F496500

General Info

Members Datasets Scaffolds Average Seq Length
2169 1196 1526 530

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0047994|Ga0395905_0047994_296_2032
Length 578
Sequence MTRAKAIGVAATGGAAGMAGASLTGTICDLRVGLPPGALALRFAMILESQLNPRSAEFQSNAQAMQALVDDLARQVAKAAAGGGEAARAKHTARGKLLPRDRVQMLLDPGTPFLEIAPLAAHDMYNGDAPCAGVIAGIGRVSGVDCMIVCNDATVKGGTYYPMTVKKHLRAQEIAAQNRLPCIYLVDSGGANLPNQDDVFPDRDHFGRIFYNQANLSAQGIAQIAVVMGSCTAGGAYVPAMSDETIIVKNQGTIFLGGPPLVKAATGEIVSAEDLGGGDAHTRLSGVADHLAQNDMHALALARQAVATLDKRKDWPVEVREPRAPKYDPRQIGGVVPQDTRKPYDVREVIARLVDASEFHEFKARFGTTLVCGFAHIEGMPVGIVANNGILFSESAQKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIARHGAKMVTAVATASVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVKRDGIEGKGGKWSAEEEAAFKQPLLDQFAHQSHPYFSSARLWDDGVIDPADTRRVLALGLSAAMNAPIGEPKFGVFRM

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
18 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
22 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
23 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
24 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
25 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
26 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
27 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
28 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
29 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
30 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
31 2516143018 Ensifer sp. BR816 Isolate Nodule
32 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
33 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
34 2519103095 Burkholderia sp. KJ006 Isolate Nodule
35 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
36 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
37 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
38 2547132374 Acidovorax radicis N35 Isolate Unclassified
39 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
40 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
41 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
42 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
43 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
44 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
45 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
46 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
47 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
48 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
49 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
50 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
51 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
52 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
53 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
54 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
55 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
56 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
57 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
58 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
59 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
60 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
61 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
62 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
63 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
64 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
65 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
66 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
67 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
68 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
69 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
70 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
71 2643221546 Microbacterium sp. Root53 Isolate Unclassified
72 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
73 2643221557 Ensifer sp. Root558 Isolate Unclassified
74 2643221558 Rhizobium sp. Root149 Isolate Unclassified
75 2643221561 Nocardioides sp. Root151 Isolate Unclassified
76 2643221570 Acidovorax sp. Root568 Isolate Unclassified
77 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
78 2643221575 Microbacterium sp. Root61 Isolate Unclassified
79 2643221583 Caulobacter sp. Root655 Isolate Unclassified
80 2643221584 Caulobacter sp. Root656 Isolate Unclassified
81 2643221585 Pelomonas sp. Root662 Isolate Unclassified
82 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
83 2643221596 Acidovorax sp. Root70 Isolate Unclassified
84 2643221597 Microbacterium sp. Root180 Isolate Unclassified
85 2643221599 Rhizobium sp. Root708 Isolate Unclassified
86 2643221607 Rhizobium sp. Root73 Isolate Unclassified
87 2643221609 Acidovorax sp. Root217 Isolate Unclassified
88 2643221610 Ensifer sp. Root74 Isolate Unclassified
89 2643221611 Acidovorax sp. Root219 Isolate Unclassified
90 2643221615 Nocardioides sp. Root224 Isolate Unclassified
91 2643221618 Ensifer sp. Root231 Isolate Unclassified
92 2643221626 Ensifer sp. Root31 Isolate Unclassified
93 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
94 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
95 2643221630 Microbacterium sp. Root322 Isolate Unclassified
96 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
97 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
98 2643221640 Caulobacter sp. Root342 Isolate Unclassified
99 2643221641 Nocardioides sp. Root122 Isolate Unclassified
100 2643221642 Caulobacter sp. Root343 Isolate Unclassified
101 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
102 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
103 2643221651 Afipia sp. Root123D2 Isolate Unclassified
104 2643221652 Acidovorax sp. Root402 Isolate Unclassified
105 2643221655 Ensifer sp. Root1252 Isolate Unclassified
106 2643221656 Pelomonas sp. Root405 Isolate Unclassified
107 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
108 2643221658 Variovorax sp. Root411 Isolate Unclassified
109 2643221659 Ensifer sp. Root127 Isolate Unclassified
110 2643221660 Methylibium sp. Root1272 Isolate Unclassified
111 2643221668 Ensifer sp. Root423 Isolate Unclassified
112 2643221672 Variovorax sp. Root434 Isolate Unclassified
113 2643221675 Ensifer sp. Root1298 Isolate Unclassified
114 2643221680 Ensifer sp. Root1312 Isolate Unclassified
115 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
116 2643221683 Variovorax sp. Root473 Isolate Unclassified
117 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
118 2643221688 Rhizobium sp. Root482 Isolate Unclassified
119 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
120 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
121 2643221696 Nocardioides sp. Root140 Isolate Unclassified
122 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
123 2643221698 Ensifer sp. Root142 Isolate Unclassified
124 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
125 2643221712 Ensifer sp. Root258 Isolate Unclassified
126 2643221714 Streptomyces sp. Root264 Isolate Unclassified
127 2643221717 Acidovorax sp. Root267 Isolate Unclassified
128 2643221723 Ensifer sp. Root278 Isolate Unclassified
129 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
130 2643221726 Ensifer sp. Root954 Isolate Unclassified
131 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
132 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
133 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
134 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
135 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
136 2684623036 Frankia sp. CgIM4 Isolate Nodule
137 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
138 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
139 2710264753 Frankia sp. KB5 Isolate Nodule
140 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
141 2738541277 Variovorax sp. GV051 Isolate Unclassified
142 2738541293 Rhizobium sp. GV031 Isolate Unclassified
143 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
144 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
145 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
146 2738541307 Variovorax sp. GV008 Isolate Unclassified
147 2738541337 Pelomonas sp. BT06 Isolate Unclassified
148 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
149 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
150 2738543012 Acidovorax sp. CF301 Isolate Unclassified
151 2738543013 Variovorax sp. BT01 Isolate Unclassified
152 2738543019 Variovorax sp. GV040 Isolate Unclassified
153 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
154 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
155 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
156 2739367653 Kocuria sp. OV113 Isolate Unclassified
157 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
158 2739367898 Nocardioides sp. CF479 Isolate Unclassified
159 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
160 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
161 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
162 2773857759 Microbacterium sp. 1294 Isolate Unclassified
163 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
164 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
165 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
166 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
167 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
168 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
169 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
170 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
171 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
172 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
173 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
174 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
175 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
176 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
177 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
178 2808606372 Agromyces sp. 23-23 Isolate Unclassified
179 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
180 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
181 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
182 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
183 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
184 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
185 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
186 2816332133 Acidovorax radicis 2721A Isolate Unclassified
187 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
188 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
189 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
190 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
191 2818991435 Caulobacter henricii 536 Isolate Unclassified
192 2818991446 Variovorax sp. 1180 Isolate Unclassified
193 2818991450 Burkholderia sp. 604 Isolate Unclassified
194 2818991452 Burkholderia cepacia 561 Isolate Unclassified
195 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
196 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
197 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
198 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
199 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
200 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
201 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
202 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
203 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
204 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
205 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
206 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
207 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
208 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
209 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
210 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
211 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
212 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
213 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
214 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
215 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
216 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
217 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
218 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
219 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
220 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
221 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
222 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
223 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
224 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
225 2842677519 Variovorax sp. R-72495 Isolate Unclassified
226 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
227 2842747753 Variovorax sp. R-72060 Isolate Unclassified
228 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
229 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
230 2844163670 Ensifer sp. 1H6 Isolate Unclassified
231 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
232 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
233 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
234 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
235 2849560528 Caulobacter zeae 410 Isolate Unclassified
236 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
237 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
238 2851153111 Caulobacter radicis 736 Isolate Unclassified
239 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
240 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
241 2855730933 Achromobacter sp. HZ28 Isolate Nodule
242 2855767633 Achromobacter sp. HZ34 Isolate Nodule
243 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
244 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
245 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
246 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
247 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
248 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
249 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
250 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
251 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
252 2857727296 Kocuria sp. R-72562 Isolate Unclassified
253 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
254 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
255 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
256 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
257 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
258 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
259 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
260 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
261 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
262 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
263 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
264 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
265 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
266 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
267 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
268 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
269 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
270 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
271 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
272 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
273 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
274 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
275 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
276 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
277 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
278 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
279 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
280 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
281 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
282 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
283 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
284 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
285 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
286 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
287 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
288 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
289 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
290 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
291 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
292 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
293 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
294 2899924645 Variovorax sp. 369 Isolate Unclassified
295 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
296 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
297 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
298 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
299 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
300 2904456579 Variovorax sp. 2002 Isolate Unclassified
301 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
302 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
303 2904564687 Burkholderia sp. 571 Isolate Unclassified
304 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
305 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
306 2904699407
307 2906610324
308 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
309 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
310 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
311 2909042592 Labrys sp. LIt4 Isolate Nodule
312 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
313 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
314 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
315 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
316 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
317 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
318 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
319 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
320 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
321 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
322 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
323 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
324 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
325 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
326 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
327 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
328 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
329 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
330 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
331 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
332 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
333 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
334 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
335 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
336 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
337 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
338 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
339 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
340 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
341 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
342 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
343 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
344 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
345 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
346 2922368715
347 2922425934
348 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
349 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
350 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
351 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
352 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
353 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
354 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
355 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
356 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
357 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
358 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
359 2928037797 Variovorax sp. 1126 Isolate Unclassified
360 2928044640 Variovorax sp. 1128 Isolate Unclassified
361 2928051484 Variovorax sp. 1133 Isolate Unclassified
362 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
363 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
364 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
365 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
366 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
367 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
368 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
369 2928163908 Burkholderia sp. 567 Isolate Unclassified
370 2928170801 Burkholderia sp. 572 Isolate Unclassified
371 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
372 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
373 2928536128 Burkholderia sola 565 Isolate Unclassified
374 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
375 2929520902 Variovorax beijingensis 502 Isolate Unclassified
376 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
377 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
378 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
379 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
380 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
381 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
382 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
383 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
384 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
385 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
386 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
387 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
388 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
389 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
390 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
391 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
392 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
393 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
394 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
395 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
396 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
397 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
398 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
399 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
400 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
401 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
402 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
403 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
404 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
405 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
406 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
407 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
408 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
409 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
410 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
411 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
412 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
413 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
414 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
415 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
416 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
417 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
418 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
419 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
420 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
421 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
422 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
423 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
424 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
425 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
426 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
427 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
428 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
429 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
430 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
431 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
432 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
433 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
434 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
435 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
436 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
437 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
438 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
439 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
440 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
441 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
442 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
443 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
444 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
445 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
446 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
447 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
448 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
449 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
450 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
451 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
452 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
453 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
454 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
455 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
456 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
457 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
458 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
459 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
460 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
461 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
462 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
463 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
464 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
465 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
466 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
467 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
468 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
469 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
470 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
471 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
472 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
473 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
474 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
475 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
476 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
477 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
478 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
479 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
480 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
481 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
482 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
483 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
484 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
485 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
486 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
487 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
488 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
489 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
490 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
491 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
492 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
493 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
494 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
495 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
496 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
497 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
498 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
499 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
500 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
501 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
502 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
503 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
504 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
505 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
506 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
507 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
508 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
509 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
510 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
511 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
512 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
513 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
514 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
515 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
516 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
517 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
518 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
519 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
520 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
521 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
522 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
523 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
524 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
525 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
526 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
527 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
528 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
529 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
530 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
531 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
532 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
533 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
534 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
535 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
536 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
537 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
538 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
539 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
540 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
541 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
542 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
543 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
544 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
545 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
546 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
547 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
548 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
549 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
550 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
551 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
552 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
553 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
554 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
555 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
556 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
557 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
558 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
