3300041460 Ga0451802_1476848 Ga0451802_1476848_89_376 95
1371 3300041491 Ga0451833_0690599 Ga0451833_0690599_252_539 95
1372 3300041494 Ga0451837_1510067 Ga0451837_1510067_541_828 95
1373 3300041496 Ga0451839_0066429 Ga0451839_0066429_321_608 95
1374 3300041496 Ga0451839_0833549 Ga0451839_0833549_233_520 95
1375 3300041498 Ga0451841_1201480 Ga0451841_1201480_132_419 95
1376 3300041507 Ga0451851_0434122 Ga0451851_0434122_54_341 95
1377 3300041512 Ga0451853_2769112 Ga0451853_2769112_129_416 95
1378 3300041997 Ga0439431_0012839 Ga0439431_0012839_442_729 95
1379 3300041997 Ga0439431_0186396 Ga0439431_0186396_26_313 95
1380 3300042005 Ga0439448_0200998 Ga0439448_0200998_77_364 95
1381 3300042146 Ga0450907_009226 Ga0450907_009226_178_465 95
1382 3300042461 Ga0439460_0038738 Ga0439460_0038738_478_765 95
1383 3300042993 Ga0439440_0248862 Ga0439440_0248862_98_385 95
1384 3300044656 Ga0466969_0358480 Ga0466969_0358480_20_307 95
1385 3300044656 Ga0466969_0376301 Ga0466969_0376301_209_511 95
1386 3300044658 Ga0466972_0000134 Ga0466972_0000134_16510_16797 95
1387 3300044658 Ga0466972_0007510 Ga0466972_0007510_782_1069 95
1388 3300044683 Ga0466965_0327063 Ga0466965_0327063_459_746 95
1389 3300044683 Ga0466965_0524089 Ga0466965_0524089_281_568 95
1390 3300044684 Ga0466966_0470563 Ga0466966_0470563_125_412 95
1391 3300044684 Ga0466966_0531975 Ga0466966_0531975_47_349 95
1392 3300044693 Ga0466961_0052077 Ga0466961_0052077_966_1253 95
1393 3300044693 Ga0466961_0162460 Ga0466961_0162460_515_802 95
1394 3300044694 Ga0466963_0013966 Ga0466963_0013966_157_444 95
1395 3300044694 Ga0466963_0268214 Ga0466963_0268214_599_886 95
1396 3300044694 Ga0466963_0413880 Ga0466963_0413880_100_387 95
1397 3300044706 Ga0466964_0089741 Ga0466964_0089741_22_309 95
1398 3300044706 Ga0466964_0092924 Ga0466964_0092924_413_700 95
1399 3300044706 Ga0466964_0454484 Ga0466964_0454484_234_521 95
1400 3300044706 Ga0466964_0914794 Ga0466964_0914794_47_334 95
1401 3300044712 Ga0453684_0013576 Ga0453684_0013576_3232_3519 95
1402 3300044712 Ga0453684_2531852 Ga0453684_2531852_120_407 95
1403 3300044719 Ga0466971_0010102 Ga0466971_0010102_334_621 95
1404 3300044735 Ga0466968_0027313 Ga0466968_0027313_822_1109 95
1405 3300044735 Ga0466968_0066339 Ga0466968_0066339_1177_1464 95
1406 3300044735 Ga0466968_0259619 Ga0466968_0259619_136_423 95
1407 3300044735 Ga0466968_0367032 Ga0466968_0367032_394_681 95
1408 3300044765 Ga0466970_0231202 Ga0466970_0231202_579_866 95
1409 3300044765 Ga0466970_0314781 Ga0466970_0314781_97_384 95
1410 3300044765 Ga0466970_0489356 Ga0466970_0489356_360_647 95
1411 3300044765 Ga0466970_0864898 Ga0466970_0864898_21_308 95
1412 3300044842 Ga0466957_0055018 Ga0466957_0055018_376_663 95
1413 3300044842 Ga0466957_0944028 Ga0466957_0944028_228_515 95
1414 3300044842 Ga0466957_0953943 Ga0466957_0953943_25_312 95
1415 3300044901 Ga0466960_0029543 Ga0466960_0029543_214_501 95
1416 3300044901 Ga0466960_0079917 Ga0466960_0079917_831_1118 95
1417 3300044901 Ga0466960_0188560 Ga0466960_0188560_699_986 95
1418 3300044901 Ga0466960_0379974 Ga0466960_0379974_384_671 95
1419 3300045049 Ga0466959_0080111 Ga0466959_0080111_1344_1631 95
1420 3300045049 Ga0466959_0195136 Ga0466959_0195136_184_471 95
1421 3300045049 Ga0466959_0437229 Ga0466959_0437229_446_748 95
1422 3300045051 Ga0451576_0006385 Ga0451576_0006385_13016_13303 95
1423 3300045051 Ga0451576_2168656 Ga0451576_2168656_241_528 95
1424 3300045976 Ga0466967_0087185 Ga0466967_0087185_2491_2778 95
1425 3300045976 Ga0466967_0231430 Ga0466967_0231430_586_873 95
1426 3300045976 Ga0466967_0270652 Ga0466967_0270652_435_722 95
1427 3300045976 Ga0466967_0438323 Ga0466967_0438323_298_585 95
1428 3300045976 Ga0466967_0500641 Ga0466967_0500641_806_1093 95
1429 3300045976 Ga0466967_0507103 Ga0466967_0507103_46_333 95
1430 3300045976 Ga0466967_0795068 Ga0466967_0795068_16_303 95
1431 3300045976 Ga0466967_0795928 Ga0466967_0795928_382_669 95
1432 3300045976 Ga0466967_0967597 Ga0466967_0967597_355_642 95
1433 3300045976 Ga0466967_2085661 Ga0466967_2085661_18_305 95
1434 3300046452 Ga0495617_006364 Ga0495617_006364_1809_2096 95
1435 3300046452 Ga0495617_280127 Ga0495617_280127_213_500 95
1436 3300046454 Ga0495592_0003196 Ga0495592_0003196_7732_8019 95
1437 3300046454 Ga0495592_0013905 Ga0495592_0013905_2846_3133 95
1438 3300046454 Ga0495592_0023651 Ga0495592_0023651_1854_2156 95
1439 3300046454 Ga0495592_0043232 Ga0495592_0043232_1885_2172 95
1440 3300046454 Ga0495592_0066877 Ga0495592_0066877_1564_1863 95
1441 3300046455 Ga0495603_0000040 Ga0495603_0000040_35438_35725 95
1442 3300046455 Ga0495603_0028569 Ga0495603_0028569_737_1024 95
1443 3300046455 Ga0495603_0059173 Ga0495603_0059173_944_1231 95
1444 3300046455 Ga0495603_0137274 Ga0495603_0137274_1001_1288 95
1445 3300046455 Ga0495603_0349373 Ga0495603_0349373_134_421 95
1446 3300046457 Ga0495590_0125906 Ga0495590_0125906_463_750 95
1447 3300046457 Ga0495590_0209921 Ga0495590_0209921_276_563 95
1448 3300046459 Ga0495629_0000077 Ga0495629_0000077_30993_31295 95
1449 3300046459 Ga0495629_0000165 Ga0495629_0000165_8474_8761 95
1450 3300046459 Ga0495629_0032235 Ga0495629_0032235_3025_3312 95
1451 3300046459 Ga0495629_0051114 Ga0495629_0051114_351_638 95
1452 3300046459 Ga0495629_0234241 Ga0495629_0234241_13_300 95
1453 3300046459 Ga0495629_0432130 Ga0495629_0432130_49_336 95
1454 3300046460 Ga0495638_0018836 Ga0495638_0018836_2716_3003 95
1455 3300046460 Ga0495638_0049627 Ga0495638_0049627_1867_2154 95
1456 3300046461 Ga0495641_0001743 Ga0495641_0001743_25_312 95
1457 3300046461 Ga0495641_0040460 Ga0495641_0040460_305_592 95
1458 3300046461 Ga0495641_0048551 Ga0495641_0048551_1301_1588 95
1459 3300046461 Ga0495641_0300732 Ga0495641_0300732_210_497 95
1460 3300046461 Ga0495641_0585416 Ga0495641_0585416_132_419 95
1461 3300046462 Ga0495651_0009285 Ga0495651_0009285_5172_5459 95
1462 3300046462 Ga0495651_0021594 Ga0495651_0021594_1432_1734 95
1463 3300046462 Ga0495651_0081482 Ga0495651_0081482_1196_1483 95
1464 3300046462 Ga0495651_0104715 Ga0495651_0104715_1096_1398 95
1465 3300046462 Ga0495651_0180665 Ga0495651_0180665_1110_1409 95
1466 3300046462 Ga0495651_0330767 Ga0495651_0330767_387_674 95
1467 3300046462 Ga0495651_0719773 Ga0495651_0719773_294_581 95
1468 3300046463 Ga0495653_0004859 Ga0495653_0004859_7150_7452 95
1469 3300046463 Ga0495653_0011489 Ga0495653_0011489_6373_6660 95
1470 3300046463 Ga0495653_0433369 Ga0495653_0433369_289_576 95
1471 3300046463 Ga0495653_0443639 Ga0495653_0443639_233_520 95
1472 3300046471 Ga0495650_0155125 Ga0495650_0155125_155_442 95
1473 3300046471 Ga0495650_0212158 Ga0495650_0212158_321_608 95
1474 3300046472 Ga0495580_0000537 Ga0495580_0000537_21854_22141 95
1475 3300046472 Ga0495580_0009466 Ga0495580_0009466_6257_6544 95
1476 3300046472 Ga0495580_0104654 Ga0495580_0104654_628_915 95
1477 3300046472 Ga0495580_0348612 Ga0495580_0348612_100_390 95
1478 3300046472 Ga0495580_0740928 Ga0495580_0740928_149_436 95
1479 3300046473 Ga0495582_0000020 Ga0495582_0000020_38090_38377 95
1480 3300046473 Ga0495582_0082501 Ga0495582_0082501_1234_1521 95
1481 3300046473 Ga0495582_0114525 Ga0495582_0114525_1127_1414 95
1482 3300046473 Ga0495582_0468467 Ga0495582_0468467_267_554 95
1483 3300046474 Ga0495605_0163040 Ga0495605_0163040_286_573 95
1484 3300046474 Ga0495605_0258906 Ga0495605_0258906_295_582 95
1485 3300046475 Ga0495639_0000011 Ga0495639_0000011_30738_31025 95
1486 3300046475 Ga0495639_0010989 Ga0495639_0010989_1356_1643 95
1487 3300046475 Ga0495639_0124389 Ga0495639_0124389_343_630 95
1488 3300046475 Ga0495639_0356467 Ga0495639_0356467_420_707 95
1489 3300046475 Ga0495639_0376504 Ga0495639_0376504_74_361 95
1490 3300046475 Ga0495639_0627332 Ga0495639_0627332_234_521 95
1491 3300046475 Ga0495639_0708528 Ga0495639_0708528_36_323 95
1492 3300046476 Ga0495662_0027255 Ga0495662_0027255_385_672 95
1493 3300046476 Ga0495662_0131896 Ga0495662_0131896_100_399 95
1494 3300046476 Ga0495662_0160432 Ga0495662_0160432_758_1045 95
1495 3300046476 Ga0495662_0307468 Ga0495662_0307468_16_303 95
1496 3300046477 Ga0495664_0002999 Ga0495664_0002999_5941_6228 95