559 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
560 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
561 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
562 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
563 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
564 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
565 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
566 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
567 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
568 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
569 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
570 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
571 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
572 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
573 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
574 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
575 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
576 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
577 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
578 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
579 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
580 2996887358 Rhizobium sp. R711 Isolate Nodule
581 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
582 3004167301 Mesorhizobium loti 582 Isolate Unclassified
583 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
584 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
585 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
586 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
587 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
588 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
589 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
590 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
591 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
592 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
593 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
594 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
595 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
596 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
597 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
598 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
599 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
600 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
601 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
602 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
603 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
604 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
605 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
606 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
607 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
608 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
609 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
610 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
611 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
612 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
613 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
614 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
615 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
616 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
617 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
618 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
619 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
620 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
621 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
622 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
623 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
624 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
625 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
626 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
627 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
628 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
629 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
630 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
631 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
632 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
633 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
634 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
635 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
636 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
637 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
638 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
639 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
640 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
641 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
642 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
643 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
644 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
645 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
646 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
647 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
648 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
649 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
650 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
651 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
652 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
653 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
654 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
655 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
656 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
657 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
658 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
659 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
660 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
661 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
662 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
663 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
664 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
665 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
666 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
667 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
668 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
669 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
670 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
671 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
672 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
673 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
674 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
675 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
676 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
677 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
678 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
679 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
680 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
681 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
682 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
683 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
684 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
685 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
686 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
687 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
688 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
689 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
690 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
691 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
692 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
693 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
694 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
695 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
696 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
697 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
698 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
699 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
700 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
701 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
702 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
703 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
704 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
705 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
706 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
707 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
708 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
709 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
710 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
711 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
712 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
713 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
714 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
715 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
716 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
717 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
718 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
719 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
720 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
721 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
722 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
723 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
724 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
725 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
726 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
727 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
728 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
729 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
730 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
731 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
732 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
733 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
734 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
735 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
736 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
737 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
738 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
739 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
740 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
741 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
742 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
743 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
744 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
745 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
746 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
747 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
748 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
749 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
750 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
751 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
752 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
753 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
754 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
755 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
756 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
757 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
758 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
759 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
760 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
761 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
762 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
763 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
764 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
765 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
766 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
767 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
768 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
769 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
770 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
771 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
772 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
773 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
774 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
775 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
776 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
777 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
778 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
779 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
780 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
781 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
782 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
783 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
784 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
785 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
786 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
787 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
788 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
789 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
790 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
791 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
792 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
793 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
794 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
795 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
796 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
797 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
798 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
799 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
800 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
801 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
802 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
803 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
804 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
805 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
806 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
807 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
808 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
809 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
810 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
811 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
812 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
813 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
814 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
815 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
816 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
817 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
818 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
819 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
820 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
821 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
822 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
823 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
824 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
825 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
826 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
827 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
828 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
829 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
830 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
831 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
832 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
833 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
834 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
835 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
836 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
837 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
838 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
839 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
840 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
841 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
842 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
843 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
844 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
845 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
846 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
847 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
848 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
849 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
850 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
851 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
852 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
853 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
854 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
855 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
856 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
857 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
858 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
859 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
860 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
861 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
862 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
863 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
864 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
865 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
866 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
867 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
868 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
869 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
870 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
871 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
872 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
873 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
874 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
875 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
876 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
877 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
878 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
879 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
880 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
881 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
882 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
883 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
884 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
885 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
886 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
887 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
888 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
889 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
890 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
891 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
892 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
893 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
894 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
895 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
896 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
897 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
898 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
899 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
900 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
901 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
902 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
903 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
904 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
905 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
906 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
907 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
908 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
909 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
910 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
911 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
912 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
913 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
914 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
915 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
916 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
917 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
918 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
919 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
920 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
921 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
922 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
923 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
924 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
925 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
926 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
927 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
928 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
929 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
930 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
931 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
932 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
933 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
934 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
935 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
936 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
937 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
938 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
939 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
940 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
941 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
942 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
943 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
944 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
945 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
946 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
947 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
948 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
949 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
950 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
951 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
952 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
953 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
954 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
955 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
956 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
957 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
958 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
959 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
960 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
961 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
962 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
963 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
964 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
965 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
966 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
967 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
968 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
969 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
970 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
971 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
972 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
973 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
974 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
975 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
976 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
977 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
978 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
979 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
980 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
981 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
982 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
983 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
984 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
985 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
986 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
987 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
988 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
989 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
990 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
991 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
992 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
993 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
994 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
995 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
996 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
997 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
998 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
999 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1000 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1001 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1002 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1003 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1004 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1005 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1006 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1007 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1008 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1009 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1010 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1011 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1012 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1013 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1014 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1015 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1016 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1017 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1018 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1019 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1020 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1021 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1022 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1023 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1024 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1025 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1026 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1027 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1028 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1029 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1030 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1031 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1032 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1033 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1034 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1035 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1036 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1037 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1038 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1039 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1040 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1041 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1042 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1043 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1044 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1045 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1046 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1047 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1048 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1049 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1050 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1051 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1052 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1053 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1054 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1055 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1056 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1057 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1058 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1059 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1060 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1061 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1062 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1063 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1064 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1065 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1066 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1067 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1068 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1069 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1070 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1071 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1072 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1073 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1074 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1075 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1076 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1077 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1078 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1079 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1080 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1081 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1082 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1083 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1084 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1085 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1086 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1087 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1088 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1089 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1090 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
1091 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1092 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1093 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1094 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1095 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1096 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1097 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1098 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1099 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1104 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1106 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1107 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1110 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1111 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1113 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1114 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
1115 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1116 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1117 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1118 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1119 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
1120 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1121 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1122 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1123 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1124 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1125 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1126 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1131 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1132 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1138 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1139 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
1140 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
1141 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1142 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1143 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
1144 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
1145 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1146 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1147 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
1148 8005258706 Rhizobium sp. R693 Isolate Nodule
1149 8005321885 Rhizobium sp. R72 Isolate Nodule
1150 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1151 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1152 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1153 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
1154 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1155 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1156 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1157 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1158 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1159 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1160 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1161 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1162 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1163 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1164 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1165 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1166 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1167 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1168 8018176218 Rhizobium sp. N122 Isolate Nodule
1169 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
1170 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1171 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1172 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1173 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1174 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1175 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1176 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1177 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1178 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1179 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1180 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1181 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
1182 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
1183 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
1184 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
1185 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
1186 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
1187 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
1188 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
1189 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1190 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
1191 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
1192 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
1193 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1194 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
1195 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1196 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.25
Metatranscriptomes 0.23
Isolates 29.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 12.82
Nodule 17.15
Rhizoplane 3.64
Rhizosphere 52.6
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000834 3300001915 Bacteria 9275
2 JGI24740J21852_10002020 3300001979 Bacteria 9279
3 JGI24740J21852_10002025 3300001979 Bacteria 9271
4 JGI24740J21852_10005408 3300001979 Bacteria 5406
5 JGI24739J22299_10002379 3300001989 Bacteria 7254
6 JGI24735J21928_10001288 3300002067 Bacteria 8898
7 JGI25155J39150_1000064 3300002704 Bacteria 69949
8 JGI25156J39149_1000085 3300002705 Bacteria 69953
9 JGI25156J39149_1000327 3300002705 Bacteria 31279
10 JGI25154J39366_1000112 3300002738 Bacteria 69961
11 JGI25158J39367_1002906 3300002739 Bacteria 2708
12 JGI25157J39369_1000109 3300002741 Bacteria 69961
13 JGI25152J39213_1001187 3300002773 Bacteria 11980
14 JGI25152J39213_1003929 3300002773 Bacteria 4871
15 JGI25150J39212_1002997 3300002774 Bacteria 4062
16 JGI25159J45721_1000075 3300002987 Bacteria 47795
17 JGI25159J45721_1000246 3300002987 Bacteria 25617
18 JGI25159J45721_1000672 3300002987 Bacteria 15094
19 JGI25159J45721_1008005 3300002987 Bacteria 2957
20 JGI25151J46595_10001019 3300003187 Bacteria 21035
21 JGI25151J46595_10004632 3300003187 Bacteria 7236
22 JGI25151J46595_10008365 3300003187 Bacteria 4982
23 JGI25406J46586_10000038 3300003203 Bacteria 59759
24 JGI25406J46586_10013251 3300003203 Bacteria 3550
25 JGI25406J46586_10013287 3300003203 Bacteria 3542
26 JGI25153J46596_10004138 3300003215 Bacteria 7886
27 JGI25153J46596_10006260 3300003215 Bacteria 6084
28 JGI25153J46596_10016966 3300003215 Bacteria 2889
29 JGI25160J50197_1000073 3300003354 Bacteria 104247
30 JGI25160J50197_1000451 3300003354 Bacteria 25633
31 JGI25160J50197_1008868 3300003354 Bacteria 3784
32 JGI25160J50197_1013618 3300003354 Bacteria 2762
33 JGI25161J50226_1000077 3300003374 Bacteria 83588
34 JGI25161J50226_1003303 3300003374 Bacteria 3738
35 JGI25161J50226_1005007 3300003374 Bacteria 2663
36 JGI25161J50226_1005903 3300003374 Bacteria 2292
37 Ga0006562J51391_1081476 3300003578 Bacteria 4210
38 Ga0006562J51391_1087736 3300003578 Bacteria 4450
39 Ga0055539_1000645 3300003752 Bacteria 9292
40 Ga0055532_1000006 3300003758 Bacteria 451244
41 Ga0055525_1000004 3300003759 Bacteria 888039
42 Ga0055525_1000837 3300003759 Bacteria 9292
43 Ga0055535_1000004 3300003761 Bacteria 451244
44 Ga0055535_1000308 3300003761 Bacteria 49802
45 Ga0055542_1000036 3300003762 Bacteria 227346
46 Ga0055529_1000273 3300003763 Bacteria 61443
47 Ga0055529_1000539 3300003763 Bacteria 32431
48 Ga0055526_1001057 3300003771 Bacteria 20116
49 Ga0055526_1001658 3300003771 Bacteria 15627
50 Ga0055526_1010931 3300003771 Bacteria 4157
51 Ga0055526_1016079 3300003771 Bacteria 2956
52 Ga0055526_1026338 3300003771 Bacteria 1837
53 Ga0055537_1000286 3300003773 Bacteria 36111
54 Ga0055537_1000621 3300003773 Bacteria 19397
55 Ga0055537_1003681 3300003773 Bacteria 4642
56 Ga0055524_1000294 3300003775 Bacteria 48038
57 Ga0055524_1000344 3300003775 Bacteria 42440
58 Ga0055524_1001108 3300003775 Bacteria 16289
59 Ga0055524_1003409 3300003775 Bacteria 7722
60 Ga0055524_1004948 3300003775 Bacteria 6041
61 Ga0055524_1013468 3300003775 Bacteria 3082
62 Ga0055536_1000700 3300003781 Bacteria 22454
63 Ga0055534_1000413 3300003784 Bacteria 26032
64 Ga0055534_1005181 3300003784 Bacteria 3567
65 Ga0055530_10000853 3300003791 Bacteria 25164
66 Ga0055530_10000981 3300003791 Bacteria 22980
67 Ga0055530_10009711 3300003791 Bacteria 3657
68 Ga0055540_1000028 3300003792 Bacteria 184864
69 Ga0055540_1000139 3300003792 Bacteria 72664
70 Ga0055540_1013518 3300003792 Bacteria 2489
71 Ga0055531_10000393 3300003794 Bacteria 42247
72 Ga0055531_10000440 3300003794 Bacteria 39086
73 Ga0055531_10000717 3300003794 Bacteria 28240
74 Ga0055531_10005930 3300003794 Bacteria 7027
75 Ga0055531_10007154 3300003794 Bacteria 6153
76 Ga0055531_10008527 3300003794 Bacteria 5383
77 Ga0055531_10019798 3300003794 Bacteria 2701
78 Ga0055543_1000629 3300004625 Bacteria 18923
79 Ga0055543_1001603 3300004625 Bacteria 8685
80 Ga0065165_1000081 3300005262 Bacteria 158849
81 Ga0065165_1000198 3300005262 Bacteria 104285
82 Ga0065165_1000289 3300005262 Bacteria 85848
83 Ga0065165_1001190 3300005262 Bacteria 30067
84 Ga0065165_1001706 3300005262 Bacteria 22057
85 Ga0065165_1002138 3300005262 Bacteria 17933
86 Ga0065165_1008159 3300005262 Bacteria 4977
87 Ga0065714_10009699 3300005288 Bacteria 4362
88 Ga0065715_10144125 3300005293 Bacteria 1812
89 Ga0070658_10001297 3300005327 Bacteria 21337
90 Ga0070658_10019632 3300005327 Bacteria 5411
91 Ga0070658_10081232 3300005327 Bacteria 2662
92 Ga0070683_100002520 3300005329 Bacteria 14596
93 Ga0070683_100010112 3300005329 Bacteria 8094
94 Ga0070690_100005241 3300005330 Bacteria 7265
95 Ga0070670_100004996 3300005331 Bacteria 11158
96 Ga0068869_100035862 3300005334 Bacteria 3518
97 Ga0070666_10000934 3300005335 Bacteria 17757
98 Ga0070666_10019991 3300005335 Bacteria 4327
99 Ga0070682_100010975 3300005337 Bacteria 5163
100 Ga0068868_100000761 3300005338 Bacteria 21829
101 Ga0068868_100001788 3300005338 Bacteria 14746
102 Ga0068868_100056123 3300005338 Bacteria 3109
103 Ga0068868_100154722 3300005338 Bacteria 1890
104 Ga0070660_100000277 3300005339 Bacteria 34197
105 Ga0070660_100003674 3300005339 Bacteria 10596
106 Ga0070660_100051219 3300005339 Bacteria 3179
107 Ga0070660_100092472 3300005339 Bacteria 2388
108 Ga0070660_100142088 3300005339 Bacteria 1926
109 Ga0070687_100001183 3300005343 Bacteria 9042
110 Ga0070661_100004670 3300005344 Bacteria 9433
111 Ga0070661_100009592 3300005344 Bacteria 6705
112 Ga0070661_100031498 3300005344 Bacteria 3837
113 Ga0070668_100046300 3300005347 Bacteria 3339
114 Ga0070669_100036550 3300005353 Bacteria 3559
115 Ga0070675_100000783 3300005354 Bacteria 22262
116 Ga0070671_100011241 3300005355 Bacteria 7191
117 Ga0070671_100064802 3300005355 Bacteria 3043
118 Ga0070671_100106772 3300005355 Bacteria 2351
119 Ga0070674_100036475 3300005356 Bacteria 3301
120 Ga0070674_100127978 3300005356 Bacteria 1889
121 Ga0070673_100009622 3300005364 Bacteria 6499
122 Ga0070688_100050598 3300005365 Bacteria 2589
123 Ga0070659_100000616 3300005366 Bacteria 26101
124 Ga0070659_100000738 3300005366 Bacteria 23779
125 Ga0070659_100049370 3300005366 Bacteria 3308
126 Ga0070667_100002525 3300005367 Bacteria 15955
127 Ga0070667_100055714 3300005367 Bacteria 3338
128 Ga0070709_10023418 3300005434 Bacteria 3626
129 Ga0070714_100002055 3300005435 Bacteria 14750
130 Ga0070714_100024992 3300005435 Bacteria 4925
131 Ga0070714_100027807 3300005435 Bacteria 4685
132 Ga0070714_100034976 3300005435 Bacteria 4208
133 Ga0070714_100038399 3300005435 Bacteria 4025
134 Ga0070714_100049920 3300005435 Bacteria 3562
135 Ga0070714_100082076 3300005435 Bacteria 2808
136 Ga0070713_100000093 3300005436 Bacteria 57164
137 Ga0070713_100003848 3300005436 Bacteria 9939
138 Ga0070713_100073880 3300005436 Bacteria 2887
139 Ga0070710_10028988 3300005437 Bacteria 2966
140 Ga0070701_10013032 3300005438 Bacteria 3772
141 Ga0070711_100070951 3300005439 Bacteria 2454
142 Ga0070705_100055992 3300005440 Bacteria 2320
143 Ga0070700_100009093 3300005441 Bacteria 5444
144 Ga0070700_100010228 3300005441 Bacteria 5175
145 Ga0070694_100097834 3300005444 Bacteria 2071
146 Ga0070708_100035997 3300005445 Bacteria 4316
147 Ga0070708_100046848 3300005445 Bacteria 3817
148 Ga0070663_100000239 3300005455 Bacteria 27754
149 Ga0070663_100003172 3300005455 Bacteria 9436
150 Ga0070663_100005073 3300005455 Bacteria 7783
151 Ga0070663_100006029 3300005455 Bacteria 7256
152 Ga0070663_100013477 3300005455 Bacteria 5216
153 Ga0070678_100004435 3300005456 Bacteria 7966
154 Ga0070678_100022120 3300005456 Bacteria 4205
155 Ga0070662_100001899 3300005457 Bacteria 12825
156 Ga0070681_10010220 3300005458 Bacteria 9258
157 Ga0070681_10012720 3300005458 Bacteria 8354
158 Ga0070681_10042524 3300005458 Bacteria 4553
159 Ga0070681_10075162 3300005458 Bacteria 3338
160 Ga0070681_10150280 3300005458 Bacteria 2256
161 Ga0070681_10171566 3300005458 Bacteria 2091
162 Ga0068867_100004111 3300005459 Bacteria 10218
163 Ga0068867_100005090 3300005459 Bacteria 9290
164 Ga0070706_100000369 3300005467 Bacteria 54197
165 Ga0070706_100004243 3300005467 Bacteria 13910
166 Ga0070706_100004591 3300005467 Bacteria 13254
167 Ga0070706_100024617 3300005467 Bacteria 5542
168 Ga0070706_100041253 3300005467 Bacteria 4261
169 Ga0070707_100001417 3300005468 Bacteria 23529
170 Ga0070707_100005118 3300005468 Bacteria 12293
171 Ga0070707_100106642 3300005468 Bacteria 2717
172 Ga0070698_100002589 3300005471 Bacteria 19918
173 Ga0070698_100013970 3300005471 Bacteria 8492
174 Ga0070698_100017687 3300005471 Bacteria 7508
175 Ga0070698_100033831 3300005471 Bacteria 5295
176 Ga0070698_100038577 3300005471 Bacteria 4921
177 Ga0070698_100041887 3300005471 Bacteria 4700
178 Ga0070698_100048036 3300005471 Bacteria 4361
179 Ga0070698_100053249 3300005471 Bacteria 4113
180 Ga0070698_100053959 3300005471 Bacteria 4083
181 Ga0070699_100000775 3300005518 Bacteria 29508
182 Ga0070699_100022285 3300005518 Bacteria 5458
183 Ga0070699_100039502 3300005518 Bacteria 4085
184 Ga0070699_100061063 3300005518 Bacteria 3267
185 Ga0070699_100091366 3300005518 Bacteria 2661
186 Ga0070679_100010473 3300005530 Bacteria 8796
187 Ga0070679_100020760 3300005530 Bacteria 6407
188 Ga0070679_100038055 3300005530 Bacteria 4781
189 Ga0070679_100055349 3300005530 Bacteria 3950
190 Ga0070684_100003247 3300005535 Bacteria 12170
191 Ga0070684_100026787 3300005535 Bacteria 4859
192 Ga0070684_100106450 3300005535 Bacteria 2511
193 Ga0070697_100006226 3300005536 Bacteria 9240
194 Ga0070697_100051710 3300005536 Bacteria 3339
195 Ga0068853_100004240 3300005539 Bacteria 11071
196 Ga0068853_100095410 3300005539 Bacteria 2623
197 Ga0070672_100014412 3300005543 Bacteria 5602
198 Ga0070672_100018023 3300005543 Bacteria 5096
199 Ga0070672_100100681 3300005543 Bacteria 2344
200 Ga0070686_100004762 3300005544 Bacteria 7486
201 Ga0070686_100044593 3300005544 Bacteria 2789
202 Ga0070686_100061849 3300005544 Bacteria 2420
203 Ga0070686_100126171 3300005544 Bacteria 1764
204 Ga0070695_100010900 3300005545 Bacteria 5431
205 Ga0070695_100015945 3300005545 Bacteria 4542
206 Ga0070696_100012095 3300005546 Bacteria 5783
207 Ga0070696_100067165 3300005546 Bacteria 2516
208 Ga0070665_100004574 3300005548 Bacteria 14484
209 Ga0070665_100008438 3300005548 Bacteria 10422
210 Ga0070665_100021746 3300005548 Bacteria 6449
211 Ga0070665_100038984 3300005548 Bacteria 4777
212 Ga0070665_100133251 3300005548 Bacteria 2487
213 Ga0068855_100000104 3300005563 Bacteria 104587
214 Ga0068855_100001097 3300005563 Bacteria 33624
215 Ga0068855_100022771 3300005563 Bacteria 7508
216 Ga0068855_100023215 3300005563 Bacteria 7431
217 Ga0068855_100037776 3300005563 Bacteria 5740
218 Ga0068855_100070225 3300005563 Bacteria 4075
219 Ga0070664_100000712 3300005564 Bacteria 25469
220 Ga0070664_100003001 3300005564 Bacteria 13649
221 Ga0070664_100006480 3300005564 Bacteria 9436
222 Ga0070664_100010765 3300005564 Bacteria 7416
223 Ga0070664_100020858 3300005564 Bacteria 5398
224 Ga0070664_100028614 3300005564 Bacteria 4638
225 Ga0068857_100145432 3300005577 Bacteria 2145
226 Ga0068854_100005268 3300005578 Bacteria 8161
227 Ga0068854_100016111 3300005578 Bacteria 4972
228 Ga0068856_100003602 3300005614 Bacteria 15590
229 Ga0068856_100004835 3300005614 Bacteria 13357
230 Ga0068856_100005726 3300005614 Bacteria 12242
231 Ga0068856_100009539 3300005614 Bacteria 9431
232 Ga0068856_100024791 3300005614 Bacteria 5842
233 Ga0068856_100048274 3300005614 Bacteria 4194
234 Ga0070702_100000150 3300005615 Bacteria 21785
235 Ga0068852_100022892 3300005616 Bacteria 5019
236 Ga0068852_100026749 3300005616 Bacteria 4695
237 Ga0068859_100011261 3300005617 Bacteria 9000
238 Ga0068859_100139880 3300005617 Bacteria 2494
239 Ga0068864_100000022 3300005618 Bacteria 261941
240 Ga0068864_100017222 3300005618 Bacteria 6026
241 Ga0068864_100025538 3300005618 Bacteria 4977
242 Ga0068864_100052232 3300005618 Bacteria 3522
243 Ga0068866_10006202 3300005718 Bacteria 4976
244 Ga0068866_10006888 3300005718 Bacteria 4747
245 Ga0068861_100118575 3300005719 Bacteria 2132
246 Ga0068851_10026514 3300005834 Bacteria 2848
247 Ga0068863_100002456 3300005841 Bacteria 18419
248 Ga0068863_100051325 3300005841 Bacteria 3909
249 Ga0068858_100045219 3300005842 Bacteria 4079
250 Ga0068858_100109774 3300005842 Bacteria 2575
251 Ga0068860_100000253 3300005843 Bacteria 79802
252 Ga0068860_100000738 3300005843 Bacteria 37292
253 Ga0068860_100017416 3300005843 Bacteria 7000
254 Ga0068860_100031234 3300005843 Bacteria 5121
255 Ga0068860_100041225 3300005843 Bacteria 4410
256 Ga0068860_100049570 3300005843 Bacteria 3999
257 Ga0068860_100077969 3300005843 Bacteria 3151
258 Ga0068860_100226450 3300005843 Bacteria 1816
259 Ga0068862_100000492 3300005844 Bacteria 42127
260 Ga0068862_100026901 3300005844 Bacteria 4838
261 Ga0068862_100140068 3300005844 Bacteria 2146
262 Ga0081455_10000525 3300005937 Bacteria 49722
263 Ga0081455_10001075 3300005937 Bacteria 34374
264 Ga0081455_10001410 3300005937 Bacteria 29737
265 Ga0081538_10001281 3300005981 Bacteria 26128
266 Ga0081538_10001832 3300005981 Bacteria 21423
267 Ga0081538_10003883 3300005981 Bacteria 13958
268 Ga0081538_10015080 3300005981 Bacteria 6005
269 Ga0081540_1006873 3300005983 Bacteria 8210
270 Ga0081540_1012947 3300005983 Bacteria 5450
271 Ga0081540_1029910 3300005983 Bacteria 3026
272 Ga0081539_10000080 3300005985 Bacteria 222745
273 Ga0081539_10000720 3300005985 Bacteria 66266
274 Ga0081539_10000917 3300005985 Bacteria 55614
275 Ga0081539_10001055 3300005985 Bacteria 50436
276 Ga0081539_10002418 3300005985 Bacteria 26381
277 Ga0081539_10002997 3300005985 Bacteria 22067
278 Ga0081539_10004249 3300005985 Bacteria 16077
279 Ga0081539_10011542 3300005985 Bacteria 6967
280 Ga0081539_10014676 3300005985 Bacteria 5766
281 Ga0070717_10002063 3300006028 Bacteria 14061
282 Ga0070717_10013078 3300006028 Bacteria 6342
283 Ga0070717_10034110 3300006028 Bacteria 4111
284 Ga0075365_10004340 3300006038 Bacteria 7491
285 Ga0075365_10005337 3300006038 Bacteria 6920
286 Ga0075365_10116084 3300006038 Bacteria 1843
287 Ga0075368_10010447 3300006042 Bacteria 3355
288 Ga0075363_100006026 3300006048 Bacteria 5464
289 Ga0075364_10000557 3300006051 Bacteria 19122
290 Ga0075364_10039185 3300006051 Bacteria 3071
291 Ga0075364_10075295 3300006051 Bacteria 2227
292 Ga0070715_10004225 3300006163 Bacteria 4685
293 Ga0070715_10007253 3300006163 Bacteria 3812
294 Ga0070716_100021983 3300006173 Bacteria 3367
295 Ga0070712_100049698 3300006175 Bacteria 2913
296 Ga0075362_10005886 3300006177 Bacteria 4526
297 Ga0075367_10002592 3300006178 Bacteria 8305
298 Ga0075366_10044974 3300006195 Bacteria 2617
299 Ga0097621_100015779 3300006237 Bacteria 5694
300 Ga0075370_10004866 3300006353 Bacteria 6587
301 Ga0075370_10010108 3300006353 Bacteria 4922
302 Ga0075370_10068181 3300006353 Bacteria 2031
303 Ga0075370_10070139 3300006353 Bacteria 2004
304 Ga0068871_100007963 3300006358 Bacteria 7601
305 Ga0068871_100011189 3300006358 Bacteria 6576
306 Ga0068871_100013192 3300006358 Bacteria 6128
307 Ga0075428_100002475 3300006844 Bacteria 20049
308 Ga0075428_100003558 3300006844 Bacteria 17062
309 Ga0075428_100015422 3300006844 Bacteria 8470
310 Ga0075428_100029340 3300006844 Bacteria 6086
311 Ga0075430_100008937 3300006846 Bacteria 8460
312 Ga0075430_100045091 3300006846 Bacteria 3726
313 Ga0075430_100067230 3300006846 Bacteria 3009
314 Ga0075431_100017790 3300006847 Bacteria 7226
315 Ga0075431_100163836 3300006847 Bacteria 2286
316 Ga0075433_10003619 3300006852 Bacteria 11940
317 Ga0075433_10025485 3300006852 Bacteria 5000
318 Ga0075433_10065998 3300006852 Bacteria 3174
319 Ga0075434_100000003 3300006871 Bacteria 134839
320 Ga0075434_100002400 3300006871 Bacteria 16442
321 Ga0075434_100096958 3300006871 Bacteria 2953
322 Ga0075434_100104246 3300006871 Bacteria 2845
323 Ga0075429_100030646 3300006880 Bacteria 4672
324 Ga0075429_100040012 3300006880 Bacteria 4080
325 Ga0075429_100045029 3300006880 Bacteria 3839
326 Ga0068865_100007151 3300006881 Bacteria 6855
327 Ga0068865_100014246 3300006881 Bacteria 5049
328 Ga0068865_100018710 3300006881 Bacteria 4474
329 Ga0075436_100004352 3300006914 Bacteria 9719
330 Ga0075436_100012300 3300006914 Bacteria 5863
331 Ga0075436_100058444 3300006914 Bacteria 2663
332 Ga0097620_100011261 3300006931 Bacteria 9000
333 Ga0097620_100139876 3300006931 Bacteria 2494
334 Ga0099823_1000051 3300006944 Bacteria 57175
335 Ga0079104_1000058 3300006946 Bacteria 165039
336 Ga0079104_1010357 3300006946 Bacteria 3077
337 Ga0079104_1014509 3300006946 Bacteria 2374
338 Ga0075435_100000265 3300007076 Bacteria 32624
339 Ga0075435_100006583 3300007076 Bacteria 8222
340 Ga0075435_100012648 3300007076 Bacteria 6253
341 Ga0075435_100014752 3300007076 Bacteria 5856
342 Ga0075435_100021661 3300007076 Bacteria 4947
343 Ga0099794_10000111 3300007265 Bacteria 29740
344 Ga0099795_10000018 3300007788 Bacteria 61029
345 Ga0105250_10000418 3300009092 Bacteria 31113
346 Ga0105250_10002429 3300009092 Bacteria 9361
347 Ga0105240_10001792 3300009093 Bacteria 36155
348 Ga0105240_10002741 3300009093 Bacteria 27878
349 Ga0105240_10116124 3300009093 Bacteria 3230
350 Ga0105240_10183917 3300009093 Bacteria 2464
351 Ga0105240_10199740 3300009093 Bacteria 2344
352 Ga0105240_10202053 3300009093 Bacteria 2328
353 Ga0111539_10000584 3300009094 Bacteria 47005
354 Ga0111539_10040746 3300009094 Bacteria 5589
355 Ga0111539_10051137 3300009094 Bacteria 4922
356 Ga0105245_10007925 3300009098 Bacteria 9289
357 Ga0105247_10049743 3300009101 Bacteria 2578
358 Ga0114129_10005124 3300009147 Bacteria 18449
359 Ga0114129_10142954 3300009147 Bacteria 3278
360 Ga0114129_10175477 3300009147 Bacteria 2919
361 Ga0105243_10002121 3300009148 Bacteria 16784
362 Ga0105243_10006862 3300009148 Bacteria 8777
363 Ga0105243_10087266 3300009148 Bacteria 2560
364 Ga0105241_10006534 3300009174 Bacteria 8593
365 Ga0105241_10018460 3300009174 Bacteria 5130
366 Ga0105242_10000242 3300009176 Bacteria 43023
367 Ga0105242_10007348 3300009176 Bacteria 8482
368 Ga0105242_10011026 3300009176 Bacteria 6943
369 Ga0105248_10003122 3300009177 Bacteria 18333
370 Ga0105248_10003925 3300009177 Bacteria 16439
371 Ga0105248_10235281 3300009177 Bacteria 2062
372 Ga0105237_10010949 3300009545 Bacteria 9624
373 Ga0105237_10019662 3300009545 Bacteria 6973
374 Ga0105237_10033777 3300009545 Bacteria 5182
375 Ga0105237_10102216 3300009545 Bacteria 2858
376 Ga0105238_10015030 3300009551 Bacteria 7838
377 Ga0105238_10049660 3300009551 Bacteria 4224
378 Ga0105249_10006840 3300009553 Bacteria 9943
379 Ga0105249_10113727 3300009553 Bacteria 2562
380 Ga0123342_1008310 3300009766 Bacteria 13149
381 Ga0099796_10000048 3300010159 Bacteria 22808
382 Ga0105239_10001197 3300010375 Eukaryota 35483
383 Ga0105239_10009133 3300010375 Bacteria 11213
384 Ga0105239_10021898 3300010375 Bacteria 7046
385 Ga0105246_10045437 3300011119 Bacteria 2990
386 Ga0157319_1000004 3300012497 Bacteria 394735
387 Ga0157373_10005110 3300013100 Bacteria 9862
388 Ga0157373_10007554 3300013100 Bacteria 8080
389 Ga0157373_10036275 3300013100 Bacteria 3540
390 Ga0157371_10000330 3300013102 Bacteria 61144
391 Ga0157371_10006672 3300013102 Bacteria 9442
392 Ga0157370_10000031 3300013104 Bacteria 139879
393 Ga0157370_10005558 3300013104 Bacteria 14131
394 Ga0157370_10017083 3300013104 Bacteria 7330
395 Ga0157370_10118328 3300013104 Bacteria 2475
396 Ga0157369_10000905 3300013105 Bacteria 37874
397 Ga0157369_10001415 3300013105 Bacteria 29510
398 Ga0157369_10003573 3300013105 Bacteria 18478
399 Ga0157369_10047479 3300013105 Bacteria 4661
400 Ga0171463_1002 3300013249 Bacteria 1274851
401 Ga0171462_1003 3300013250 Bacteria 853796
402 Ga0157374_10000012 3300013296 Bacteria 462353
403 Ga0157374_10000141 3300013296 Bacteria 65347
404 Ga0157374_10072501 3300013296 Bacteria 3249
405 Ga0157378_10002977 3300013297 Bacteria 15048
406 Ga0157378_10138858 3300013297 Bacteria 2255
407 Ga0163162_10241039 3300013306 Bacteria 1939
408 Ga0157372_10003374 3300013307 Bacteria 17228
409 Ga0157372_10013312 3300013307 Bacteria 8780
410 Ga0157372_10018145 3300013307 Bacteria 7565
411 Ga0157375_10000007 3300013308 Bacteria 377743
412 Ga0157375_10110400 3300013308 Bacteria 2848
413 Ga0163163_10009795 3300014325 Bacteria 8585
414 Ga0163163_10034114 3300014325 Bacteria 4926
415 Ga0157380_10042129 3300014326 Bacteria 3567
416 Ga0157377_10000002 3300014745 Bacteria 473827
417 Ga0157377_10000069 3300014745 Bacteria 80723
418 Ga0157377_10009663 3300014745 Bacteria 4744
419 Ga0157379_10005458 3300014968 Bacteria 10925
420 Ga0157379_10137126 3300014968 Bacteria 2205
421 Ga0157376_10000020 3300014969 Bacteria 246318
422 Ga0183362_10012 3300015683 Bacteria 49008
423 Ga0183362_10018 3300015683 Bacteria 25088
424 Ga0183363_1304 3300015690 Bacteria 6855
425 Ga0163161_10001893 3300017792 Bacteria 15281
426 Ga0163161_10033338 3300017792 Bacteria 3680
427 Ga0197907_11229304 3300020069 Eukaryota 1950
428 Ga0206351_10150708 3300020077 Eukaryota 1968
429 Ga0214544_1000646 3300021320 Bacteria 66087
430 Ga0214542_1000027 3300021321 Bacteria 175107
431 Ga0214543_1000025 3300021327 Bacteria 225351
432 Ga0214543_1000047 3300021327 Bacteria 150894
433 Ga0213873_10000002 3300021358 Bacteria 1164195
434 Ga0213872_10000031 3300021361 Bacteria 139321
435 Ga0213872_10000037 3300021361 Bacteria 125032
436 Ga0213872_10000107 3300021361 Bacteria 77234
437 Ga0213872_10000836 3300021361 Bacteria 22348
438 Ga0213872_10026117 3300021361 Bacteria 2683
439 Ga0213874_10002184 3300021377 Bacteria 4152
440 Ga0213876_10000001 3300021384 Bacteria 1186326
441 Ga0213876_10000063 3300021384 Bacteria 128550
442 Ga0213876_10036700 3300021384 Bacteria 2585
443 Ga0213875_10000001 3300021388 Bacteria 2793540
444 Ga0213875_10014263 3300021388 Bacteria 3880
445 Ga0224712_10025821 3300022467 Eukaryota 2069
446 Ga0228711_1021534 3300022739 Bacteria 5279
447 Ga0228710_1006811 3300022740 Bacteria 17155
448 Ga0209435_100002 3300025206 Bacteria 794178
449 Ga0209436_100108 3300025208 Bacteria 41289
450 Ga0209784_100006 3300025224 Bacteria 930704
451 Ga0209784_100597 3300025224 Bacteria 11909
452 Ga0209566_100002 3300025225 Bacteria 2614868
453 Ga0209566_100700 3300025225 Bacteria 19345
454 Ga0209566_101395 3300025225 Bacteria 7398
455 Ga0209674_100010 3300025226 Bacteria 1038638
456 Ga0209674_101858 3300025226 Bacteria 5000
457 Ga0209674_102689 3300025226 Bacteria 3660
458 Ga0209672_100020 3300025228 Bacteria 429003
459 Ga0209672_100145 3300025228 Bacteria 66093
460 Ga0209672_100390 3300025228 Bacteria 26529
461 Ga0209147_100015 3300025229 Bacteria 565073
462 Ga0209147_100024 3300025229 Bacteria 429003
463 Ga0209147_100201 3300025229 Bacteria 65943
464 Ga0209147_100256 3300025229 Bacteria 49622
465 Ga0209147_101035 3300025229 Bacteria 11855
466 Ga0209563_100004 3300025230 Bacteria 1814108
467 Ga0209563_100013 3300025230 Bacteria 941463
468 Ga0209258_100021 3300025242 Bacteria 565073
469 Ga0209258_100084 3300025242 Bacteria 244783
470 Ga0209258_100091 3300025242 Bacteria 227454
471 Ga0209258_100350 3300025242 Bacteria 66093
472 Ga0207425_1000036 3300025245 Bacteria 225783
473 Ga0207425_1000238 3300025245 Bacteria 42734
474 Ga0207425_1003268 3300025245 Bacteria 5280
475 Ga0207425_1005562 3300025245 Bacteria 3573
476 Ga0209646_1000001 3300025246 Bacteria 3092932
477 Ga0209026_1000121 3300025250 Bacteria 126801
478 Ga0209677_100007 3300025253 Bacteria 1021332
479 Ga0209677_103362 3300025253 Bacteria 5247
480 Ga0209148_1000033 3300025254 Bacteria 555508
481 Ga0209148_1000327 3300025254 Bacteria 65997
482 Ga0209148_1001409 3300025254 Bacteria 12349
483 Ga0209759_1000001 3300025256 Bacteria 2799452
484 Ga0209759_1000052 3300025256 Bacteria 213964
485 Ga0209129_1000062 3300025258 Bacteria 240655
486 Ga0209129_1001728 3300025258 Bacteria 11774
487 Ga0209129_1002948 3300025258 Bacteria 7777
488 Ga0209233_1001798 3300025261 Bacteria 8262
489 Ga0209565_1000016 3300025263 Bacteria 477707
490 Ga0209565_1000020 3300025263 Bacteria 432627
491 Ga0209565_1000141 3300025263 Bacteria 99867
492 Ga0209565_1002645 3300025263 Bacteria 6305
493 Ga0209565_1002766 3300025263 Bacteria 6080
494 Ga0209565_1003483 3300025263 Bacteria 5067
495 Ga0209565_1004056 3300025263 Bacteria 4565
496 Ga0209565_1004057 3300025263 Bacteria 4565
497 Ga0209565_1012570 3300025263 Bacteria 2015
498 Ga0209455_1000028 3300025272 Bacteria 565073
499 Ga0209455_1000248 3300025272 Bacteria 65943
500 Ga0209673_1000057 3300025273 Bacteria 270150
501 Ga0209673_1000072 3300025273 Bacteria 236935
502 Ga0209673_1000073 3300025273 Bacteria 233645
503 Ga0209673_1003353 3300025273 Bacteria 9563
504 Ga0209673_1003969 3300025273 Bacteria 8254
505 Ga0209673_1005102 3300025273 Bacteria 6739
506 Ga0209673_1005325 3300025273 Bacteria 6514
507 Ga0209673_1016859 3300025273 Bacteria 2715
508 Ga0209130_1000040 3300025284 Bacteria 262926
509 Ga0209130_1000153 3300025284 Bacteria 104299
510 Ga0209130_1000354 3300025284 Bacteria 52516
511 Ga0209130_1001487 3300025284 Bacteria 15232
512 Ga0209130_1004819 3300025284 Bacteria 4944
513 Ga0209675_1000014 3300025291 Bacteria 421902
514 Ga0209675_1000122 3300025291 Bacteria 106769
515 Ga0209675_1006650 3300025291 Bacteria 4595
516 Ga0209675_1012694 3300025291 Bacteria 2693
517 Ga0209676_1000088 3300025292 Bacteria 263010
518 Ga0209676_1000395 3300025292 Bacteria 79555
519 Ga0209676_1000420 3300025292 Bacteria 74714
520 Ga0209676_1000666 3300025292 Bacteria 49043
521 Ga0209676_1000931 3300025292 Bacteria 36157
522 Ga0209676_1028900 3300025292 Bacteria 1719
523 Ga0209025_1000019 3300025294 Bacteria 631548
524 Ga0209025_1000333 3300025294 Bacteria 104266
525 Ga0209025_1000694 3300025294 Bacteria 57446
526 Ga0209025_1001471 3300025294 Bacteria 30670
527 Ga0209025_1003349 3300025294 Bacteria 15378
528 Ga0209025_1004234 3300025294 Bacteria 12629
529 Ga0209025_1005849 3300025294 Bacteria 9838
530 Ga0209025_1013423 3300025294 Bacteria 5151
531 Ga0209025_1015598 3300025294 Bacteria 4562
532 Ga0209025_1016423 3300025294 Bacteria 4369
533 Ga0209025_1017124 3300025294 Bacteria 4211
534 Ga0209025_1024509 3300025294 Bacteria 3108
535 Ga0209564_1000008 3300025295 Bacteria 953227
536 Ga0209564_1000014 3300025295 Bacteria 621501
537 Ga0209564_1000280 3300025295 Bacteria 104429
538 Ga0209564_1001246 3300025295 Bacteria 28344
539 Ga0209564_1001716 3300025295 Bacteria 20589
540 Ga0209564_1001744 3300025295 Bacteria 20355
541 Ga0209564_1001751 3300025295 Bacteria 20266
542 Ga0209564_1002020 3300025295 Bacteria 17645
543 Ga0209564_1003797 3300025295 Bacteria 9803
544 Ga0209564_1012428 3300025295 Bacteria 3713
545 Ga0209564_1019034 3300025295 Bacteria 2585
546 Ga0209564_1019348 3300025295 Bacteria 2549
547 Ga0209758_1000021 3300025297 Bacteria 697691
548 Ga0209758_1000126 3300025297 Bacteria 189761
549 Ga0209758_1000129 3300025297 Bacteria 185022
550 Ga0209758_1001159 3300025297 Bacteria 33705
551 Ga0209758_1001994 3300025297 Bacteria 21994
552 Ga0209758_1002553 3300025297 Bacteria 18345
553 Ga0209758_1003114 3300025297 Bacteria 15668
554 Ga0209758_1003909 3300025297 Bacteria 12999
555 Ga0209758_1007220 3300025297 Bacteria 7646
556 Ga0209758_1009132 3300025297 Bacteria 6242
557 Ga0209758_1011179 3300025297 Bacteria 5238
558 Ga0209050_1000084 3300025298 Bacteria 263245
559 Ga0209050_1000110 3300025298 Bacteria 216664
560 Ga0209050_1000282 3300025298 Bacteria 108629