1497 3300046477 Ga0495664_0009652 Ga0495664_0009652_2336_2623 95
1498 3300046477 Ga0495664_0010302 Ga0495664_0010302_1650_1937 95
1499 3300046477 Ga0495664_0071547 Ga0495664_0071547_846_1133 95
1500 3300046477 Ga0495664_0103554 Ga0495664_0103554_557_844 95
1501 3300046477 Ga0495664_0168704 Ga0495664_0168704_475_774 95
1502 3300046477 Ga0495664_0312652 Ga0495664_0312652_364_654 95
1503 3300046491 Ga0495584_0331962 Ga0495584_0331962_34_321 95
1504 3300046491 Ga0495584_0417730 Ga0495584_0417730_225_512 95
1505 3300046492 Ga0495585_0070271 Ga0495585_0070271_459_746 95
1506 3300046492 Ga0495585_0189717 Ga0495585_0189717_678_965 95
1507 3300046492 Ga0495585_0225779 Ga0495585_0225779_192_479 95
1508 3300046492 Ga0495585_0232178 Ga0495585_0232178_38_325 95
1509 3300046492 Ga0495585_0426092 Ga0495585_0426092_280_567 95
1510 3300046492 Ga0495585_0612520 Ga0495585_0612520_125_412 95
1511 3300046499 Ga0495594_0000081 Ga0495594_0000081_12926_13213 95
1512 3300046499 Ga0495594_0031029 Ga0495594_0031029_516_803 95
1513 3300046499 Ga0495594_0597901 Ga0495594_0597901_281_571 95
1514 3300046500 Ga0495596_0055356 Ga0495596_0055356_231_518 95
1515 3300046500 Ga0495596_0381364 Ga0495596_0381364_13_300 95
1516 3300046501 Ga0495607_0198798 Ga0495607_0198798_172_459 95
1517 3300046501 Ga0495607_0204879 Ga0495607_0204879_438_725 95
1518 3300046506 Ga0495583_0084436 Ga0495583_0084436_612_899 95
1519 3300046507 Ga0495606_0004894 Ga0495606_0004894_10380_10670 95
1520 3300046507 Ga0495606_0049268 Ga0495606_0049268_14_358 95
1521 3300046507 Ga0495606_0174994 Ga0495606_0174994_28_315 95
1522 3300046507 Ga0495606_0218227 Ga0495606_0218227_661_948 95
1523 3300046511 Ga0495608_0026954 Ga0495608_0026954_3520_3822 95
1524 3300046511 Ga0495608_0060907 Ga0495608_0060907_1193_1480 95
1525 3300046511 Ga0495608_0077498 Ga0495608_0077498_489_776 95
1526 3300046511 Ga0495608_0346646 Ga0495608_0346646_545_844 95
1527 3300046511 Ga0495608_0730430 Ga0495608_0730430_26_313 95
1528 3300046511 Ga0495608_0735292 Ga0495608_0735292_55_342 95
1529 3300046512 Ga0495610_0008458 Ga0495610_0008458_5257_5544 95
1530 3300046512 Ga0495610_0077672 Ga0495610_0077672_907_1215 95
1531 3300046513 Ga0495616_0163589 Ga0495616_0163589_351_638 95
1532 3300046514 Ga0495618_0082641 Ga0495618_0082641_684_986 95
1533 3300046514 Ga0495618_0090465 Ga0495618_0090465_770_1057 95
1534 3300046514 Ga0495618_0337979 Ga0495618_0337979_518_805 95
1535 3300046514 Ga0495618_0773089 Ga0495618_0773089_89_376 95
1536 3300046515 Ga0495620_0098928 Ga0495620_0098928_213_500 95
1537 3300046516 Ga0495628_0029543 Ga0495628_0029543_4141_4428 95
1538 3300046516 Ga0495628_0031457 Ga0495628_0031457_363_665 95
1539 3300046516 Ga0495628_0068148 Ga0495628_0068148_2180_2467 95
1540 3300046516 Ga0495628_0132867 Ga0495628_0132867_1203_1490 95
1541 3300046516 Ga0495628_0231629 Ga0495628_0231629_901_1200 95
1542 3300046516 Ga0495628_0641146 Ga0495628_0641146_139_426 95
1543 3300046516 Ga0495628_0936741 Ga0495628_0936741_158_445 95
1544 3300046516 Ga0495628_1069817 Ga0495628_1069817_109_399 95
1545 3300046517 Ga0495630_0004121 Ga0495630_0004121_650_937 95
1546 3300046517 Ga0495630_0124688 Ga0495630_0124688_775_1062 95
1547 3300046517 Ga0495630_0234861 Ga0495630_0234861_179_466 95
1548 3300046517 Ga0495630_1521238 Ga0495630_1521238_49_336 95
1549 3300046518 Ga0495631_0068625 Ga0495631_0068625_331_618 95
1550 3300046518 Ga0495631_0520582 Ga0495631_0520582_62_349 95
1551 3300046519 Ga0495632_0140052 Ga0495632_0140052_458_745 95
1552 3300046519 Ga0495632_0187933 Ga0495632_0187933_243_530 95
1553 3300046519 Ga0495632_0243967 Ga0495632_0243967_311_598 95
1554 3300046522 Ga0495643_0054116 Ga0495643_0054116_440_727 95
1555 3300046522 Ga0495643_0085479 Ga0495643_0085479_705_992 95
1556 3300046522 Ga0495643_0165034 Ga0495643_0165034_160_447 95
1557 3300046522 Ga0495643_0263794 Ga0495643_0263794_178_477 95
1558 3300046522 Ga0495643_0412591 Ga0495643_0412591_41_328 95
1559 3300046523 Ga0495644_0017733 Ga0495644_0017733_227_514 95
1560 3300046523 Ga0495644_0030765 Ga0495644_0030765_519_806 95
1561 3300046524 Ga0495648_0003326 Ga0495648_0003326_2696_2986 95
1562 3300046524 Ga0495648_0009249 Ga0495648_0009249_5291_5578 95
1563 3300046524 Ga0495648_0029631 Ga0495648_0029631_1136_1423 95
1564 3300046524 Ga0495648_0152172 Ga0495648_0152172_698_985 95
1565 3300046524 Ga0495648_0170225 Ga0495648_0170225_273_560 95
1566 3300046524 Ga0495648_0382742 Ga0495648_0382742_287_574 95
1567 3300046526 Ga0495666_0039170 Ga0495666_0039170_1397_1684 95
1568 3300046526 Ga0495666_0130240 Ga0495666_0130240_469_783 95
1569 3300046526 Ga0495666_0229685 Ga0495666_0229685_518_805 95
1570 3300046526 Ga0495666_0262863 Ga0495666_0262863_295_582 95
1571 3300046529 Ga0495652_0000938 Ga0495652_0000938_9554_9841 95
1572 3300046529 Ga0495652_0005699 Ga0495652_0005699_8914_9216 95
1573 3300046529 Ga0495652_0031849 Ga0495652_0031849_2680_2967 95
1574 3300046529 Ga0495652_0342076 Ga0495652_0342076_601_900 95
1575 3300046529 Ga0495652_0373677 Ga0495652_0373677_380_667 95
1576 3300046530 Ga0495654_0244355 Ga0495654_0244355_28_315 95
1577 3300046530 Ga0495654_0379005 Ga0495654_0379005_35_322 95
1578 3300046531 Ga0495665_0000035 Ga0495665_0000035_29077_29364 95
1579 3300046531 Ga0495665_0464861 Ga0495665_0464861_64_351 95
1580 3300046533 Ga0495640_0003879 Ga0495640_0003879_7523_7810 95
1581 3300046533 Ga0495640_0014952 Ga0495640_0014952_3259_3546 95
1582 3300046533 Ga0495640_0050554 Ga0495640_0050554_819_1106 95
1583 3300046533 Ga0495640_0074369 Ga0495640_0074369_687_989 95
1584 3300046533 Ga0495640_0075716 Ga0495640_0075716_30_317 95
1585 3300046533 Ga0495640_0971653 Ga0495640_0971653_57_344 95
1586 3300046535 Ga0495586_0031123 Ga0495586_0031123_583_870 95
1587 3300046535 Ga0495586_0510217 Ga0495586_0510217_231_518 95
1588 3300046536 Ga0495587_0003189 Ga0495587_0003189_92_394 95
1589 3300046536 Ga0495587_0042145 Ga0495587_0042145_432_719 95
1590 3300046536 Ga0495587_0111177 Ga0495587_0111177_887_1174 95
1591 3300046536 Ga0495587_0461243 Ga0495587_0461243_337_624 95
1592 3300046537 Ga0495598_0147660 Ga0495598_0147660_140_427 95
1593 3300046538 Ga0495609_0190895 Ga0495609_0190895_44_331 95
1594 3300046538 Ga0495609_0446246 Ga0495609_0446246_91_378 95
1595 3300046539 Ga0495621_0201541 Ga0495621_0201541_443_730 95
1596 3300046539 Ga0495621_0230841 Ga0495621_0230841_76_363 95
1597 3300046539 Ga0495621_0394375 Ga0495621_0394375_53_340 95
1598 3300046542 Ga0495597_0312632 Ga0495597_0312632_95_382 95
1599 3300046543 Ga0495645_0034770 Ga0495645_0034770_2384_2671 95
1600 3300046543 Ga0495645_0036700 Ga0495645_0036700_1743_2030 95
1601 3300046543 Ga0495645_0269487 Ga0495645_0269487_244_531 95
1602 3300046543 Ga0495645_0831945 Ga0495645_0831945_83_370 95
1603 3300046557 Ga0495622_0000778 Ga0495622_0000778_13090_13377 95
1604 3300046557 Ga0495622_0006010 Ga0495622_0006010_4993_5280 95
1605 3300046557 Ga0495622_0013909 Ga0495622_0013909_1064_1351 95
1606 3300046557 Ga0495622_0227970 Ga0495622_0227970_355_642 95
1607 3300046557 Ga0495622_0345859 Ga0495622_0345859_311_601 95
1608 3300046557 Ga0495622_0369571 Ga0495622_0369571_292_579 95
1609 3300046558 Ga0495633_0075476 Ga0495633_0075476_988_1275 95
1610 3300046559 Ga0495667_0013074 Ga0495667_0013074_2870_3157 95
1611 3300046559 Ga0495667_0019765 Ga0495667_0019765_3028_3315 95
1612 3300046559 Ga0495667_0152450 Ga0495667_0152450_1035_1322 95
1613 3300046559 Ga0495667_0164390 Ga0495667_0164390_374_661 95
1614 3300046615 Ga0495656_0019632 Ga0495656_0019632_533_820 95
1615 3300046615 Ga0495656_0081927 Ga0495656_0081927_713_1000 95
1616 3300046615 Ga0495656_0091838 Ga0495656_0091838_227_514 95
1617 3300046615 Ga0495656_0361825 Ga0495656_0361825_433_720 95
1618 3300046616 Ga0495668_0055669 Ga0495668_0055669_625_912 95
1619 3300046616 Ga0495668_0196218 Ga0495668_0196218_285_572 95
1620 3300046616 Ga0495668_0353540 Ga0495668_0353540_317_604 95
1621 3300046616 Ga0495668_0617326 Ga0495668_0617326_108_395 95
1622 3300046642 Ga0495634_0000553 Ga0495634_0000553_16838_17125 95
1623 3300046642 Ga0495634_0009258 Ga0495634_0009258_4368_4670 95