561 Ga0209050_1000447 3300025298 Bacteria 74743
562 Ga0209050_1000502 3300025298 Bacteria 66494
563 Ga0209050_1000852 3300025298 Bacteria 41567
564 Ga0209050_1002252 3300025298 Bacteria 17173
565 Ga0209050_1011864 3300025298 Bacteria 4072
566 Ga0209256_1000015 3300025299 Bacteria 622953
567 Ga0209256_1000064 3300025299 Bacteria 250853
568 Ga0209256_1000065 3300025299 Bacteria 248104
569 Ga0209256_1000223 3300025299 Bacteria 104801
570 Ga0209256_1000313 3300025299 Bacteria 84424
571 Ga0209256_1000811 3300025299 Bacteria 39987
572 Ga0209256_1001123 3300025299 Bacteria 30560
573 Ga0209256_1001124 3300025299 Bacteria 30526
574 Ga0209256_1002149 3300025299 Bacteria 17030
575 Ga0209256_1010626 3300025299 Bacteria 3823
576 Ga0207426_1000084 3300025302 Bacteria 298123
577 Ga0207426_1000124 3300025302 Bacteria 218145
578 Ga0207426_1000280 3300025302 Bacteria 104299
579 Ga0207426_1000359 3300025302 Bacteria 82359
580 Ga0207426_1001223 3300025302 Bacteria 22633
581 Ga0207426_1001336 3300025302 Bacteria 20936
582 Ga0207426_1001977 3300025302 Bacteria 14553
583 Ga0209051_1000022 3300025303 Bacteria 474879
584 Ga0209051_1000058 3300025303 Bacteria 263137
585 Ga0209051_1000069 3300025303 Bacteria 219208
586 Ga0209051_1000280 3300025303 Bacteria 83521
587 Ga0209051_1000285 3300025303 Bacteria 82429
588 Ga0209051_1000986 3300025303 Bacteria 27534
589 Ga0209051_1001259 3300025303 Bacteria 22635
590 Ga0209051_1002965 3300025303 Bacteria 11559
591 Ga0209257_1000016 3300025304 Bacteria 908015
592 Ga0209257_1000030 3300025304 Bacteria 689812
593 Ga0209257_1000087 3300025304 Bacteria 282503
594 Ga0209257_1000092 3300025304 Bacteria 263137
595 Ga0209257_1000093 3300025304 Bacteria 263088
596 Ga0209257_1000165 3300025304 Bacteria 172773
597 Ga0209257_1000417 3300025304 Bacteria 82249
598 Ga0209257_1000527 3300025304 Bacteria 66423
599 Ga0209257_1001027 3300025304 Bacteria 37515
600 Ga0209257_1002180 3300025304 Bacteria 20273
601 Ga0209257_1004584 3300025304 Bacteria 10552
602 Ga0209257_1007169 3300025304 Bacteria 6849
603 Ga0207696_1000147 3300025711 Bacteria 120603
604 Ga0207696_1001154 3300025711 Bacteria 15193
605 Ga0207655_1012876 3300025728 Bacteria 4845
606 Ga0207680_10059878 3300025903 Bacteria 2315
607 Ga0207647_10000264 3300025904 Bacteria 43118
608 Ga0207685_10001447 3300025905 Bacteria 4977
609 Ga0207699_10003289 3300025906 Bacteria 7703
610 Ga0207645_10005837 3300025907 Bacteria 8876
611 Ga0207645_10027593 3300025907 Bacteria 3665
612 Ga0207643_10035227 3300025908 Bacteria 2805
613 Ga0207643_10042854 3300025908 Bacteria 2552
614 Ga0207705_10000006 3300025909 Bacteria 657147
615 Ga0207705_10036568 3300025909 Bacteria 3513
616 Ga0207705_10058069 3300025909 Bacteria 2791
617 Ga0207684_10000077 3300025910 Bacteria 182957
618 Ga0207684_10022988 3300025910 Bacteria 5325
619 Ga0207684_10043948 3300025910 Bacteria 3788
620 Ga0207654_10012461 3300025911 Bacteria 4357
621 Ga0207707_10001948 3300025912 Bacteria 18787
622 Ga0207707_10002051 3300025912 Bacteria 18286
623 Ga0207707_10012301 3300025912 Bacteria 7438
624 Ga0207707_10029214 3300025912 Bacteria 4819
625 Ga0207707_10114941 3300025912 Bacteria 2352
626 Ga0207695_10005557 3300025913 Bacteria 16655
627 Ga0207695_10006723 3300025913 Bacteria 14842
628 Ga0207695_10009029 3300025913 Bacteria 12394
629 Ga0207695_10050782 3300025913 Bacteria 4360
630 Ga0207695_10087061 3300025913 Bacteria 3148
631 Ga0207695_10143712 3300025913 Bacteria 2332
632 Ga0207671_10009367 3300025914 Bacteria 8189
633 Ga0207693_10021947 3300025915 Bacteria 5075
634 Ga0207693_10030540 3300025915 Bacteria 4256
635 Ga0207693_10046133 3300025915 Bacteria 3423
636 Ga0207693_10055438 3300025915 Bacteria 3110
637 Ga0207663_10000963 3300025916 Bacteria 13168
638 Ga0207663_10101314 3300025916 Bacteria 1935
639 Ga0207662_10000110 3300025918 Bacteria 39525
640 Ga0207662_10021496 3300025918 Bacteria 3688
641 Ga0207657_10000003 3300025919 Bacteria 263148
642 Ga0207657_10000169 3300025919 Bacteria 66914
643 Ga0207657_10000745 3300025919 Bacteria 34547
644 Ga0207657_10000927 3300025919 Bacteria 31004
645 Ga0207657_10022126 3300025919 Bacteria 5965
646 Ga0207657_10032334 3300025919 Bacteria 4729
647 Ga0207657_10041878 3300025919 Bacteria 4045
648 Ga0207649_10002908 3300025920 Bacteria 9428
649 Ga0207649_10061573 3300025920 Bacteria 2363
650 Ga0207652_10002113 3300025921 Bacteria 17039
651 Ga0207652_10002264 3300025921 Bacteria 16327
652 Ga0207652_10007510 3300025921 Bacteria 8777
653 Ga0207652_10013940 3300025921 Bacteria 6508
654 Ga0207652_10039102 3300025921 Bacteria 4025
655 Ga0207646_10001485 3300025922 Bacteria 28893
656 Ga0207646_10001492 3300025922 Bacteria 28758
657 Ga0207646_10016391 3300025922 Bacteria 6952
658 Ga0207646_10031703 3300025922 Bacteria 4785
659 Ga0207694_10000001 3300025924 Bacteria 4078485
660 Ga0207694_10012840 3300025924 Bacteria 6308
661 Ga0207694_10016717 3300025924 Bacteria 5546
662 Ga0207694_10165432 3300025924 Bacteria 1788
663 Ga0207650_10014656 3300025925 Bacteria 5446
664 Ga0207650_10015087 3300025925 Bacteria 5375
665 Ga0207659_10026627 3300025926 Bacteria 3904
666 Ga0207659_10058318 3300025926 Bacteria 2771
667 Ga0207687_10001209 3300025927 Bacteria 17685
668 Ga0207687_10037904 3300025927 Bacteria 3292
669 Ga0207687_10106109 3300025927 Bacteria 2076
670 Ga0207700_10000073 3300025928 Bacteria 61784
671 Ga0207700_10003148 3300025928 Bacteria 9523
672 Ga0207700_10010941 3300025928 Bacteria 5759
673 Ga0207700_10171684 3300025928 Bacteria 1809
674 Ga0207664_10000542 3300025929 Bacteria 26749
675 Ga0207664_10014981 3300025929 Bacteria 5615
676 Ga0207664_10015163 3300025929 Bacteria 5585
677 Ga0207664_10028741 3300025929 Bacteria 4228
678 Ga0207664_10097651 3300025929 Bacteria 2420
679 Ga0207664_10104572 3300025929 Bacteria 2345
680 Ga0207644_10011232 3300025931 Bacteria 5920
681 Ga0207644_10088173 3300025931 Bacteria 2307
682 Ga0207690_10000007 3300025932 Bacteria 388533
683 Ga0207690_10001061 3300025932 Bacteria 17606
684 Ga0207690_10008488 3300025932 Bacteria 6095
685 Ga0207706_10000023 3300025933 Bacteria 153979
686 Ga0207686_10004180 3300025934 Bacteria 7743
687 Ga0207709_10000160 3300025935 Bacteria 91486
688 Ga0207709_10001196 3300025935 Bacteria 18730
689 Ga0207709_10002053 3300025935 Bacteria 13023
690 Ga0207709_10002264 3300025935 Bacteria 12219
691 Ga0207709_10003963 3300025935 Bacteria 8638
692 Ga0207709_10024451 3300025935 Bacteria 3450
693 Ga0207709_10055086 3300025935 Bacteria 2455
694 Ga0207709_10057896 3300025935 Bacteria 2406
695 Ga0207670_10043643 3300025936 Bacteria 2963
696 Ga0207669_10022675 3300025937 Bacteria 3339
697 Ga0207669_10121924 3300025937 Bacteria 1772
698 Ga0207665_10010799 3300025939 Bacteria 5995
699 Ga0207665_10033990 3300025939 Bacteria 3383
700 Ga0207691_10014621 3300025940 Bacteria 7482
701 Ga0207691_10081360 3300025940 Bacteria 2911
702 Ga0207711_10057311 3300025941 Bacteria 3349
703 Ga0207689_10007725 3300025942 Bacteria 9411
704 Ga0207689_10009885 3300025942 Bacteria 8224
705 Ga0207689_10124366 3300025942 Bacteria 2122
706 Ga0207661_10003557 3300025944 Bacteria 10830
707 Ga0207661_10010000 3300025944 Bacteria 6816
708 Ga0207661_10046617 3300025944 Bacteria 3437
709 Ga0207661_10213964 3300025944 Bacteria 1700
710 Ga0207679_10000007 3300025945 Bacteria 460140
711 Ga0207679_10013781 3300025945 Bacteria 5302
712 Ga0207679_10026592 3300025945 Bacteria 3992
713 Ga0207679_10029885 3300025945 Bacteria 3798
714 Ga0207679_10041837 3300025945 Bacteria 3289
715 Ga0207667_10000058 3300025949 Bacteria 200529
716 Ga0207667_10001383 3300025949 Bacteria 30431
717 Ga0207667_10003202 3300025949 Bacteria 20233
718 Ga0207667_10006874 3300025949 Bacteria 13743
719 Ga0207667_10008850 3300025949 Bacteria 11915
720 Ga0207667_10016327 3300025949 Bacteria 8391
721 Ga0207667_10019658 3300025949 Bacteria 7531
722 Ga0207667_10044504 3300025949 Bacteria 4703
723 Ga0207667_10089052 3300025949 Bacteria 3191
724 Ga0207651_10039683 3300025960 Bacteria 3107
725 Ga0207712_10014233 3300025961 Bacteria 5110
726 Ga0207668_10005766 3300025972 Bacteria 7300
727 Ga0207640_10000107 3300025981 Bacteria 63143
728 Ga0207640_10019654 3300025981 Bacteria 3995
729 Ga0207640_10144269 3300025981 Bacteria 1740
730 Ga0207658_10012781 3300025986 Bacteria 5733
731 Ga0207658_10031607 3300025986 Bacteria 3761
732 Ga0207658_10059842 3300025986 Bacteria 2840
733 Ga0207677_10000009 3300026023 Bacteria 252751
734 Ga0207677_10020339 3300026023 Bacteria 4028
735 Ga0207677_10153420 3300026023 Bacteria 1780
736 Ga0207703_10006237 3300026035 Bacteria 9539
737 Ga0207703_10127395 3300026035 Bacteria 2194
738 Ga0207639_10010939 3300026041 Bacteria 6292
739 Ga0207678_10001969 3300026067 Bacteria 18714
740 Ga0207678_10002335 3300026067 Bacteria 17195
741 Ga0207678_10008085 3300026067 Bacteria 9275
742 Ga0207678_10011358 3300026067 Bacteria 7817
743 Ga0207678_10012488 3300026067 Bacteria 7458
744 Ga0207678_10017713 3300026067 Bacteria 6255
745 Ga0207678_10018918 3300026067 Bacteria 6053
746 Ga0207678_10107168 3300026067 Bacteria 2384
747 Ga0207708_10002903 3300026075 Bacteria 12635
748 Ga0207708_10023705 3300026075 Bacteria 4639
749 Ga0207708_10081144 3300026075 Bacteria 2493
750 Ga0207702_10000260 3300026078 Bacteria 61036
751 Ga0207702_10000337 3300026078 Bacteria 53931
752 Ga0207702_10004398 3300026078 Bacteria 12551
753 Ga0207702_10005167 3300026078 Bacteria 11484
754 Ga0207702_10020136 3300026078 Bacteria 5527
755 Ga0207702_10033148 3300026078 Bacteria 4313
756 Ga0207702_10163310 3300026078 Bacteria 2035
757 Ga0207648_10008955 3300026089 Bacteria 9628
758 Ga0207648_10015226 3300026089 Bacteria 7075
759 Ga0207648_10029600 3300026089 Bacteria 4856
760 Ga0207648_10117322 3300026089 Bacteria 2339
761 Ga0207676_10000029 3300026095 Bacteria 232795
762 Ga0207676_10010708 3300026095 Bacteria 6539
763 Ga0207676_10013864 3300026095 Bacteria 5787
764 Ga0207674_10000429 3300026116 Bacteria 54858
765 Ga0207674_10018062 3300026116 Bacteria 7681
766 Ga0207675_100004715 3300026118 Bacteria 13128
767 Ga0207675_100005732 3300026118 Bacteria 11884
768 Ga0207675_100008757 3300026118 Bacteria 9506
769 Ga0207675_100015056 3300026118 Bacteria 7217
770 Ga0207675_100113155 3300026118 Bacteria 2562
771 Ga0207683_10000123 3300026121 Bacteria 63353
772 Ga0207683_10023126 3300026121 Bacteria 5340
773 Ga0207698_10009610 3300026142 Bacteria 6174
774 Ga0207698_10011139 3300026142 Bacteria 5815
775 Ga0207698_10027312 3300026142 Bacteria 4050
776 Ga0207698_10032212 3300026142 Bacteria 3794
777 Ga0209281_1000017 3300027111 Bacteria 583251
778 Ga0209281_1000314 3300027111 Bacteria 86424
779 Ga0209389_1003130 3300027296 Bacteria 13157
780 Ga0209371_1000292 3300027312 Bacteria 57076
781 Ga0209371_1002246 3300027312 Bacteria 11120
782 Ga0209589_1000003 3300027357 Bacteria 629130
783 Ga0209489_100003 3300027361 Bacteria 663105
784 Ga0209700_100003 3300027363 Bacteria 663105
785 Ga0210000_1000314 3300027462 Bacteria 7003
786 Ga0209995_1001170 3300027471 Bacteria 4029
787 Ga0209179_1000007 3300027512 Bacteria 93732
788 Ga0209179_1002568 3300027512 Bacteria 2475
789 Ga0209999_1000071 3300027543 Bacteria 11724
790 Ga0209970_1000300 3300027614 Bacteria 8158
791 Ga0209282_1000068 3300027666 Bacteria 85817
792 Ga0209282_1004480 3300027666 Bacteria 8420
793 Ga0209588_1002124 3300027671 Bacteria 5346
794 Ga0209971_1001823 3300027682 Bacteria 5217
795 Ga0209966_1000161 3300027695 Bacteria 28311
796 Ga0209966_1003206 3300027695 Bacteria 2747
797 Ga0209998_10000408 3300027717 Bacteria 12270
798 Ga0209813_10007844 3300027866 Bacteria 2673
799 Ga0209974_10001049 3300027876 Bacteria 9796
800 Ga0207428_10002865 3300027907 Bacteria 17096
801 Ga0207428_10056370 3300027907 Bacteria 3123
802 Ga0268266_10000190 3300028379 Bacteria 107630
803 Ga0268266_10002300 3300028379 Bacteria 20725
804 Ga0268266_10032638 3300028379 Bacteria 4424
805 Ga0268266_10052019 3300028379 Bacteria 3516
806 Ga0268266_10053608 3300028379 Bacteria 3465
807 Ga0268265_10001435 3300028380 Bacteria 20111
808 Ga0268265_10002340 3300028380 Bacteria 14383
809 Ga0268265_10009307 3300028380 Bacteria 6639
810 Ga0268265_10079019 3300028380 Bacteria 2589
811 Ga0268264_10000043 3300028381 Bacteria 371761
812 Ga0268264_10000220 3300028381 Bacteria 111692
813 Ga0268264_10047641 3300028381 Bacteria 3563
814 Ga0268264_10143573 3300028381 Bacteria 2132
815 Ga0265318_10011370 3300028577 Bacteria 3835
816 Ga0265318_10020381 3300028577 Bacteria 2677
817 Ga0307517_10000053 3300028786 Bacteria 155723
818 Ga0307515_10000062 3300028794 Bacteria 247284
819 Ga0307515_10000346 3300028794 Bacteria 114729
820 Ga0307515_10000398 3300028794 Bacteria 105087
821 Ga0307515_10000975 3300028794 Bacteria 65367
822 Ga0307515_10001252 3300028794 Bacteria 57943
823 Ga0307515_10005050 3300028794 Bacteria 26834
824 Ga0307515_10006111 3300028794 Bacteria 24214
825 Ga0307515_10011471 3300028794 Bacteria 16819
826 Ga0307515_10024951 3300028794 Bacteria 10375
827 Ga0307515_10066126 3300028794 Bacteria 5014
828 Ga0307515_10113321 3300028794 Bacteria 3145
829 Ga0265338_10052193 3300028800 Bacteria 3673
830 Ga0268256_1000255 3300030500 Bacteria 56398
831 Ga0268256_1003512 3300030500 Bacteria 7036
832 Ga0314311_1190663 3300030733 Bacteria 1932
833 Ga0265330_10000052 3300031235 Bacteria 102771
834 Ga0265330_10026724 3300031235 Bacteria 2609
835 Ga0265332_10000001 3300031238 Bacteria 863783
836 Ga0265332_10006386 3300031238 Bacteria 5346
837 Ga0265328_10002917 3300031239 Bacteria 7630
838 Ga0265325_10002984 3300031241 Bacteria 11229
839 Ga0265325_10013593 3300031241 Bacteria 4628
840 Ga0265329_10007409 3300031242 Bacteria 4249
841 Ga0265339_10001286 3300031249 Bacteria 18767
842 Ga0265331_10007279 3300031250 Bacteria 6415
843 Ga0265327_10000018 3300031251 Bacteria 439197
844 Ga0265327_10000080 3300031251 Bacteria 206086
845 Ga0265327_10000622 3300031251 Bacteria 58359
846 Ga0265327_10000733 3300031251 Bacteria 51231
847 Ga0265316_10019109 3300031344 Bacteria 5870
848 Ga0265316_10066938 3300031344 Bacteria 2778
849 Ga0265316_10069887 3300031344 Bacteria 2710
850 Ga0307513_10000070 3300031456 Bacteria 139895
851 Ga0307513_10000072 3300031456 Bacteria 138840
852 Ga0307513_10000162 3300031456 Bacteria 96000
853 Ga0307513_10004918 3300031456 Bacteria 17742
854 Ga0307513_10011662 3300031456 Bacteria 10905
855 Ga0307513_10021256 3300031456 Bacteria 7664
856 Ga0307513_10069763 3300031456 Bacteria 3677
857 Ga0307513_10108064 3300031456 Bacteria 2784
858 Ga0307509_10000032 3300031507 Bacteria 202919
859 Ga0307509_10008220 3300031507 Bacteria 13346
860 Ga0307509_10075146 3300031507 Bacteria 3510
861 Ga0307408_100000012 3300031548 Bacteria 408153
862 Ga0307408_100000219 3300031548 Bacteria 61012
863 Ga0307408_100002474 3300031548 Bacteria 12950
864 Ga0307508_10000001 3300031616 Bacteria 553635
865 Ga0307508_10000023 3300031616 Bacteria 177362
866 Ga0307508_10013998 3300031616 Bacteria 7320
867 Ga0307508_10020567 3300031616 Bacteria 5995
868 Ga0307508_10098651 3300031616 Bacteria 2515
869 Ga0307514_10003961 3300031649 Bacteria 13848
870 Ga0307514_10010805 3300031649 Bacteria 7624
871 Ga0307514_10015637 3300031649 Bacteria 6254
872 Ga0307514_10016384 3300031649 Bacteria 6105
873 Ga0307514_10047240 3300031649 Bacteria 3361
874 Ga0316575_10002135 3300031665 Bacteria 6602
875 Ga0265314_10000013 3300031711 Bacteria 403405
876 Ga0265314_10001416 3300031711 Bacteria 26889
877 Ga0265314_10003480 3300031711 Bacteria 15205
878 Ga0265314_10009656 3300031711 Bacteria 8125
879 Ga0265342_10015981 3300031712 Bacteria 4918
880 Ga0265342_10050856 3300031712 Bacteria 2474
881 Ga0316576_10005251 3300031727 Bacteria 7884
882 Ga0316576_10044334 3300031727 Bacteria 3212
883 Ga0316576_10056466 3300031727 Bacteria 2867
884 Ga0316578_10033710 3300031728 Bacteria 2936
885 Ga0307516_10000045 3300031730 Bacteria 132787
886 Ga0307516_10003224 3300031730 Bacteria 21166
887 Ga0307516_10006540 3300031730 Bacteria 13642
888 Ga0307516_10007517 3300031730 Bacteria 12523
889 Ga0307516_10010031 3300031730 Bacteria 10481
890 Ga0307405_10000676 3300031731 Bacteria 13196
891 Ga0307405_10024174 3300031731 Bacteria 3466
892 Ga0316577_10016321 3300031733 Bacteria 4091
893 Ga0307413_10038493 3300031824 Bacteria 2773
894 Ga0307410_10036376 3300031852 Bacteria 3206
895 Ga0307406_10000407 3300031901 Bacteria 24935
896 Ga0307406_10005726 3300031901 Bacteria 6804
897 Ga0307412_10000002 3300031911 Bacteria 743446
898 Ga0307412_10025093 3300031911 Bacteria 3687
899 Ga0315914_1020806 3300031967 Bacteria 5279
900 Ga0307409_100082576 3300031995 Bacteria 2602
901 Ga0307409_100103549 3300031995 Bacteria 2368
902 Ga0307416_100004227 3300032002 Bacteria 8619
903 Ga0307416_100008902 3300032002 Bacteria 6521
904 Ga0307416_100191736 3300032002 Bacteria 1928
905 Ga0307414_10021938 3300032004 Bacteria 4019
906 Ga0307414_10029553 3300032004 Bacteria 3568
907 Ga0307414_10039044 3300032004 Bacteria 3194
908 Ga0307414_10063992 3300032004 Bacteria 2617
909 Ga0307411_10044025 3300032005 Bacteria 2859
910 Ga0307411_10126242 3300032005 Bacteria 1861
911 Ga0307415_100084486 3300032126 Bacteria 2278
912 Ga0316583_10004774 3300032133 Bacteria 4841
913 Ga0316580_10002722 3300032139 Bacteria 4916
914 Ga0307510_10106751 3300033180 Bacteria 2562
915 Ga0315913_1002536 3300033430 Bacteria 21509
916 Ga0315915_1000007 3300033464 Bacteria 319225
917 Ga0373926_0001668 3300035083 Bacteria 6863
918 Ga0373934_0000684 3300035086 Bacteria 12034
919 Ga0373934_0026986 3300035086 Bacteria 2230
920 Ga0373953_0000768 3300035117 Bacteria 8919
921 Ga0373954_0000028 3300035118 Bacteria 56501
922 Ga0373954_0000045 3300035118 Bacteria 43877
923 Ga0373956_0000635 3300035119 Bacteria 14416
924 Ga0373960_0000576 3300035121 Bacteria 7472
925 Ga0373943_0018742 3300035170 Bacteria 3181
926 Ga0373943_0038304 3300035170 Bacteria 2304
927 Ga0373946_0002476 3300035171 Bacteria 6521
928 Ga0373955_0000519 3300035172 Bacteria 16383
929 Ga0373955_0009467 3300035172 Bacteria 4563
930 Ga0373942_0001178 3300035207 Bacteria 6908
931 Ga0316574_0016862 3300035398 Bacteria 4263
932 Ga0373924_0010387 3300035410 Bacteria 3429
933 Ga0373931_0001811 3300035691 Bacteria 9299
934 Ga0373931_0003169 3300035691 Bacteria 7343
935 Ga0373935_0007344 3300035692 Bacteria 6592
936 Ga0373935_0149847 3300035692 Bacteria 1582
937 Ga0373927_0002624 3300035695 Bacteria 13109
938 Ga0373927_0012450 3300035695 Bacteria 5665
939 Ga0373933_0000309 3300035724 Bacteria 31558
940 Ga0373933_0001241 3300035724 Bacteria 15060
941 Ga0373933_0025582 3300035724 Bacteria 3386
942 Ga0373933_0034721 3300035724 Bacteria 2941
943 Ga0373947_0015581 3300035725 Bacteria 4366
944 Ga0373937_0000742 3300036401 Bacteria 28122
945 Ga0373937_0001199 3300036401 Bacteria 21771
946 Ga0373937_0045869 3300036401 Bacteria 3995
947 Ga0373937_0143850 3300036401 Bacteria 2231
948 Ga0316582_0076106 3300036647 Bacteria 2182
949 Ga0373925_0087351 3300037068 Bacteria 2380
950 Ga0373925_0089666 3300037068 Bacteria 2349
951 Ga0395899_0000013 3300037312 Bacteria 510397
952 Ga0395899_0000023 3300037312 Bacteria 367159
953 Ga0395899_0000078 3300037312 Bacteria 174141
954 Ga0395899_0002871 3300037312 Bacteria 13845
955 Ga0395899_0022135 3300037312 Bacteria 4820
956 Ga0395899_0027406 3300037312 Bacteria 4297
957 Ga0395900_0000019 3300037418 Bacteria 357240
958 Ga0395900_0000211 3300037418 Bacteria 91303
959 Ga0395900_0013503 3300037418 Bacteria 8346
960 Ga0395900_0019625 3300037418 Bacteria 6892
961 Ga0395900_0035336 3300037418 Bacteria 5147
962 Ga0395900_0105174 3300037418 Bacteria 2900
963 Ga0395900_0124953 3300037418 Bacteria 2638
964 Ga0395900_0157547 3300037418 Bacteria 2319
965 Ga0395900_0241507 3300037418 Bacteria 1812
966 Ga0395898_0000016 3300037466 Bacteria 435585
967 Ga0395898_0002136 3300037466 Bacteria 24363
968 Ga0395898_0007259 3300037466 Bacteria 11760
969 Ga0395898_0010588 3300037466 Bacteria 9629
970 Ga0395898_0012425 3300037466 Bacteria 8803
971 Ga0395898_0021799 3300037466 Bacteria 6491
972 Ga0395898_0053635 3300037466 Bacteria 3938
973 Ga0395898_0056493 3300037466 Bacteria 3825
974 Ga0395898_0061367 3300037466 Bacteria 3652
975 Ga0395905_0000117 3300037471 Bacteria 133291
976 Ga0395905_0000283 3300037471 Bacteria 74377
977 Ga0395905_0000352 3300037471 Bacteria 65434
978 Ga0395905_0001425 3300037471 Bacteria 28820
979 Ga0395905_0003331 3300037471 Bacteria 17244
980 Ga0395905_0003956 3300037471 Bacteria 15588
981 Ga0395905_0009380 3300037471 Bacteria 9571
982 Ga0395905_0011137 3300037471 Bacteria 8698
983 Ga0395905_0017915 3300037471 Bacteria 6727
984 Ga0395905_0018137 3300037471 Bacteria 6679
985 Ga0395905_0031988 3300037471 Bacteria 4949
986 Ga0395905_0047994 3300037471 Bacteria 4001
987 Ga0436364_0273345 3300037853 Bacteria 2794207
988 Ga0436364_0461129 3300037853 Bacteria 3432
989 Ga0436364_0476731 3300037853 Bacteria 5156
990 Ga0436364_1323953 3300037853 Bacteria 2207
991 Ga0395901_0009034 3300038443 Bacteria 10088
992 Ga0395901_0011033 3300038443 Bacteria 9152
993 Ga0395901_0040984 3300038443 Bacteria 4797
994 Ga0395901_0044297 3300038443 Bacteria 4615
995 Ga0395901_0047204 3300038443 Bacteria 4471
996 Ga0395901_0123138 3300038443 Bacteria 2725
997 Ga0400483_041877 3300039062 Bacteria 34809
998 Ga0400483_128917 3300039062 Bacteria 3482
999 Ga0400483_239666 3300039062 Bacteria 2700
1000 Ga0436365_0613835 3300039437 Bacteria 19254
1001 Ga0436365_0774883 3300039437 Bacteria 390569
1002 Ga0436365_0818746 3300039437 Bacteria 84606
1003 Ga0436365_0843555 3300039437 Bacteria 2654
1004 Ga0436365_1024917 3300039437 Bacteria 4764
1005 Ga0436360_0242974 3300039438 Bacteria 3205
1006 Ga0436360_0965900 3300039438 Bacteria 1749
1007 Ga0436361_0067858 3300039447 Bacteria 4310
1008 Ga0436361_0192229 3300039447 Bacteria 2185
1009 Ga0436361_0208418 3300039447 Bacteria 17479
1010 Ga0436361_0224368 3300039447 Bacteria 99317
1011 Ga0436361_0307998 3300039447 Bacteria 2365
1012 Ga0436361_0319598 3300039447 Bacteria 24219
1013 Ga0436361_0394184 3300039447 Bacteria 10632
1014 Ga0436361_0424891 3300039447 Bacteria 6785
1015 Ga0436361_0437880 3300039447 Bacteria 10056
1016 Ga0436361_0767394 3300039447 Bacteria 56110
1017 Ga0436361_0807409 3300039447 Bacteria 14539
1018 Ga0436361_0913791 3300039447 Bacteria 99691
1019 Ga0436361_0922325 3300039447 Bacteria 2478
1020 Ga0436361_0937617 3300039447 Bacteria 6347
1021 Ga0436361_0941839 3300039447 Bacteria 174965
1022 Ga0436361_1034384 3300039447 Bacteria 7100
1023 Ga0436363_0794016 3300039450 Bacteria 7079
1024 Ga0436363_1052713 3300039450 Bacteria 2573
1025 Ga0436362_0660519 3300039453 Bacteria 832172
1026 Ga0436362_0933513 3300039453 Bacteria 15871
1027 Ga0439465_0002181 3300041413 Bacteria 6425
1028 Ga0439442_000327 3300042002 Bacteria 11381
1029 Ga0439449_0000741 3300042007 Bacteria 12538
1030 Ga0439449_0016081 3300042007 Bacteria 2814
1031 Ga0439449_0018901 3300042007 Bacteria 2583
1032 Ga0439462_0000613 3300042015 Bacteria 7135
1033 Ga0450894_000652 3300042131 Bacteria 5794
1034 Ga0450908_003056 3300042184 Bacteria 3261
1035 Ga0439434_0003053 3300042435 Bacteria 4908
1036 Ga0439444_0001693 3300042437 Bacteria 2911
1037 Ga0439459_0000205 3300042438 Bacteria 6630
1038 Ga0439460_0000526 3300042461 Bacteria 8328
1039 Ga0439460_0003588 3300042461 Bacteria 3752
1040 Ga0451577_0000014 3300042876 Bacteria 546755
1041 Ga0451577_0000388 3300042876 Bacteria 81462
1042 Ga0451577_0006997 3300042876 Bacteria 11140
1043 Ga0451577_0013489 3300042876 Bacteria 7644
1044 Ga0466969_0054442 3300044656 Bacteria 1959
1045 Ga0453683_0002610 3300044673 Bacteria 13817
1046 Ga0453683_0003826 3300044673 Bacteria 10931
1047 Ga0466965_0050337 3300044683 Bacteria 2066
1048 Ga0466966_0000009 3300044684 Bacteria 150954
1049 Ga0466966_0033613 3300044684 Bacteria 3320
1050 Ga0466961_0000353 3300044693 Bacteria 29874
1051 Ga0466961_0006262 3300044693 Bacteria 7556
1052 Ga0466961_0019806 3300044693 Bacteria 4329
1053 Ga0466961_0022355 3300044693 Bacteria 4068
1054 Ga0466963_0017627 3300044694 Bacteria 4453
1055 Ga0466963_0040009 3300044694 Bacteria 3072
1056 Ga0453684_0000082 3300044712 Bacteria 399380
1057 Ga0453684_0000132 3300044712 Bacteria 331157
1058 Ga0453684_0000187 3300044712 Bacteria 272378
1059 Ga0453684_0000204 3300044712 Bacteria 258105
1060 Ga0453684_0001066 3300044712 Bacteria 87216
1061 Ga0453684_0002858 3300044712 Bacteria 40576
1062 Ga0453684_0007830 3300044712 Bacteria 19464
1063 Ga0453684_0031157 3300044712 Bacteria 7503
1064 Ga0453684_0033889 3300044712 Bacteria 7104
1065 Ga0453684_0048661 3300044712 Bacteria 5600
1066 Ga0453684_0239155 3300044712 Bacteria 2091
1067 Ga0466971_0022622 3300044719 Bacteria 2802
1068 Ga0466968_0001573 3300044735 Bacteria 8235
1069 Ga0466968_0006458 3300044735 Bacteria 4421
1070 Ga0466968_0017610 3300044735 Bacteria 2858
1071 Ga0466957_0067691 3300044842 Bacteria 2203
1072 Ga0466960_0003202 3300044901 Bacteria 6275
1073 Ga0466960_0009154 3300044901 Bacteria 4075
1074 Ga0466960_0014600 3300044901 Bacteria 3368
1075 Ga0466960_0042521 3300044901 Bacteria 2158
1076 Ga0466959_0000394 3300045049 Bacteria 25591
1077 Ga0466959_0000938 3300045049 Bacteria 17303
1078 Ga0466959_0005843 3300045049 Bacteria 8470
1079 Ga0451576_0000096 3300045051 Bacteria 221078
1080 Ga0451576_0005438 3300045051 Bacteria 15974
1081 Ga0451576_0009574 3300045051 Bacteria 11217
1082 Ga0451576_0026461 3300045051 Bacteria 6240
1083 Ga0451576_0028947 3300045051 Bacteria 5933
1084 Ga0451576_0031011 3300045051 Bacteria 5703
1085 Ga0451576_0055246 3300045051 Bacteria 4155
1086 Ga0451576_0145422 3300045051 Bacteria 2472
1087 Ga0466958_0008156 3300045836 Bacteria 5799
1088 Ga0466958_0023126 3300045836 Bacteria 3645
1089 Ga0466958_0027790 3300045836 Bacteria 3348
1090 Ga0466967_0001288 3300045976 Bacteria 14273
1091 Ga0466967_0003130 3300045976 Bacteria 10654
1092 Ga0466967_0005413 3300045976 Bacteria 8843
1093 Ga0466967_0035194 3300045976 Bacteria 4259
1094 Ga0466967_0039274 3300045976 Bacteria 4067
1095 Ga0495617_025787 3300046452 Bacteria 1981
1096 Ga0495592_0000436 3300046454 Bacteria 31448
1097 Ga0495592_0002487 3300046454 Bacteria 13018
1098 Ga0495603_0032454 3300046455 Bacteria 3141
1099 Ga0495603_0048284 3300046455 Bacteria 2534
1100 Ga0495629_0000257 3300046459 Bacteria 46305
1101 Ga0495651_0003296 3300046462 Bacteria 12393
1102 Ga0495653_0000288 3300046463 Bacteria 40866
1103 Ga0495653_0116844 3300046463 Bacteria 1907
1104 Ga0495650_0007201 3300046471 Bacteria 6740
1105 Ga0495580_0018040 3300046472 Bacteria 5262
1106 Ga0495639_0037330 3300046475 Bacteria 2177
1107 Ga0495662_0008407 3300046476 Bacteria 5076
1108 Ga0495664_0051708 3300046477 Bacteria 2440
1109 Ga0495594_0033120 3300046499 Bacteria 2808
1110 Ga0495606_0000873 3300046507 Bacteria 45086
1111 Ga0495606_0019756 3300046507 Bacteria 4993
1112 Ga0495606_0037209 3300046507 Bacteria 3306
1113 Ga0495606_0055199 3300046507 Bacteria 2570
1114 Ga0495606_0086059 3300046507 Bacteria 1943
1115 Ga0495608_0001126 3300046511 Bacteria 18919
1116 Ga0495608_0004197 3300046511 Bacteria 10325
1117 Ga0495608_0023176 3300046511 Bacteria 4256
1118 Ga0495610_0000092 3300046512 Bacteria 105874
1119 Ga0495616_0002407 3300046513 Bacteria 12455
1120 Ga0495616_0010237 3300046513 Bacteria 5437
1121 Ga0495628_0016679 3300046516 Bacteria 6124
1122 Ga0495631_0000844 3300046518 Bacteria 19424
1123 Ga0495632_0032470 3300046519 Bacteria 2689
1124 Ga0495643_0016919 3300046522 Bacteria 4275
1125 Ga0495643_0050007 3300046522 Bacteria 2252
1126 Ga0495648_0000717 3300046524 Bacteria 35307
1127 Ga0495652_0041591 3300046529 Bacteria 3966
1128 Ga0495652_0116214 3300046529 Bacteria 2142
1129 Ga0495654_0000010 3300046530 Bacteria 378481
1130 Ga0495665_0037605 3300046531 Bacteria 2583
1131 Ga0495640_0001444 3300046533 Bacteria 18719
1132 Ga0495586_0001370 3300046535 Bacteria 13538
1133 Ga0495587_0000584 3300046536 Bacteria 25102
1134 Ga0495597_0002137 3300046542 Bacteria 13088
1135 Ga0495622_0000692 3300046557 Bacteria 19112
1136 Ga0495633_0007327 3300046558 Bacteria 6361
1137 Ga0495667_0000700 3300046559 Bacteria 21464
1138 Ga0495667_0048969 3300046559 Bacteria 2790
1139 Ga0495667_0053610 3300046559 Bacteria 2655
1140 Ga0495667_0092464 3300046559 Bacteria 1958
1141 Ga0495667_0132831 3300046559 Bacteria 1605
1142 Ga0495656_0013838 3300046615 Bacteria 3011
1143 Ga0495656_0017331 3300046615 Bacteria 2748
1144 Ga0495668_0005568 3300046616 Bacteria 8474
1145 Ga0495634_0043826 3300046642 Bacteria 3031
1146 Ga0495625_0000032 3300046660 Bacteria 233135
1147 Ga0495625_0000235 3300046660 Bacteria 86400
1148 Ga0495625_0000295 3300046660 Bacteria 77306
1149 Ga0495635_0000040 3300046663 Bacteria 86519
1150 Ga0495657_0001715 3300046675 Bacteria 18791
1151 Ga0495657_0037606 3300046675 Bacteria 3335
1152 Ga0495657_0041833 3300046675 Bacteria 3133
1153 Ga0495599_0000120 3300046678 Bacteria 53081
1154 Ga0495599_0016254 3300046678 Bacteria 4620
1155 Ga0495599_0069268 3300046678 Bacteria 2202
1156 Ga0495623_0006814 3300046679 Bacteria 7431
1157 Ga0495647_0013904 3300046681 Bacteria 2797
1158 Ga0495613_0002186 3300046689 Bacteria 14811
1159 Ga0495613_0028693 3300046689 Bacteria 4140
1160 Ga0495624_0013950 3300046690 Bacteria 5470
1161 Ga0495600_0000074 3300046809 Bacteria 55182
1162 Ga0495600_0004089 3300046809 Bacteria 8682
1163 Ga0495604_0001303 3300047317 Bacteria 20381
1164 Ga0495604_0007337 3300047317 Bacteria 8732
1165 Ga0495604_0101818 3300047317 Bacteria 2109
1166 Ga0495674_0009149 3300047319 Bacteria 9414
1167 Ga0495674_0019982 3300047319 Bacteria 6208
1168 Ga0495672_0003177 3300047320 Bacteria 14280
1169 Ga0495676_0026484 3300047321 Bacteria 4990
1170 Ga0495680_0001054 3300047322 Bacteria 30518
1171 Ga0495680_0022250 3300047322 Bacteria 5287
1172 Ga0495680_0035962 3300047322 Bacteria 3982
1173 Ga0495675_0000382 3300047444 Bacteria 30557
1174 Ga0495675_0024379 3300047444 Bacteria 3856
1175 Ga0495673_0014454 3300047469 Bacteria 4104
1176 Ga0495684_0000134 3300047471 Bacteria 54180
1177 Ga0495686_0000090 3300047472 Bacteria 193179
1178 Ga0495686_0007525 3300047472 Bacteria 8155
1179 Ga0495593_0011569 3300047673 Bacteria 5063
1180 Ga0495602_0002953 3300048088 Bacteria 17450
1181 Ga0496100_0001853 3300048903 Bacteria 10582
1182 Ga0496100_0008025 3300048903 Bacteria 5866
1183 Ga0496100_0025105 3300048903 Bacteria 3641
1184 Ga0496100_0056912 3300048903 Bacteria 2559
1185 Ga0496100_0057940 3300048903 Bacteria 2540
1186 Ga0496101_0010944 3300048904 Bacteria 6006
1187 Ga0496101_0068987 3300048904 Bacteria 2586
1188 Ga0496101_0095470 3300048904 Bacteria 2218
1189 Ga0496101_0199414 3300048904 Bacteria 1547
1190 Ga0496102_0002544 3300048905 Bacteria 15560
1191 Ga0496102_0019661 3300048905 Bacteria 5951
1192 Ga0496102_0030595 3300048905 Bacteria 4819
1193 Ga0496102_0042879 3300048905 Bacteria 4101
1194 Ga0496102_0044851 3300048905 Bacteria 4012
1195 Ga0496102_0050955 3300048905 Bacteria 3771
1196 Ga0496102_0128299 3300048905 Bacteria 2372
1197 Ga0496102_0201107 3300048905 Bacteria 1878
1198 Ga0496103_0024204 3300048906 Bacteria 3663
1199 Ga0496103_0099047 3300048906 Bacteria 1844
1200 Ga0496103_0102244 3300048906 Bacteria 1815
1201 Ga0496104_0000334 3300048907 Bacteria 42142
1202 Ga0496104_0001544 3300048907 Bacteria 19867
1203 Ga0496104_0009904 3300048907 Bacteria 8509
1204 Ga0496104_0012289 3300048907 Bacteria 7697
1205 Ga0496105_0000114 3300048908 Bacteria 54319
1206 Ga0496105_0018449 3300048908 Bacteria 5608
1207 Ga0496105_0038978 3300048908 Bacteria 3915
1208 Ga0496105_0040586 3300048908 Bacteria 3837
1209 Ga0496105_0044334 3300048908 Bacteria 3668
1210 Ga0496105_0090312 3300048908 Bacteria 2530
1211 Ga0496106_0000852 3300048909 Bacteria 22131
1212 Ga0496106_0013667 3300048909 Bacteria 5994
1213 Ga0496106_0025589 3300048909 Bacteria 4393
1214 Ga0496106_0052408 3300048909 Bacteria 3078
1215 Ga0496106_0082060 3300048909 Bacteria 2477
1216 Ga0496107_0000933 3300048910 Bacteria 17270
1217 Ga0496107_0021676 3300048910 Bacteria 4540
1218 Ga0496107_0057794 3300048910 Bacteria 2804
1219 Ga0496108_0009068 3300048911 Bacteria 8058
1220 Ga0496108_0023669 3300048911 Bacteria 5054
1221 Ga0496108_0094016 3300048911 Bacteria 2551
1222 Ga0496109_0025721 3300048912 Bacteria 5245
1223 Ga0496109_0055526 3300048912 Bacteria 3613
1224 Ga0496110_0006909 3300048913 Bacteria 9026
1225 Ga0496110_0008766 3300048913 Bacteria 8149
1226 Ga0496110_0034208 3300048913 Bacteria 4400
1227 Ga0496110_0039373 3300048913 Bacteria 4115
1228 Ga0496110_0160624 3300048913 Bacteria 2037
1229 Ga0496111_0000116 3300048914 Bacteria 34570
1230 Ga0496111_0004674 3300048914 Bacteria 8678
1231 Ga0496111_0014357 3300048914 Bacteria 5409
1232 Ga0496111_0017456 3300048914 Bacteria 4962
1233 Ga0496111_0031131 3300048914 Bacteria 3799
1234 Ga0496111_0089710 3300048914 Bacteria 2252
1235 Ga0496111_0168652 3300048914 Bacteria 1626
1236 Ga0496112_0012770 3300048915 Bacteria 7729
1237 Ga0496112_0089671 3300048915 Bacteria 3043
1238 Ga0496113_0005533 3300048916 Bacteria 7887
1239 Ga0496113_0103365 3300048916 Bacteria 2210
1240 Ga0496114_0000208 3300048917 Bacteria 42600
1241 Ga0496114_0000497 3300048917 Bacteria 28761
1242 Ga0496114_0004155 3300048917 Bacteria 11201
1243 Ga0496114_0013825 3300048917 Bacteria 6471
1244 Ga0496114_0020551 3300048917 Bacteria 5358
1245 Ga0496114_0020869 3300048917 Bacteria 5320
1246 Ga0496114_0024569 3300048917 Bacteria 4920
1247 Ga0496115_0000406 3300048918 Bacteria 35489
1248 Ga0496115_0001480 3300048918 Bacteria 16879
1249 Ga0496115_0025731 3300048918 Bacteria 4586
1250 Ga0496115_0050208 3300048918 Bacteria 3341
1251 Ga0496116_0000600 3300048919 Bacteria 47814
1252 Ga0496117_0007455 3300048920 Bacteria 10681
1253 Ga0496119_0001210 3300048922 Bacteria 32241
1254 Ga0496119_0003780 3300048922 Bacteria 15490
1255 Ga0496120_0017294 3300048923 Bacteria 4681
1256 Ga0496121_0000303 3300048924 Bacteria 102261
1257 Ga0496121_0029495 3300048924 Bacteria 5071
1258 Ga0496121_0057624 3300048924 Bacteria 3218
1259 Ga0496121_0068817 3300048924 Bacteria 2861
1260 Ga0496121_0176326 3300048924 Bacteria 1547
1261 Ga0496122_0003710 3300048925 Bacteria 19747
1262 Ga0496122_0007800 3300048925 Bacteria 11767
1263 Ga0496122_0011264 3300048925 Bacteria 9085
1264 Ga0496122_0037915 3300048925 Bacteria 3870
1265 Ga0496123_0008925 3300048926 Bacteria 9116
1266 Ga0496124_0002789 3300048927 Bacteria 22161
1267 Ga0496124_0038597 3300048927 Bacteria 4146
1268 Ga0496124_0107817 3300048927 Bacteria 2247
1269 Ga0496125_0001159 3300048928 Bacteria 39918
1270 Ga0496125_0013587 3300048928 Bacteria 7996
1271 Ga0496125_0032941 3300048928 Bacteria 4594
1272 Ga0496125_0038602 3300048928 Bacteria 4129
1273 Ga0496125_0047535 3300048928 Bacteria 3587
1274 Ga0496126_0000315 3300048929 Bacteria 102933
1275 Ga0496126_0000480 3300048929 Bacteria 79257
1276 Ga0496126_0009379 3300048929 Bacteria 10400
1277 Ga0496126_0025520 3300048929 Bacteria 5683
1278 Ga0496126_0038634 3300048929 Bacteria 4438
1279 Ga0496126_0038837 3300048929 Bacteria 4425
1280 Ga0495678_013497 3300049459 Bacteria 3835
1281 Ga0501031_0006699 3300049568 Bacteria 7515
1282 Ga0501031_0045163 3300049568 Bacteria 2874
1283 Ga0501031_0068113 3300049568 Bacteria 2318
1284 Ga0501032_0005601 3300049569 Bacteria 9305
1285 Ga0501032_0006523 3300049569 Bacteria 8572
1286 Ga0501032_0022099 3300049569 Bacteria 4415
1287 Ga0501032_0076794 3300049569 Bacteria 2224
1288 Ga0501033_0000025 3300049570 Bacteria 173634
1289 Ga0501033_0004074 3300049570 Bacteria 11790
1290 Ga0501033_0005255 3300049570 Bacteria 10274
1291 Ga0501033_0016641 3300049570 Bacteria 5562
1292 Ga0501033_0028306 3300049570 Bacteria 4210
1293 Ga0501033_0056476 3300049570 Bacteria 2901
1294 Ga0501034_0000656 3300049571 Bacteria 53197
1295 Ga0501034_0001007 3300049571 Bacteria 40401
1296 Ga0501034_0005401 3300049571 Bacteria 13969
1297 Ga0501034_0011724 3300049571 Bacteria 9068
1298 Ga0501034_0027517 3300049571 Bacteria 5785
1299 Ga0501034_0044594 3300049571 Bacteria 4484
1300 Ga0501036_0001771 3300049572 Bacteria 16761
1301 Ga0501036_0002177 3300049572 Bacteria 15289
1302 Ga0501036_0002532 3300049572 Bacteria 14356
1303 Ga0501036_0004395 3300049572 Bacteria 11377
1304 Ga0501036_0023231 3300049572 Bacteria 5220
1305 Ga0501036_0031880 3300049572 Bacteria 4452
1306 Ga0501036_0157786 3300049572 Bacteria 1913
1307 Ga0501037_0000034 3300049573 Bacteria 126321
1308 Ga0501037_0002486 3300049573 Bacteria 13311
1309 Ga0501037_0004111 3300049573 Bacteria 10551
1310 Ga0501037_0009303 3300049573 Bacteria 7207
1311 Ga0501038_0000286 3300049574 Bacteria 43041
1312 Ga0501038_0000494 3300049574 Bacteria 34711
1313 Ga0501038_0009471 3300049574 Bacteria 8934
1314 Ga0501038_0015376 3300049574 Bacteria 6957
1315 Ga0501039_0002404 3300049575 Bacteria 13918
1316 Ga0501039_0003332 3300049575 Bacteria 12001
1317 Ga0501040_0005237 3300049576 Bacteria 8379
1318 Ga0501040_0006452 3300049576 Bacteria 7618
1319 Ga0501041_0046595 3300049577 Bacteria 2638
1320 Ga0501041_0057305 3300049577 Bacteria 2383
1321 Ga0501041_0063804 3300049577 Bacteria 2256
1322 Ga0501042_0010828 3300049578 Bacteria 6132
1323 Ga0501042_0036041 3300049578 Bacteria 3509
1324 Ga0501042_0072607 3300049578 Bacteria 2462
1325 Ga0501043_0001194 3300049579 Bacteria 22852
1326 Ga0501043_0001282 3300049579 Bacteria 22062
1327 Ga0501043_0002005 3300049579 Bacteria 17378
1328 Ga0501043_0008771 3300049579 Bacteria 7961
1329 Ga0501043_0043791 3300049579 Bacteria 3518
1330 Ga0501046_0004377 3300049580 Bacteria 12838
1331 Ga0501046_0004738 3300049580 Bacteria 12272
1332 Ga0501046_0013469 3300049580 Bacteria 6923
1333 Ga0501047_0000061 3300049581 Bacteria 137341
1334 Ga0501047_0000341 3300049581 Bacteria 53185
1335 Ga0501047_0005327 3300049581 Bacteria 12091
1336 Ga0501047_0008793 3300049581 Bacteria 9527
1337 Ga0501047_0010493 3300049581 Bacteria 8767
1338 Ga0501047_0045621 3300049581 Bacteria 4238
1339 Ga0501047_0092569 3300049581 Bacteria 2901
1340 Ga0501048_0000009 3300049582 Bacteria 84404
1341 Ga0501048_0003281 3300049582 Bacteria 12332
1342 Ga0501048_0004373 3300049582 Bacteria 10757
1343 Ga0501048_0016054 3300049582 Bacteria 5522
1344 Ga0501067_0010995 3300049583 Bacteria 5012
1345 Ga0501068_0000288 3300049584 Bacteria 25058
1346 Ga0501068_0000820 3300049584 Bacteria 16120
1347 Ga0501069_0000266 3300049585 Bacteria 23651
1348 Ga0501069_0002228 3300049585 Bacteria 9772
1349 Ga0501069_0002802 3300049585 Bacteria 8917
1350 Ga0501069_0046880 3300049585 Bacteria 2398
1351 Ga0501070_0000245 3300049586 Bacteria 51075
1352 Ga0501070_0003719 3300049586 Bacteria 13176
1353 Ga0501070_0004387 3300049586 Bacteria 12121
1354 Ga0501070_0011450 3300049586 Bacteria 7494
1355 Ga0501070_0061236 3300049586 Bacteria 3118
1356 Ga0501070_0071430 3300049586 Bacteria 2873
1357 Ga0501070_0097520 3300049586 Bacteria 2431
1358 Ga0501070_0126075 3300049586 Bacteria 2116
1359 Ga0501071_0007283 3300049587 Bacteria 7242
1360 Ga0501071_0015105 3300049587 Bacteria 5295
1361 Ga0501071_0042043 3300049587 Bacteria 3273
1362 Ga0501071_0105512 3300049587 Bacteria 2080
1363 Ga0501072_0001729 3300049588 Bacteria 16275
1364 Ga0501072_0008620 3300049588 Bacteria 7740
1365 Ga0501072_0010747 3300049588 Bacteria 6976
1366 Ga0501072_0011452 3300049588 Bacteria 6780
1367 Ga0501072_0013474 3300049588 Bacteria 6258
1368 Ga0501072_0014012 3300049588 Bacteria 6144
1369 Ga0501072_0021437 3300049588 Bacteria 5010
1370 Ga0501072_0028417 3300049588 Bacteria 4366
1371 Ga0501072_0034545 3300049588 Bacteria 3963
1372 Ga0501072_0160021 3300049588 Bacteria 1796
1373 Ga0501073_0001985 3300049589 Bacteria 15256
1374 Ga0501073_0007988 3300049589 Bacteria 7855
1375 Ga0501073_0008527 3300049589 Bacteria 7599
1376 Ga0501073_0017803 3300049589 Bacteria 5141
1377 Ga0501073_0073952 3300049589 Bacteria 2372
1378 Ga0501073_0098755 3300049589 Bacteria 2027
1379 Ga0501074_0000048 3300049590 Bacteria 56982
1380 Ga0501074_0006514 3300049590 Bacteria 8429
1381 Ga0501074_0015861 3300049590 Bacteria 5479
1382 Ga0501074_0020795 3300049590 Bacteria 4767
1383 Ga0501075_0028297 3300049591 Bacteria 4136
1384 Ga0501075_0031307 3300049591 Bacteria 3948
1385 Ga0501075_0065027 3300049591 Bacteria 2751
1386 Ga0501076_0000337 3300049592 Bacteria 28949
1387 Ga0501076_0002331 3300049592 Bacteria 13011
1388 Ga0501076_0027193 3300049592 Bacteria 4437
1389 Ga0501076_0043645 3300049592 Bacteria 3534
1390 Ga0501077_0038694 3300049593 Bacteria 3038
1391 Ga0501077_0067423 3300049593 Bacteria 2269
1392 Ga0501077_0086679 3300049593 Bacteria 1985
1393 Ga0501079_0009609 3300049741 Bacteria 7334
1394 Ga0501079_0025132 3300049741 Bacteria 4569
1395 Ga0501079_0058039 3300049741 Bacteria 2986
1396 Ga0501079_0069819 3300049741 Bacteria 2712
1397 Ga0501079_0071871 3300049741 Bacteria 2673
1398 Ga0501079_0103320 3300049741 Bacteria 2210
1399 Ga0501080_0000342 3300049742 Bacteria 35816
1400 Ga0501080_0000476 3300049742 Bacteria 31184
1401 Ga0501080_0000599 3300049742 Bacteria 28495
1402 Ga0501080_0003302 3300049742 Bacteria 14255
1403 Ga0501080_0080104 3300049742 Bacteria 3036
1404 Ga0501080_0126287 3300049742 Bacteria 2369
1405 Ga0501080_0126781 3300049742 Bacteria 2364
1406 Ga0501081_0001984 3300049743 Bacteria 12761
1407 Ga0501081_0008274 3300049743 Bacteria 6751
1408 Ga0501083_0000765 3300049744 Bacteria 21045
1409 Ga0501083_0002138 3300049744 Bacteria 13562
1410 Ga0501083_0007356 3300049744 Bacteria 7813
1411 Ga0501083_0013613 3300049744 Bacteria 5686
1412 Ga0501083_0042917 3300049744 Bacteria 3065
1413 Ga0501279_001251 3300049775 Bacteria 3344
1414 Ga0501035_0000300 3300049822 Bacteria 58171
1415 Ga0501035_0005485 3300049822 Bacteria 11985
1416 Ga0501035_0012407 3300049822 Bacteria 7877
1417 Ga0501035_0019919 3300049822 Bacteria 6162
1418 Ga0501035_0034003 3300049822 Bacteria 4633
1419 Ga0501035_0048332 3300049822 Bacteria 3815
1420 Ga0501035_0158625 3300049822 Bacteria 1959
1421 Ga0501044_0000028 3300049823 Bacteria 179203
1422 Ga0501044_0002168 3300049823 Bacteria 22515
1423 Ga0501044_0006203 3300049823 Bacteria 13211
1424 Ga0501044_0008979 3300049823 Bacteria 10929
1425 Ga0501044_0027416 3300049823 Bacteria 6020
1426 Ga0501044_0107446 3300049823 Bacteria 2801
1427 Ga0501045_0003147 3300049824 Bacteria 11286
1428 Ga0501045_0008635 3300049824 Bacteria 7102
1429 Ga0501045_0012663 3300049824 Bacteria 5938
1430 Ga0501045_0020968 3300049824 Bacteria 4672
1431 nmdc:mga03683_5726_c1 3300050489 Bacteria 4216
1432 nmdc:mga0yw44_14167_c1 3300050492 Bacteria 4222
1433 nmdc:mga0yw44_4982_c1 3300050492 Bacteria 6197
1434 nmdc:mga0yw44_62166_c1 3300050492 Bacteria 2293
1435 nmdc:mga0yw44_7896_c1 3300050492 Bacteria 5270
1436 nmdc:mga07m45_503_c1 3300050496 Bacteria 16544
1437 nmdc:mga07m45_6605_c2 3300050496 Bacteria 5691
1438 nmdc:mga07m45_7110_c1 3300050496 Bacteria 5700
1439 nmdc:mga05p37_46055_c1 3300050507 Bacteria 5363
1440 nmdc:mga05p37_512_c1 3300050507 Bacteria 42901
1441 nmdc:mga05p37_712_c1 3300050507 Bacteria 36873
1442 nmdc:mga09592_225_c1 3300050508 Bacteria 40713
1443 nmdc:mga09592_29911_c1 3300050508 Bacteria 4530
1444 nmdc:mga09592_30307_c1 3300050508 Bacteria 4501
1445 nmdc:mga09592_496_c1 3300050508 Bacteria 29603
1446 nmdc:mga09592_58871_c1 3300050508 Bacteria 3248
1447 nmdc:mga0qj67_160540_c1 3300050509 Bacteria 1825
1448 nmdc:mga0qj67_61308_c1 3300050509 Bacteria 2986
1449 nmdc:mga0qj67_62958_c1 3300050509 Bacteria 2949
1450 nmdc:mga0qj67_7506_c1 3300050509 Bacteria 8055
1451 nmdc:mga06r32_439_c1 3300050510 Bacteria 35271
1452 nmdc:mga08y16_32621_c1 3300050511 Bacteria 5474
1453 nmdc:mga08y16_34152_c1 3300050511 Bacteria 5343
1454 nmdc:mga08y16_9134_c1 3300050511 Bacteria 10406
1455 nmdc:mga0n895_1108_c1 3300050512 Bacteria 19675
1456 nmdc:mga0n895_1527_c1 3300050512 Bacteria 17386
1457 nmdc:mga0n895_23081_c1 3300050512 Bacteria 5844
1458 nmdc:mga0n895_90066_c1 3300050512 Bacteria 3069
1459 nmdc:mga0rr50_11010_c1 3300050513 Bacteria 5768
1460 nmdc:mga0rr50_14857_c1 3300050513 Bacteria 5124
1461 nmdc:mga0rr50_2902_c1 3300050513 Bacteria 9778
1462 nmdc:mga0rr50_30623_c1 3300050513 Bacteria 3812
1463 nmdc:mga08x19_16842_c1 3300050514 Bacteria 4464
1464 nmdc:mga08x19_19378_c1 3300050514 Bacteria 4174
1465 nmdc:mga08x19_45422_c1 3300050514 Bacteria 2808
1466 nmdc:mga0a205_179401_c1 3300050515 Bacteria 2012
1467 nmdc:mga0a205_2500_c1 3300050515 Bacteria 16211
1468 nmdc:mga0a205_85319_c1 3300050515 Bacteria 3049
1469 nmdc:mga0sz30_33994_c1 3300050516 Bacteria 2121
1470 nmdc:mga0sz30_40789_c1 3300050516 Bacteria 1951
1471 Ga0500635_0000039 3300053080 Bacteria 93004
1472 Ga0500635_0004585 3300053080 Bacteria 3567
1473 Ga0495595_0000064 3300053084 Bacteria 54079
1474 Ga0495595_0011328 3300053084 Bacteria 3725
1475 Ga0495595_0021702 3300053084 Bacteria 2808
1476 Ga0495619_0000995 3300053085 Bacteria 18591
1477 Ga0495619_0021913 3300053085 Bacteria 4084
1478 Ga0495619_0022271 3300053085 Bacteria 4053
1479 Ga0495619_0036626 3300053085 Bacteria 3195
1480 Ga0500578_0000040 3300053086 Bacteria 133601
1481 Ga0500643_000015 3300053087 Bacteria 310312
1482 Ga0500651_0001995 3300053093 Bacteria 10593
1483 Ga0500566_0000010 3300053094 Bacteria 119976
1484 Ga0500640_031403 3300053095 Bacteria 2327
1485 Ga0500650_0000121 3300053098 Bacteria 21143
1486 Ga0500554_027261 3300053102 Bacteria 1650
1487 Ga0500556_0000022 3300053104 Bacteria 174894
1488 Ga0500556_0000611 3300053104 Bacteria 22870
1489 Ga0500556_0000961 3300053104 Bacteria 15444
1490 Ga0500557_000002 3300053105 Bacteria 234207
1491 Ga0500571_015394 3300053110 Bacteria 4274
1492 Ga0500572_000031 3300053111 Bacteria 43489
1493 Ga0500593_000387 3300053117 Bacteria 17529
1494 Ga0500593_000627 3300053117 Bacteria 13548
1495 Ga0500595_000914 3300053119 Bacteria 16816
1496 Ga0500608_000321 3300053122 Bacteria 18349
1497 Ga0500608_064059 3300053122 Bacteria 1754
1498 Ga0500642_0000043 3300053130 Bacteria 84852
1499 Ga0500652_000133 3300053131 Bacteria 27855
1500 Ga0500658_0027562 3300053134 Bacteria 2198
1501 Ga0500559_0008850 3300053136 Bacteria 4384
1502 Ga0500568_0003061 3300053139 Bacteria 9548
1503 Ga0500616_0002646 3300053153 Bacteria 14590
1504 Ga0500616_0023420 3300053153 Bacteria 3440
1505 Ga0500622_0001741 3300053156 Bacteria 16823
1506 Ga0500622_0028141 3300053156 Bacteria 2959
1507 Ga0500627_0004513 3300053158 Bacteria 4488
1508 Ga0500639_000084 3300053163 Bacteria 44199
1509 Ga0500645_001733 3300053730 Bacteria 10579
1510 Ga0501084_0000111 3300054114 Bacteria 61429
1511 Ga0501084_0000907 3300054114 Bacteria 22887
1512 Ga0501084_0001128 3300054114 Bacteria 20843
1513 Ga0501084_0007216 3300054114 Bacteria 9158
1514 Ga0501084_0042590 3300054114 Bacteria 3798
1515 Ga0501084_0078522 3300054114 Bacteria 2767
1516 Ga0501084_0089174 3300054114 Bacteria 2589
1517 Ga0501084_0115344 3300054114 Bacteria 2258
1518 Ga0501082_0009535 3300060353 Bacteria 8354
1519 Ga0501082_0021656 3300060353 Bacteria 5541
1520 Ga0501082_0030399 3300060353 Bacteria 4655
1521 Ga0501082_0048022 3300060353 Bacteria 3679
1522 Ga0501082_0093964 3300060353 Bacteria 2591
1523 Ga0501082_0264404 3300060353 Bacteria 1497
1524 Ga0466962_0003462 3300061719 Bacteria 7525
1525 Ga0466962_0017705 3300061719 Bacteria 3430
1526 Ga0530510_0001617 3300061734 Bacteria 15209

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10021496 Ga0207662_100214962 398
2 3300046559 Ga0495667_0092464 Ga0495667_0092464_17_1222 399
3 3300049578 Ga0501042_0072607 Ga0501042_0072607_38_1318 423
4 3300060353 Ga0501082_0264404 Ga0501082_0264404_165_1481 435
5 3300025915 Ga0207693_10030540 Ga0207693_100305405 437
6 3300049741 Ga0501079_0058039 Ga0501079_0058039_1608_2957 446
7 3300046529 Ga0495652_0116214 Ga0495652_0116214_12_1442 462
8 3300049568 Ga0501031_0006699 Ga0501031_0006699_6091_7491 464
9 3300048928 Ga0496125_0032941 Ga0496125_0032941_2227_3927 465
10 iso_pu_bacteria 2551306087 2551697836 468
11 3300033180 Ga0307510_10106751 Ga0307510_101067512 470
12 3300039062 Ga0400483_239666 Ga0400483_239666_376_1821 471
13 3300049578 Ga0501042_0036041 Ga0501042_0036041_10_1533 472
14 iso_pu_bacteria 2551306090 2551721599 472
15 3300025986 Ga0207658_10012781 Ga0207658_100127812 474
16 iso_pu_bacteria 2551306092 2551735403 474
17 3300046559 Ga0495667_0132831 Ga0495667_0132831_50_1477 475
18 iso_pu_bacteria 2551306089 2551708264 475
19 3300049583 Ga0501067_0010995 Ga0501067_0010995_1650_3080 476
20 3300048909 Ga0496106_0082060 Ga0496106_0082060_925_2424 479
21 3300045976 Ga0466967_0035194 Ga0466967_0035194_1346_2845 481
22 3300009147 Ga0114129_10175477 Ga0114129_101754772 482
23 3300035692 Ga0373935_0149847 Ga0373935_0149847_17_1471 482
24 3300048904 Ga0496101_0199414 Ga0496101_0199414_12_1460 482
25 3300048924 Ga0496121_0176326 Ga0496121_0176326_41_1489 482
26 3300048929 Ga0496126_0025520 Ga0496126_0025520_4200_5648 482
27 3300049568 Ga0501031_0068113 Ga0501031_0068113_36_1484 482
28 3300049572 Ga0501036_0157786 Ga0501036_0157786_424_1872 482
29 3300050492 nmdc:mga0yw44_4982_c1 nmdc:mga0yw44_4982_c1_1166_2677 484
30 3300046675 Ga0495657_0041833 Ga0495657_0041833_106_1605 485
31 3300053085 Ga0495619_0022271 Ga0495619_0022271_1946_3415 487
32 3300005329 Ga0070683_100002520 Ga0070683_1000025202 488
33 3300005337 Ga0070682_100010975 Ga0070682_1000109756 488
34 3300005458 Ga0070681_10042524 Ga0070681_100425242 488
35 3300005535 Ga0070684_100003247 Ga0070684_1000032473 488
36 3300005614 Ga0068856_100024791 Ga0068856_1000247916 488
37 3300005985 Ga0081539_10011542 Ga0081539_100115423 488
38 3300025921 Ga0207652_10002113 Ga0207652_1000211310 488
39 3300025927 Ga0207687_10001209 Ga0207687_100012098 488
40 3300025935 Ga0207709_10055086 Ga0207709_100550861 488
41 3300025944 Ga0207661_10003557 Ga0207661_100035572 488
42 3300048905 Ga0496102_0019661 Ga0496102_0019661_1785_3344 488
43 3300048908 Ga0496105_0018449 Ga0496105_0018449_3184_4743 488
44 3300048911 Ga0496108_0094016 Ga0496108_0094016_891_2519 488
45 3300048917 Ga0496114_0000208 Ga0496114_0000208_8906_10465 488
46 3300049571 Ga0501034_0044594 Ga0501034_0044594_720_2345 488
47 3300049586 Ga0501070_0004387 Ga0501070_0004387_3426_5051 488
48 3300049588 Ga0501072_0028417 Ga0501072_0028417_647_2272 488
49 3300049589 Ga0501073_0073952 Ga0501073_0073952_204_1829 488
50 3300053102 Ga0500554_027261 Ga0500554_027261_12_1529 488
51 3300060353 Ga0501082_0030399 Ga0501082_0030399_2151_3776 488
52 3300005471 Ga0070698_100033831 Ga0070698_1000338312 489
53 3300044683 Ga0466965_0050337 Ga0466965_0050337_290_1825 489
54 3300044901 Ga0466960_0042521 Ga0466960_0042521_471_2006 489
55 3300049742 Ga0501080_0080104 Ga0501080_0080104_10_1503 489
56 3300005327 Ga0070658_10081232 Ga0070658_100812323 490
57 3300050492 nmdc:mga0yw44_7896_c1 nmdc:mga0yw44_7896_c1_1839_3413 491
58 3300048905 Ga0496102_0128299 Ga0496102_0128299_13_1545 492
59 3300049587 Ga0501071_0015105 Ga0501071_0015105_1847_3403 492
60 3300049592 Ga0501076_0043645 Ga0501076_0043645_391_1947 492
61 3300005548 Ga0070665_100004574 Ga0070665_1000045743 493
62 iso_pu_bacteria 2773857762 2774395289 494
63 iso_pu_bacteria 2808606439 2809193872 494
64 3300005543 Ga0070672_100018023 Ga0070672_1000180232 495
65 3300049568 Ga0501031_0045163 Ga0501031_0045163_941_2536 496
66 3300049582 Ga0501048_0016054 Ga0501048_0016054_728_2323 496
67 3300049587 Ga0501071_0007283 Ga0501071_0007283_2268_3863 496
68 3300049592 Ga0501076_0027193 Ga0501076_0027193_565_2160 496
69 3300049593 Ga0501077_0038694 Ga0501077_0038694_1039_2634 496
70 3300049742 Ga0501080_0126287 Ga0501080_0126287_558_2153 496
71 3300054114 Ga0501084_0007216 Ga0501084_0007216_4468_6063 496
72 iso_pu_bacteria 2643221615 2644092159 496
73 iso_pu_bacteria 2643221657 2644321962 496
74 3300005456 Ga0070678_100004435 Ga0070678_1000044352 497
75 3300005843 Ga0068860_100000253 Ga0068860_10000025361 497
76 3300006358 Ga0068871_100011189 Ga0068871_1000111894 497
77 3300026121 Ga0207683_10000123 Ga0207683_1000012311 497
78 3300028381 Ga0268264_10000220 Ga0268264_1000022040 497
79 3300047322 Ga0495680_0035962 Ga0495680_0035962_1946_3445 497
80 3300048907 Ga0496104_0009904 Ga0496104_0009904_6950_8494 497
81 3300050514 nmdc:mga08x19_45422_c1 nmdc:mga08x19_45422_c1_191_1690 497
82 3300053084 Ga0495595_0021702 Ga0495595_0021702_1214_2713 497
83 3300006844 Ga0075428_100015422 Ga0075428_1000154222 498
84 3300006846 Ga0075430_100008937 Ga0075430_1000089372 498
85 3300009094 Ga0111539_10051137 Ga0111539_100511372 498
86 3300027907 Ga0207428_10056370 Ga0207428_100563703 498
87 3300045049 Ga0466959_0000394 Ga0466959_0000394_19037_20539 498
88 3300050507 nmdc:mga05p37_512_c1 nmdc:mga05p37_512_c1_38788_40401 498
89 3300050508 nmdc:mga09592_225_c1 nmdc:mga09592_225_c1_8167_9780 498
90 3300050509 nmdc:mga0qj67_7506_c1 nmdc:mga0qj67_7506_c1_645_2258 498
91 3300050510 nmdc:mga06r32_439_c1 nmdc:mga06r32_439_c1_28595_30208 498
92 3300050511 nmdc:mga08y16_9134_c1 nmdc:mga08y16_9134_c1_8723_10336 498
93 iso_pu_bacteria 2891968417 2891973654 498
94 3300005439 Ga0070711_100070951 Ga0070711_1000709512 499
95 3300005985 Ga0081539_10002997 Ga0081539_1000299716 499
96 3300047319 Ga0495674_0019982 Ga0495674_0019982_1928_3487 499
97 3300048903 Ga0496100_0001853 Ga0496100_0001853_931_2490 499
98 3300048905 Ga0496102_0002544 Ga0496102_0002544_6341_7900 499
99 3300048907 Ga0496104_0001544 Ga0496104_0001544_7140_8699 499
100 3300048908 Ga0496105_0090312 Ga0496105_0090312_492_2051 499
101 3300048910 Ga0496107_0000933 Ga0496107_0000933_8219_9778 499
102 3300048911 Ga0496108_0023669 Ga0496108_0023669_132_1691 499
103 3300048913 Ga0496110_0039373 Ga0496110_0039373_1398_2957 499
104 3300048914 Ga0496111_0089710 Ga0496111_0089710_224_1783 499
105 3300048914 Ga0496111_0168652 Ga0496111_0168652_30_1589 499
106 3300048917 Ga0496114_0004155 Ga0496114_0004155_1425_2984 499
107 3300048917 Ga0496114_0020869 Ga0496114_0020869_605_2164 499
108 3300048918 Ga0496115_0000406 Ga0496115_0000406_16479_18038 499
109 3300005937 Ga0081455_10000525 Ga0081455_1000052514 500
110 3300005981 Ga0081538_10003883 Ga0081538_100038834 500
111 3300038443 Ga0395901_0044297 Ga0395901_0044297_1469_3037 500
112 3300046463 Ga0495653_0116844 Ga0495653_0116844_42_1595 500
113 iso_pu_bacteria 2857481737 2857484431 500
114 3300039438 Ga0436360_0965900 Ga0436360_0965900_174_1736 501
115 3300046642 Ga0495634_0043826 Ga0495634_0043826_339_1898 501
116 3300025294 Ga0209025_1017124 Ga0209025_10171242 502
117 3300025297 Ga0209758_1007220 Ga0209758_10072203 502
118 3300025927 Ga0207687_10037904 Ga0207687_100379044 502
119 3300044901 Ga0466960_0003202 Ga0466960_0003202_3666_5186 502
120 3300045976 Ga0466967_0005413 Ga0466967_0005413_1249_2811 502
121 3300048916 Ga0496113_0103365 Ga0496113_0103365_163_1725 502
122 3300049581 Ga0501047_0010493 Ga0501047_0010493_4982_6544 502
123 3300049588 Ga0501072_0021437 Ga0501072_0021437_2926_4539 502
124 3300049741 Ga0501079_0069819 Ga0501079_0069819_261_1874 502
125 3300060353 Ga0501082_0048022 Ga0501082_0048022_1695_3308 502
126 iso_pu_bacteria 2811994878 2812348617 502
127 3300044693 Ga0466961_0019806 Ga0466961_0019806_152_1708 503
128 iso_pu_bacteria 8016630954 8016640612 503
129 3300003203 JGI25406J46586_10013251 JGI25406J46586_100132512 504
130 3300005344 Ga0070661_100031498 Ga0070661_1000314982 504
131 3300005435 Ga0070714_100024992 Ga0070714_1000249923 504
132 3300005842 Ga0068858_100109774 Ga0068858_1001097742 504
133 3300005985 Ga0081539_10002418 Ga0081539_1000241826 504
134 3300006852 Ga0075433_10003619 Ga0075433_100036192 504
135 3300006871 Ga0075434_100002400 Ga0075434_10000240011 504
136 3300006871 Ga0075434_100096958 Ga0075434_1000969583 504
137 3300006914 Ga0075436_100004352 Ga0075436_10000435210 504
138 3300007076 Ga0075435_100000265 Ga0075435_10000026510 504
139 3300007076 Ga0075435_100014752 Ga0075435_1000147524 504
140 3300021384 Ga0213876_10036700 Ga0213876_100367002 504
141 3300025936 Ga0207670_10043643 Ga0207670_100436433 504
142 3300026035 Ga0207703_10127395 Ga0207703_101273952 504
143 3300039062 Ga0400483_128917 Ga0400483_128917_611_2170 504
144 3300045976 Ga0466967_0001288 Ga0466967_0001288_9180_10700 504
145 3300050513 nmdc:mga0rr50_14857_c1 nmdc:mga0rr50_14857_c1_3508_5106 504
146 3300053104 Ga0500556_0000961 Ga0500556_0000961_505_2022 504
147 iso_pu_bacteria 2643221641 2644231839 504
148 iso_pu_bacteria 2739367898 2740168789 504
149 3300013306 Ga0163162_10241039 Ga0163162_102410392 505
150 3300026078 Ga0207702_10000337 Ga0207702_1000033734 505
151 3300031728 Ga0316578_10033710 Ga0316578_100337102 505
152 3300035398 Ga0316574_0016862 Ga0316574_0016862_2346_3929 505
153 3300048905 Ga0496102_0201107 Ga0496102_0201107_309_1844 505
154 3300049572 Ga0501036_0031880 Ga0501036_0031880_1842_3380 505
155 3300054114 Ga0501084_0078522 Ga0501084_0078522_12_1550 505
156 iso_pu_bacteria 2643221697 2644539309 506
157 iso_pu_bacteria 8054609563 8054611699 506
158 3300005435 Ga0070714_100049920 Ga0070714_1000499202 507
159 3300005545 Ga0070695_100010900 Ga0070695_1000109005 507
160 3300025912 Ga0207707_10002051 Ga0207707_1000205111 507
161 3300025916 Ga0207663_10101314 Ga0207663_101013142 507
162 3300028800 Ga0265338_10052193 Ga0265338_100521932 507
163 3300042461 Ga0439460_0003588 Ga0439460_0003588_953_2476 507
164 3300049588 Ga0501072_0034545 Ga0501072_0034545_974_2557 507
165 3300049589 Ga0501073_0098755 Ga0501073_0098755_352_1935 507
166 3300049593 Ga0501077_0067423 Ga0501077_0067423_656_2239 507
167 3300049744 Ga0501083_0042917 Ga0501083_0042917_827_2410 507
168 3300050509 nmdc:mga0qj67_62958_c1 nmdc:mga0qj67_62958_c1_1185_2708 507
169 3300050515 nmdc:mga0a205_85319_c1 nmdc:mga0a205_85319_c1_11_1534 507
170 iso_pu_bacteria 2643221961 2645721569 507
171 iso_pu_bacteria 2643221962 2645724475 507
172 iso_pu_bacteria 2984576629 2984577595 507
173 iso_pu_bacteria 2990256926 2990259753 507
174 3300025949 Ga0207667_10006874 Ga0207667_1000687411 508
175 iso_pu_bacteria 2643221681 2644455265 508
176 3300010375 Ga0105239_10001197 Ga0105239_1000119732 509
177 3300048905 Ga0496102_0042879 Ga0496102_0042879_1195_2751 509
178 3300003761 Ga0055535_1000308 Ga0055535_100030840 510
179 3300003762 Ga0055542_1000036 Ga0055542_10000367 510
180 3300025229 Ga0209147_101035 Ga0209147_1010357 510
181 3300025242 Ga0209258_100091 Ga0209258_1000917 510
182 3300025254 Ga0209148_1000033 Ga0209148_1000033477 510
183 3300025263 Ga0209565_1002766 Ga0209565_10027662 510
184 3300025291 Ga0209675_1012694 Ga0209675_10126942 510
185 3300025294 Ga0209025_1016423 Ga0209025_10164232 510
186 3300025295 Ga0209564_1001716 Ga0209564_10017163 510
187 3300025297 Ga0209758_1011179 Ga0209758_10111794 510
188 3300025299 Ga0209256_1000065 Ga0209256_1000065176 510
189 3300031852 Ga0307410_10036376 Ga0307410_100363761 510
190 3300039447 Ga0436361_0394184 Ga0436361_0394184_7336_8964 510
191 iso_pu_bacteria 2885366525 2885372289 510
192 3300025292 Ga0209676_1000931 Ga0209676_100093126 511
193 3300025298 Ga0209050_1000447 Ga0209050_100044723 511
194 3300025303 Ga0209051_1001259 Ga0209051_100125914 511
195 3300025304 Ga0209257_1000417 Ga0209257_100041726 511
196 3300031730 Ga0307516_10006540 Ga0307516_100065403 511
197 3300044735 Ga0466968_0001573 Ga0466968_0001573_2808_4346 511
198 3300044901 Ga0466960_0009154 Ga0466960_0009154_1555_3093 511
199 3300048923 Ga0496120_0017294 Ga0496120_0017294_3085_4623 511
200 3300048927 Ga0496124_0107817 Ga0496124_0107817_608_2149 511
201 3300005518 Ga0070699_100039502 Ga0070699_1000395023 512
202 3300035724 Ga0373933_0025582 Ga0373933_0025582_749_2356 512
203 3300046678 Ga0495599_0069268 Ga0495599_0069268_516_2096 512
204 3300048917 Ga0496114_0020551 Ga0496114_0020551_2836_4449 512
205 3300049586 Ga0501070_0126075 Ga0501070_0126075_217_1779 512
206 iso_pu_bacteria 2643221542 2643733773 512
207 iso_pu_bacteria 2643221630 2644170354 512
208 iso_pu_bacteria 2643221724 2644680043 512
209 iso_pu_bacteria 2728369380 2730229541 512
210 iso_pu_bacteria 2747842429 2747951793 512
211 3300005364 Ga0070673_100009622 Ga0070673_1000096223 513
212 3300005455 Ga0070663_100013477 Ga0070663_1000134772 513
213 3300005458 Ga0070681_10171566 Ga0070681_101715662 513
214 3300005471 Ga0070698_100041887 Ga0070698_1000418873 513
215 3300005530 Ga0070679_100038055 Ga0070679_1000380552 513
216 3300005535 Ga0070684_100106450 Ga0070684_1001064502 513
217 3300025912 Ga0207707_10114941 Ga0207707_101149412 513
218 3300025921 Ga0207652_10002264 Ga0207652_1000226413 513
219 3300025944 Ga0207661_10213964 Ga0207661_102139641 513
220 3300026067 Ga0207678_10002335 Ga0207678_100023352 513
221 3300049579 Ga0501043_0008771 Ga0501043_0008771_3420_4976 513
222 iso_pu_bacteria 2643221561 2643825117 513
223 iso_pu_bacteria 2643221696 2644534579 513
224 3300005983 Ga0081540_1006873 Ga0081540_10068733 514
225 3300025302 Ga0207426_1001977 Ga0207426_10019773 514
226 3300039438 Ga0436360_0242974 Ga0436360_0242974_1432_2976 514
227 3300045051 Ga0451576_0145422 Ga0451576_0145422_637_2223 514
228 3300046559 Ga0495667_0053610 Ga0495667_0053610_1089_2633 514
229 3300047472 Ga0495686_0007525 Ga0495686_0007525_6189_7733 514
230 iso_pu_bacteria 2773857759 2774382791 514
231 iso_pu_bacteria 2984592036 2984592889 514
232 3300046507 Ga0495606_0055199 Ga0495606_0055199_969_2555 515
233 3300049744 Ga0501083_0007356 Ga0501083_0007356_3903_5453 515
234 3300006163 Ga0070715_10007253 Ga0070715_100072535 516
235 3300025915 Ga0207693_10046133 Ga0207693_100461332 516
236 3300025927 Ga0207687_10106109 Ga0207687_101061092 516
237 3300032004 Ga0307414_10021938 Ga0307414_100219382 516
238 3300048906 Ga0496103_0099047 Ga0496103_0099047_52_1611 516
239 3300048906 Ga0496103_0102244 Ga0496103_0102244_85_1644 516
240 3300048908 Ga0496105_0040586 Ga0496105_0040586_203_1762 516
241 3300048910 Ga0496107_0057794 Ga0496107_0057794_1070_2629 516
242 3300048912 Ga0496109_0055526 Ga0496109_0055526_623_2182 516
243 3300048914 Ga0496111_0017456 Ga0496111_0017456_1352_2911 516
244 3300048925 Ga0496122_0007800 Ga0496122_0007800_3672_5261 516
245 3300005981 Ga0081538_10015080 Ga0081538_100150804 517
246 3300006871 Ga0075434_100104246 Ga0075434_1001042461 517
247 3300007076 Ga0075435_100021661 Ga0075435_1000216615 517
248 3300028577 Ga0265318_10020381 Ga0265318_100203813 517
249 3300031649 Ga0307514_10047240 Ga0307514_100472402 517
250 3300035170 Ga0373943_0038304 Ga0373943_0038304_434_1993 517
251 3300037466 Ga0395898_0002136 Ga0395898_0002136_9605_11164 517
252 3300037466 Ga0395898_0061367 Ga0395898_0061367_1608_3209 517
253 3300046477 Ga0495664_0051708 Ga0495664_0051708_233_1792 517
254 3300046518 Ga0495631_0000844 Ga0495631_0000844_16984_18606 517
255 3300046675 Ga0495657_0037606 Ga0495657_0037606_1293_2861 517
256 3300047317 Ga0495604_0101818 Ga0495604_0101818_37_1596 517
257 3300047319 Ga0495674_0009149 Ga0495674_0009149_4248_5807 517
258 3300048903 Ga0496100_0008025 Ga0496100_0008025_3220_4848 517
259 3300048905 Ga0496102_0050955 Ga0496102_0050955_778_2406 517
260 3300048907 Ga0496104_0000334 Ga0496104_0000334_11403_13031 517
261 3300048907 Ga0496104_0012289 Ga0496104_0012289_2814_4373 517
262 3300048908 Ga0496105_0000114 Ga0496105_0000114_41775_43403 517
263 3300048913 Ga0496110_0006909 Ga0496110_0006909_3764_5323 517
264 3300048913 Ga0496110_0008766 Ga0496110_0008766_339_1967 517
265 3300048914 Ga0496111_0000116 Ga0496111_0000116_26586_28214 517
266 3300048914 Ga0496111_0031131 Ga0496111_0031131_677_2236 517
267 3300048917 Ga0496114_0000497 Ga0496114_0000497_8370_9998 517
268 3300049569 Ga0501032_0022099 Ga0501032_0022099_646_2205 517
269 3300049570 Ga0501033_0004074 Ga0501033_0004074_3234_4793 517
270 3300049572 Ga0501036_0002532 Ga0501036_0002532_3076_4635 517
271 3300049573 Ga0501037_0002486 Ga0501037_0002486_8604_10163 517
272 3300049575 Ga0501039_0003332 Ga0501039_0003332_7072_8631 517
273 3300049576 Ga0501040_0005237 Ga0501040_0005237_3017_4576 517
274 3300049578 Ga0501042_0010828 Ga0501042_0010828_2897_4456 517
275 3300049580 Ga0501046_0004377 Ga0501046_0004377_6290_7849 517