1624 3300046642 Ga0495634_0097796 Ga0495634_0097796_1280_1567 95
1625 3300046642 Ga0495634_0188253 Ga0495634_0188253_71_358 95
1626 3300046648 Ga0495611_0071591 Ga0495611_0071591_254_541 95
1627 3300046648 Ga0495611_0220689 Ga0495611_0220689_363_650 95
1628 3300046648 Ga0495611_0291622 Ga0495611_0291622_170_457 95
1629 3300046648 Ga0495611_0301889 Ga0495611_0301889_214_501 95
1630 3300046648 Ga0495611_0400732 Ga0495611_0400732_14_301 95
1631 3300046660 Ga0495625_0068462 Ga0495625_0068462_382_669 95
1632 3300046660 Ga0495625_0136577 Ga0495625_0136577_404_691 95
1633 3300046660 Ga0495625_0720587 Ga0495625_0720587_179_466 95
1634 3300046663 Ga0495635_0000196 Ga0495635_0000196_31023_31325 95
1635 3300046663 Ga0495635_0000348 Ga0495635_0000348_4977_5264 95
1636 3300046663 Ga0495635_0028688 Ga0495635_0028688_1873_2160 95
1637 3300046663 Ga0495635_0095817 Ga0495635_0095817_176_463 95
1638 3300046663 Ga0495635_0145984 Ga0495635_0145984_958_1245 95
1639 3300046663 Ga0495635_0160008 Ga0495635_0160008_300_587 95
1640 3300046664 Ga0495659_0071618 Ga0495659_0071618_394_681 95
1641 3300046664 Ga0495659_0510652 Ga0495659_0510652_62_349 95
1642 3300046665 Ga0495661_0127451 Ga0495661_0127451_681_968 95
1643 3300046665 Ga0495661_0215302 Ga0495661_0215302_516_803 95
1644 3300046665 Ga0495661_0323598 Ga0495661_0323598_158_445 95
1645 3300046665 Ga0495661_0555394 Ga0495661_0555394_68_355 95
1646 3300046674 Ga0495588_0020663 Ga0495588_0020663_2579_2866 95
1647 3300046674 Ga0495588_0043053 Ga0495588_0043053_1431_1718 95
1648 3300046674 Ga0495588_0050692 Ga0495588_0050692_1102_1410 95
1649 3300046674 Ga0495588_0396910 Ga0495588_0396910_417_704 95
1650 3300046674 Ga0495588_0489429 Ga0495588_0489429_324_611 95
1651 3300046674 Ga0495588_0534096 Ga0495588_0534096_136_423 95
1652 3300046675 Ga0495657_0001933 Ga0495657_0001933_9741_10043 95
1653 3300046675 Ga0495657_0003343 Ga0495657_0003343_5320_5607 95
1654 3300046675 Ga0495657_0004507 Ga0495657_0004507_9058_9345 95
1655 3300046675 Ga0495657_0068033 Ga0495657_0068033_1491_1778 95
1656 3300046675 Ga0495657_0265297 Ga0495657_0265297_450_737 95
1657 3300046678 Ga0495599_0003155 Ga0495599_0003155_820_1122 95
1658 3300046678 Ga0495599_0031277 Ga0495599_0031277_2954_3241 95
1659 3300046678 Ga0495599_0058092 Ga0495599_0058092_191_490 95
1660 3300046678 Ga0495599_0331481 Ga0495599_0331481_251_538 95
1661 3300046679 Ga0495623_0005172 Ga0495623_0005172_1333_1620 95
1662 3300046679 Ga0495623_0032653 Ga0495623_0032653_401_703 95
1663 3300046679 Ga0495623_0238971 Ga0495623_0238971_132_419 95
1664 3300046679 Ga0495623_0250225 Ga0495623_0250225_23_310 95
1665 3300046679 Ga0495623_0398838 Ga0495623_0398838_68_367 95
1666 3300046679 Ga0495623_0593533 Ga0495623_0593533_152_442 95
1667 3300046680 Ga0495646_0003641 Ga0495646_0003641_4281_4583 95
1668 3300046680 Ga0495646_0021027 Ga0495646_0021027_528_815 95
1669 3300046680 Ga0495646_0076600 Ga0495646_0076600_1047_1334 95
1670 3300046680 Ga0495646_0096378 Ga0495646_0096378_782_1069 95
1671 3300046681 Ga0495647_0006868 Ga0495647_0006868_2350_2637 95
1672 3300046681 Ga0495647_0025522 Ga0495647_0025522_740_1027 95
1673 3300046681 Ga0495647_0040165 Ga0495647_0040165_1162_1449 95
1674 3300046683 Ga0495658_0000609 Ga0495658_0000609_4887_5174 95
1675 3300046683 Ga0495658_0015458 Ga0495658_0015458_120_407 95
1676 3300046684 Ga0495669_0004250 Ga0495669_0004250_311_598 95
1677 3300046684 Ga0495669_0050040 Ga0495669_0050040_1151_1438 95
1678 3300046684 Ga0495669_0108107 Ga0495669_0108107_412_699 95
1679 3300046684 Ga0495669_0120953 Ga0495669_0120953_676_963 95
1680 3300046684 Ga0495669_0151196 Ga0495669_0151196_778_1065 95
1681 3300046684 Ga0495669_0293547 Ga0495669_0293547_180_467 95
1682 3300046689 Ga0495613_0000907 Ga0495613_0000907_12608_12895 95
1683 3300046689 Ga0495613_0101904 Ga0495613_0101904_13_315 95
1684 3300046689 Ga0495613_0510368 Ga0495613_0510368_462_749 95
1685 3300046689 Ga0495613_0602041 Ga0495613_0602041_25_312 95
1686 3300046689 Ga0495613_0672962 Ga0495613_0672962_118_405 95
1687 3300046690 Ga0495624_0000379 Ga0495624_0000379_10913_11200 95
1688 3300046690 Ga0495624_0163030 Ga0495624_0163030_866_1153 95
1689 3300046690 Ga0495624_0166561 Ga0495624_0166561_633_920 95
1690 3300046690 Ga0495624_0203294 Ga0495624_0203294_194_484 95
1691 3300046690 Ga0495624_0249075 Ga0495624_0249075_659_946 95
1692 3300046690 Ga0495624_0498795 Ga0495624_0498795_28_315 95
1693 3300046691 Ga0495670_0143536 Ga0495670_0143536_486_773 95
1694 3300046692 Ga0495671_0182052 Ga0495671_0182052_327_614 95
1695 3300046692 Ga0495671_0211482 Ga0495671_0211482_207_494 95
1696 3300046692 Ga0495671_0214347 Ga0495671_0214347_242_529 95
1697 3300046692 Ga0495671_0291333 Ga0495671_0291333_376_663 95
1698 3300046694 Ga0495649_0060583 Ga0495649_0060583_1540_1827 95
1699 3300046694 Ga0495649_0074839 Ga0495649_0074839_1024_1311 95
1700 3300046694 Ga0495649_0247920 Ga0495649_0247920_301_588 95
1701 3300046694 Ga0495649_0516137 Ga0495649_0516137_112_399 95
1702 3300046694 Ga0495649_0692113 Ga0495649_0692113_32_319 95
1703 3300046794 Ga0495589_0332900 Ga0495589_0332900_362_649 95
1704 3300046794 Ga0495589_0533508 Ga0495589_0533508_166_453 95
1705 3300046809 Ga0495600_0000323 Ga0495600_0000323_2405_2707 95
1706 3300046809 Ga0495600_0029070 Ga0495600_0029070_2437_2724 95
1707 3300046809 Ga0495600_0066129 Ga0495600_0066129_671_958 95
1708 3300046809 Ga0495600_0153199 Ga0495600_0153199_695_982 95
1709 3300046809 Ga0495600_0184648 Ga0495600_0184648_646_933 95
1710 3300046809 Ga0495600_0198087 Ga0495600_0198087_919_1206 95
1711 3300046809 Ga0495600_0474369 Ga0495600_0474369_95_382 95
1712 3300046810 Ga0495660_0303851 Ga0495660_0303851_285_593 95
1713 3300047315 Ga0495581_0000001 Ga0495581_0000001_17450_17737 95
1714 3300047315 Ga0495581_0073603 Ga0495581_0073603_369_656 95
1715 3300047315 Ga0495581_0193688 Ga0495581_0193688_750_1037 95
1716 3300047315 Ga0495581_0459085 Ga0495581_0459085_43_330 95
1717 3300047315 Ga0495581_0510998 Ga0495581_0510998_265_567 95
1718 3300047315 Ga0495581_0565766 Ga0495581_0565766_13_300 95
1719 3300047317 Ga0495604_0003325 Ga0495604_0003325_3166_3453 95
1720 3300047317 Ga0495604_0003557 Ga0495604_0003557_12075_12362 95
1721 3300047317 Ga0495604_0004601 Ga0495604_0004601_2184_2486 95
1722 3300047317 Ga0495604_0022993 Ga0495604_0022993_2005_2304 95
1723 3300047317 Ga0495604_0166344 Ga0495604_0166344_133_420 95
1724 3300047318 Ga0495636_0020511 Ga0495636_0020511_99_386 95
1725 3300047318 Ga0495636_0407744 Ga0495636_0407744_289_576 95
1726 3300047319 Ga0495674_0003721 Ga0495674_0003721_4730_5017 95
1727 3300047319 Ga0495674_0016137 Ga0495674_0016137_233_520 95
1728 3300047319 Ga0495674_0020192 Ga0495674_0020192_2150_2437 95
1729 3300047319 Ga0495674_0025082 Ga0495674_0025082_3177_3479 95
1730 3300047319 Ga0495674_0386015 Ga0495674_0386015_316_603 95
1731 3300047319 Ga0495674_0779306 Ga0495674_0779306_37_324 95
1732 3300047319 Ga0495674_1219125 Ga0495674_1219125_139_426 95
1733 3300047320 Ga0495672_0312446 Ga0495672_0312446_82_369 95
1734 3300047320 Ga0495672_0452903 Ga0495672_0452903_135_422 95
1735 3300047320 Ga0495672_0459206 Ga0495672_0459206_246_533 95
1736 3300047321 Ga0495676_0021328 Ga0495676_0021328_1085_1372 95
1737 3300047321 Ga0495676_0508897 Ga0495676_0508897_14_301 95
1738 3300047321 Ga0495676_0560222 Ga0495676_0560222_121_411 95
1739 3300047321 Ga0495676_0690233 Ga0495676_0690233_154_441 95
1740 3300047321 Ga0495676_0718170 Ga0495676_0718170_94_381 95
1741 3300047322 Ga0495680_0002305 Ga0495680_0002305_16060_16362 95
1742 3300047322 Ga0495680_0005416 Ga0495680_0005416_2157_2444 95
1743 3300047322 Ga0495680_0111527 Ga0495680_0111527_176_463 95
1744 3300047322 Ga0495680_0224127 Ga0495680_0224127_421_708 95
1745 3300047322 Ga0495680_0260009 Ga0495680_0260009_128_415 95
1746 3300047322 Ga0495680_0355359 Ga0495680_0355359_345_632 95
1747 3300047322 Ga0495680_0665036 Ga0495680_0665036_188_475 95
1748 3300047322 Ga0495680_0750261 Ga0495680_0750261_12_299 95
1749 3300047323 Ga0495683_0145856 Ga0495683_0145856_245_532 95