276 3300049582 Ga0501048_0003281 Ga0501048_0003281_6970_8529 517
277 3300049584 Ga0501068_0000820 Ga0501068_0000820_2949_4508 517
278 3300049585 Ga0501069_0002228 Ga0501069_0002228_139_1698 517
279 3300049586 Ga0501070_0011450 Ga0501070_0011450_2914_4473 517
280 3300049588 Ga0501072_0014012 Ga0501072_0014012_1460_3019 517
281 3300049589 Ga0501073_0001985 Ga0501073_0001985_12592_14151 517
282 3300049590 Ga0501074_0006514 Ga0501074_0006514_4550_6109 517
283 3300049591 Ga0501075_0028297 Ga0501075_0028297_2000_3559 517
284 3300049591 Ga0501075_0031307 Ga0501075_0031307_2199_3758 517
285 3300049742 Ga0501080_0003302 Ga0501080_0003302_1609_3168 517
286 3300049743 Ga0501081_0008274 Ga0501081_0008274_1642_3201 517
287 3300049744 Ga0501083_0013613 Ga0501083_0013613_3027_4586 517
288 3300049822 Ga0501035_0005485 Ga0501035_0005485_8751_10310 517
289 3300050489 nmdc:mga03683_5726_c1 nmdc:mga03683_5726_c1_462_2120 517
290 3300050512 nmdc:mga0n895_23081_c1 nmdc:mga0n895_23081_c1_185_1744 517
291 3300050513 nmdc:mga0rr50_11010_c1 nmdc:mga0rr50_11010_c1_4081_5640 517
292 3300053085 Ga0495619_0036626 Ga0495619_0036626_1025_2584 517
293 3300060353 Ga0501082_0021656 Ga0501082_0021656_1086_2645 517
294 iso_pu_bacteria 2855386786 2855390386 517
295 3300005335 Ga0070666_10000934 Ga0070666_100009342 518
296 3300005471 Ga0070698_100017687 Ga0070698_1000176872 518
297 3300005544 Ga0070686_100044593 Ga0070686_1000445933 518
298 3300005548 Ga0070665_100008438 Ga0070665_1000084382 518
299 3300005981 Ga0081538_10001832 Ga0081538_1000183218 518
300 3300006852 Ga0075433_10065998 Ga0075433_100659984 518
301 3300006881 Ga0068865_100014246 Ga0068865_1000142463 518
302 3300009094 Ga0111539_10000584 Ga0111539_1000058436 518
303 3300009148 Ga0105243_10006862 Ga0105243_100068624 518
304 3300009176 Ga0105242_10007348 Ga0105242_100073486 518
305 3300013297 Ga0157378_10002977 Ga0157378_100029776 518
306 3300014968 Ga0157379_10005458 Ga0157379_100054585 518
307 3300027695 Ga0209966_1003206 Ga0209966_10032063 518
308 3300027717 Ga0209998_10000408 Ga0209998_100004084 518
309 3300027876 Ga0209974_10001049 Ga0209974_100010496 518
310 3300028379 Ga0268266_10000190 Ga0268266_1000019010 518
311 3300028379 Ga0268266_10052019 Ga0268266_100520192 518
312 3300048906 Ga0496103_0024204 Ga0496103_0024204_1561_3123 518
313 3300048908 Ga0496105_0044334 Ga0496105_0044334_287_1894 518
314 3300048910 Ga0496107_0021676 Ga0496107_0021676_2865_4472 518
315 3300048917 Ga0496114_0024569 Ga0496114_0024569_1239_2846 518
316 3300048919 Ga0496116_0000600 Ga0496116_0000600_27535_29097 518
317 3300048920 Ga0496117_0007455 Ga0496117_0007455_1973_3535 518
318 3300048922 Ga0496119_0003780 Ga0496119_0003780_9419_10981 518
319 3300048924 Ga0496121_0057624 Ga0496121_0057624_1359_2921 518
320 3300048928 Ga0496125_0047535 Ga0496125_0047535_1244_2806 518
321 3300048929 Ga0496126_0009379 Ga0496126_0009379_5580_7142 518
322 3300048929 Ga0496126_0038634 Ga0496126_0038634_2472_4034 518
323 3300049577 Ga0501041_0063804 Ga0501041_0063804_385_1947 518
324 3300049585 Ga0501069_0002802 Ga0501069_0002802_4044_5606 518
325 3300049586 Ga0501070_0071430 Ga0501070_0071430_944_2506 518
326 3300049587 Ga0501071_0105512 Ga0501071_0105512_271_1833 518
327 3300049590 Ga0501074_0020795 Ga0501074_0020795_428_1990 518
328 3300005331 Ga0070670_100004996 Ga0070670_10000499611 519
329 3300005618 Ga0068864_100025538 Ga0068864_1000255385 519
330 3300005843 Ga0068860_100049570 Ga0068860_1000495702 519
331 3300005844 Ga0068862_100000492 Ga0068862_10000049232 519
332 3300005981 Ga0081538_10001281 Ga0081538_1000128127 519
333 3300005985 Ga0081539_10004249 Ga0081539_1000424910 519
334 3300005985 Ga0081539_10014676 Ga0081539_100146764 519
335 3300009553 Ga0105249_10006840 Ga0105249_1000684013 519
336 3300025925 Ga0207650_10014656 Ga0207650_100146566 519
337 3300025961 Ga0207712_10014233 Ga0207712_100142336 519
338 3300025972 Ga0207668_10005766 Ga0207668_100057662 519
339 3300026095 Ga0207676_10013864 Ga0207676_100138642 519
340 3300028380 Ga0268265_10001435 Ga0268265_1000143515 519
341 3300046660 Ga0495625_0000032 Ga0495625_0000032_119262_120824 519
342 3300048922 Ga0496119_0001210 Ga0496119_0001210_10170_11777 519
343 3300005458 Ga0070681_10150280 Ga0070681_101502801 520
344 3300005548 Ga0070665_100038984 Ga0070665_1000389842 520
345 3300028379 Ga0268266_10032638 Ga0268266_100326381 520
346 3300037853 Ga0436364_1323953 Ga0436364_1323953_37_1620 520
347 iso_pu_bacteria 2738543034 2739364180 520
348 iso_pu_bacteria 2928115317 2928119829 520
349 3300005327 Ga0070658_10001297 Ga0070658_1000129727 521
350 3300005445 Ga0070708_100035997 Ga0070708_1000359973 521
351 3300005467 Ga0070706_100000369 Ga0070706_10000036942 521
352 3300005467 Ga0070706_100024617 Ga0070706_1000246173 521
353 3300005471 Ga0070698_100013970 Ga0070698_1000139702 521
354 3300005471 Ga0070698_100048036 Ga0070698_1000480364 521
355 3300005518 Ga0070699_100022285 Ga0070699_1000222854 521
356 3300005563 Ga0068855_100037776 Ga0068855_1000377762 521
357 3300006038 Ga0075365_10005337 Ga0075365_100053374 521
358 3300013104 Ga0157370_10017083 Ga0157370_100170833 521
359 3300013297 Ga0157378_10138858 Ga0157378_101388582 521
360 3300025909 Ga0207705_10000006 Ga0207705_1000000645 521
361 3300025910 Ga0207684_10000077 Ga0207684_10000077139 521
362 3300025922 Ga0207646_10016391 Ga0207646_100163915 521
363 3300025949 Ga0207667_10089052 Ga0207667_100890522 521
364 3300026067 Ga0207678_10018918 Ga0207678_100189182 521
365 3300031251 Ga0265327_10000018 Ga0265327_10000018433 521
366 3300037418 Ga0395900_0241507 Ga0395900_0241507_38_1621 521
367 3300049577 Ga0501041_0046595 Ga0501041_0046595_525_2123 521
368 3300050516 nmdc:mga0sz30_40789_c1 nmdc:mga0sz30_40789_c1_267_1874 521
369 3300054114 Ga0501084_0089174 Ga0501084_0089174_322_1920 521
370 3300005435 Ga0070714_100038399 Ga0070714_1000383993 522
371 3300009766 Ga0123342_1008310 Ga0123342_10083103 522
372 3300031616 Ga0307508_10098651 Ga0307508_100986513 522
373 3300037466 Ga0395898_0012425 Ga0395898_0012425_583_2157 522
374 3300038443 Ga0395901_0009034 Ga0395901_0009034_3850_5424 522
375 3300039062 Ga0400483_041877 Ga0400483_041877_9175_10743 522
376 3300048925 Ga0496122_0003710 Ga0496122_0003710_505_2112 522
377 3300048926 Ga0496123_0008925 Ga0496123_0008925_405_2012 522
378 iso_pu_bacteria 2954767861 2954769251 522
379 3300037418 Ga0395900_0013503 Ga0395900_0013503_4099_5742 523
380 3300037466 Ga0395898_0021799 Ga0395898_0021799_2585_4228 523
381 3300038443 Ga0395901_0040984 Ga0395901_0040984_2124_3767 523
382 3300042437 Ga0439444_0001693 Ga0439444_0001693_1228_2799 523
383 3300049574 Ga0501038_0015376 Ga0501038_0015376_3404_5008 523
384 iso_pu_bacteria 2939657138 2939658476 523
385 iso_pu_bacteria 637000159 637078049 523
386 3300031995 Ga0307409_100103549 Ga0307409_1001035492 524
387 3300032002 Ga0307416_100008902 Ga0307416_1000089023 524
388 3300044842 Ga0466957_0067691 Ga0466957_0067691_309_1889 524
389 3300045976 Ga0466967_0039274 Ga0466967_0039274_51_1631 524
390 iso_pu_bacteria 2904541872 2904547285 524
391 iso_pu_bacteria 2932398195 2932400423 524
392 iso_pu_bacteria 2977558990 2977565778 524
393 3300005338 Ga0068868_100056123 Ga0068868_1000561232 525
394 3300005435 Ga0070714_100002055 Ga0070714_10000205512 525
395 3300005435 Ga0070714_100082076 Ga0070714_1000820763 525
396 3300005437 Ga0070710_10028988 Ga0070710_100289882 525
397 3300005563 Ga0068855_100000104 Ga0068855_10000010415 525
398 3300013296 Ga0157374_10072501 Ga0157374_100725013 525
399 3300021377 Ga0213874_10002184 Ga0213874_100021843 525
400 3300021388 Ga0213875_10000001 Ga0213875_100000011006 525
401 3300025929 Ga0207664_10000542 Ga0207664_1000054229 525
402 3300025929 Ga0207664_10097651 Ga0207664_100976513 525
403 3300025944 Ga0207661_10046617 Ga0207661_100466173 525
404 3300025949 Ga0207667_10000058 Ga0207667_10000058196 525
405 3300026078 Ga0207702_10033148 Ga0207702_100331483 525
406 3300028794 Ga0307515_10000975 Ga0307515_1000097510 525
407 3300031456 Ga0307513_10108064 Ga0307513_101080641 525
408 3300031995 Ga0307409_100082576 Ga0307409_1000825762 525
409 3300037853 Ga0436364_0273345 Ga0436364_0273345_1030014_1031597 525
410 3300039437 Ga0436365_0613835 Ga0436365_0613835_7879_9462 525
411 3300039453 Ga0436362_0933513 Ga0436362_0933513_2569_4152 525
412 3300044694 Ga0466963_0017627 Ga0466963_0017627_860_2443 525
413 3300044901 Ga0466960_0014600 Ga0466960_0014600_1030_2613 525
414 3300045836 Ga0466958_0023126 Ga0466958_0023126_1151_2734 525
415 3300045976 Ga0466967_0003130 Ga0466967_0003130_782_2365 525
416 3300048904 Ga0496101_0095470 Ga0496101_0095470_85_1668 525
417 3300048914 Ga0496111_0004674 Ga0496111_0004674_883_2466 525
418 3300048918 Ga0496115_0001480 Ga0496115_0001480_8287_9870 525
419 3300049569 Ga0501032_0005601 Ga0501032_0005601_1235_2839 525
420 3300049569 Ga0501032_0076794 Ga0501032_0076794_60_1667 525
421 3300049570 Ga0501033_0000025 Ga0501033_0000025_48943_50547 525
422 3300049571 Ga0501034_0000656 Ga0501034_0000656_39918_41522 525
423 3300049572 Ga0501036_0004395 Ga0501036_0004395_5581_7185 525
424 3300049573 Ga0501037_0000034 Ga0501037_0000034_76738_78342 525
425 3300049574 Ga0501038_0000286 Ga0501038_0000286_23082_24686 525
426 3300049579 Ga0501043_0001282 Ga0501043_0001282_8041_9645 525
427 3300049581 Ga0501047_0000061 Ga0501047_0000061_23178_24782 525
428 3300049582 Ga0501048_0000009 Ga0501048_0000009_31600_33204 525
429 3300049584 Ga0501068_0000288 Ga0501068_0000288_18322_19926 525
430 3300049585 Ga0501069_0000266 Ga0501069_0000266_8799_10403 525
431 3300049586 Ga0501070_0097520 Ga0501070_0097520_92_1696 525
432 3300049588 Ga0501072_0001729 Ga0501072_0001729_6696_8300 525
433 3300049590 Ga0501074_0000048 Ga0501074_0000048_12417_14021 525
434 3300049741 Ga0501079_0009609 Ga0501079_0009609_2203_3807 525
435 3300049742 Ga0501080_0000342 Ga0501080_0000342_4495_6099 525
436 3300049744 Ga0501083_0000765 Ga0501083_0000765_9953_11557 525
437 3300049822 Ga0501035_0000300 Ga0501035_0000300_39189_40793 525
438 3300049823 Ga0501044_0000028 Ga0501044_0000028_51419_53023 525
439 3300054114 Ga0501084_0001128 Ga0501084_0001128_9075_10679 525
440 iso_pu_bacteria 2551306086 2551692458 525
441 iso_pu_bacteria 2738543013 2739249738 525
442 iso_pu_bacteria 2885192300 2885193240 525
443 3300005366 Ga0070659_100049370 Ga0070659_1000493702 526
444 3300006844 Ga0075428_100029340 Ga0075428_1000293404 526
445 3300006847 Ga0075431_100163836 Ga0075431_1001638362 526
446 3300009093 Ga0105240_10202053 Ga0105240_102020532 526
447 3300011119 Ga0105246_10045437 Ga0105246_100454372 526
448 3300025913 Ga0207695_10143712 Ga0207695_101437122 526
449 3300027682 Ga0209971_1001823 Ga0209971_10018233 526
450 3300031456 Ga0307513_10000072 Ga0307513_1000007248 526
451 3300035118 Ga0373954_0000028 Ga0373954_0000028_42869_44449 526
452 3300035172 Ga0373955_0009467 Ga0373955_0009467_1805_3385 526
453 3300036401 Ga0373937_0001199 Ga0373937_0001199_5769_7349 526
454 3300036401 Ga0373937_0143850 Ga0373937_0143850_589_2169 526
455 3300042461 Ga0439460_0000526 Ga0439460_0000526_4182_5762 526
456 3300046513 Ga0495616_0010237 Ga0495616_0010237_494_2104 526
457 3300049588 Ga0501072_0011452 Ga0501072_0011452_2121_3710 526
458 3300049592 Ga0501076_0002331 Ga0501076_0002331_3696_5276 526
459 3300049741 Ga0501079_0025132 Ga0501079_0025132_2919_4499 526
460 3300049743 Ga0501081_0001984 Ga0501081_0001984_4502_6082 526
461 3300049824 Ga0501045_0012663 Ga0501045_0012663_4267_5847 526
462 3300053104 Ga0500556_0000022 Ga0500556_0000022_162697_164304 526
463 iso_pu_bacteria 2585428106 2587919410 526
464 iso_pu_bacteria 2599185236 2599718348 526
465 iso_pu_bacteria 2643221574 2643884684 526
466 iso_pu_bacteria 2643221628 2644163992 526
467 iso_pu_bacteria 2643221640 2644225239 526
468 iso_pu_bacteria 2643221642 2644232547 526
469 iso_pu_bacteria 2643221683 2644466598 526
470 iso_pu_bacteria 2643221699 2644547938 526
471 iso_pu_bacteria 2738541277 2738721596 526
472 iso_pu_bacteria 2738541293 2738799638 526
473 iso_pu_bacteria 2738541307 2738880922 526
474 iso_pu_bacteria 2738543019 2739281265 526
475 iso_pu_bacteria 2791355048 2792461100 526
476 iso_pu_bacteria 2818991446 2819601398 526
477 iso_pu_bacteria 2831265667 2831272348 526
478 iso_pu_bacteria 2838054893 2838059506 526
479 iso_pu_bacteria 2838736955 2838740295 526
480 iso_pu_bacteria 2841840854 2841843580 526
481 iso_pu_bacteria 2842140634 2842143300 526
482 iso_pu_bacteria 2843744320 2843749385 526
483 iso_pu_bacteria 2849560528 2849562640 526
484 iso_pu_bacteria 2849573788 2849576969 526
485 iso_pu_bacteria 2851153111 2851156064 526
486 iso_pu_bacteria 2857504554 2857504629 526
487 iso_pu_bacteria 2857531043 2857535526 526
488 iso_pu_bacteria 2884960567 2884960733 526
489 iso_pu_bacteria 2898329390 2898333975 526
490 iso_pu_bacteria 2899924645 2899931061 526
491 iso_pu_bacteria 2904449895 2904452812 526
492 iso_pu_bacteria 2904456579 2904460159 526
493 iso_pu_bacteria 2928037797 2928040707 526
494 iso_pu_bacteria 2928044640 2928047549 526
495 iso_pu_bacteria 2928051484 2928055326 526
496 iso_pu_bacteria 2928064002 2928069427 526
497 iso_pu_bacteria 2928084124 2928089560 526
498 iso_pu_bacteria 2928531327 2928534368 526
499 3300005444 Ga0070694_100097834 Ga0070694_1000978342 527
500 3300025909 Ga0207705_10058069 Ga0207705_100580692 527
501 3300028794 Ga0307515_10011471 Ga0307515_100114714 527
502 3300035083 Ga0373926_0001668 Ga0373926_0001668_3535_5118 527
503 3300035170 Ga0373943_0018742 Ga0373943_0018742_389_1972 527
504 3300035171 Ga0373946_0002476 Ga0373946_0002476_631_2214 527
505 3300035692 Ga0373935_0007344 Ga0373935_0007344_3174_4757 527
506 3300035695 Ga0373927_0012450 Ga0373927_0012450_333_1916 527
507 3300035725 Ga0373947_0015581 Ga0373947_0015581_698_2281 527
508 3300037068 Ga0373925_0089666 Ga0373925_0089666_539_2122 527
509 3300046475 Ga0495639_0037330 Ga0495639_0037330_88_1671 527
510 3300046531 Ga0495665_0037605 Ga0495665_0037605_735_2318 527
511 3300046681 Ga0495647_0013904 Ga0495647_0013904_916_2499 527
512 3300050509 nmdc:mga0qj67_160540_c1 nmdc:mga0qj67_160540_c1_101_1684 527
513 iso_pu_bacteria 2513020051 2513226466 527
514 iso_pu_bacteria 2643221658 2644326732 527
515 iso_pu_bacteria 2643221672 2644400006 527
516 iso_pu_bacteria 2842677519 2842678589 527
517 iso_pu_bacteria 2842747753 2842752334 527
518 iso_pu_bacteria 2904479285 2904479433 527
519 iso_pu_bacteria 2919462493 2919463570 527
520 iso_pu_bacteria 2929160207 2929165798 527
521 iso_pu_bacteria 2945909444 2945909516 527
522 iso_pu_bacteria 2945945610 2945945668 527
523 3300005293 Ga0065715_10144125 Ga0065715_101441251 528
524 3300005330 Ga0070690_100005241 Ga0070690_1000052411 528
525 3300005334 Ga0068869_100035862 Ga0068869_1000358621 528
526 3300005335 Ga0070666_10019991 Ga0070666_100199914 528
527 3300005343 Ga0070687_100001183 Ga0070687_1000011837 528
528 3300005354 Ga0070675_100000783 Ga0070675_1000007835 528
529 3300005355 Ga0070671_100106772 Ga0070671_1001067721 528
530 3300005365 Ga0070688_100050598 Ga0070688_1000505982 528
531 3300005367 Ga0070667_100055714 Ga0070667_1000557144 528
532 3300005438 Ga0070701_10013032 Ga0070701_100130324 528
533 3300005440 Ga0070705_100055992 Ga0070705_1000559922 528
534 3300005459 Ga0068867_100005090 Ga0068867_1000050907 528
535 3300005518 Ga0070699_100061063 Ga0070699_1000610633 528
536 3300005536 Ga0070697_100006226 Ga0070697_1000062267 528
537 3300005544 Ga0070686_100061849 Ga0070686_1000618492 528
538 3300005545 Ga0070695_100015945 Ga0070695_1000159452 528
539 3300005546 Ga0070696_100012095 Ga0070696_1000120956 528
540 3300005563 Ga0068855_100022771 Ga0068855_1000227714 528
541 3300005564 Ga0070664_100000712 Ga0070664_1000007122 528
542 3300005615 Ga0070702_100000150 Ga0070702_10000015015 528
543 3300005618 Ga0068864_100017222 Ga0068864_1000172224 528
544 3300005718 Ga0068866_10006202 Ga0068866_100062025 528
545 3300005841 Ga0068863_100002456 Ga0068863_10000245613 528
546 3300005843 Ga0068860_100031234 Ga0068860_1000312345 528
547 3300005843 Ga0068860_100226450 Ga0068860_1002264502 528
548 3300005844 Ga0068862_100026901 Ga0068862_1000269013 528
549 3300005985 Ga0081539_10000917 Ga0081539_1000091722 528
550 3300006237 Ga0097621_100015779 Ga0097621_1000157792 528
551 3300006358 Ga0068871_100007963 Ga0068871_1000079634 528
552 3300006844 Ga0075428_100002475 Ga0075428_10000247518 528
553 3300006846 Ga0075430_100067230 Ga0075430_1000672302 528
554 3300006847 Ga0075431_100017790 Ga0075431_1000177905 528
555 3300006871 Ga0075434_100000003 Ga0075434_100000003128 528
556 3300006914 Ga0075436_100012300 Ga0075436_1000123004 528
557 3300007076 Ga0075435_100006583 Ga0075435_1000065834 528
558 3300007076 Ga0075435_100012648 Ga0075435_1000126483 528
559 3300009093 Ga0105240_10002741 Ga0105240_1000274113 528
560 3300009094 Ga0111539_10040746 Ga0111539_100407463 528
561 3300009098 Ga0105245_10007925 Ga0105245_100079255 528
562 3300009147 Ga0114129_10005124 Ga0114129_100051246 528
563 3300009174 Ga0105241_10018460 Ga0105241_100184604 528
564 3300009177 Ga0105248_10003925 Ga0105248_1000392510 528
565 3300014325 Ga0163163_10009795 Ga0163163_100097953 528
566 3300014745 Ga0157377_10009663 Ga0157377_100096632 528
567 3300015683 Ga0183362_10012 Ga0183362_1001244 528
568 3300025294 Ga0209025_1000694 Ga0209025_100069427 528
569 3300025903 Ga0207680_10059878 Ga0207680_100598783 528
570 3300025908 Ga0207643_10042854 Ga0207643_100428542 528
571 3300025913 Ga0207695_10005557 Ga0207695_100055576 528
572 3300025918 Ga0207662_10000110 Ga0207662_1000011036 528
573 3300025922 Ga0207646_10031703 Ga0207646_100317033 528
574 3300025929 Ga0207664_10104572 Ga0207664_101045722 528
575 3300025935 Ga0207709_10003963 Ga0207709_100039636 528
576 3300025942 Ga0207689_10009885 Ga0207689_100098854 528
577 3300025945 Ga0207679_10029885 Ga0207679_100298852 528
578 3300025949 Ga0207667_10003202 Ga0207667_100032029 528
579 3300025949 Ga0207667_10044504 Ga0207667_100445045 528
580 3300026089 Ga0207648_10029600 Ga0207648_100296002 528
581 3300026095 Ga0207676_10010708 Ga0207676_100107086 528
582 3300026118 Ga0207675_100004715 Ga0207675_1000047159 528
583 3300027462 Ga0210000_1000314 Ga0210000_10003142 528
584 3300027471 Ga0209995_1001170 Ga0209995_10011702 528
585 3300027543 Ga0209999_1000071 Ga0209999_10000713 528
586 3300028380 Ga0268265_10002340 Ga0268265_100023405 528
587 3300028381 Ga0268264_10143573 Ga0268264_101435732 528
588 3300031251 Ga0265327_10000733 Ga0265327_100007339 528
589 3300031727 Ga0316576_10044334 Ga0316576_100443343 528
590 3300031731 Ga0307405_10024174 Ga0307405_100241743 528
591 3300031824 Ga0307413_10038493 Ga0307413_100384931 528
592 3300031911 Ga0307412_10025093 Ga0307412_100250933 528
593 3300032002 Ga0307416_100191736 Ga0307416_1001917362 528
594 3300032133 Ga0316583_10004774 Ga0316583_100047744 528
595 3300032139 Ga0316580_10002722 Ga0316580_100027223 528
596 3300035207 Ga0373942_0001178 Ga0373942_0001178_4700_6286 528
597 3300035691 Ga0373931_0001811 Ga0373931_0001811_6130_7716 528
598 3300035724 Ga0373933_0034721 Ga0373933_0034721_142_1728 528
599 3300036401 Ga0373937_0045869 Ga0373937_0045869_1959_3545 528
600 3300041413 Ga0439465_0002181 Ga0439465_0002181_3889_5499 528
601 3300042007 Ga0439449_0000741 Ga0439449_0000741_2414_4024 528
602 3300042007 Ga0439449_0018901 Ga0439449_0018901_605_2227 528
603 3300042015 Ga0439462_0000613 Ga0439462_0000613_2775_4385 528
604 3300042435 Ga0439434_0003053 Ga0439434_0003053_2228_3838 528
605 3300044735 Ga0466968_0006458 Ga0466968_0006458_1496_3085 528
606 3300045051 Ga0451576_0009574 Ga0451576_0009574_1620_3206 528
607 3300045051 Ga0451576_0026461 Ga0451576_0026461_2043_3629 528
608 3300046454 Ga0495592_0002487 Ga0495592_0002487_2942_4528 528
609 3300046476 Ga0495662_0008407 Ga0495662_0008407_2974_4560 528
610 3300046511 Ga0495608_0004197 Ga0495608_0004197_1109_2695 528
611 3300046516 Ga0495628_0016679 Ga0495628_0016679_1857_3443 528
612 3300046533 Ga0495640_0001444 Ga0495640_0001444_9788_11374 528
613 3300046535 Ga0495586_0001370 Ga0495586_0001370_3867_5453 528
614 3300046559 Ga0495667_0048969 Ga0495667_0048969_139_1740 528
615 3300046615 Ga0495656_0013838 Ga0495656_0013838_114_1700 528
616 3300046689 Ga0495613_0002186 Ga0495613_0002186_5497_7083 528
617 3300046690 Ga0495624_0013950 Ga0495624_0013950_1280_2866 528
618 3300046809 Ga0495600_0004089 Ga0495600_0004089_6879_8465 528
619 3300047317 Ga0495604_0007337 Ga0495604_0007337_5953_7539 528
620 3300047322 Ga0495680_0022250 Ga0495680_0022250_1623_3209 528
621 3300048903 Ga0496100_0056912 Ga0496100_0056912_553_2163 528
622 3300048904 Ga0496101_0010944 Ga0496101_0010944_2256_3866 528
623 3300048905 Ga0496102_0030595 Ga0496102_0030595_1165_2775 528
624 3300048913 Ga0496110_0160624 Ga0496110_0160624_271_1875 528
625 3300049587 Ga0501071_0042043 Ga0501071_0042043_785_2371 528
626 3300049588 Ga0501072_0010747 Ga0501072_0010747_874_2460 528
627 3300049589 Ga0501073_0008527 Ga0501073_0008527_2103_3710 528
628 3300049591 Ga0501075_0065027 Ga0501075_0065027_425_2011 528
629 3300049741 Ga0501079_0071871 Ga0501079_0071871_33_1619 528
630 3300049742 Ga0501080_0000599 Ga0501080_0000599_19602_21188 528
631 3300050507 nmdc:mga05p37_712_c1 nmdc:mga05p37_712_c1_12196_13782 528
632 3300050508 nmdc:mga09592_496_c1 nmdc:mga09592_496_c1_11374_12960 528
633 3300050509 nmdc:mga0qj67_61308_c1 nmdc:mga0qj67_61308_c1_1043_2674 528
634 3300050511 nmdc:mga08y16_32621_c1 nmdc:mga08y16_32621_c1_2978_4564 528
635 3300050511 nmdc:mga08y16_34152_c1 nmdc:mga08y16_34152_c1_2130_3716 528
636 3300050512 nmdc:mga0n895_1108_c1 nmdc:mga0n895_1108_c1_5674_7260 528
637 3300050512 nmdc:mga0n895_1527_c1 nmdc:mga0n895_1527_c1_15144_16730 528
638 3300050513 nmdc:mga0rr50_2902_c1 nmdc:mga0rr50_2902_c1_6865_8451 528
639 3300050513 nmdc:mga0rr50_30623_c1 nmdc:mga0rr50_30623_c1_657_2243 528
640 3300050514 nmdc:mga08x19_16842_c1 nmdc:mga08x19_16842_c1_61_1647 528
641 3300050514 nmdc:mga08x19_19378_c1 nmdc:mga08x19_19378_c1_2193_3779 528
642 3300050515 nmdc:mga0a205_2500_c1 nmdc:mga0a205_2500_c1_9929_11515 528
643 3300054114 Ga0501084_0000111 Ga0501084_0000111_38588_40195 528
644 3300054114 Ga0501084_0042590 Ga0501084_0042590_547_2133 528
645 3300060353 Ga0501082_0093964 Ga0501082_0093964_360_1946 528
646 iso_pu_bacteria 2524023207 2524449568 528
647 iso_pu_bacteria 2846037992 2846038813 528
648 iso_pu_bacteria 2883577096 2883577799 528
649 iso_pu_bacteria 2929520902 2929525788 528
650 iso_pu_bacteria 2945972063 2945975306 528
651 iso_pu_bacteria 2945984333 2945988502 528
652 3300005471 Ga0070698_100053959 Ga0070698_1000539592 529
653 3300006844 Ga0075428_100003558 Ga0075428_10000355812 529
654 3300006852 Ga0075433_10025485 Ga0075433_100254852 529
655 3300006880 Ga0075429_100040012 Ga0075429_1000400122 529
656 3300009545 Ga0105237_10102216 Ga0105237_101022161 529
657 3300015683 Ga0183362_10018 Ga0183362_100183 529
658 3300020069 Ga0197907_11229304 Ga0197907_112293041 529
659 3300020077 Ga0206351_10150708 Ga0206351_101507081 529
660 3300022467 Ga0224712_10025821 Ga0224712_100258211 529
661 3300031456 Ga0307513_10069763 Ga0307513_100697632 529
662 3300037853 Ga0436364_0461129 Ga0436364_0461129_149_1774 529
663 3300044712 Ga0453684_0033889 Ga0453684_0033889_1790_3412 529
664 3300045051 Ga0451576_0031011 Ga0451576_0031011_3882_5504 529
665 3300046689 Ga0495613_0028693 Ga0495613_0028693_752_2344 529
666 3300050508 nmdc:mga09592_29911_c1 nmdc:mga09592_29911_c1_658_2262 529
667 3300050508 nmdc:mga09592_58871_c1 nmdc:mga09592_58871_c1_1575_3221 529
668 iso_pu_bacteria 2643221575 2643885644 529
669 iso_pu_bacteria 2643221597 2643995927 529
670 iso_pu_bacteria 2773857763 2774399728 529
671 iso_pu_bacteria 2808606447 2809227246 529
672 iso_pu_bacteria 2852632344 2852633373 529
673 iso_pu_bacteria 2857479173 2857481286 529
674 iso_pu_bacteria 2857632687 2857634718 529
675 iso_pu_bacteria 2870628048 2870630172 529
676 iso_pu_bacteria 2870801768 2870802977 529
677 iso_pu_bacteria 2870804320 2870805042 529
678 iso_pu_bacteria 8004212874 8004214125 529
679 3300002739 JGI25158J39367_1002906 JGI25158J39367_10029062 530
680 3300002987 JGI25159J45721_1008005 JGI25159J45721_10080052 530
681 3300003354 JGI25160J50197_1013618 JGI25160J50197_10136183 530
682 3300003374 JGI25161J50226_1003303 JGI25161J50226_10033033 530
683 3300003578 Ga0006562J51391_1081476 Ga0006562J51391_10814762 530
684 3300003792 Ga0055540_1013518 Ga0055540_10135182 530
685 3300025245 Ga0207425_1003268 Ga0207425_10032683 530
686 3300025258 Ga0209129_1002948 Ga0209129_10029483 530
687 3300025263 Ga0209565_1000141 Ga0209565_100014187 530
688 3300025263 Ga0209565_1002645 Ga0209565_10026455 530
689 3300025284 Ga0209130_1001487 Ga0209130_10014877 530
690 3300025292 Ga0209676_1000088 Ga0209676_1000088186 530
691 3300025292 Ga0209676_1000420 Ga0209676_100042030 530
692 3300025294 Ga0209025_1005849 Ga0209025_10058493 530
693 3300025295 Ga0209564_1003797 Ga0209564_10037973 530
694 3300025297 Ga0209758_1001159 Ga0209758_10011597 530
695 3300025297 Ga0209758_1003909 Ga0209758_10039093 530
696 3300025298 Ga0209050_1000110 Ga0209050_100011057 530
697 3300025299 Ga0209256_1000223 Ga0209256_100022392 530
698 3300025302 Ga0207426_1000084 Ga0207426_1000084281 530
699 3300025302 Ga0207426_1000124 Ga0207426_1000124149 530
700 3300025303 Ga0209051_1000069 Ga0209051_100006916 530
701 3300025303 Ga0209051_1000285 Ga0209051_100028537 530
702 3300025303 Ga0209051_1000986 Ga0209051_100098617 530
703 3300025304 Ga0209257_1000093 Ga0209257_100009358 530
704 3300025304 Ga0209257_1007169 Ga0209257_10071693 530
705 3300025935 Ga0207709_10001196 Ga0207709_1000119611 530
706 3300025986 Ga0207658_10059842 Ga0207658_100598422 530
707 3300031456 Ga0307513_10021256 Ga0307513_100212563 530
708 3300031731 Ga0307405_10000676 Ga0307405_100006763 530
709 3300032126 Ga0307415_100084486 Ga0307415_1000844862 530
710 3300039447 Ga0436361_0767394 Ga0436361_0767394_44984_46588 530
711 3300046660 Ga0495625_0000235 Ga0495625_0000235_54912_56534 530
712 3300047321 Ga0495676_0026484 Ga0495676_0026484_3130_4752 530
713 3300048929 Ga0496126_0000480 Ga0496126_0000480_51459_53051 530
714 3300053093 Ga0500651_0001995 Ga0500651_0001995_7251_8873 530
715 3300053110 Ga0500571_015394 Ga0500571_015394_354_1976 530
716 3300053139 Ga0500568_0003061 Ga0500568_0003061_6067_7689 530
717 iso_pu_bacteria 2507262055 2507508805 530
718 iso_pu_bacteria 2508501009 2508542965 530
719 iso_pu_bacteria 2508501042 2508691342 530
720 iso_pu_bacteria 2508501128 2509152722 530
721 iso_pu_bacteria 2513237102 2513699248 530
722 iso_pu_bacteria 2513237161 2514012055 530
723 iso_pu_bacteria 2515154112 2515626328 530
724 iso_pu_bacteria 2524023228 2524539094 530
725 iso_pu_bacteria 2528768022 2528853918 530
726 iso_pu_bacteria 2547132374 2548501672 530
727 iso_pu_bacteria 2643221546 2643753104 530
728 iso_pu_bacteria 2643221558 2643814025 530
729 iso_pu_bacteria 2643221651 2644288621 530
730 iso_pu_bacteria 2667528175 2671122332 530
731 iso_pu_bacteria 2684623036 2686544765 530
732 iso_pu_bacteria 2710264753 2710601871 530
733 iso_pu_bacteria 2739367653 2739603679 530
734 iso_pu_bacteria 2791355197 2793068609 530
735 iso_pu_bacteria 2808606372 2808902628 530
736 iso_pu_bacteria 2816332305 2817510204 530
737 iso_pu_bacteria 2824617872 2824625104 530
738 iso_pu_bacteria 2824626560 2824633984 530
739 iso_pu_bacteria 2824635225 2824641128 530
740 iso_pu_bacteria 2824644064 2824648278 530
741 iso_pu_bacteria 2824661429 2824664530 530
742 iso_pu_bacteria 2824714736 2824718172 530
743 iso_pu_bacteria 2824723954 2824728426 530
744 iso_pu_bacteria 2838122688 2838123959 530
745 iso_pu_bacteria 2840878972 2840883840 530
746 iso_pu_bacteria 2841941048 2841943890 530
747 iso_pu_bacteria 2841966195 2841966476 530
748 iso_pu_bacteria 2841974524 2841975211 530
749 iso_pu_bacteria 2841983080 2841983219 530
750 iso_pu_bacteria 2842718218 2842721865 530
751 iso_pu_bacteria 2849076700 2849079525 530
752 iso_pu_bacteria 2857727296 2857728164 530
753 iso_pu_bacteria 2857737099 2857739729 530
754 iso_pu_bacteria 2874590934 2874591950 530
755 iso_pu_bacteria 2874604998 2874608788 530
756 iso_pu_bacteria 2874620515 2874627319 530
757 iso_pu_bacteria 2874645413 2874648196 530
758 iso_pu_bacteria 2876771140 2876772164 530
759 iso_pu_bacteria 2876818435 2876819494 530
760 iso_pu_bacteria 2879074833 2879075946 530
761 iso_pu_bacteria 2879099564 2879103504 530
762 iso_pu_bacteria 2879110137 2879111483 530
763 iso_pu_bacteria 2879127579 2879131578 530
764 iso_pu_bacteria 2879142872 2879148129 530
765 iso_pu_bacteria 2881364244 2881371625 530
766 iso_pu_bacteria 2885374607 2885379285 530
767 iso_pu_bacteria 2888388044 2888394027 530
768 iso_pu_bacteria 2903748898 2903751251 530
769 iso_pu_bacteria 2904666416 2904671163 530
770 iso_pu_bacteria 2904699407 2904702669 530
771 iso_pu_bacteria 2906610324 2906618441 530
772 iso_pu_bacteria 2906626472 2906629937 530
773 iso_pu_bacteria 2908739725 2908742887 530
774 iso_pu_bacteria 2919443155 2919443230 530
775 iso_pu_bacteria 2922368715 2922374102 530
776 iso_pu_bacteria 2922425934 2922429662 530
777 iso_pu_bacteria 2928121344 2928124671 530
778 iso_pu_bacteria 2929615660 2929617832 530
779 iso_pu_bacteria 2929624759 2929627513 530
780 iso_pu_bacteria 2932784394 2932788387 530
781 iso_pu_bacteria 2932794094 2932800596 530
782 iso_pu_bacteria 2932801729 2932803045 530
783 iso_pu_bacteria 2932809354 2932810461 530
784 iso_pu_bacteria 2932818245 2932821394 530
785 iso_pu_bacteria 2932828146 2932831380 530
786 iso_pu_bacteria 2933577622 2933579761 530
787 iso_pu_bacteria 2935608549 2935608658 530
788 iso_pu_bacteria 2935616580 2935622817 530
789 iso_pu_bacteria 2935630451 2935631825 530
790 iso_pu_bacteria 2935638405 2935645092 530
791 iso_pu_bacteria 2935648319 2935649822 530
792 iso_pu_bacteria 2935656913 2935658663 530
793 iso_pu_bacteria 2935665750 2935671880 530
794 iso_pu_bacteria 2935675223 2935678723 530
795 iso_pu_bacteria 2935684952 2935689040 530
796 iso_pu_bacteria 2935694250 2935696367 530
797 iso_pu_bacteria 2935703347 2935707083 530
798 iso_pu_bacteria 2935713505 2935716059 530
799 iso_pu_bacteria 2935722832 2935725376 530
800 iso_pu_bacteria 2935732158 2935738347 530
801 iso_pu_bacteria 2935741537 2935747722 530
802 iso_pu_bacteria 2935750917 2935753704 530
803 iso_pu_bacteria 2935760218 2935762773 530
804 iso_pu_bacteria 2935769743 2935777214 530
805 iso_pu_bacteria 2935777560 2935784646 530
806 iso_pu_bacteria 2935785616 2935793166 530
807 iso_pu_bacteria 2935793552 2935801171 530
808 iso_pu_bacteria 2935801545 2935807572 530
809 iso_pu_bacteria 2935810662 2935817160 530
810 iso_pu_bacteria 2935819856 2935821798 530
811 iso_pu_bacteria 2935827899 2935834559 530
812 iso_pu_bacteria 2935837841 2935838699 530
813 iso_pu_bacteria 2935847175 2935847401 530
814 iso_pu_bacteria 2935855204 2935861065 530
815 iso_pu_bacteria 2935864058 2935865603 530
816 iso_pu_bacteria 2935873716 2935878104 530
817 iso_pu_bacteria 2935883170 2935885383 530
818 iso_pu_bacteria 2935908558 2935909331 530
819 iso_pu_bacteria 2935916978 2935924781 530
820 iso_pu_bacteria 2935926038 2935926095 530
821 iso_pu_bacteria 2935934488 2935934545 530
822 iso_pu_bacteria 2935942939 2935942995 530
823 iso_pu_bacteria 2935951376 2935951433 530
824 iso_pu_bacteria 2935967501 2935967558 530
825 iso_pu_bacteria 2935975950 2935977234 530
826 iso_pu_bacteria 2935984226 2935988424 530
827 iso_pu_bacteria 2935992306 2935995890 530
828 iso_pu_bacteria 2936002035 2936009610 530
829 iso_pu_bacteria 2936011229 2936012696 530
830 iso_pu_bacteria 2936019824 2936021260 530
831 iso_pu_bacteria 2936028420 2936029989 530
832 iso_pu_bacteria 2936037263 2936043562 530
833 iso_pu_bacteria 2936046547 2936047454 530
834 iso_pu_bacteria 2936055302 2936057388 530
835 iso_pu_bacteria 2940556831 2940560919 530
836 iso_pu_bacteria 2941507105 2941513060 530
837 iso_pu_bacteria 2941515067 2941521036 530