1750 3300047323 Ga0495683_0179805 Ga0495683_0179805_644_931 95
1751 3300047323 Ga0495683_0210576 Ga0495683_0210576_268_555 95
1752 3300047443 Ga0495687_007841 Ga0495687_007841_789_1076 95
1753 3300047444 Ga0495675_0009211 Ga0495675_0009211_5747_6049 95
1754 3300047444 Ga0495675_0026374 Ga0495675_0026374_303_590 95
1755 3300047444 Ga0495675_0132502 Ga0495675_0132502_175_462 95
1756 3300047444 Ga0495675_0531106 Ga0495675_0531106_293_595 95
1757 3300047445 Ga0495677_0283641 Ga0495677_0283641_219_506 95
1758 3300047445 Ga0495677_0362414 Ga0495677_0362414_115_402 95
1759 3300047445 Ga0495677_0442185 Ga0495677_0442185_19_306 95
1760 3300047447 Ga0495685_153302 Ga0495685_153302_148_435 95
1761 3300047469 Ga0495673_0047867 Ga0495673_0047867_1013_1300 95
1762 3300047469 Ga0495673_0194329 Ga0495673_0194329_150_437 95
1763 3300047470 Ga0495681_0143221 Ga0495681_0143221_656_943 95
1764 3300047470 Ga0495681_0237519 Ga0495681_0237519_334_621 95
1765 3300047471 Ga0495684_0000068 Ga0495684_0000068_31748_32050 95
1766 3300047471 Ga0495684_0003924 Ga0495684_0003924_8940_9227 95
1767 3300047471 Ga0495684_0007928 Ga0495684_0007928_5884_6171 95
1768 3300047471 Ga0495684_0037353 Ga0495684_0037353_1027_1314 95
1769 3300047471 Ga0495684_0475131 Ga0495684_0475131_354_641 95
1770 3300047471 Ga0495684_0873068 Ga0495684_0873068_264_551 95
1771 3300047472 Ga0495686_0158211 Ga0495686_0158211_532_819 95
1772 3300047472 Ga0495686_0382836 Ga0495686_0382836_16_303 95
1773 3300047472 Ga0495686_0421754 Ga0495686_0421754_147_434 95
1774 3300047673 Ga0495593_0000006 Ga0495593_0000006_45512_45799 95
1775 3300047673 Ga0495593_0000215 Ga0495593_0000215_14259_14561 95
1776 3300047673 Ga0495593_0100084 Ga0495593_0100084_117_404 95
1777 3300047673 Ga0495593_0207943 Ga0495593_0207943_683_970 95
1778 3300047673 Ga0495593_0285089 Ga0495593_0285089_525_812 95
1779 3300048088 Ga0495602_0019107 Ga0495602_0019107_2130_2417 95
1780 3300048088 Ga0495602_0031066 Ga0495602_0031066_3450_3752 95
1781 3300048088 Ga0495602_0043046 Ga0495602_0043046_758_1045 95
1782 3300048088 Ga0495602_0179921 Ga0495602_0179921_536_823 95
1783 3300048088 Ga0495602_0321022 Ga0495602_0321022_304_591 95
1784 3300048088 Ga0495602_0384823 Ga0495602_0384823_667_954 95
1785 3300048088 Ga0495602_0433098 Ga0495602_0433098_26_325 95
1786 3300048089 Ga0495614_0025788 Ga0495614_0025788_527_814 95
1787 3300048089 Ga0495614_0075936 Ga0495614_0075936_1023_1310 95
1788 3300048091 Ga0495626_0028759 Ga0495626_0028759_920_1273 95
1789 3300048091 Ga0495626_0110688 Ga0495626_0110688_648_935 95
1790 3300048903 Ga0496100_0015171 Ga0496100_0015171_2224_2511 95
1791 3300048903 Ga0496100_0036571 Ga0496100_0036571_2717_3004 95
1792 3300048903 Ga0496100_0089601 Ga0496100_0089601_1207_1494 95
1793 3300048903 Ga0496100_0407326 Ga0496100_0407326_240_527 95
1794 3300048903 Ga0496100_0413529 Ga0496100_0413529_92_379 95
1795 3300048903 Ga0496100_0760173 Ga0496100_0760173_225_512 95
1796 3300048903 Ga0496100_1684505 Ga0496100_1684505_175_462 95
1797 3300048904 Ga0496101_0001159 Ga0496101_0001159_13203_13490 95
1798 3300048904 Ga0496101_0100259 Ga0496101_0100259_752_1039 95
1799 3300048904 Ga0496101_0159657 Ga0496101_0159657_925_1212 95
1800 3300048904 Ga0496101_0254464 Ga0496101_0254464_752_1039 95
1801 3300048904 Ga0496101_0320843 Ga0496101_0320843_905_1192 95
1802 3300048904 Ga0496101_0467638 Ga0496101_0467638_572_859 95
1803 3300048904 Ga0496101_1605481 Ga0496101_1605481_26_313 95
1804 3300048905 Ga0496102_0011986 Ga0496102_0011986_4190_4477 95
1805 3300048905 Ga0496102_0130187 Ga0496102_0130187_619_906 95
1806 3300048905 Ga0496102_0283221 Ga0496102_0283221_1145_1432 95
1807 3300048905 Ga0496102_0296878 Ga0496102_0296878_907_1194 95
1808 3300048905 Ga0496102_0429549 Ga0496102_0429549_86_373 95
1809 3300048905 Ga0496102_0452961 Ga0496102_0452961_727_1014 95
1810 3300048905 Ga0496102_1440672 Ga0496102_1440672_129_416 95
1811 3300048905 Ga0496102_1454739 Ga0496102_1454739_153_440 95
1812 3300048905 Ga0496102_1539619 Ga0496102_1539619_251_538 95
1813 3300048906 Ga0496103_0046054 Ga0496103_0046054_921_1208 95
1814 3300048906 Ga0496103_0122790 Ga0496103_0122790_1028_1315 95
1815 3300048906 Ga0496103_0143524 Ga0496103_0143524_574_861 95
1816 3300048906 Ga0496103_0948001 Ga0496103_0948001_128_415 95
1817 3300048907 Ga0496104_0004108 Ga0496104_0004108_1214_1501 95
1818 3300048907 Ga0496104_0077101 Ga0496104_0077101_1453_1740 95
1819 3300048907 Ga0496104_0101404 Ga0496104_0101404_834_1124 95
1820 3300048907 Ga0496104_0108087 Ga0496104_0108087_2090_2377 95
1821 3300048907 Ga0496104_0127604 Ga0496104_0127604_1761_2048 95
1822 3300048907 Ga0496104_0306170 Ga0496104_0306170_300_587 95
1823 3300048907 Ga0496104_0462960 Ga0496104_0462960_773_1060 95
1824 3300048907 Ga0496104_0779858 Ga0496104_0779858_187_474 95
1825 3300048907 Ga0496104_0950562 Ga0496104_0950562_249_536 95
1826 3300048907 Ga0496104_1510856 Ga0496104_1510856_74_361 95
1827 3300048908 Ga0496105_0017252 Ga0496105_0017252_1032_1319 95
1828 3300048908 Ga0496105_0067069 Ga0496105_0067069_1148_1435 95
1829 3300048908 Ga0496105_0307023 Ga0496105_0307023_341_628 95
1830 3300048909 Ga0496106_0003069 Ga0496106_0003069_10812_11099 95
1831 3300048909 Ga0496106_0007508 Ga0496106_0007508_3617_3904 95
1832 3300048909 Ga0496106_0010549 Ga0496106_0010549_4164_4451 95
1833 3300048909 Ga0496106_0016349 Ga0496106_0016349_4982_5269 95
1834 3300048909 Ga0496106_0246198 Ga0496106_0246198_739_1026 95
1835 3300048909 Ga0496106_0275664 Ga0496106_0275664_33_320 95
1836 3300048909 Ga0496106_0934696 Ga0496106_0934696_286_573 95
1837 3300048909 Ga0496106_1557946 Ga0496106_1557946_163_450 95
1838 3300048910 Ga0496107_0003589 Ga0496107_0003589_9673_9960 95
1839 3300048910 Ga0496107_0025544 Ga0496107_0025544_1227_1514 95
1840 3300048910 Ga0496107_0187264 Ga0496107_0187264_194_481 95
1841 3300048910 Ga0496107_0215756 Ga0496107_0215756_594_881 95
1842 3300048910 Ga0496107_0234097 Ga0496107_0234097_621_908 95
1843 3300048910 Ga0496107_0906519 Ga0496107_0906519_35_322 95
1844 3300048910 Ga0496107_0949394 Ga0496107_0949394_139_426 95
1845 3300048911 Ga0496108_0019187 Ga0496108_0019187_4387_4674 95
1846 3300048911 Ga0496108_0033963 Ga0496108_0033963_3722_4009 95
1847 3300048911 Ga0496108_0316275 Ga0496108_0316275_952_1239 95
1848 3300048911 Ga0496108_0327145 Ga0496108_0327145_254_541 95
1849 3300048911 Ga0496108_0385443 Ga0496108_0385443_734_1021 95
1850 3300048911 Ga0496108_0437840 Ga0496108_0437840_740_1027 95
1851 3300048911 Ga0496108_0576502 Ga0496108_0576502_266_553 95
1852 3300048911 Ga0496108_1253939 Ga0496108_1253939_320_607 95
1853 3300048912 Ga0496109_0000250 Ga0496109_0000250_45742_46029 95
1854 3300048912 Ga0496109_0139783 Ga0496109_0139783_874_1161 95
1855 3300048912 Ga0496109_0235400 Ga0496109_0235400_77_364 95
1856 3300048912 Ga0496109_0427785 Ga0496109_0427785_258_545 95
1857 3300048912 Ga0496109_0672623 Ga0496109_0672623_463_750 95
1858 3300048913 Ga0496110_0011301 Ga0496110_0011301_4388_4675 95
1859 3300048913 Ga0496110_0038816 Ga0496110_0038816_217_504 95
1860 3300048913 Ga0496110_0099371 Ga0496110_0099371_2102_2389 95
1861 3300048913 Ga0496110_0157712 Ga0496110_0157712_945_1232 95
1862 3300048913 Ga0496110_0204934 Ga0496110_0204934_1001_1288 95
1863 3300048913 Ga0496110_0244300 Ga0496110_0244300_767_1054 95
1864 3300048913 Ga0496110_0364156 Ga0496110_0364156_156_446 95
1865 3300048913 Ga0496110_0886120 Ga0496110_0886120_151_438 95
1866 3300048913 Ga0496110_1660762 Ga0496110_1660762_75_362 95
1867 3300048914 Ga0496111_0107284 Ga0496111_0107284_69_356 95
1868 3300048914 Ga0496111_0145604 Ga0496111_0145604_922_1209 95
1869 3300048914 Ga0496111_0685396 Ga0496111_0685396_11_301 95
1870 3300048914 Ga0496111_0876424 Ga0496111_0876424_300_587 95
1871 3300048915 Ga0496112_0000044 Ga0496112_0000044_84080_84367 95
1872 3300048915 Ga0496112_0007524 Ga0496112_0007524_4166_4453 95
1873 3300048915 Ga0496112_0012690 Ga0496112_0012690_358_645 95
1874 3300048915 Ga0496112_0017262 Ga0496112_0017262_301_588 95
1875 3300048915 Ga0496112_0021397 Ga0496112_0021397_3917_4204 95
1876 3300048915 Ga0496112_0064223 Ga0496112_0064223_298_585 95
1877 3300048915 Ga0496112_0082922 Ga0496112_0082922_2739_3029 95
1878 3300048915 Ga0496112_0133358 Ga0496112_0133358_996_1283 95
1879 3300048915 Ga0496112_0160576 Ga0496112_0160576_841_1128 95
1880 3300048915 Ga0496112_0161330 Ga0496112_0161330_738_1031 95
1881 3300048916 Ga0496113_0036053 Ga0496113_0036053_3073_3360 95
1882 3300048916 Ga0496113_0041517 Ga0496113_0041517_34_321 95
1883 3300048916 Ga0496113_0085558 Ga0496113_0085558_1752_2042 95
1884 3300048916 Ga0496113_0099870 Ga0496113_0099870_358_645 95
1885 3300048916 Ga0496113_0270730 Ga0496113_0270730_107_394 95
1886 3300048916 Ga0496113_1107108 Ga0496113_1107108_107_394 95
1887 3300048916 Ga0496113_1508498 Ga0496113_1508498_121_417 95
1888 3300048917 Ga0496114_0028062 Ga0496114_0028062_1940_2227 95
1889 3300048917 Ga0496114_0188992 Ga0496114_0188992_891_1178 95
1890 3300048917 Ga0496114_0400391 Ga0496114_0400391_716_1003 95
1891 3300048917 Ga0496114_0976084 Ga0496114_0976084_14_301 95
1892 3300048918 Ga0496115_0001185 Ga0496115_0001185_1393_1680 95
1893 3300048918 Ga0496115_0015033 Ga0496115_0015033_4895_5182 95
1894 3300048918 Ga0496115_0091121 Ga0496115_0091121_559_846 95
1895 3300048918 Ga0496115_0187739 Ga0496115_0187739_72_416 95
1896 3300048918 Ga0496115_0434256 Ga0496115_0434256_436_723 95
1897 3300048918 Ga0496115_0541455 Ga0496115_0541455_488_778 95
1898 3300048918 Ga0496115_0741166 Ga0496115_0741166_143_430 95
1899 3300048918 Ga0496115_0835835 Ga0496115_0835835_22_312 95
1900 3300048918 Ga0496115_1311967 Ga0496115_1311967_104_391 95
1901 3300048919 Ga0496116_0150200 Ga0496116_0150200_991_1278 95
1902 3300048919 Ga0496116_0396387 Ga0496116_0396387_92_379 95
1903 3300048919 Ga0496116_0449015 Ga0496116_0449015_96_383 95
1904 3300048920 Ga0496117_0079372 Ga0496117_0079372_1431_1718 95
1905 3300048920 Ga0496117_0095575 Ga0496117_0095575_89_376 95
1906 3300048920 Ga0496117_0171061 Ga0496117_0171061_333_620 95
1907 3300048920 Ga0496117_0176847 Ga0496117_0176847_537_824 95
1908 3300048920 Ga0496117_0262276 Ga0496117_0262276_354_641 95
1909 3300048921 Ga0496118_0003016 Ga0496118_0003016_20703_20990 95
1910 3300048921 Ga0496118_0039641 Ga0496118_0039641_2799_3086 95
1911 3300048921 Ga0496118_0112001 Ga0496118_0112001_1211_1501 95
1912 3300048921 Ga0496118_0158646 Ga0496118_0158646_1094_1381 95
1913 3300048921 Ga0496118_0186498 Ga0496118_0186498_75_362 95
1914 3300048921 Ga0496118_0227539 Ga0496118_0227539_759_1046 95
1915 3300048921 Ga0496118_0304693 Ga0496118_0304693_320_607 95
1916 3300048921 Ga0496118_0568866 Ga0496118_0568866_227_514 95
1917 3300048922 Ga0496119_0015793 Ga0496119_0015793_83_370 95
1918 3300048922 Ga0496119_0026363 Ga0496119_0026363_1944_2231 95
1919 3300048922 Ga0496119_0038363 Ga0496119_0038363_220_510 95
1920 3300048922 Ga0496119_0191033 Ga0496119_0191033_36_323 95
1921 3300048922 Ga0496119_0286632 Ga0496119_0286632_257_544 95
1922 3300048923 Ga0496120_0024028 Ga0496120_0024028_2438_2725 95
1923 3300048923 Ga0496120_0129994 Ga0496120_0129994_353_640 95
1924 3300048923 Ga0496120_0226667 Ga0496120_0226667_494_781 95
1925 3300048924 Ga0496121_0000041 Ga0496121_0000041_175022_175309 95
1926 3300048924 Ga0496121_0000643 Ga0496121_0000643_17567_17875 95
1927 3300048924 Ga0496121_0003467 Ga0496121_0003467_5363_5650 95
1928 3300048924 Ga0496121_0018262 Ga0496121_0018262_443_730 95
1929 3300048924 Ga0496121_0019164 Ga0496121_0019164_3734_4021 95
1930 3300048924 Ga0496121_0028124 Ga0496121_0028124_3740_4027 95
1931 3300048924 Ga0496121_0028955 Ga0496121_0028955_2622_2912 95
1932 3300048924 Ga0496121_0032744 Ga0496121_0032744_1031_1318 95
1933 3300048924 Ga0496121_0059096 Ga0496121_0059096_1346_1633 95
1934 3300048924 Ga0496121_0134334 Ga0496121_0134334_215_502 95
1935 3300048924 Ga0496121_0181239 Ga0496121_0181239_1161_1448 95
1936 3300048924 Ga0496121_0232362 Ga0496121_0232362_322_609 95
1937 3300048924 Ga0496121_0280122 Ga0496121_0280122_544_831 95
1938 3300048924 Ga0496121_0325480 Ga0496121_0325480_87_374 95
1939 3300048924 Ga0496121_0453732 Ga0496121_0453732_399_686 95
1940 3300048924 Ga0496121_0738183 Ga0496121_0738183_281_568 95
1941 3300048925 Ga0496122_0111930 Ga0496122_0111930_447_734 95
1942 3300048925 Ga0496122_0267507 Ga0496122_0267507_594_881 95
1943 3300048926 Ga0496123_0122194 Ga0496123_0122194_558_845 95
1944 3300048926 Ga0496123_0460637 Ga0496123_0460637_73_360 95
1945 3300048927 Ga0496124_0007272 Ga0496124_0007272_9099_9386 95
1946 3300048927 Ga0496124_0080603 Ga0496124_0080603_2071_2358 95
1947 3300048927 Ga0496124_0228578 Ga0496124_0228578_146_433 95
1948 3300048927 Ga0496124_0516005 Ga0496124_0516005_189_476 95
1949 3300048927 Ga0496124_0550897 Ga0496124_0550897_44_331 95
1950 3300048927 Ga0496124_0681154 Ga0496124_0681154_114_401 95
1951 3300048927 Ga0496124_0747205 Ga0496124_0747205_182_469 95
1952 3300048928 Ga0496125_0000578 Ga0496125_0000578_3575_3862 95
1953 3300048928 Ga0496125_0188520 Ga0496125_0188520_672_959 95
1954 3300048928 Ga0496125_0246826 Ga0496125_0246826_522_809 95
1955 3300048928 Ga0496125_0357683 Ga0496125_0357683_218_505 95
1956 3300048928 Ga0496125_0422027 Ga0496125_0422027_74_361 95
1957 3300048928 Ga0496125_0697017 Ga0496125_0697017_67_354 95
1958 3300048929 Ga0496126_0009677 Ga0496126_0009677_3757_4044 95
1959 3300048929 Ga0496126_0012003 Ga0496126_0012003_2318_2605 95
1960 3300048929 Ga0496126_0014128 Ga0496126_0014128_5152_5496 95
1961 3300048929 Ga0496126_0036950 Ga0496126_0036950_3200_3487 95
1962 3300048929 Ga0496126_0039833 Ga0496126_0039833_755_1093 95
1963 3300048929 Ga0496126_0076682 Ga0496126_0076682_1031_1318 95
1964 3300048929 Ga0496126_0226191 Ga0496126_0226191_699_986 95
1965 3300048929 Ga0496126_0242665 Ga0496126_0242665_703_990 95
1966 3300048929 Ga0496126_0243238 Ga0496126_0243238_72_359 95
1967 3300048929 Ga0496126_0262096 Ga0496126_0262096_953_1240 95
1968 3300048929 Ga0496126_0289644 Ga0496126_0289644_567_854 95
1969 3300048929 Ga0496126_0346442 Ga0496126_0346442_832_1119 95
1970 3300048929 Ga0496126_0382877 Ga0496126_0382877_685_972 95
1971 3300048929 Ga0496126_0412397 Ga0496126_0412397_114_401 95
1972 3300048929 Ga0496126_0513466 Ga0496126_0513466_315_602 95
1973 3300048929 Ga0496126_0733851 Ga0496126_0733851_437_724 95
1974 3300048929 Ga0496126_0752367 Ga0496126_0752367_97_384 95
1975 3300048929 Ga0496126_0817492 Ga0496126_0817492_33_377 95
1976 3300049460 Ga0495682_0035863 Ga0495682_0035863_663_950 95
1977 3300049460 Ga0495682_0221107 Ga0495682_0221107_78_365 95
1978 3300049460 Ga0495682_0324394 Ga0495682_0324394_57_344 95
1979 3300049460 Ga0495682_0355242 Ga0495682_0355242_12_299 95
1980 3300049460 Ga0495682_0373590 Ga0495682_0373590_156_446 95
1981 3300049568 Ga0501031_0000652 Ga0501031_0000652_6711_6998 95
1982 3300049568 Ga0501031_0006542 Ga0501031_0006542_1808_2095 95
1983 3300049569 Ga0501032_0000046 Ga0501032_0000046_20021_20308 95
1984 3300049569 Ga0501032_0008287 Ga0501032_0008287_151_438 95
1985 3300049569 Ga0501032_0074850 Ga0501032_0074850_328_618 95
1986 3300049569 Ga0501032_0394987 Ga0501032_0394987_418_705 95
1987 3300049570 Ga0501033_0000091 Ga0501033_0000091_9597_9884 95
1988 3300049570 Ga0501033_0000232 Ga0501033_0000232_4825_5112 95
1989 3300049570 Ga0501033_0202762 Ga0501033_0202762_769_1059 95
1990 3300049570 Ga0501033_0229469 Ga0501033_0229469_1001_1288 95
1991 3300049570 Ga0501033_0385211 Ga0501033_0385211_452_739 95
1992 3300049570 Ga0501033_1183280 Ga0501033_1183280_61_348 95
1993 3300049571 Ga0501034_0000039 Ga0501034_0000039_142739_143026 95
1994 3300049571 Ga0501034_0000704 Ga0501034_0000704_716_1003 95
1995 3300049571 Ga0501034_0041940 Ga0501034_0041940_2091_2378 95
1996 3300049571 Ga0501034_0073466 Ga0501034_0073466_1040_1327 95
1997 3300049571 Ga0501034_0485172 Ga0501034_0485172_726_1013 95
1998 3300049571 Ga0501034_0529392 Ga0501034_0529392_388_675 95
1999 3300049571 Ga0501034_0565716 Ga0501034_0565716_178_465 95
2000 3300049571 Ga0501034_1096816 Ga0501034_1096816_48_335 95
2001 3300049571 Ga0501034_1400699 Ga0501034_1400699_150_437 95
2002 3300049572 Ga0501036_0000007 Ga0501036_0000007_227311_227598 95