838 iso_pu_bacteria 2941523033 2941526100 530
839 iso_pu_bacteria 2941538514 2941538634 530
840 iso_pu_bacteria 2946024296 2946025199 530
841 iso_pu_bacteria 2974320154 2974322039 530
842 iso_pu_bacteria 3005474847 3005480037 530
843 iso_pu_bacteria 8006933436 8006941240 530
844 iso_pu_bacteria 8006973647 8006980554 530
845 iso_pu_bacteria 8016511872 8016513441 530
846 iso_pu_bacteria 8016522445 8016529890 530
847 iso_pu_bacteria 8016539877 8016548325 530
848 iso_pu_bacteria 8016548790 8016553797 530
849 iso_pu_bacteria 8016557553 8016562174 530
850 iso_pu_bacteria 8016566248 8016573466 530
851 iso_pu_bacteria 8016575299 8016577595 530
852 iso_pu_bacteria 8016583857 8016592080 530
853 iso_pu_bacteria 8016595262 8016599989 530
854 iso_pu_bacteria 8016603502 8016610812 530
855 iso_pu_bacteria 8016613128 8016614151 530
856 iso_pu_bacteria 8016622563 8016626825 530
857 iso_pu_bacteria 8017057580 8017062992 530
858 iso_pu_bacteria 8019530166 8019534876 530
859 iso_pu_bacteria 8019555841 8019556965 530
860 iso_pu_bacteria 8019565922 8019568332 530
861 iso_pu_bacteria 8019586578 8019590034 530
862 iso_pu_bacteria 8019597564 8019601227 530
863 iso_pu_bacteria 8019608314 8019617318 530
864 iso_pu_bacteria 8019619141 8019627805 530
865 iso_pu_bacteria 8019629233 8019634700 530
866 iso_pu_bacteria 8019638758 8019645002 530
867 iso_pu_bacteria 8019648815 8019658162 530
868 iso_pu_bacteria 8019668869 8019672088 530
869 iso_pu_bacteria 8055742211 8055746580 530
870 iso_pu_bacteria 8056689827 8056693691 530
871 iso_pu_bacteria 8057132660 8057135433 530
872 3300003187 JGI25151J46595_10008365 JGI25151J46595_100083652 531
873 3300003773 Ga0055537_1000286 Ga0055537_100028628 531
874 3300003784 Ga0055534_1000413 Ga0055534_10004133 531
875 3300005288 Ga0065714_10009699 Ga0065714_100096992 531
876 3300005564 Ga0070664_100028614 Ga0070664_1000286144 531
877 3300006048 Ga0075363_100006026 Ga0075363_1000060264 531
878 3300006177 Ga0075362_10005886 Ga0075362_100058864 531
879 3300006353 Ga0075370_10010108 Ga0075370_100101082 531
880 3300006946 Ga0079104_1014509 Ga0079104_10145091 531
881 3300017792 Ga0163161_10001893 Ga0163161_100018932 531
882 3300025263 Ga0209565_1000020 Ga0209565_100002037 531
883 3300025273 Ga0209673_1000072 Ga0209673_1000072163 531
884 3300025291 Ga0209675_1000014 Ga0209675_100001425 531
885 3300025291 Ga0209675_1006650 Ga0209675_10066503 531
886 3300025294 Ga0209025_1001471 Ga0209025_100147112 531
887 3300025298 Ga0209050_1011864 Ga0209050_10118643 531
888 3300025728 Ga0207655_1012876 Ga0207655_10128763 531
889 3300025935 Ga0207709_10002053 Ga0207709_100020534 531
890 3300025945 Ga0207679_10026592 Ga0207679_100265922 531
891 3300027666 Ga0209282_1004480 Ga0209282_10044807 531
892 3300028379 Ga0268266_10053608 Ga0268266_100536083 531
893 3300030733 Ga0314311_1190663 Ga0314311_11906632 531
894 3300031711 Ga0265314_10009656 Ga0265314_100096564 531
895 3300032005 Ga0307411_10044025 Ga0307411_100440253 531
896 3300046472 Ga0495580_0018040 Ga0495580_0018040_38_1642 531
897 3300049577 Ga0501041_0057305 Ga0501041_0057305_628_2238 531
898 3300050492 nmdc:mga0yw44_62166_c1 nmdc:mga0yw44_62166_c1_384_2009 531
899 3300050496 nmdc:mga07m45_6605_c2 nmdc:mga07m45_6605_c2_3223_4854 531
900 3300053158 Ga0500627_0004513 Ga0500627_0004513_82_1710 531
901 iso_pu_bacteria 2508501125 2509130574 531
902 iso_pu_bacteria 2509276019 2509379399 531
903 iso_pu_bacteria 2510065057 2510307915 531
904 iso_pu_bacteria 2510917020 2511124109 531
905 iso_pu_bacteria 2510917028 2511182930 531
906 iso_pu_bacteria 2511231002 2511244452 531
907 iso_pu_bacteria 2511231052 2511498223 531
908 iso_pu_bacteria 2512047086 2512529379 531
909 iso_pu_bacteria 2512875026 2512969536 531
910 iso_pu_bacteria 2513237086 2513586869 531
911 iso_pu_bacteria 2513237089 2513606240 531
912 iso_pu_bacteria 2513237091 2513619662 531
913 iso_pu_bacteria 2513237140 2513885156 531
914 iso_pu_bacteria 2513237143 2513906255 531
915 iso_pu_bacteria 2513237151 2513958598 531
916 iso_pu_bacteria 2513237156 2513985052 531
917 iso_pu_bacteria 2513237159 2513998998 531
918 iso_pu_bacteria 2513237160 2514007955 531
919 iso_pu_bacteria 2513237351 2514591729 531
920 iso_pu_bacteria 2515154107 2515610796 531
921 iso_pu_bacteria 2515154122 2515680455 531
922 iso_pu_bacteria 2515154123 2515692053 531
923 iso_pu_bacteria 2516143018 2516207542 531
924 iso_pu_bacteria 2516653046 2516896134 531
925 iso_pu_bacteria 2517487022 2517565586 531
926 iso_pu_bacteria 2519103095 2519460403 531
927 iso_pu_bacteria 2551306084 2551674965 531
928 iso_pu_bacteria 2551306085 2551687281 531
929 iso_pu_bacteria 2551306093 2551743238 531
930 iso_pu_bacteria 2558860100 2558861472 531
931 iso_pu_bacteria 2582581280 2585155727 531
932 iso_pu_bacteria 2582581283 2585167054 531
933 iso_pu_bacteria 2582581306 2585269907 531
934 iso_pu_bacteria 2582581311 2585292707 531
935 iso_pu_bacteria 2582581865 2585390695 531
936 iso_pu_bacteria 2582581866 2585397624 531
937 iso_pu_bacteria 2585428057 2587725812 531
938 iso_pu_bacteria 2585428062 2587758332 531
939 iso_pu_bacteria 2588253510 2588290739 531
940 iso_pu_bacteria 2597489875 2597815122 531
941 iso_pu_bacteria 2599185178 2599447271 531
942 iso_pu_bacteria 2599185239 2599740735 531
943 iso_pu_bacteria 2599185240 2599748262 531
944 iso_pu_bacteria 2599185352 2600197251 531
945 iso_pu_bacteria 2599185355 2600210174 531
946 iso_pu_bacteria 2600255067 2600814859 531
947 iso_pu_bacteria 2643221544 2643744069 531
948 iso_pu_bacteria 2643221545 2643750805 531
949 iso_pu_bacteria 2643221552 2643779240 531
950 iso_pu_bacteria 2643221557 2643804853 531
951 iso_pu_bacteria 2643221570 2643865064 531
952 iso_pu_bacteria 2643221583 2643925675 531
953 iso_pu_bacteria 2643221584 2643931416 531
954 iso_pu_bacteria 2643221585 2643932456 531
955 iso_pu_bacteria 2643221595 2643985440 531
956 iso_pu_bacteria 2643221596 2643990786 531
957 iso_pu_bacteria 2643221599 2644002618 531
958 iso_pu_bacteria 2643221607 2644047717 531
959 iso_pu_bacteria 2643221609 2644059094 531
960 iso_pu_bacteria 2643221610 2644065697 531
961 iso_pu_bacteria 2643221611 2644075866 531
962 iso_pu_bacteria 2643221618 2644104287 531
963 iso_pu_bacteria 2643221626 2644148896 531
964 iso_pu_bacteria 2643221627 2644152136 531
965 iso_pu_bacteria 2643221636 2644205865 531
966 iso_pu_bacteria 2643221639 2644219871 531
967 iso_pu_bacteria 2643221644 2644246957 531
968 iso_pu_bacteria 2643221646 2644261012 531
969 iso_pu_bacteria 2643221652 2644292345 531
970 iso_pu_bacteria 2643221655 2644313280 531
971 iso_pu_bacteria 2643221656 2644313707 531
972 iso_pu_bacteria 2643221659 2644334149 531
973 iso_pu_bacteria 2643221660 2644338086 531
974 iso_pu_bacteria 2643221668 2644376803 531
975 iso_pu_bacteria 2643221675 2644417589 531
976 iso_pu_bacteria 2643221680 2644453693 531
977 iso_pu_bacteria 2643221686 2644481879 531
978 iso_pu_bacteria 2643221688 2644495309 531
979 iso_pu_bacteria 2643221689 2644497517 531
980 iso_pu_bacteria 2643221691 2644509879 531
981 iso_pu_bacteria 2643221698 2644547203 531
982 iso_pu_bacteria 2643221712 2644612905 531
983 iso_pu_bacteria 2643221717 2644645457 531
984 iso_pu_bacteria 2643221723 2644677765 531
985 iso_pu_bacteria 2643221726 2644688328 531
986 iso_pu_bacteria 2657244999 2657683367 531
987 iso_pu_bacteria 2675903129 2676745664 531
988 iso_pu_bacteria 2690315857 2691331830 531
989 iso_pu_bacteria 2690316117 2692318413 531
990 iso_pu_bacteria 2738541296 2738820498 531
991 iso_pu_bacteria 2738541298 2738832978 531
992 iso_pu_bacteria 2738541306 2738874505 531
993 iso_pu_bacteria 2738541337 2739054770 531
994 iso_pu_bacteria 2738543002 2739186135 531
995 iso_pu_bacteria 2738543008 2739221103 531
996 iso_pu_bacteria 2738543012 2739245500 531
997 iso_pu_bacteria 2738543020 2739285156 531
998 iso_pu_bacteria 2738543021 2739290470 531
999 iso_pu_bacteria 2739367655 2739611214 531
1000 iso_pu_bacteria 2751185821 2753459458 531
1001 iso_pu_bacteria 2751185846 2753566878 531
1002 iso_pu_bacteria 2791355082 2792580468 531
1003 iso_pu_bacteria 2791355094 2792639858 531
1004 iso_pu_bacteria 2802428858 2802715966 531
1005 iso_pu_bacteria 2802428859 2802723010 531
1006 iso_pu_bacteria 2802428860 2802728857 531
1007 iso_pu_bacteria 2802428861 2802735224 531
1008 iso_pu_bacteria 2802428862 2802742172 531
1009 iso_pu_bacteria 2802428863 2802748619 531
1010 iso_pu_bacteria 2802429268 2804754687 531
1011 iso_pu_bacteria 2808606384 2808967631 531
1012 iso_pu_bacteria 2808606390 2809002462 531
1013 iso_pu_bacteria 2808606391 2809009740 531
1014 iso_pu_bacteria 2816332133 2816472342 531
1015 iso_pu_bacteria 2816332253 2817257804 531
1016 iso_pu_bacteria 2816332256 2817281804 531
1017 iso_pu_bacteria 2816332286 2817451453 531
1018 iso_pu_bacteria 2818991435 2819540039 531
1019 iso_pu_bacteria 2818991450 2819620696 531
1020 iso_pu_bacteria 2818991452 2819636957 531
1021 iso_pu_bacteria 2818991454 2819648961 531
1022 iso_pu_bacteria 2834641062 2834644140 531
1023 iso_pu_bacteria 2838016132 2838019766 531
1024 iso_pu_bacteria 2838074704 2838077745 531
1025 iso_pu_bacteria 2839138175 2839141369 531
1026 iso_pu_bacteria 2842428310 2842430066 531
1027 iso_pu_bacteria 2842441272 2842442693 531
1028 iso_pu_bacteria 2842462802 2842464569 531
1029 iso_pu_bacteria 2842469257 2842471063 531
1030 iso_pu_bacteria 2842521101 2842524739 531
1031 iso_pu_bacteria 2842805378 2842806736 531
1032 iso_pu_bacteria 2844163670 2844168114 531
1033 iso_pu_bacteria 2847417321 2847423084 531
1034 iso_pu_bacteria 2848992105 2848997523 531
1035 iso_pu_bacteria 2850079185 2850084560 531
1036 iso_pu_bacteria 2855730933 2855732755 531
1037 iso_pu_bacteria 2855767633 2855771507 531
1038 iso_pu_bacteria 2855825444 2855829041 531
1039 iso_pu_bacteria 2855839649 2855844159 531
1040 iso_pu_bacteria 2855872281 2855874071 531
1041 iso_pu_bacteria 2857576091 2857578921 531
1042 iso_pu_bacteria 2858800743 2858806591 531
1043 iso_pu_bacteria 2863421361 2863427135 531
1044 iso_pu_bacteria 2870068957 2870073665 531
1045 iso_pu_bacteria 2881101125 2881103265 531
1046 iso_pu_bacteria 2881412998 2881415551 531
1047 iso_pu_bacteria 2881927736 2881929956 531
1048 iso_pu_bacteria 2883291878 2883294790 531
1049 iso_pu_bacteria 2883354860 2883356723 531
1050 iso_pu_bacteria 2885270888 2885272792 531
1051 iso_pu_bacteria 2886848708 2886851567 531
1052 iso_pu_bacteria 2887375801 2887376333 531
1053 iso_pu_bacteria 2889306138 2889309814 531
1054 iso_pu_bacteria 2894023352 2894027440 531
1055 iso_pu_bacteria 2894232714 2894233713 531
1056 iso_pu_bacteria 2896384573 2896391859 531
1057 iso_pu_bacteria 2898795034 2898798283 531
1058 iso_pu_bacteria 2900634093 2900641740 531
1059 iso_pu_bacteria 2902405164 2902410593 531
1060 iso_pu_bacteria 2902682994 2902687801 531
1061 iso_pu_bacteria 2904564687 2904571116 531
1062 iso_pu_bacteria 2904571731 2904578172 531
1063 iso_pu_bacteria 2909042592 2909043825 531
1064 iso_pu_bacteria 2913295892 2913296771 531
1065 iso_pu_bacteria 2915980308 2915983631 531
1066 iso_pu_bacteria 2915986958 2915992207 531
1067 iso_pu_bacteria 2915993759 2915999281 531
1068 iso_pu_bacteria 2916000859 2916007499 531
1069 iso_pu_bacteria 2916007675 2916011610 531
1070 iso_pu_bacteria 2916014648 2916018857 531
1071 iso_pu_bacteria 2916021584 2916026064 531
1072 iso_pu_bacteria 2916028427 2916032109 531
1073 iso_pu_bacteria 2916035215 2916039055 531
1074 iso_pu_bacteria 2916041962 2916046154 531
1075 iso_pu_bacteria 2916048683 2916051889 531
1076 iso_pu_bacteria 2916055098 2916060878 531
1077 iso_pu_bacteria 2916061851 2916065329 531
1078 iso_pu_bacteria 2916068649 2916071964 531
1079 iso_pu_bacteria 2916076590 2916077361 531
1080 iso_pu_bacteria 2919534386 2919537123 531
1081 iso_pu_bacteria 2919688452 2919691481 531
1082 iso_pu_bacteria 2919704043 2919708417 531
1083 iso_pu_bacteria 2920760137 2920765001 531
1084 iso_pu_bacteria 2920822456 2920826793 531
1085 iso_pu_bacteria 2921201388 2921203586 531
1086 iso_pu_bacteria 2921208531 2921209478 531
1087 iso_pu_bacteria 2921237296 2921237929 531
1088 iso_pu_bacteria 2921244191 2921248291 531
1089 iso_pu_bacteria 2921250672 2921256870 531
1090 iso_pu_bacteria 2921257292 2921260982 531
1091 iso_pu_bacteria 2921263974 2921267897 531
1092 iso_pu_bacteria 2921282425 2921287069 531
1093 iso_pu_bacteria 2921289301 2921295700 531
1094 iso_pu_bacteria 2924144063 2924145714 531
1095 iso_pu_bacteria 2924150972 2924155844 531
1096 iso_pu_bacteria 2924158325 2924162445 531
1097 iso_pu_bacteria 2924165586 2924171310 531
1098 iso_pu_bacteria 2924172951 2924178396 531
1099 iso_pu_bacteria 2924179722 2924183398 531
1100 iso_pu_bacteria 2924186466 2924192003 531
1101 iso_pu_bacteria 2924200457 2924204591 531
1102 iso_pu_bacteria 2924214083 2924220846 531
1103 iso_pu_bacteria 2924221636 2924223527 531
1104 iso_pu_bacteria 2924228884 2924234614 531
1105 iso_pu_bacteria 2928108538 2928108702 531
1106 iso_pu_bacteria 2928135762 2928135926 531
1107 iso_pu_bacteria 2928157003 2928158267 531
1108 iso_pu_bacteria 2928163908 2928167514 531
1109 iso_pu_bacteria 2928170801 2928177834 531
1110 iso_pu_bacteria 2928503688 2928504307 531
1111 iso_pu_bacteria 2928536128 2928542898 531
1112 iso_pu_bacteria 2932422444 2932426297 531
1113 iso_pu_bacteria 2936996657 2937002235 531
1114 iso_pu_bacteria 2937002841 2937007227 531
1115 iso_pu_bacteria 2937009748 2937015203 531
1116 iso_pu_bacteria 2937016420 2937020748 531
1117 iso_pu_bacteria 2937023124 2937026948 531
1118 iso_pu_bacteria 2937029754 2937034983 531
1119 iso_pu_bacteria 2937036028 2937039214 531
1120 iso_pu_bacteria 2937042894 2937048060 531
1121 iso_pu_bacteria 2937049772 2937054127 531
1122 iso_pu_bacteria 2937056579 2937060582 531
1123 iso_pu_bacteria 2937063883 2937068016 531
1124 iso_pu_bacteria 2937071275 2937076986 531
1125 iso_pu_bacteria 2937078374 2937084373 531
1126 iso_pu_bacteria 2937091812 2937095333 531
1127 iso_pu_bacteria 2937098957 2937103598 531
1128 iso_pu_bacteria 2937106411 2937110303 531
1129 iso_pu_bacteria 2937113482 2937117190 531
1130 iso_pu_bacteria 2937119839 2937123589 531
1131 iso_pu_bacteria 2937126314 2937130524 531
1132 iso_pu_bacteria 2939631187 2939633815 531
1133 iso_pu_bacteria 2945934425 2945938721 531
1134 iso_pu_bacteria 2957375807 2957379102 531
1135 iso_pu_bacteria 2957382221 2957386364 531
1136 iso_pu_bacteria 2957388812 2957392785 531
1137 iso_pu_bacteria 2957395598 2957401477 531
1138 iso_pu_bacteria 2957402308 2957406648 531
1139 iso_pu_bacteria 2957408893 2957413649 531
1140 iso_pu_bacteria 2957415311 2957420937 531
1141 iso_pu_bacteria 2957422303 2957427384 531
1142 iso_pu_bacteria 2957437181 2957442992 531
1143 iso_pu_bacteria 2957443900 2957449181 531
1144 iso_pu_bacteria 2957457609 2957461445 531
1145 iso_pu_bacteria 2957464669 2957468583 531
1146 iso_pu_bacteria 2957471148 2957476796 531
1147 iso_pu_bacteria 2957478035 2957484268 531
1148 iso_pu_bacteria 2957484790 2957488635 531
1149 iso_pu_bacteria 2957491536 2957497248 531
1150 iso_pu_bacteria 2957498199 2957504217 531
1151 iso_pu_bacteria 2957505466 2957509662 531
1152 iso_pu_bacteria 2960584000 2960586858 531
1153 iso_pu_bacteria 2960591022 2960595261 531
1154 iso_pu_bacteria 2960597568 2960601081 531
1155 iso_pu_bacteria 2960603979 2960608843 531
1156 iso_pu_bacteria 2960610863 2960615808 531
1157 iso_pu_bacteria 2960617483 2960622058 531
1158 iso_pu_bacteria 2960624210 2960629915 531
1159 iso_pu_bacteria 2960631154 2960634350 531
1160 iso_pu_bacteria 2960637947 2960645331 531
1161 iso_pu_bacteria 2960645483 2960649755 531
1162 iso_pu_bacteria 2960652885 2960659014 531
1163 iso_pu_bacteria 2960660292 2960665639 531
1164 iso_pu_bacteria 2960667422 2960671612 531
1165 iso_pu_bacteria 2960674078 2960679895 531
1166 iso_pu_bacteria 2960680706 2960683421 531
1167 iso_pu_bacteria 2960687367 2960690040 531
1168 iso_pu_bacteria 2960693952 2960695273 531
1169 iso_pu_bacteria 2964607997 2964611937 531
1170 iso_pu_bacteria 2964615318 2964619656 531
1171 iso_pu_bacteria 2964621998 2964626938 531
1172 iso_pu_bacteria 2964628898 2964635020 531
1173 iso_pu_bacteria 2964636051 2964640079 531
1174 iso_pu_bacteria 2964643177 2964647458 531
1175 iso_pu_bacteria 2964649959 2964653787 531
1176 iso_pu_bacteria 2964656573 2964663411 531
1177 iso_pu_bacteria 2964663802 2964669197 531
1178 iso_pu_bacteria 2964678106 2964682796 531
1179 iso_pu_bacteria 2964685014 2964690182 531
1180 iso_pu_bacteria 2964691889 2964695611 531
1181 iso_pu_bacteria 2964698721 2964703749 531
1182 iso_pu_bacteria 2964705432 2964711576 531
1183 iso_pu_bacteria 2964712639 2964716253 531
1184 iso_pu_bacteria 2964719344 2964724924 531
1185 iso_pu_bacteria 2967664464 2967665346 531
1186 iso_pu_bacteria 2967671571 2967677194 531
1187 iso_pu_bacteria 2967678726 2967683353 531
1188 iso_pu_bacteria 2967686174 2967687994 531
1189 iso_pu_bacteria 2967693043 2967697008 531
1190 iso_pu_bacteria 2967699805 2967703956 531
1191 iso_pu_bacteria 2967706974 2967711159 531
1192 iso_pu_bacteria 2967714385 2967718404 531
1193 iso_pu_bacteria 2967721400 2967726993 531
1194 iso_pu_bacteria 2967728569 2967734042 531
1195 iso_pu_bacteria 2967735183 2967738799 531
1196 iso_pu_bacteria 2967742019 2967747964 531
1197 iso_pu_bacteria 2967755722 2967759404 531
1198 iso_pu_bacteria 2967762386 2967766263 531
1199 iso_pu_bacteria 2967769361 2967773542 531
1200 iso_pu_bacteria 2967775926 2967780783 531
1201 iso_pu_bacteria 2970019648 2970026605 531
1202 iso_pu_bacteria 2970026789 2970028916 531
1203 iso_pu_bacteria 2970033650 2970040095 531
1204 iso_pu_bacteria 2970040964 2970046414 531
1205 iso_pu_bacteria 2970047711 2970051658 531
1206 iso_pu_bacteria 2970054988 2970059175 531
1207 iso_pu_bacteria 2970061556 2970065420 531
1208 iso_pu_bacteria 2970068827 2970074103 531
1209 iso_pu_bacteria 2970076120 2970080746 531
1210 iso_pu_bacteria 2970082768 2970087084 531
1211 iso_pu_bacteria 2970088815 2970093152 531
1212 iso_pu_bacteria 2970095765 2970099652 531
1213 iso_pu_bacteria 2970102677 2970106493 531
1214 iso_pu_bacteria 2970109326 2970113712 531
1215 iso_pu_bacteria 2970116247 2970120080 531
1216 iso_pu_bacteria 2970122695 2970128495 531
1217 iso_pu_bacteria 2970129317 2970135723 531
1218 iso_pu_bacteria 2970136068 2970141904 531
1219 iso_pu_bacteria 2970143518 2970147826 531
1220 iso_pu_bacteria 2970149975 2970154072 531
1221 iso_pu_bacteria 2970156795 2970161902 531
1222 iso_pu_bacteria 2970164137 2970168087 531
1223 iso_pu_bacteria 2970170962 2970176153 531
1224 iso_pu_bacteria 2970177841 2970179152 531
1225 iso_pu_bacteria 2970184632 2970190218 531
1226 iso_pu_bacteria 2970191845 2970195949 531
1227 iso_pu_bacteria 2977516862 2977523669 531
1228 iso_pu_bacteria 2977523885 2977529772 531
1229 iso_pu_bacteria 2977530762 2977533919 531
1230 iso_pu_bacteria 2977537788 2977541610 531
1231 iso_pu_bacteria 2977544691 2977548007 531
1232 iso_pu_bacteria 2977551784 2977556282 531
1233 iso_pu_bacteria 2977565890 2977570203 531
1234 iso_pu_bacteria 2977572785 2977576942 531
1235 iso_pu_bacteria 2977579622 2977583443 531
1236 iso_pu_bacteria 2981990288 2981996660 531
1237 iso_pu_bacteria 2989349275 2989351566 531
1238 iso_pu_bacteria 2990703756 2990708720 531
1239 iso_pu_bacteria 2990710928 2990710957 531
1240 iso_pu_bacteria 2996887358 2996890405 531
1241 iso_pu_bacteria 3003665799 3003669567 531
1242 iso_pu_bacteria 3004167301 3004171018 531
1243 iso_pu_bacteria 3005452660 3005456110 531
1244 iso_pu_bacteria 641736151 642420867 531
1245 iso_pu_bacteria 641736154 642415613 531
1246 iso_pu_bacteria 643692032 643823019 531
1247 iso_pu_bacteria 648276728 648738327 531
1248 iso_pu_bacteria 8002392321 8002392461 531
1249 iso_pu_bacteria 8003400568 8003404293 531
1250 iso_pu_bacteria 8003992118 8003996740 531
1251 iso_pu_bacteria 8003999396 8004004063 531
1252 iso_pu_bacteria 8005258706 8005262592 531
1253 iso_pu_bacteria 8005321885 8005324932 531
1254 iso_pu_bacteria 8005619151 8005625902 531
1255 iso_pu_bacteria 8011350971 8011356963 531
1256 iso_pu_bacteria 8018176218 8018180798 531
1257 iso_pu_bacteria 8018845410 8018850059 531
1258 iso_pu_bacteria 8020807995 8020810936 531
1259 iso_pu_bacteria 8020938398 8020942433 531
1260 iso_pu_bacteria 8020953355 8020954592 531
1261 iso_pu_bacteria 8021120328 8021123749 531
1262 iso_pu_bacteria 8039098773 8039104416 531
1263 iso_pu_bacteria 8040167225 8040172384 531
1264 iso_pu_bacteria 8040173305 8040177024 531
1265 iso_pu_bacteria 8049293176 8049298495 531
1266 iso_pu_bacteria 8055225921 8055228395 531
1267 iso_pu_bacteria 8055266321 8055269189 531
1268 3300003203 JGI25406J46586_10013287 JGI25406J46586_100132872 532
1269 3300005458 Ga0070681_10012720 Ga0070681_100127206 532
1270 3300005544 Ga0070686_100004762 Ga0070686_1000047623 532
1271 3300005617 Ga0068859_100011261 Ga0068859_1000112615 532
1272 3300005719 Ga0068861_100118575 Ga0068861_1001185752 532
1273 3300005985 Ga0081539_10000720 Ga0081539_1000072068 532
1274 3300006931 Ga0097620_100011261 Ga0097620_1000112615 532
1275 3300007788 Ga0099795_10000018 Ga0099795_1000001824 532
1276 3300009093 Ga0105240_10116124 Ga0105240_101161242 532
1277 3300009093 Ga0105240_10199740 Ga0105240_101997402 532
1278 3300010159 Ga0099796_10000048 Ga0099796_100000487 532
1279 3300013105 Ga0157369_10047479 Ga0157369_100474793 532
1280 3300025913 Ga0207695_10087061 Ga0207695_100870612 532
1281 3300026118 Ga0207675_100015056 Ga0207675_1000150563 532
1282 3300027512 Ga0209179_1000007 Ga0209179_100000787 532
1283 3300031649 Ga0307514_10015637 Ga0307514_100156374 532
1284 3300039437 Ga0436365_1024917 Ga0436365_1024917_2273_3880 532
1285 3300046615 Ga0495656_0017331 Ga0495656_0017331_22_1641 532
1286 3300048903 Ga0496100_0057940 Ga0496100_0057940_631_2238 532
1287 3300048918 Ga0496115_0050208 Ga0496115_0050208_727_2334 532
1288 iso_pu_bacteria 2894772417 2894777341 532
1289 iso_pu_bacteria 2906799679 2906800416 532
1290 iso_pu_bacteria 2977264416 2977266426 532
1291 3300003578 Ga0006562J51391_1087736 Ga0006562J51391_10877362 533
1292 3300005338 Ga0068868_100000761 Ga0068868_1000007617 533
1293 3300005441 Ga0070700_100010228 Ga0070700_1000102285 533
1294 3300005445 Ga0070708_100046848 Ga0070708_1000468482 533
1295 3300005467 Ga0070706_100004243 Ga0070706_1000042434 533
1296 3300005467 Ga0070706_100004591 Ga0070706_10000459116 533
1297 3300005467 Ga0070706_100041253 Ga0070706_1000412533 533
1298 3300005468 Ga0070707_100001417 Ga0070707_10000141719 533
1299 3300005468 Ga0070707_100005118 Ga0070707_10000511813 533
1300 3300005471 Ga0070698_100002589 Ga0070698_1000025895 533
1301 3300005471 Ga0070698_100038577 Ga0070698_1000385775 533
1302 3300005471 Ga0070698_100053249 Ga0070698_1000532493 533
1303 3300005518 Ga0070699_100000775 Ga0070699_10000077522 533
1304 3300005518 Ga0070699_100091366 Ga0070699_1000913662 533
1305 3300005536 Ga0070697_100051710 Ga0070697_1000517102 533
1306 3300005546 Ga0070696_100067165 Ga0070696_1000671652 533
1307 3300005564 Ga0070664_100020858 Ga0070664_1000208582 533
1308 3300005577 Ga0068857_100145432 Ga0068857_1001454322 533
1309 3300005618 Ga0068864_100000022 Ga0068864_100000022210 533
1310 3300006028 Ga0070717_10034110 Ga0070717_100341103 533
1311 3300006881 Ga0068865_100007151 Ga0068865_1000071512 533
1312 3300009147 Ga0114129_10142954 Ga0114129_101429542 533
1313 3300013250 Ga0171462_1003 Ga0171462_1003586 533
1314 3300013296 Ga0157374_10000012 Ga0157374_10000012424 533
1315 3300013308 Ga0157375_10000007 Ga0157375_10000007240 533
1316 3300014745 Ga0157377_10000002 Ga0157377_1000000217 533
1317 3300014969 Ga0157376_10000020 Ga0157376_10000020164 533
1318 3300021358 Ga0213873_10000002 Ga0213873_10000002521 533
1319 3300021384 Ga0213876_10000001 Ga0213876_10000001604 533
1320 3300021384 Ga0213876_10000063 Ga0213876_10000063121 533
1321 3300025907 Ga0207645_10005837 Ga0207645_100058371 533
1322 3300025910 Ga0207684_10022988 Ga0207684_100229884 533
1323 3300025910 Ga0207684_10043948 Ga0207684_100439483 533
1324 3300025912 Ga0207707_10029214 Ga0207707_100292143 533
1325 3300025922 Ga0207646_10001485 Ga0207646_1000148512 533
1326 3300025922 Ga0207646_10001492 Ga0207646_1000149219 533
1327 3300025924 Ga0207694_10000001 Ga0207694_100000011897 533
1328 3300025925 Ga0207650_10015087 Ga0207650_100150875 533
1329 3300025926 Ga0207659_10026627 Ga0207659_100266272 533
1330 3300025945 Ga0207679_10041837 Ga0207679_100418372 533
1331 3300025981 Ga0207640_10019654 Ga0207640_100196542 533
1332 3300025981 Ga0207640_10144269 Ga0207640_101442691 533
1333 3300026023 Ga0207677_10000009 Ga0207677_1000000959 533
1334 3300026023 Ga0207677_10153420 Ga0207677_101534201 533
1335 3300026067 Ga0207678_10107168 Ga0207678_101071682 533
1336 3300026075 Ga0207708_10023705 Ga0207708_100237053 533
1337 3300026095 Ga0207676_10000029 Ga0207676_1000002930 533
1338 3300026116 Ga0207674_10018062 Ga0207674_100180626 533
1339 3300027907 Ga0207428_10002865 Ga0207428_1000286515 533
1340 3300028577 Ga0265318_10011370 Ga0265318_100113705 533
1341 3300031238 Ga0265332_10006386 Ga0265332_100063862 533
1342 3300031242 Ga0265329_10007409 Ga0265329_100074092 533
1343 3300031249 Ga0265339_10001286 Ga0265339_1000128620 533
1344 3300031250 Ga0265331_10007279 Ga0265331_100072796 533
1345 3300031344 Ga0265316_10066938 Ga0265316_100669383 533
1346 3300031344 Ga0265316_10069887 Ga0265316_100698872 533
1347 3300031665 Ga0316575_10002135 Ga0316575_100021358 533
1348 3300031711 Ga0265314_10001416 Ga0265314_100014167 533
1349 3300031711 Ga0265314_10003480 Ga0265314_1000348017 533
1350 3300031712 Ga0265342_10050856 Ga0265342_100508561 533
1351 3300035695 Ga0373927_0002624 Ga0373927_0002624_9242_10843 533
1352 3300037418 Ga0395900_0124953 Ga0395900_0124953_86_1687 533
1353 3300038443 Ga0395901_0123138 Ga0395901_0123138_109_1710 533
1354 3300039437 Ga0436365_0774883 Ga0436365_0774883_73688_75295 533
1355 3300039437 Ga0436365_0818746 Ga0436365_0818746_78269_79876 533
1356 3300039453 Ga0436362_0660519 Ga0436362_0660519_407986_409593 533
1357 3300042131 Ga0450894_000652 Ga0450894_000652_3238_4845 533
1358 3300042184 Ga0450908_003056 Ga0450908_003056_561_2168 533
1359 3300044712 Ga0453684_0000132 Ga0453684_0000132_26262_27872 533
1360 3300049570 Ga0501033_0028306 Ga0501033_0028306_1827_3428 533
1361 3300049571 Ga0501034_0011724 Ga0501034_0011724_4790_6391 533
1362 3300049571 Ga0501034_0027517 Ga0501034_0027517_3745_5352 533
1363 3300049572 Ga0501036_0001771 Ga0501036_0001771_12933_14534 533
1364 3300049574 Ga0501038_0000494 Ga0501038_0000494_17754_19355 533
1365 3300049579 Ga0501043_0001194 Ga0501043_0001194_2242_3843 533
1366 3300049580 Ga0501046_0013469 Ga0501046_0013469_3362_4963 533
1367 3300049581 Ga0501047_0008793 Ga0501047_0008793_4790_6391 533
1368 3300049586 Ga0501070_0000245 Ga0501070_0000245_12757_14361 533
1369 3300049588 Ga0501072_0160021 Ga0501072_0160021_73_1728 533
1370 3300049822 Ga0501035_0019919 Ga0501035_0019919_719_2320 533
1371 3300049823 Ga0501044_0008979 Ga0501044_0008979_2167_3768 533
1372 3300050507 nmdc:mga05p37_46055_c1 nmdc:mga05p37_46055_c1_1167_2774 533
1373 3300050515 nmdc:mga0a205_179401_c1 nmdc:mga0a205_179401_c1_219_1826 533
1374 3300054114 Ga0501084_0115344 Ga0501084_0115344_231_1886 533
1375 iso_pu_bacteria 2582581314 2585319764 533
1376 iso_pu_bacteria 2643221714 2644625593 533
1377 iso_pu_bacteria 2808606982 2811848414 533
1378 iso_pu_bacteria 2821268502 2821269842 533
1379 iso_pu_bacteria 2912715099 2912720678 533
1380 iso_pu_bacteria 2919468124 2919473531 533
1381 iso_pu_bacteria 8056060235 8056064235 533
1382 3300003203 JGI25406J46586_10000038 JGI25406J46586_1000003863 534
1383 3300003215 JGI25153J46596_10004138 JGI25153J46596_100041388 534
1384 3300003794 Ga0055531_10007154 Ga0055531_100071545 534
1385 3300005262 Ga0065165_1002138 Ga0065165_10021386 534
1386 3300005339 Ga0070660_100092472 Ga0070660_1000924722 534
1387 3300005356 Ga0070674_100127978 Ga0070674_1001279781 534
1388 3300005435 Ga0070714_100027807 Ga0070714_1000278072 534
1389 3300005436 Ga0070713_100003848 Ga0070713_1000038486 534
1390 3300005539 Ga0068853_100095410 Ga0068853_1000954102 534
1391 3300005843 Ga0068860_100000738 Ga0068860_10000073828 534
1392 3300005937 Ga0081455_10001075 Ga0081455_100010753 534
1393 3300005983 Ga0081540_1029910 Ga0081540_10299103 534
1394 3300005985 Ga0081539_10000080 Ga0081539_10000080147 534
1395 3300006028 Ga0070717_10013078 Ga0070717_100130784 534
1396 3300006051 Ga0075364_10039185 Ga0075364_100391852 534
1397 3300006163 Ga0070715_10004225 Ga0070715_100042252 534
1398 3300006173 Ga0070716_100021983 Ga0070716_1000219832 534
1399 3300006175 Ga0070712_100049698 Ga0070712_1000496982 534
1400 3300006881 Ga0068865_100018710 Ga0068865_1000187102 534
1401 3300009101 Ga0105247_10049743 Ga0105247_100497432 534
1402 3300009176 Ga0105242_10000242 Ga0105242_1000024225 534
1403 3300009545 Ga0105237_10019662 Ga0105237_100196624 534
1404 3300009551 Ga0105238_10015030 Ga0105238_100150304 534
1405 3300009551 Ga0105238_10049660 Ga0105238_100496604 534
1406 3300021361 Ga0213872_10000836 Ga0213872_1000083618 534
1407 3300021388 Ga0213875_10014263 Ga0213875_100142633 534
1408 3300025253 Ga0209677_103362 Ga0209677_1033622 534
1409 3300025261 Ga0209233_1001798 Ga0209233_10017983 534
1410 3300025295 Ga0209564_1019348 Ga0209564_10193482 534
1411 3300025297 Ga0209758_1000021 Ga0209758_1000021476 534
1412 3300025297 Ga0209758_1001994 Ga0209758_100199411 534
1413 3300025297 Ga0209758_1002553 Ga0209758_100255313 534
1414 3300025304 Ga0209257_1000527 Ga0209257_100052725 534
1415 3300025905 Ga0207685_10001447 Ga0207685_100014472 534
1416 3300025906 Ga0207699_10003289 Ga0207699_100032893 534
1417 3300025915 Ga0207693_10021947 Ga0207693_100219472 534
1418 3300025916 Ga0207663_10000963 Ga0207663_100009639 534
1419 3300025919 Ga0207657_10032334 Ga0207657_100323343 534
1420 3300025924 Ga0207694_10012840 Ga0207694_100128402 534
1421 3300025928 Ga0207700_10010941 Ga0207700_100109414 534
1422 3300025929 Ga0207664_10028741 Ga0207664_100287413 534
1423 3300025934 Ga0207686_10004180 Ga0207686_100041802 534
1424 3300025937 Ga0207669_10022675 Ga0207669_100226752 534
1425 3300025939 Ga0207665_10010799 Ga0207665_100107994 534
1426 3300025940 Ga0207691_10081360 Ga0207691_100813602 534
1427 3300026075 Ga0207708_10081144 Ga0207708_100811442 534
1428 3300026078 Ga0207702_10163310 Ga0207702_101633102 534
1429 3300026089 Ga0207648_10117322 Ga0207648_101173222 534
1430 3300027357 Ga0209589_1000003 Ga0209589_1000003402 534
1431 3300027361 Ga0209489_100003 Ga0209489_100003453 534
1432 3300027363 Ga0209700_100003 Ga0209700_100003453 534
1433 3300027512 Ga0209179_1002568 Ga0209179_10025682 534
1434 3300028379 Ga0268266_10002300 Ga0268266_1000230018 534
1435 3300028381 Ga0268264_10000043 Ga0268264_10000043209 534
1436 3300028786 Ga0307517_10000053 Ga0307517_1000005363 534
1437 3300028794 Ga0307515_10066126 Ga0307515_100661264 534
1438 3300031235 Ga0265330_10026724 Ga0265330_100267242 534
1439 3300031241 Ga0265325_10013593 Ga0265325_100135932 534
1440 3300031616 Ga0307508_10000001 Ga0307508_10000001500 534
1441 3300031616 Ga0307508_10013998 Ga0307508_100139983 534
1442 3300031649 Ga0307514_10010805 Ga0307514_100108053 534
1443 3300031712 Ga0265342_10015981 Ga0265342_100159813 534
1444 3300031730 Ga0307516_10007517 Ga0307516_100075176 534
1445 3300035086 Ga0373934_0000684 Ga0373934_0000684_4990_6594 534
1446 3300035086 Ga0373934_0026986 Ga0373934_0026986_276_1880 534
1447 3300035117 Ga0373953_0000768 Ga0373953_0000768_1193_2797 534
1448 3300035118 Ga0373954_0000045 Ga0373954_0000045_32166_33770 534
1449 3300035119 Ga0373956_0000635 Ga0373956_0000635_5348_6952 534
1450 3300035172 Ga0373955_0000519 Ga0373955_0000519_681_2285 534
1451 3300035410 Ga0373924_0010387 Ga0373924_0010387_1624_3228 534
1452 3300035724 Ga0373933_0000309 Ga0373933_0000309_9908_11512 534
1453 3300035724 Ga0373933_0001241 Ga0373933_0001241_8421_10025 534