2003 3300049572 Ga0501036_0000052 Ga0501036_0000052_43116_43403 95
2004 3300049572 Ga0501036_0613644 Ga0501036_0613644_164_451 95
2005 3300049572 Ga0501036_1361374 Ga0501036_1361374_226_513 95
2006 3300049572 Ga0501036_1434623 Ga0501036_1434623_94_381 95
2007 3300049572 Ga0501036_1614410 Ga0501036_1614410_221_508 95
2008 3300049573 Ga0501037_0000025 Ga0501037_0000025_45307_45594 95
2009 3300049573 Ga0501037_0000550 Ga0501037_0000550_9395_9682 95
2010 3300049574 Ga0501038_0000026 Ga0501038_0000026_87606_87893 95
2011 3300049574 Ga0501038_0001467 Ga0501038_0001467_6360_6647 95
2012 3300049574 Ga0501038_0286798 Ga0501038_0286798_208_495 95
2013 3300049574 Ga0501038_0980705 Ga0501038_0980705_222_509 95
2014 3300049574 Ga0501038_1305721 Ga0501038_1305721_109_396 95
2015 3300049575 Ga0501039_0000005 Ga0501039_0000005_24593_24880 95
2016 3300049575 Ga0501039_0000719 Ga0501039_0000719_12809_13096 95
2017 3300049575 Ga0501039_0900412 Ga0501039_0900412_108_395 95
2018 3300049576 Ga0501040_0702180 Ga0501040_0702180_122_409 95
2019 3300049578 Ga0501042_0294891 Ga0501042_0294891_703_990 95
2020 3300049579 Ga0501043_0000036 Ga0501043_0000036_131489_131776 95
2021 3300049579 Ga0501043_0003933 Ga0501043_0003933_6322_6609 95
2022 3300049579 Ga0501043_0024382 Ga0501043_0024382_76_366 95
2023 3300049579 Ga0501043_0114870 Ga0501043_0114870_1695_1982 95
2024 3300049579 Ga0501043_0506475 Ga0501043_0506475_246_533 95
2025 3300049580 Ga0501046_0000147 Ga0501046_0000147_8046_8333 95
2026 3300049580 Ga0501046_0000231 Ga0501046_0000231_38937_39224 95
2027 3300049580 Ga0501046_0130234 Ga0501046_0130234_1431_1718 95
2028 3300049580 Ga0501046_0188160 Ga0501046_0188160_537_824 95
2029 3300049581 Ga0501047_0000101 Ga0501047_0000101_87893_88180 95
2030 3300049581 Ga0501047_0000457 Ga0501047_0000457_22823_23110 95
2031 3300049581 Ga0501047_0020324 Ga0501047_0020324_606_893 95
2032 3300049581 Ga0501047_0035146 Ga0501047_0035146_2781_3068 95
2033 3300049581 Ga0501047_0061023 Ga0501047_0061023_3065_3355 95
2034 3300049581 Ga0501047_0096339 Ga0501047_0096339_975_1262 95
2035 3300049581 Ga0501047_0467379 Ga0501047_0467379_422_709 95
2036 3300049581 Ga0501047_1179482 Ga0501047_1179482_47_334 95
2037 3300049581 Ga0501047_1244723 Ga0501047_1244723_201_488 95
2038 3300049582 Ga0501048_0006581 Ga0501048_0006581_6176_6463 95
2039 3300049582 Ga0501048_0362112 Ga0501048_0362112_375_665 95
2040 3300049582 Ga0501048_0826763 Ga0501048_0826763_275_562 95
2041 3300049583 Ga0501067_0019194 Ga0501067_0019194_178_465 95
2042 3300049583 Ga0501067_0021998 Ga0501067_0021998_2343_2630 95
2043 3300049583 Ga0501067_0103626 Ga0501067_0103626_944_1237 95
2044 3300049583 Ga0501067_0550195 Ga0501067_0550195_88_375 95
2045 3300049584 Ga0501068_0001352 Ga0501068_0001352_11234_11521 95
2046 3300049584 Ga0501068_0027461 Ga0501068_0027461_1328_1615 95
2047 3300049584 Ga0501068_1149979 Ga0501068_1149979_189_476 95
2048 3300049584 Ga0501068_1173230 Ga0501068_1173230_62_349 95
2049 3300049585 Ga0501069_0004096 Ga0501069_0004096_35_322 95
2050 3300049586 Ga0501070_0000297 Ga0501070_0000297_4191_4478 95
2051 3300049586 Ga0501070_0003647 Ga0501070_0003647_12635_12922 95
2052 3300049586 Ga0501070_0067053 Ga0501070_0067053_979_1266 95
2053 3300049586 Ga0501070_0199997 Ga0501070_0199997_895_1182 95
2054 3300049586 Ga0501070_0635895 Ga0501070_0635895_348_635 95
2055 3300049586 Ga0501070_0684894 Ga0501070_0684894_273_560 95
2056 3300049586 Ga0501070_0750510 Ga0501070_0750510_233_520 95
2057 3300049586 Ga0501070_1063515 Ga0501070_1063515_141_428 95
2058 3300049587 Ga0501071_0021622 Ga0501071_0021622_2757_3044 95
2059 3300049588 Ga0501072_0005648 Ga0501072_0005648_2936_3223 95
2060 3300049588 Ga0501072_0770408 Ga0501072_0770408_232_519 95
2061 3300049589 Ga0501073_0000877 Ga0501073_0000877_19652_19939 95
2062 3300049589 Ga0501073_0037404 Ga0501073_0037404_554_841 95
2063 3300049589 Ga0501073_0841887 Ga0501073_0841887_277_564 95
2064 3300049590 Ga0501074_0005054 Ga0501074_0005054_5106_5393 95
2065 3300049590 Ga0501074_0051846 Ga0501074_0051846_1867_2154 95
2066 3300049590 Ga0501074_0377557 Ga0501074_0377557_677_976 95
2067 3300049590 Ga0501074_0499960 Ga0501074_0499960_541_828 95
2068 3300049741 Ga0501079_0093370 Ga0501079_0093370_1479_1766 95
2069 3300049741 Ga0501079_0162536 Ga0501079_0162536_14_301 95
2070 3300049742 Ga0501080_0000124 Ga0501080_0000124_1415_1702 95
2071 3300049742 Ga0501080_0000382 Ga0501080_0000382_7896_8183 95
2072 3300049742 Ga0501080_1080328 Ga0501080_1080328_137_424 95
2073 3300049742 Ga0501080_1178709 Ga0501080_1178709_204_491 95
2074 3300049742 Ga0501080_1465750 Ga0501080_1465750_81_368 95
2075 3300049742 Ga0501080_1620591 Ga0501080_1620591_107_394 95
2076 3300049744 Ga0501083_0000929 Ga0501083_0000929_7437_7724 95
2077 3300049744 Ga0501083_0324842 Ga0501083_0324842_491_778 95
2078 3300049764 Ga0501267_043493 Ga0501267_043493_19_306 95
2079 3300049822 Ga0501035_0000052 Ga0501035_0000052_57618_57905 95
2080 3300049822 Ga0501035_0001237 Ga0501035_0001237_3181_3468 95
2081 3300049822 Ga0501035_0081438 Ga0501035_0081438_63_353 95
2082 3300049822 Ga0501035_0251644 Ga0501035_0251644_829_1116 95
2083 3300049822 Ga0501035_0256897 Ga0501035_0256897_885_1172 95
2084 3300049822 Ga0501035_0392703 Ga0501035_0392703_509_796 95
2085 3300049822 Ga0501035_1096282 Ga0501035_1096282_249_536 95
2086 3300049823 Ga0501044_0000217 Ga0501044_0000217_41563_41850 95
2087 3300049823 Ga0501044_0000366 Ga0501044_0000366_7542_7829 95
2088 3300049823 Ga0501044_0022498 Ga0501044_0022498_2908_3198 95
2089 3300049823 Ga0501044_0056626 Ga0501044_0056626_695_982 95
2090 3300049823 Ga0501044_0060176 Ga0501044_0060176_1105_1392 95
2091 3300049823 Ga0501044_0172671 Ga0501044_0172671_518_805 95
2092 3300049823 Ga0501044_0232962 Ga0501044_0232962_1032_1319 95
2093 3300049823 Ga0501044_0280774 Ga0501044_0280774_786_1073 95
2094 3300049823 Ga0501044_0367799 Ga0501044_0367799_622_909 95
2095 3300049823 Ga0501044_0507246 Ga0501044_0507246_652_939 95
2096 3300049823 Ga0501044_0550894 Ga0501044_0550894_246_533 95
2097 3300049823 Ga0501044_0570969 Ga0501044_0570969_89_376 95
2098 3300049823 Ga0501044_0663802 Ga0501044_0663802_278_565 95
2099 3300049823 Ga0501044_1251831 Ga0501044_1251831_139_426 95
2100 3300049824 Ga0501045_0009980 Ga0501045_0009980_4821_5108 95
2101 3300049824 Ga0501045_0046654 Ga0501045_0046654_531_818 95
2102 3300050489 nmdc:mga03683_313740_c1 nmdc:mga03683_313740_c1_373_660 95
2103 3300050489 nmdc:mga03683_79868_c1 nmdc:mga03683_79868_c1_340_627 95
2104 3300050490 nmdc:mga03n38_121508_c1 nmdc:mga03n38_121508_c1_465_752 95
2105 3300050490 nmdc:mga03n38_1240_c1 nmdc:mga03n38_1240_c1_3310_3597 95
2106 3300050490 nmdc:mga03n38_335316_c1 nmdc:mga03n38_335316_c1_192_479 95
2107 3300050490 nmdc:mga03n38_364542_c1 nmdc:mga03n38_364542_c1_417_704 95
2108 3300050490 nmdc:mga03n38_51358_c1 nmdc:mga03n38_51358_c1_838_1125 95
2109 3300050490 nmdc:mga03n38_86681_c1 nmdc:mga03n38_86681_c1_90_377 95
2110 3300050491 nmdc:mga00v17_125857_c1 nmdc:mga00v17_125857_c1_576_863 95
2111 3300050491 nmdc:mga00v17_20822_c1 nmdc:mga00v17_20822_c1_3125_3412 95
2112 3300050491 nmdc:mga00v17_221836_c1 nmdc:mga00v17_221836_c1_804_1091 95
2113 3300050491 nmdc:mga00v17_330924_c1 nmdc:mga00v17_330924_c1_277_564 95
2114 3300050492 nmdc:mga0yw44_16875_c1 nmdc:mga0yw44_16875_c1_845_1132 95
2115 3300050492 nmdc:mga0yw44_214731_c1 nmdc:mga0yw44_214731_c1_263_550 95
2116 3300050492 nmdc:mga0yw44_253139_c1 nmdc:mga0yw44_253139_c1_247_534 95
2117 3300050492 nmdc:mga0yw44_269525_c1 nmdc:mga0yw44_269525_c1_544_831 95
2118 3300050492 nmdc:mga0yw44_398332_c1 nmdc:mga0yw44_398332_c1_477_764 95
2119 3300050492 nmdc:mga0yw44_47694_c1 nmdc:mga0yw44_47694_c1_440_727 95
2120 3300050492 nmdc:mga0yw44_60824_c1 nmdc:mga0yw44_60824_c1_2004_2294 95
2121 3300050492 nmdc:mga0yw44_839926_c1 nmdc:mga0yw44_839926_c1_13_315 95
2122 3300050492 nmdc:mga0yw44_861874_c1 nmdc:mga0yw44_861874_c1_163_450 95
2123 3300050492 nmdc:mga0yw44_909013_c1 nmdc:mga0yw44_909013_c1_236_523 95
2124 3300050493 nmdc:mga0k408_126071_c1 nmdc:mga0k408_126071_c1_167_454 95
2125 3300050493 nmdc:mga0k408_42687_c1 nmdc:mga0k408_42687_c1_1214_1501 95
2126 3300050493 nmdc:mga0k408_562967_c1 nmdc:mga0k408_562967_c1_56_343 95
2127 3300050493 nmdc:mga0k408_835182_c1 nmdc:mga0k408_835182_c1_190_477 95
2128 3300050494 nmdc:mga06z11_1013503_c1 nmdc:mga06z11_1013503_c1_189_476 95
2129 3300050494 nmdc:mga06z11_163242_c1 nmdc:mga06z11_163242_c1_483_770 95
2130 3300050494 nmdc:mga06z11_2124_c1 nmdc:mga06z11_2124_c1_6014_6301 95
2131 3300050494 nmdc:mga06z11_238606_c1 nmdc:mga06z11_238606_c1_195_482 95
2132 3300050494 nmdc:mga06z11_276552_c1 nmdc:mga06z11_276552_c1_351_638 95
2133 3300050494 nmdc:mga06z11_304692_c1 nmdc:mga06z11_304692_c1_454_741 95
2134 3300050494 nmdc:mga06z11_593010_c1 nmdc:mga06z11_593010_c1_285_572 95
2135 3300050494 nmdc:mga06z11_855150_c1 nmdc:mga06z11_855150_c1_52_339 95
2136 3300050494 nmdc:mga06z11_862023_c1 nmdc:mga06z11_862023_c1_225_512 95
2137 3300050495 nmdc:mga04h51_117958_c1 nmdc:mga04h51_117958_c1_340_627 95
2138 3300050495 nmdc:mga04h51_140852_c1 nmdc:mga04h51_140852_c1_513_800 95
2139 3300050495 nmdc:mga04h51_145486_c1 nmdc:mga04h51_145486_c1_458_745 95
2140 3300050495 nmdc:mga04h51_293332_c1 nmdc:mga04h51_293332_c1_18_305 95
2141 3300050496 nmdc:mga07m45_10503_c1 nmdc:mga07m45_10503_c1_1868_2155 95
2142 3300050496 nmdc:mga07m45_24533_c1 nmdc:mga07m45_24533_c1_1339_1626 95
2143 3300050496 nmdc:mga07m45_431991_c1 nmdc:mga07m45_431991_c1_339_626 95
2144 3300050496 nmdc:mga07m45_438638_c1 nmdc:mga07m45_438638_c1_339_641 95
2145 3300050496 nmdc:mga07m45_5369_c1 nmdc:mga07m45_5369_c1_1430_1717 95
2146 3300050496 nmdc:mga07m45_94253_c1 nmdc:mga07m45_94253_c1_330_617 95
2147 3300050507 nmdc:mga05p37_149693_c1 nmdc:mga05p37_149693_c1_151_438 95
2148 3300050507 nmdc:mga05p37_2246975_c1 nmdc:mga05p37_2246975_c1_30_317 95
2149 3300050511 nmdc:mga08y16_105399_c1 nmdc:mga08y16_105399_c1_2121_2408 95
2150 3300050511 nmdc:mga08y16_273475_c1 nmdc:mga08y16_273475_c1_433_720 95
2151 3300050512 nmdc:mga0n895_4334_c1 nmdc:mga0n895_4334_c1_7530_7817 95
2152 3300050513 nmdc:mga0rr50_109474_c1 nmdc:mga0rr50_109474_c1_1838_2125 95
2153 3300050513 nmdc:mga0rr50_287538_c1 nmdc:mga0rr50_287538_c1_282_569 95
2154 3300050513 nmdc:mga0rr50_642623_c1 nmdc:mga0rr50_642623_c1_258_545 95
2155 3300050513 nmdc:mga0rr50_651752_c1 nmdc:mga0rr50_651752_c1_70_357 95
2156 3300050514 nmdc:mga08x19_162520_c1 nmdc:mga08x19_162520_c1_597_884 95
2157 3300050514 nmdc:mga08x19_167838_c1 nmdc:mga08x19_167838_c1_309_596 95
2158 3300050515 nmdc:mga0a205_434695_c1 nmdc:mga0a205_434695_c1_801_1088 95
2159 3300050516 nmdc:mga0sz30_13512_c1 nmdc:mga0sz30_13512_c1_2186_2473 95
2160 3300050516 nmdc:mga0sz30_173900_c1 nmdc:mga0sz30_173900_c1_116_403 95
2161 3300050516 nmdc:mga0sz30_280339_c1 nmdc:mga0sz30_280339_c1_86_373 95
2162 3300050516 nmdc:mga0sz30_4476_c1 nmdc:mga0sz30_4476_c1_4390_4680 95
2163 3300050516 nmdc:mga0sz30_62031_c1 nmdc:mga0sz30_62031_c1_1214_1501 95
2164 3300053077 Ga0495601_0056584 Ga0495601_0056584_645_932 95
2165 3300053077 Ga0495601_0058736 Ga0495601_0058736_412_714 95
2166 3300053077 Ga0495601_0144307 Ga0495601_0144307_758_1045 95
2167 3300053077 Ga0495601_0163428 Ga0495601_0163428_252_539 95
2168 3300053077 Ga0495601_0982238 Ga0495601_0982238_122_409 95
2169 3300053078 Ga0495612_0055802 Ga0495612_0055802_706_993 95
2170 3300053078 Ga0495612_0169009 Ga0495612_0169009_176_463 95
2171 3300053078 Ga0495612_0184575 Ga0495612_0184575_541_828 95
2172 3300053079 Ga0500610_0401615 Ga0500610_0401615_39_326 95
2173 3300053080 Ga0500635_0162773 Ga0500635_0162773_451_765 95
2174 3300053080 Ga0500635_0338901 Ga0500635_0338901_115_402 95
2175 3300053083 Ga0495655_0018385 Ga0495655_0018385_371_658 95
2176 3300053083 Ga0495655_0120559 Ga0495655_0120559_145_432 95
2177 3300053084 Ga0495595_0005974 Ga0495595_0005974_3549_3836 95
2178 3300053084 Ga0495595_0008598 Ga0495595_0008598_685_987 95
2179 3300053084 Ga0495595_0099485 Ga0495595_0099485_93_380 95
2180 3300053084 Ga0495595_0133640 Ga0495595_0133640_626_913 95
2181 3300053085 Ga0495619_0000711 Ga0495619_0000711_13151_13453 95
2182 3300053085 Ga0495619_0128788 Ga0495619_0128788_1268_1567 95
2183 3300053085 Ga0495619_0395181 Ga0495619_0395181_419_706 95
2184 3300053085 Ga0495619_0796690 Ga0495619_0796690_203_490 95
2185 3300053085 Ga0495619_0827275 Ga0495619_0827275_261_548 95
2186 3300053086 Ga0500578_0089111 Ga0500578_0089111_615_902 95
2187 3300053086 Ga0500578_0101708 Ga0500578_0101708_574_861 95
2188 3300053086 Ga0500578_0195004 Ga0500578_0195004_648_935 95
2189 3300053086 Ga0500578_0556067 Ga0500578_0556067_285_572 95
2190 3300053086 Ga0500578_0694932 Ga0500578_0694932_13_300 95
2191 3300053087 Ga0500643_000069 Ga0500643_000069_45688_45975 95
2192 3300053088 Ga0500644_0436010 Ga0500644_0436010_94_381 95
2193 3300053090 Ga0500646_0088326 Ga0500646_0088326_571_858 95
2194 3300053091 Ga0500647_0017088 Ga0500647_0017088_679_969 95
2195 3300053091 Ga0500647_0037133 Ga0500647_0037133_1899_2189 95
2196 3300053091 Ga0500647_0093665 Ga0500647_0093665_1116_1403 95
2197 3300053091 Ga0500647_0321716 Ga0500647_0321716_47_334 95
2198 3300053092 Ga0500583_0094842 Ga0500583_0094842_330_617 95
2199 3300053092 Ga0500583_0350973 Ga0500583_0350973_233_520 95
2200 3300053093 Ga0500651_0000824 Ga0500651_0000824_13_303 95
2201 3300053093 Ga0500651_0062542 Ga0500651_0062542_430_717 95
2202 3300053093 Ga0500651_0325465 Ga0500651_0325465_25_312 95
2203 3300053093 Ga0500651_0557538 Ga0500651_0557538_55_342 95
2204 3300053093 Ga0500651_0749879 Ga0500651_0749879_125_412 95
2205 3300053094 Ga0500566_0000608 Ga0500566_0000608_1635_1922 95
2206 3300053094 Ga0500566_0003815 Ga0500566_0003815_2580_2867 95
2207 3300053094 Ga0500566_0004782 Ga0500566_0004782_7251_7538 95
2208 3300053094 Ga0500566_0005056 Ga0500566_0005056_2938_3225 95
2209 3300053094 Ga0500566_0011120 Ga0500566_0011120_619_909 95
2210 3300053094 Ga0500566_0068687 Ga0500566_0068687_533_820 95
2211 3300053095 Ga0500640_018353 Ga0500640_018353_2136_2426 95
2212 3300053095 Ga0500640_085847 Ga0500640_085847_49_336 95
2213 3300053096 Ga0500641_0003947 Ga0500641_0003947_183_470 95
2214 3300053096 Ga0500641_0004337 Ga0500641_0004337_878_1186 95
2215 3300053096 Ga0500641_0361133 Ga0500641_0361133_160_447 95
2216 3300053097 Ga0500648_380166 Ga0500648_380166_214_504 95
2217 3300053102 Ga0500554_007221 Ga0500554_007221_932_1246 95
2218 3300053102 Ga0500554_078200 Ga0500554_078200_492_779 95
2219 3300053103 Ga0500555_004853 Ga0500555_004853_57_344 95
2220 3300053103 Ga0500555_139789 Ga0500555_139789_12_299 95
2221 3300053104 Ga0500556_0009103 Ga0500556_0009103_109_396 95
2222 3300053105 Ga0500557_000003 Ga0500557_000003_96257_96547 95
2223 3300053106 Ga0500558_222791 Ga0500558_222791_246_533 95
2224 3300053108 Ga0500562_019809 Ga0500562_019809_1195_1494 95
2225 3300053108 Ga0500562_064884 Ga0500562_064884_247_534 95
2226 3300053109 Ga0500569_022899 Ga0500569_022899_39_326 95
2227 3300053109 Ga0500569_075342 Ga0500569_075342_361_648 95
2228 3300053109 Ga0500569_128954 Ga0500569_128954_313_600 95
2229 3300053111 Ga0500572_000104 Ga0500572_000104_5725_6015 95
2230 3300053111 Ga0500572_000220 Ga0500572_000220_13959_14246 95
2231 3300053111 Ga0500572_004858 Ga0500572_004858_2244_2531 95
2232 3300053111 Ga0500572_065576 Ga0500572_065576_563_850 95
2233 3300053115 Ga0500591_036508 Ga0500591_036508_108_398 95
2234 3300053119 Ga0500595_000200 Ga0500595_000200_35126_35413 95
2235 3300053119 Ga0500595_000875 Ga0500595_000875_11380_11730 95
2236 3300053119 Ga0500595_002551 Ga0500595_002551_4617_4907 95
2237 3300053119 Ga0500595_004958 Ga0500595_004958_4546_4833 95
2238 3300053119 Ga0500595_008437 Ga0500595_008437_48_335 95
2239 3300053119 Ga0500595_066609 Ga0500595_066609_10_297 95
2240 3300053119 Ga0500595_074685 Ga0500595_074685_693_980 95
2241 3300053119 Ga0500595_106602 Ga0500595_106602_154_444 95
2242 3300053121 Ga0500607_065380 Ga0500607_065380_379_666 95
2243 3300053122 Ga0500608_012547 Ga0500608_012547_2532_2822 95
2244 3300053122 Ga0500608_025531 Ga0500608_025531_2036_2323 95
2245 3300053122 Ga0500608_230500 Ga0500608_230500_124_411 95
2246 3300053123 Ga0500614_003064 Ga0500614_003064_549_839 95
2247 3300053123 Ga0500614_170743 Ga0500614_170743_305_592 95
2248 3300053130 Ga0500642_0000051 Ga0500642_0000051_23108_23395 95
2249 3300053130 Ga0500642_0003167 Ga0500642_0003167_3056_3346 95
2250 3300053130 Ga0500642_0048786 Ga0500642_0048786_982_1269 95
2251 3300053133 Ga0500655_014210 Ga0500655_014210_315_602 95
2252 3300053133 Ga0500655_062547 Ga0500655_062547_34_321 95
2253 3300053134 Ga0500658_0024537 Ga0500658_0024537_1807_2115 95
2254 3300053134 Ga0500658_0323797 Ga0500658_0323797_137_424 95
2255 3300053136 Ga0500559_0000907 Ga0500559_0000907_5833_6120 95
2256 3300053136 Ga0500559_0000932 Ga0500559_0000932_3273_3560 95
2257 3300053136 Ga0500559_0007519 Ga0500559_0007519_2342_2632 95
2258 3300053136 Ga0500559_0018715 Ga0500559_0018715_429_716 95
2259 3300053136 Ga0500559_0040143 Ga0500559_0040143_690_977 95
2260 3300053136 Ga0500559_0218519 Ga0500559_0218519_449_736 95
2261 3300053136 Ga0500559_0295429 Ga0500559_0295429_84_371 95
2262 3300053136 Ga0500559_0535449 Ga0500559_0535449_232_519 95
2263 3300053138 Ga0500564_162552 Ga0500564_162552_191_478 95
2264 3300053139 Ga0500568_0000268 Ga0500568_0000268_4796_5104 95
2265 3300053139 Ga0500568_0040806 Ga0500568_0040806_740_1027 95
2266 3300053139 Ga0500568_0090890 Ga0500568_0090890_801_1091 95
2267 3300053139 Ga0500568_0105734 Ga0500568_0105734_351_638 95
2268 3300053139 Ga0500568_0112834 Ga0500568_0112834_616_903 95
2269 3300053140 Ga0500573_0338042 Ga0500573_0338042_165_452 95
2270 3300053142 Ga0500577_0197950 Ga0500577_0197950_158_445 95
2271 3300053142 Ga0500577_0402486 Ga0500577_0402486_287_574 95
2272 3300053146 Ga0500588_0027983 Ga0500588_0027983_1193_1480 95
2273 3300053147 Ga0500589_172020 Ga0500589_172020_39_326 95
2274 3300053147 Ga0500589_181400 Ga0500589_181400_38_325 95
2275 3300053147 Ga0500589_235415 Ga0500589_235415_153_440 95
2276 3300053148 Ga0500590_093815 Ga0500590_093815_932_1219 95
2277 3300053148 Ga0500590_126032 Ga0500590_126032_791_1078 95
2278 3300053148 Ga0500590_327498 Ga0500590_327498_256_543 95
2279 3300053150 Ga0500603_000137 Ga0500603_000137_11475_11765 95
2280 3300053150 Ga0500603_000240 Ga0500603_000240_4400_4714 95
2281 3300053150 Ga0500603_100510 Ga0500603_100510_379_666 95
2282 3300053151 Ga0500604_0182591 Ga0500604_0182591_367_654 95
2283 3300053153 Ga0500616_0000028 Ga0500616_0000028_50237_50524 95
2284 3300053153 Ga0500616_0015823 Ga0500616_0015823_3500_3787 95
2285 3300053153 Ga0500616_0154289 Ga0500616_0154289_623_910 95
2286 3300053153 Ga0500616_0200182 Ga0500616_0200182_145_432 95
2287 3300053154 Ga0500619_214535 Ga0500619_214535_56_343 95
2288 3300053155 Ga0500620_032096 Ga0500620_032096_466_753 95
2289 3300053155 Ga0500620_110952 Ga0500620_110952_434_721 95
2290 3300053156 Ga0500622_0009323 Ga0500622_0009323_2813_3100 95
2291 3300053158 Ga0500627_0037154 Ga0500627_0037154_1317_1625 95
2292 3300053158 Ga0500627_0179988 Ga0500627_0179988_290_577 95
2293 3300053158 Ga0500627_0413630 Ga0500627_0413630_14_301 95
2294 3300053159 Ga0500630_002999 Ga0500630_002999_2151_2441 95
2295 3300053160 Ga0500633_0258537 Ga0500633_0258537_150_437 95
2296 3300053161 Ga0500634_0111726 Ga0500634_0111726_358_645 95
2297 3300053162 Ga0500638_015970 Ga0500638_015970_3060_3347 95
2298 3300053162 Ga0500638_039878 Ga0500638_039878_1467_1754 95
2299 3300053162 Ga0500638_045446 Ga0500638_045446_1691_1981 95
2300 3300053162 Ga0500638_308264 Ga0500638_308264_15_302 95
2301 3300053163 Ga0500639_000071 Ga0500639_000071_27023_27313 95
2302 3300053163 Ga0500639_007676 Ga0500639_007676_2600_2887 95
2303 3300053163 Ga0500639_059159 Ga0500639_059159_1237_1524 95
2304 3300053177 Ga0500636_0000166 Ga0500636_0000166_16867_17154 95
2305 3300053177 Ga0500636_0001770 Ga0500636_0001770_9696_9983 95
2306 3300053177 Ga0500636_0027127 Ga0500636_0027127_1368_1655 95
2307 3300053177 Ga0500636_0091798 Ga0500636_0091798_1288_1575 95
2308 3300053177 Ga0500636_0240712 Ga0500636_0240712_59_346 95
2309 3300053177 Ga0500636_0251260 Ga0500636_0251260_489_776 95
2310 3300053178 Ga0500637_0000144 Ga0500637_0000144_3751_4038 95
2311 3300053178 Ga0500637_0044593 Ga0500637_0044593_1234_1521 95
2312 3300053178 Ga0500637_0081623 Ga0500637_0081623_1236_1523 95
2313 3300053178 Ga0500637_0088641 Ga0500637_0088641_382_696 95
2314 3300053178 Ga0500637_0515925 Ga0500637_0515925_242_529 95
2315 3300053722 Ga0500649_133568 Ga0500649_133568_427_714 95
2316 3300053725 Ga0500576_130409 Ga0500576_130409_62_349 95
2317 3300053725 Ga0500576_231663 Ga0500576_231663_50_340 95
2318 3300053727 Ga0500611_055120 Ga0500611_055120_181_468 95
2319 3300053728 Ga0500657_073300 Ga0500657_073300_932_1219 95
2320 3300053729 Ga0500625_007957 Ga0500625_007957_37_327 95
2321 3300053729 Ga0500625_157424 Ga0500625_157424_246_533 95
2322 3300053730 Ga0500645_013058 Ga0500645_013058_379_666 95
2323 3300053730 Ga0500645_017503 Ga0500645_017503_1827_2114 95
2324 3300053733 Ga0500552_029933 Ga0500552_029933_20_307 95
2325 3300053733 Ga0500552_070706 Ga0500552_070706_102_389 95
2326 3300053735 Ga0500596_001829 Ga0500596_001829_750_1040 95
2327 3300053735 Ga0500596_012156 Ga0500596_012156_50_337 95
2328 3300053735 Ga0500596_019220 Ga0500596_019220_326_613 95
2329 3300053735 Ga0500596_049359 Ga0500596_049359_43_330 95
2330 3300053736 Ga0500599_001634 Ga0500599_001634_2011_2298 95
2331 3300053737 Ga0500601_000090 Ga0500601_000090_9022_9309 95
2332 3300053737 Ga0500601_002582 Ga0500601_002582_1295_1582 95
2333 3300054114 Ga0501084_0000683 Ga0501084_0000683_1430_1717 95
2334 3300054114 Ga0501084_0608474 Ga0501084_0608474_216_503 95
2335 3300054114 Ga0501084_1453798 Ga0501084_1453798_254_553 95
2336 3300055283 Ga0500661_029156 Ga0500661_029156_178_465 95
2337 3300060353 Ga0501082_0128046 Ga0501082_0128046_395_682 95
2338 3300060353 Ga0501082_0727055 Ga0501082_0727055_483_770 95
2339 3300060353 Ga0501082_1758048 Ga0501082_1758048_94_381 95
2340 3300061719 Ga0466962_0062122 Ga0466962_0062122_719_1006 95
2341 3300061719 Ga0466962_0142351 Ga0466962_0142351_243_530 95
2342 iso_pu_bacteria 2513237161 2514009372 95
2343 iso_pu_bacteria 2842775625 2842777476 95
2344 iso_pu_bacteria 2935608549 2935609887 95
2345 iso_pu_bacteria 2935819856 2935823047 95
2346 iso_pu_bacteria 2935847175 2935848629 95
2347 iso_pu_bacteria 8019619141 8019619872 95
2348 iso_pu_bacteria 8019629233 8019633245 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06243

PaaB

Phenylacetic acid degradation B

27

115

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3egr-assembly1.cif.gz_B-2 crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution 0.8564 6 65
4iit-assembly1.cif.gz_B-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8403 3 65
4iit-assembly1.cif.gz_B-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8284 3 65
3egr-assembly1.cif.gz_B-2 crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution 0.8193 6 65
6no7-assembly2.cif.gz_F crystal structure of the full-length wild-type pka ria holoenzyme 0.6971 6 31
ID Description Score Start End Superfamily
af_P76078_2_65_3.10.20.520 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8712 2 65 3.10.20.520
af_P76078_2_65_3.10.20.520 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8589 2 65 3.10.20.520
3egrB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8529 6 65 3.10.20.520
3egrB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8154 6 65 3.10.20.520
2qcsB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6794 5 31 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V8XMX9-F1-model_v4 Phenylacetic acid degradation protein PaaB 0.8954 8 64
AF-A0A537JLP7-F1-model_v4 1,2-phenylacetyl-CoA epoxidase subunit B 0.8943 4 65
AF-A0A2T0LAA4-F1-model_v4 Ring-1,2-phenylacetyl-CoA epoxidase subunit PaaB 0.8901 7 65
AF-A0A538BYS8-F1-model_v4 Uncharacterized protein 0.8854 7 56
AF-A0A7C5QV50-F1-model_v4 Phenylacetic acid degradation b 0.8784 1 61

Feature Viewer

pLDDT pTM Quality
71.66 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map