1454 3300036401 Ga0373937_0000742 Ga0373937_0000742_19997_21601 534
1455 3300037471 Ga0395905_0009380 Ga0395905_0009380_6897_8501 534
1456 3300037853 Ga0436364_0476731 Ga0436364_0476731_1566_3170 534
1457 3300039437 Ga0436365_0843555 Ga0436365_0843555_444_2048 534
1458 3300039447 Ga0436361_0307998 Ga0436361_0307998_506_2113 534
1459 3300039447 Ga0436361_0319598 Ga0436361_0319598_15399_17006 534
1460 3300039447 Ga0436361_0922325 Ga0436361_0922325_190_1794 534
1461 3300039450 Ga0436363_1052713 Ga0436363_1052713_162_1766 534
1462 3300042002 Ga0439442_000327 Ga0439442_000327_1238_2845 534
1463 3300044693 Ga0466961_0022355 Ga0466961_0022355_1121_2728 534
1464 3300046452 Ga0495617_025787 Ga0495617_025787_165_1769 534
1465 3300046454 Ga0495592_0000436 Ga0495592_0000436_13051_14655 534
1466 3300046455 Ga0495603_0032454 Ga0495603_0032454_937_2541 534
1467 3300046455 Ga0495603_0048284 Ga0495603_0048284_624_2291 534
1468 3300046459 Ga0495629_0000257 Ga0495629_0000257_22958_24562 534
1469 3300046462 Ga0495651_0003296 Ga0495651_0003296_682_2286 534
1470 3300046463 Ga0495653_0000288 Ga0495653_0000288_24340_25944 534
1471 3300046499 Ga0495594_0033120 Ga0495594_0033120_291_1895 534
1472 3300046507 Ga0495606_0086059 Ga0495606_0086059_210_1814 534
1473 3300046511 Ga0495608_0001126 Ga0495608_0001126_16634_18238 534
1474 3300046511 Ga0495608_0023176 Ga0495608_0023176_1541_3145 534
1475 3300046519 Ga0495632_0032470 Ga0495632_0032470_12_1616 534
1476 3300046522 Ga0495643_0016919 Ga0495643_0016919_1393_2997 534
1477 3300046524 Ga0495648_0000717 Ga0495648_0000717_25629_27233 534
1478 3300046529 Ga0495652_0041591 Ga0495652_0041591_2083_3717 534
1479 3300046536 Ga0495587_0000584 Ga0495587_0000584_667_2271 534
1480 3300046559 Ga0495667_0000700 Ga0495667_0000700_14271_15875 534
1481 3300046663 Ga0495635_0000040 Ga0495635_0000040_68649_70253 534
1482 3300046675 Ga0495657_0001715 Ga0495657_0001715_16506_18110 534
1483 3300046678 Ga0495599_0000120 Ga0495599_0000120_15443_17047 534
1484 3300046678 Ga0495599_0016254 Ga0495599_0016254_839_2473 534
1485 3300046679 Ga0495623_0006814 Ga0495623_0006814_1703_3307 534
1486 3300046809 Ga0495600_0000074 Ga0495600_0000074_22832_24436 534
1487 3300047317 Ga0495604_0001303 Ga0495604_0001303_9120_10724 534
1488 3300047322 Ga0495680_0001054 Ga0495680_0001054_23197_24801 534
1489 3300047444 Ga0495675_0000382 Ga0495675_0000382_13207_14811 534
1490 3300047444 Ga0495675_0024379 Ga0495675_0024379_975_2591 534
1491 3300047469 Ga0495673_0014454 Ga0495673_0014454_2164_3768 534
1492 3300047471 Ga0495684_0000134 Ga0495684_0000134_16506_18110 534
1493 3300047673 Ga0495593_0011569 Ga0495593_0011569_202_1806 534
1494 3300048088 Ga0495602_0002953 Ga0495602_0002953_2379_3983 534
1495 3300048915 Ga0496112_0012770 Ga0496112_0012770_1385_2989 534
1496 3300048924 Ga0496121_0068817 Ga0496121_0068817_101_1705 534
1497 3300048927 Ga0496124_0038597 Ga0496124_0038597_2452_4059 534
1498 3300049569 Ga0501032_0006523 Ga0501032_0006523_2229_3836 534
1499 3300049570 Ga0501033_0005255 Ga0501033_0005255_2310_3962 534
1500 3300049570 Ga0501033_0056476 Ga0501033_0056476_278_1885 534
1501 3300049571 Ga0501034_0001007 Ga0501034_0001007_22965_24617 534
1502 3300049571 Ga0501034_0005401 Ga0501034_0005401_10868_12475 534
1503 3300049572 Ga0501036_0002177 Ga0501036_0002177_8213_9865 534
1504 3300049572 Ga0501036_0023231 Ga0501036_0023231_1423_3030 534
1505 3300049573 Ga0501037_0004111 Ga0501037_0004111_4048_5655 534
1506 3300049573 Ga0501037_0009303 Ga0501037_0009303_5107_6711 534
1507 3300049574 Ga0501038_0009471 Ga0501038_0009471_464_2068 534
1508 3300049575 Ga0501039_0002404 Ga0501039_0002404_5204_6811 534
1509 3300049579 Ga0501043_0002005 Ga0501043_0002005_13589_15241 534
1510 3300049579 Ga0501043_0043791 Ga0501043_0043791_278_1885 534
1511 3300049580 Ga0501046_0004738 Ga0501046_0004738_7197_8804 534
1512 3300049581 Ga0501047_0000341 Ga0501047_0000341_10084_11688 534
1513 3300049581 Ga0501047_0045621 Ga0501047_0045621_2185_3789 534
1514 3300049581 Ga0501047_0092569 Ga0501047_0092569_1017_2624 534
1515 3300049582 Ga0501048_0004373 Ga0501048_0004373_7767_9374 534
1516 3300049585 Ga0501069_0046880 Ga0501069_0046880_529_2133 534
1517 3300049586 Ga0501070_0003719 Ga0501070_0003719_5218_6825 534
1518 3300049588 Ga0501072_0013474 Ga0501072_0013474_1592_3196 534
1519 3300049590 Ga0501074_0015861 Ga0501074_0015861_1660_3264 534
1520 3300049593 Ga0501077_0086679 Ga0501077_0086679_248_1852 534
1521 3300049741 Ga0501079_0103320 Ga0501079_0103320_519_2123 534
1522 3300049744 Ga0501083_0002138 Ga0501083_0002138_4524_6128 534
1523 3300049822 Ga0501035_0034003 Ga0501035_0034003_706_2310 534
1524 3300049822 Ga0501035_0048332 Ga0501035_0048332_1017_2624 534
1525 3300049823 Ga0501044_0002168 Ga0501044_0002168_17893_19509 534
1526 3300049823 Ga0501044_0006203 Ga0501044_0006203_6981_8585 534
1527 3300049823 Ga0501044_0027416 Ga0501044_0027416_950_2557 534
1528 3300049823 Ga0501044_0107446 Ga0501044_0107446_1102_2706 534
1529 3300049824 Ga0501045_0008635 Ga0501045_0008635_3999_5603 534
1530 3300049824 Ga0501045_0020968 Ga0501045_0020968_311_1918 534
1531 3300050516 nmdc:mga0sz30_33994_c1 nmdc:mga0sz30_33994_c1_345_1949 534
1532 3300053080 Ga0500635_0000039 Ga0500635_0000039_38155_39762 534
1533 3300053084 Ga0495595_0000064 Ga0495595_0000064_29288_30892 534
1534 3300053084 Ga0495595_0011328 Ga0495595_0011328_1354_2958 534
1535 3300053085 Ga0495619_0000995 Ga0495619_0000995_16750_18354 534
1536 3300053085 Ga0495619_0021913 Ga0495619_0021913_1652_3256 534
1537 3300053087 Ga0500643_000015 Ga0500643_000015_250985_252589 534
1538 3300053094 Ga0500566_0000010 Ga0500566_0000010_88935_90539 534
1539 3300053095 Ga0500640_031403 Ga0500640_031403_19_1623 534
1540 3300053105 Ga0500557_000002 Ga0500557_000002_171495_173099 534
1541 3300053111 Ga0500572_000031 Ga0500572_000031_29413_31017 534
1542 3300053119 Ga0500595_000914 Ga0500595_000914_972_2576 534
1543 3300053130 Ga0500642_0000043 Ga0500642_0000043_30997_32601 534
1544 3300053134 Ga0500658_0027562 Ga0500658_0027562_403_2007 534
1545 3300053136 Ga0500559_0008850 Ga0500559_0008850_405_2009 534
1546 3300053153 Ga0500616_0002646 Ga0500616_0002646_11284_12891 534
1547 3300053153 Ga0500616_0023420 Ga0500616_0023420_309_1913 534
1548 3300053156 Ga0500622_0028141 Ga0500622_0028141_979_2583 534
1549 3300053163 Ga0500639_000084 Ga0500639_000084_2408_4012 534
1550 iso_pu_bacteria 2585428094 2587864480 534
1551 iso_pu_bacteria 2833709550 2833710765 534
1552 iso_pu_bacteria 8045830549 8045830995 534
1553 3300001915 JGI24741J21665_1000834 JGI24741J21665_10008344 535
1554 3300001979 JGI24740J21852_10002020 JGI24740J21852_100020206 535
1555 3300001979 JGI24740J21852_10002025 JGI24740J21852_100020254 535
1556 3300001979 JGI24740J21852_10005408 JGI24740J21852_100054081 535
1557 3300001989 JGI24739J22299_10002379 JGI24739J22299_100023793 535
1558 3300002067 JGI24735J21928_10001288 JGI24735J21928_100012886 535
1559 3300002704 JGI25155J39150_1000064 JGI25155J39150_100006435 535
1560 3300002705 JGI25156J39149_1000085 JGI25156J39149_100008535 535
1561 3300002705 JGI25156J39149_1000327 JGI25156J39149_100032730 535
1562 3300002738 JGI25154J39366_1000112 JGI25154J39366_100011235 535
1563 3300002741 JGI25157J39369_1000109 JGI25157J39369_100010935 535
1564 3300002773 JGI25152J39213_1001187 JGI25152J39213_10011879 535
1565 3300002773 JGI25152J39213_1003929 JGI25152J39213_10039294 535
1566 3300002774 JGI25150J39212_1002997 JGI25150J39212_10029974 535
1567 3300002987 JGI25159J45721_1000075 JGI25159J45721_100007539 535
1568 3300002987 JGI25159J45721_1000246 JGI25159J45721_100024619 535
1569 3300002987 JGI25159J45721_1000672 JGI25159J45721_10006727 535
1570 3300003187 JGI25151J46595_10001019 JGI25151J46595_1000101919 535
1571 3300003187 JGI25151J46595_10004632 JGI25151J46595_100046323 535
1572 3300003215 JGI25153J46596_10006260 JGI25153J46596_100062602 535
1573 3300003215 JGI25153J46596_10016966 JGI25153J46596_100169662 535
1574 3300003354 JGI25160J50197_1000073 JGI25160J50197_10000739 535
1575 3300003354 JGI25160J50197_1000451 JGI25160J50197_100045119 535
1576 3300003354 JGI25160J50197_1008868 JGI25160J50197_10088682 535
1577 3300003374 JGI25161J50226_1000077 JGI25161J50226_100007741 535
1578 3300003374 JGI25161J50226_1005007 JGI25161J50226_10050072 535
1579 3300003374 JGI25161J50226_1005903 JGI25161J50226_10059032 535
1580 3300003752 Ga0055539_1000645 Ga0055539_10006456 535
1581 3300003758 Ga0055532_1000006 Ga0055532_1000006397 535
1582 3300003759 Ga0055525_1000004 Ga0055525_100000482 535
1583 3300003759 Ga0055525_1000837 Ga0055525_10008376 535
1584 3300003761 Ga0055535_1000004 Ga0055535_1000004397 535
1585 3300003763 Ga0055529_1000273 Ga0055529_100027351 535
1586 3300003763 Ga0055529_1000539 Ga0055529_100053917 535
1587 3300003771 Ga0055526_1001057 Ga0055526_10010578 535
1588 3300003771 Ga0055526_1001658 Ga0055526_100165813 535
1589 3300003771 Ga0055526_1010931 Ga0055526_10109314 535
1590 3300003771 Ga0055526_1016079 Ga0055526_10160791 535
1591 3300003771 Ga0055526_1026338 Ga0055526_10263381 535
1592 3300003773 Ga0055537_1000621 Ga0055537_100062112 535
1593 3300003773 Ga0055537_1003681 Ga0055537_10036813 535
1594 3300003775 Ga0055524_1000294 Ga0055524_100029418 535
1595 3300003775 Ga0055524_1000344 Ga0055524_100034432 535
1596 3300003775 Ga0055524_1001108 Ga0055524_10011082 535
1597 3300003775 Ga0055524_1003409 Ga0055524_10034093 535
1598 3300003775 Ga0055524_1004948 Ga0055524_10049483 535
1599 3300003775 Ga0055524_1013468 Ga0055524_10134683 535
1600 3300003781 Ga0055536_1000700 Ga0055536_100070011 535
1601 3300003784 Ga0055534_1005181 Ga0055534_10051811 535
1602 3300003791 Ga0055530_10000853 Ga0055530_1000085320 535
1603 3300003791 Ga0055530_10000981 Ga0055530_100009813 535
1604 3300003791 Ga0055530_10009711 Ga0055530_100097113 535
1605 3300003792 Ga0055540_1000028 Ga0055540_100002881 535
1606 3300003792 Ga0055540_1000139 Ga0055540_100013928 535
1607 3300003794 Ga0055531_10000393 Ga0055531_100003938 535
1608 3300003794 Ga0055531_10000440 Ga0055531_1000044014 535
1609 3300003794 Ga0055531_10000717 Ga0055531_100007175 535
1610 3300003794 Ga0055531_10005930 Ga0055531_100059305 535
1611 3300003794 Ga0055531_10008527 Ga0055531_100085274 535
1612 3300003794 Ga0055531_10019798 Ga0055531_100197982 535
1613 3300004625 Ga0055543_1000629 Ga0055543_100062915 535
1614 3300004625 Ga0055543_1001603 Ga0055543_10016038 535
1615 3300005262 Ga0065165_1000081 Ga0065165_100008178 535
1616 3300005262 Ga0065165_1000198 Ga0065165_10001989 535
1617 3300005262 Ga0065165_1000289 Ga0065165_10002897 535
1618 3300005262 Ga0065165_1001190 Ga0065165_10011907 535
1619 3300005262 Ga0065165_1001706 Ga0065165_100170619 535
1620 3300005262 Ga0065165_1008159 Ga0065165_10081593 535
1621 3300005327 Ga0070658_10019632 Ga0070658_100196324 535
1622 3300005329 Ga0070683_100010112 Ga0070683_1000101124 535
1623 3300005338 Ga0068868_100001788 Ga0068868_10000178813 535
1624 3300005338 Ga0068868_100154722 Ga0068868_1001547222 535
1625 3300005339 Ga0070660_100000277 Ga0070660_10000027714 535
1626 3300005339 Ga0070660_100003674 Ga0070660_1000036744 535
1627 3300005339 Ga0070660_100051219 Ga0070660_1000512192 535
1628 3300005339 Ga0070660_100142088 Ga0070660_1001420881 535
1629 3300005344 Ga0070661_100004670 Ga0070661_1000046704 535
1630 3300005344 Ga0070661_100009592 Ga0070661_1000095922 535
1631 3300005347 Ga0070668_100046300 Ga0070668_1000463003 535
1632 3300005353 Ga0070669_100036550 Ga0070669_1000365502 535
1633 3300005355 Ga0070671_100011241 Ga0070671_1000112411 535
1634 3300005355 Ga0070671_100064802 Ga0070671_1000648021 535
1635 3300005356 Ga0070674_100036475 Ga0070674_1000364752 535
1636 3300005366 Ga0070659_100000616 Ga0070659_10000061620 535
1637 3300005366 Ga0070659_100000738 Ga0070659_10000073816 535
1638 3300005367 Ga0070667_100002525 Ga0070667_10000252512 535
1639 3300005434 Ga0070709_10023418 Ga0070709_100234184 535
1640 3300005435 Ga0070714_100034976 Ga0070714_1000349764 535
1641 3300005436 Ga0070713_100000093 Ga0070713_1000000939 535
1642 3300005436 Ga0070713_100073880 Ga0070713_1000738803 535
1643 3300005441 Ga0070700_100009093 Ga0070700_1000090933 535
1644 3300005455 Ga0070663_100000239 Ga0070663_10000023914 535
1645 3300005455 Ga0070663_100003172 Ga0070663_1000031724 535
1646 3300005455 Ga0070663_100005073 Ga0070663_1000050737 535
1647 3300005455 Ga0070663_100006029 Ga0070663_1000060295 535
1648 3300005456 Ga0070678_100022120 Ga0070678_1000221205 535
1649 3300005457 Ga0070662_100001899 Ga0070662_1000018997 535
1650 3300005458 Ga0070681_10010220 Ga0070681_100102203 535
1651 3300005458 Ga0070681_10075162 Ga0070681_100751622 535
1652 3300005459 Ga0068867_100004111 Ga0068867_1000041119 535
1653 3300005468 Ga0070707_100106642 Ga0070707_1001066423 535
1654 3300005530 Ga0070679_100010473 Ga0070679_1000104739 535
1655 3300005530 Ga0070679_100020760 Ga0070679_1000207606 535
1656 3300005530 Ga0070679_100055349 Ga0070679_1000553494 535
1657 3300005535 Ga0070684_100026787 Ga0070684_1000267875 535
1658 3300005539 Ga0068853_100004240 Ga0068853_1000042407 535
1659 3300005543 Ga0070672_100014412 Ga0070672_1000144122 535
1660 3300005543 Ga0070672_100100681 Ga0070672_1001006812 535
1661 3300005544 Ga0070686_100126171 Ga0070686_1001261711 535
1662 3300005548 Ga0070665_100021746 Ga0070665_1000217462 535
1663 3300005548 Ga0070665_100133251 Ga0070665_1001332513 535
1664 3300005563 Ga0068855_100001097 Ga0068855_10000109728 535
1665 3300005563 Ga0068855_100023215 Ga0068855_1000232152 535
1666 3300005563 Ga0068855_100070225 Ga0068855_1000702253 535
1667 3300005564 Ga0070664_100003001 Ga0070664_10000300112 535
1668 3300005564 Ga0070664_100006480 Ga0070664_1000064804 535
1669 3300005564 Ga0070664_100010765 Ga0070664_1000107654 535
1670 3300005578 Ga0068854_100005268 Ga0068854_1000052682 535
1671 3300005578 Ga0068854_100016111 Ga0068854_1000161115 535
1672 3300005614 Ga0068856_100003602 Ga0068856_1000036025 535
1673 3300005614 Ga0068856_100004835 Ga0068856_10000483515 535
1674 3300005614 Ga0068856_100005726 Ga0068856_10000572614 535
1675 3300005614 Ga0068856_100009539 Ga0068856_1000095394 535
1676 3300005614 Ga0068856_100048274 Ga0068856_1000482742 535
1677 3300005616 Ga0068852_100022892 Ga0068852_1000228924 535
1678 3300005616 Ga0068852_100026749 Ga0068852_1000267494 535
1679 3300005617 Ga0068859_100139880 Ga0068859_1001398801 535
1680 3300005618 Ga0068864_100052232 Ga0068864_1000522323 535
1681 3300005718 Ga0068866_10006888 Ga0068866_100068883 535
1682 3300005834 Ga0068851_10026514 Ga0068851_100265142 535
1683 3300005841 Ga0068863_100051325 Ga0068863_1000513252 535
1684 3300005842 Ga0068858_100045219 Ga0068858_1000452193 535
1685 3300005843 Ga0068860_100017416 Ga0068860_1000174162 535
1686 3300005843 Ga0068860_100041225 Ga0068860_1000412253 535
1687 3300005843 Ga0068860_100077969 Ga0068860_1000779692 535
1688 3300005844 Ga0068862_100140068 Ga0068862_1001400682 535
1689 3300005937 Ga0081455_10001410 Ga0081455_1000141024 535
1690 3300005983 Ga0081540_1012947 Ga0081540_10129472 535
1691 3300005985 Ga0081539_10001055 Ga0081539_1000105518 535
1692 3300006028 Ga0070717_10002063 Ga0070717_1000206310 535
1693 3300006038 Ga0075365_10004340 Ga0075365_100043404 535
1694 3300006038 Ga0075365_10116084 Ga0075365_101160842 535
1695 3300006042 Ga0075368_10010447 Ga0075368_100104472 535
1696 3300006051 Ga0075364_10000557 Ga0075364_1000055711 535
1697 3300006051 Ga0075364_10075295 Ga0075364_100752952 535
1698 3300006178 Ga0075367_10002592 Ga0075367_100025924 535
1699 3300006195 Ga0075366_10044974 Ga0075366_100449742 535
1700 3300006353 Ga0075370_10004866 Ga0075370_100048662 535
1701 3300006353 Ga0075370_10068181 Ga0075370_100681811 535
1702 3300006353 Ga0075370_10070139 Ga0075370_100701391 535
1703 3300006358 Ga0068871_100013192 Ga0068871_1000131922 535
1704 3300006846 Ga0075430_100045091 Ga0075430_1000450913 535
1705 3300006880 Ga0075429_100030646 Ga0075429_1000306462 535
1706 3300006880 Ga0075429_100045029 Ga0075429_1000450293 535
1707 3300006914 Ga0075436_100058444 Ga0075436_1000584443 535
1708 3300006931 Ga0097620_100139876 Ga0097620_1001398762 535
1709 3300006944 Ga0099823_1000051 Ga0099823_100005130 535
1710 3300006946 Ga0079104_1000058 Ga0079104_100005822 535
1711 3300006946 Ga0079104_1010357 Ga0079104_10103572 535
1712 3300007265 Ga0099794_10000111 Ga0099794_100001113 535
1713 3300009092 Ga0105250_10000418 Ga0105250_1000041823 535
1714 3300009092 Ga0105250_10002429 Ga0105250_100024293 535
1715 3300009093 Ga0105240_10001792 Ga0105240_100017928 535
1716 3300009093 Ga0105240_10183917 Ga0105240_101839171 535
1717 3300009148 Ga0105243_10002121 Ga0105243_1000212116 535
1718 3300009148 Ga0105243_10087266 Ga0105243_100872662 535
1719 3300009174 Ga0105241_10006534 Ga0105241_100065345 535
1720 3300009176 Ga0105242_10011026 Ga0105242_100110267 535
1721 3300009177 Ga0105248_10003122 Ga0105248_100031225 535
1722 3300009177 Ga0105248_10235281 Ga0105248_102352812 535
1723 3300009545 Ga0105237_10010949 Ga0105237_100109492 535
1724 3300009545 Ga0105237_10033777 Ga0105237_100337773 535
1725 3300009553 Ga0105249_10113727 Ga0105249_101137271 535
1726 3300010375 Ga0105239_10009133 Ga0105239_100091336 535
1727 3300010375 Ga0105239_10021898 Ga0105239_100218985 535
1728 3300012497 Ga0157319_1000004 Ga0157319_100000410 535
1729 3300013100 Ga0157373_10005110 Ga0157373_100051102 535
1730 3300013100 Ga0157373_10007554 Ga0157373_100075541 535
1731 3300013100 Ga0157373_10036275 Ga0157373_100362751 535
1732 3300013102 Ga0157371_10000330 Ga0157371_1000033038 535
1733 3300013102 Ga0157371_10006672 Ga0157371_100066726 535
1734 3300013104 Ga0157370_10000031 Ga0157370_1000003150 535
1735 3300013104 Ga0157370_10005558 Ga0157370_100055581 535
1736 3300013104 Ga0157370_10118328 Ga0157370_101183282 535
1737 3300013105 Ga0157369_10000905 Ga0157369_1000090515 535
1738 3300013105 Ga0157369_10001415 Ga0157369_1000141524 535
1739 3300013105 Ga0157369_10003573 Ga0157369_100035732 535
1740 3300013249 Ga0171463_1002 Ga0171463_10029 535
1741 3300013296 Ga0157374_10000141 Ga0157374_1000014148 535
1742 3300013307 Ga0157372_10003374 Ga0157372_1000337413 535
1743 3300013307 Ga0157372_10013312 Ga0157372_100133124 535
1744 3300013307 Ga0157372_10018145 Ga0157372_100181455 535
1745 3300013308 Ga0157375_10110400 Ga0157375_101104002 535
1746 3300014325 Ga0163163_10034114 Ga0163163_100341142 535
1747 3300014326 Ga0157380_10042129 Ga0157380_100421293 535
1748 3300014745 Ga0157377_10000069 Ga0157377_1000006953 535
1749 3300014968 Ga0157379_10137126 Ga0157379_101371262 535
1750 3300015690 Ga0183363_1304 Ga0183363_13043 535
1751 3300017792 Ga0163161_10033338 Ga0163161_100333382 535
1752 3300021320 Ga0214544_1000646 Ga0214544_100064657 535
1753 3300021321 Ga0214542_1000027 Ga0214542_100002762 535
1754 3300021327 Ga0214543_1000025 Ga0214543_1000025129 535
1755 3300021327 Ga0214543_1000047 Ga0214543_100004736 535
1756 3300021361 Ga0213872_10000031 Ga0213872_1000003139 535
1757 3300021361 Ga0213872_10000037 Ga0213872_1000003741 535
1758 3300021361 Ga0213872_10000107 Ga0213872_1000010745 535
1759 3300021361 Ga0213872_10026117 Ga0213872_100261174 535
1760 3300022739 Ga0228711_1021534 Ga0228711_10215344 535
1761 3300022740 Ga0228710_1006811 Ga0228710_100681112 535
1762 3300025206 Ga0209435_100002 Ga0209435_100002666 535
1763 3300025208 Ga0209436_100108 Ga0209436_10010821 535
1764 3300025224 Ga0209784_100006 Ga0209784_100006658 535
1765 3300025224 Ga0209784_100597 Ga0209784_10059711 535
1766 3300025225 Ga0209566_100002 Ga0209566_100002658 535
1767 3300025225 Ga0209566_100700 Ga0209566_1007007 535
1768 3300025225 Ga0209566_101395 Ga0209566_1013953 535
1769 3300025226 Ga0209674_100010 Ga0209674_100010478 535
1770 3300025226 Ga0209674_101858 Ga0209674_1018583 535
1771 3300025226 Ga0209674_102689 Ga0209674_1026893 535
1772 3300025228 Ga0209672_100020 Ga0209672_10002050 535
1773 3300025228 Ga0209672_100145 Ga0209672_10014531 535
1774 3300025228 Ga0209672_100390 Ga0209672_1003908 535
1775 3300025229 Ga0209147_100015 Ga0209147_100015153 535
1776 3300025229 Ga0209147_100024 Ga0209147_10002450 535
1777 3300025229 Ga0209147_100201 Ga0209147_10020131 535
1778 3300025229 Ga0209147_100256 Ga0209147_10025633 535
1779 3300025230 Ga0209563_100004 Ga0209563_10000469 535
1780 3300025230 Ga0209563_100013 Ga0209563_10001382 535
1781 3300025242 Ga0209258_100021 Ga0209258_100021153 535
1782 3300025242 Ga0209258_100084 Ga0209258_10008450 535
1783 3300025242 Ga0209258_100350 Ga0209258_10035031 535
1784 3300025245 Ga0207425_1000036 Ga0207425_1000036103 535
1785 3300025245 Ga0207425_1000238 Ga0207425_100023841 535
1786 3300025245 Ga0207425_1005562 Ga0207425_10055622 535
1787 3300025246 Ga0209646_1000001 Ga0209646_10000012809 535
1788 3300025250 Ga0209026_1000121 Ga0209026_100012135 535
1789 3300025253 Ga0209677_100007 Ga0209677_100007658 535
1790 3300025254 Ga0209148_1000327 Ga0209148_100032731 535
1791 3300025254 Ga0209148_1001409 Ga0209148_10014095 535
1792 3300025256 Ga0209759_1000001 Ga0209759_10000012440 535
1793 3300025256 Ga0209759_1000052 Ga0209759_1000052129 535
1794 3300025258 Ga0209129_1000062 Ga0209129_10000624 535
1795 3300025258 Ga0209129_1001728 Ga0209129_10017286 535
1796 3300025263 Ga0209565_1000016 Ga0209565_100001668 535
1797 3300025263 Ga0209565_1003483 Ga0209565_10034832 535
1798 3300025263 Ga0209565_1004056 Ga0209565_10040562 535
1799 3300025263 Ga0209565_1004057 Ga0209565_10040572 535
1800 3300025263 Ga0209565_1012570 Ga0209565_10125702 535
1801 3300025272 Ga0209455_1000028 Ga0209455_1000028153 535
1802 3300025272 Ga0209455_1000248 Ga0209455_100024831 535
1803 3300025273 Ga0209673_1000057 Ga0209673_1000057160 535
1804 3300025273 Ga0209673_1000073 Ga0209673_1000073210 535
1805 3300025273 Ga0209673_1003353 Ga0209673_10033534 535
1806 3300025273 Ga0209673_1003969 Ga0209673_10039696 535
1807 3300025273 Ga0209673_1005102 Ga0209673_10051021 535
1808 3300025273 Ga0209673_1005325 Ga0209673_10053251 535
1809 3300025273 Ga0209673_1016859 Ga0209673_10168592 535
1810 3300025284 Ga0209130_1000040 Ga0209130_1000040179 535
1811 3300025284 Ga0209130_1000153 Ga0209130_10001539 535
1812 3300025284 Ga0209130_1000354 Ga0209130_100035442 535
1813 3300025284 Ga0209130_1004819 Ga0209130_10048196 535
1814 3300025291 Ga0209675_1000122 Ga0209675_100012223 535
1815 3300025292 Ga0209676_1000395 Ga0209676_100039565 535
1816 3300025292 Ga0209676_1000666 Ga0209676_100066622 535
1817 3300025292 Ga0209676_1028900 Ga0209676_10289001 535
1818 3300025294 Ga0209025_1000019 Ga0209025_100001948 535
1819 3300025294 Ga0209025_1000333 Ga0209025_10003339 535
1820 3300025294 Ga0209025_1003349 Ga0209025_10033494 535
1821 3300025294 Ga0209025_1004234 Ga0209025_100423411 535
1822 3300025294 Ga0209025_1013423 Ga0209025_10134234 535
1823 3300025294 Ga0209025_1015598 Ga0209025_10155983 535
1824 3300025294 Ga0209025_1024509 Ga0209025_10245093 535
1825 3300025295 Ga0209564_1000008 Ga0209564_1000008168 535
1826 3300025295 Ga0209564_1000014 Ga0209564_100001478 535
1827 3300025295 Ga0209564_1000280 Ga0209564_10002809 535
1828 3300025295 Ga0209564_1001246 Ga0209564_10012468 535
1829 3300025295 Ga0209564_1001744 Ga0209564_100174415 535
1830 3300025295 Ga0209564_1001751 Ga0209564_100175120 535
1831 3300025295 Ga0209564_1002020 Ga0209564_100202013 535
1832 3300025295 Ga0209564_1012428 Ga0209564_10124282 535
1833 3300025295 Ga0209564_1019034 Ga0209564_10190341 535
1834 3300025297 Ga0209758_1000126 Ga0209758_100012696 535
1835 3300025297 Ga0209758_1000129 Ga0209758_1000129165 535
1836 3300025297 Ga0209758_1003114 Ga0209758_10031148 535
1837 3300025297 Ga0209758_1009132 Ga0209758_10091325 535
1838 3300025298 Ga0209050_1000084 Ga0209050_100008465 535
1839 3300025298 Ga0209050_1000282 Ga0209050_100028219 535
1840 3300025298 Ga0209050_1000502 Ga0209050_100050227 535
1841 3300025298 Ga0209050_1000852 Ga0209050_100085235 535
1842 3300025298 Ga0209050_1002252 Ga0209050_10022526 535
1843 3300025299 Ga0209256_1000015 Ga0209256_1000015109 535
1844 3300025299 Ga0209256_1000064 Ga0209256_10000649 535
1845 3300025299 Ga0209256_1000313 Ga0209256_10003139 535
1846 3300025299 Ga0209256_1000811 Ga0209256_100081121 535
1847 3300025299 Ga0209256_1001123 Ga0209256_10011239 535
1848 3300025299 Ga0209256_1001124 Ga0209256_10011245 535
1849 3300025299 Ga0209256_1002149 Ga0209256_10021493 535
1850 3300025299 Ga0209256_1010626 Ga0209256_10106261 535
1851 3300025302 Ga0207426_1000280 Ga0207426_10002809 535
1852 3300025302 Ga0207426_1000359 Ga0207426_100035910 535
1853 3300025302 Ga0207426_1001223 Ga0207426_100122316 535
1854 3300025302 Ga0207426_1001336 Ga0207426_100133624 535
1855 3300025303 Ga0209051_1000022 Ga0209051_1000022346 535
1856 3300025303 Ga0209051_1000058 Ga0209051_100005865 535
1857 3300025303 Ga0209051_1000280 Ga0209051_100028041 535
1858 3300025303 Ga0209051_1002965 Ga0209051_10029657 535
1859 3300025304 Ga0209257_1000016 Ga0209257_1000016172 535
1860 3300025304 Ga0209257_1000030 Ga0209257_1000030544 535
1861 3300025304 Ga0209257_1000087 Ga0209257_100008746 535
1862 3300025304 Ga0209257_1000092 Ga0209257_100009265 535
1863 3300025304 Ga0209257_1000165 Ga0209257_100016541 535
1864 3300025304 Ga0209257_1001027 Ga0209257_10010279 535
1865 3300025304 Ga0209257_1002180 Ga0209257_10021809 535
1866 3300025304 Ga0209257_1004584 Ga0209257_10045846 535
1867 3300025711 Ga0207696_1000147 Ga0207696_100014756 535
1868 3300025711 Ga0207696_1001154 Ga0207696_10011545 535
1869 3300025904 Ga0207647_10000264 Ga0207647_1000026412 535
1870 3300025907 Ga0207645_10027593 Ga0207645_100275932 535
1871 3300025908 Ga0207643_10035227 Ga0207643_100352272 535
1872 3300025909 Ga0207705_10036568 Ga0207705_100365683 535
1873 3300025911 Ga0207654_10012461 Ga0207654_100124614 535
1874 3300025912 Ga0207707_10001948 Ga0207707_100019482 535
1875 3300025912 Ga0207707_10012301 Ga0207707_100123012 535
1876 3300025913 Ga0207695_10006723 Ga0207695_100067235 535
1877 3300025913 Ga0207695_10009029 Ga0207695_1000902911 535
1878 3300025913 Ga0207695_10050782 Ga0207695_100507823 535
1879 3300025914 Ga0207671_10009367 Ga0207671_100093673 535
1880 3300025915 Ga0207693_10055438 Ga0207693_100554382 535
1881 3300025919 Ga0207657_10000003 Ga0207657_1000000364 535
1882 3300025919 Ga0207657_10000169 Ga0207657_1000016959 535
1883 3300025919 Ga0207657_10000745 Ga0207657_1000074517 535
1884 3300025919 Ga0207657_10000927 Ga0207657_100009278 535
1885 3300025919 Ga0207657_10022126 Ga0207657_100221263 535
1886 3300025919 Ga0207657_10041878 Ga0207657_100418782 535
1887 3300025920 Ga0207649_10002908 Ga0207649_100029086 535
1888 3300025920 Ga0207649_10061573 Ga0207649_100615732 535
1889 3300025921 Ga0207652_10007510 Ga0207652_100075109 535
1890 3300025921 Ga0207652_10013940 Ga0207652_100139405 535
1891 3300025921 Ga0207652_10039102 Ga0207652_100391021 535
1892 3300025924 Ga0207694_10016717 Ga0207694_100167174 535
1893 3300025924 Ga0207694_10165432 Ga0207694_101654321 535
1894 3300025926 Ga0207659_10058318 Ga0207659_100583182 535
1895 3300025928 Ga0207700_10000073 Ga0207700_1000007347 535
1896 3300025928 Ga0207700_10003148 Ga0207700_100031483 535
1897 3300025928 Ga0207700_10171684 Ga0207700_101716842 535
1898 3300025929 Ga0207664_10014981 Ga0207664_100149814 535
1899 3300025929 Ga0207664_10015163 Ga0207664_100151635 535
1900 3300025931 Ga0207644_10011232 Ga0207644_100112322 535
1901 3300025931 Ga0207644_10088173 Ga0207644_100881732 535
1902 3300025932 Ga0207690_10000007 Ga0207690_1000000765 535
1903 3300025932 Ga0207690_10001061 Ga0207690_1000106112 535
1904 3300025932 Ga0207690_10008488 Ga0207690_100084884 535
1905 3300025933 Ga0207706_10000023 Ga0207706_100000237 535
1906 3300025935 Ga0207709_10000160 Ga0207709_1000016023 535
1907 3300025935 Ga0207709_10002264 Ga0207709_100022643 535
1908 3300025935 Ga0207709_10024451 Ga0207709_100244512 535
1909 3300025935 Ga0207709_10057896 Ga0207709_100578961 535
1910 3300025937 Ga0207669_10121924 Ga0207669_101219241 535
1911 3300025939 Ga0207665_10033990 Ga0207665_100339902 535
1912 3300025940 Ga0207691_10014621 Ga0207691_100146217 535
1913 3300025941 Ga0207711_10057311 Ga0207711_100573113 535
1914 3300025942 Ga0207689_10007725 Ga0207689_100077255 535
1915 3300025942 Ga0207689_10124366 Ga0207689_101243662 535
1916 3300025944 Ga0207661_10010000 Ga0207661_100100005 535
1917 3300025945 Ga0207679_10000007 Ga0207679_10000007291 535
1918 3300025945 Ga0207679_10013781 Ga0207679_100137814 535
1919 3300025949 Ga0207667_10001383 Ga0207667_1000138310 535
1920 3300025949 Ga0207667_10008850 Ga0207667_100088503 535
1921 3300025949 Ga0207667_10016327 Ga0207667_100163277 535
1922 3300025949 Ga0207667_10019658 Ga0207667_100196586 535
1923 3300025960 Ga0207651_10039683 Ga0207651_100396831 535
1924 3300025981 Ga0207640_10000107 Ga0207640_1000010749 535
1925 3300025986 Ga0207658_10031607 Ga0207658_100316073 535
1926 3300026023 Ga0207677_10020339 Ga0207677_100203393 535
1927 3300026035 Ga0207703_10006237 Ga0207703_100062378 535
1928 3300026041 Ga0207639_10010939 Ga0207639_100109395 535
1929 3300026067 Ga0207678_10001969 Ga0207678_100019692 535
1930 3300026067 Ga0207678_10008085 Ga0207678_100080856 535
1931 3300026067 Ga0207678_10011358 Ga0207678_100113587 535
1932 3300026067 Ga0207678_10012488 Ga0207678_100124882 535
1933 3300026067 Ga0207678_10017713 Ga0207678_100177133 535
1934 3300026075 Ga0207708_10002903 Ga0207708_1000290310 535
1935 3300026078 Ga0207702_10000260 Ga0207702_1000026051 535
1936 3300026078 Ga0207702_10004398 Ga0207702_100043986 535
1937 3300026078 Ga0207702_10005167 Ga0207702_100051672 535
1938 3300026078 Ga0207702_10020136 Ga0207702_100201364 535
1939 3300026089 Ga0207648_10008955 Ga0207648_100089556 535
1940 3300026089 Ga0207648_10015226 Ga0207648_100152264 535
1941 3300026116 Ga0207674_10000429 Ga0207674_100004295 535
1942 3300026118 Ga0207675_100005732 Ga0207675_1000057325 535
1943 3300026118 Ga0207675_100008757 Ga0207675_1000087575 535
1944 3300026118 Ga0207675_100113155 Ga0207675_1001131552 535
1945 3300026121 Ga0207683_10023126 Ga0207683_100231263 535
1946 3300026142 Ga0207698_10009610 Ga0207698_100096105 535
1947 3300026142 Ga0207698_10011139 Ga0207698_100111395 535
1948 3300026142 Ga0207698_10027312 Ga0207698_100273122 535
1949 3300026142 Ga0207698_10032212 Ga0207698_100322123 535
1950 3300027111 Ga0209281_1000017 Ga0209281_1000017500 535
1951 3300027111 Ga0209281_1000314 Ga0209281_100031456 535
1952 3300027296 Ga0209389_1003130 Ga0209389_10031309 535
1953 3300027312 Ga0209371_1000292 Ga0209371_100029217 535
1954 3300027312 Ga0209371_1002246 Ga0209371_10022462 535
1955 3300027614 Ga0209970_1000300 Ga0209970_10003008 535
1956 3300027666 Ga0209282_1000068 Ga0209282_100006856 535
1957 3300027671 Ga0209588_1002124 Ga0209588_10021242 535
1958 3300027695 Ga0209966_1000161 Ga0209966_100016114 535
1959 3300027866 Ga0209813_10007844 Ga0209813_100078442 535
1960 3300028380 Ga0268265_10009307 Ga0268265_100093072 535
1961 3300028380 Ga0268265_10079019 Ga0268265_100790192 535
1962 3300028381 Ga0268264_10047641 Ga0268264_100476412 535
1963 3300028794 Ga0307515_10000062 Ga0307515_10000062140 535
1964 3300028794 Ga0307515_10000346 Ga0307515_1000034660 535
1965 3300028794 Ga0307515_10000398 Ga0307515_1000039829 535
1966 3300028794 Ga0307515_10001252 Ga0307515_100012528 535
1967 3300028794 Ga0307515_10005050 Ga0307515_1000505024 535
1968 3300028794 Ga0307515_10006111 Ga0307515_1000611125 535
1969 3300028794 Ga0307515_10024951 Ga0307515_100249519 535
1970 3300028794 Ga0307515_10113321 Ga0307515_101133212 535
1971 3300030500 Ga0268256_1000255 Ga0268256_100025517 535
1972 3300030500 Ga0268256_1003512 Ga0268256_10035125 535
1973 3300031235 Ga0265330_10000052 Ga0265330_1000005222 535
1974 3300031238 Ga0265332_10000001 Ga0265332_10000001797 535
1975 3300031239 Ga0265328_10002917 Ga0265328_100029172 535
1976 3300031241 Ga0265325_10002984 Ga0265325_100029846 535
1977 3300031251 Ga0265327_10000080 Ga0265327_10000080151 535
1978 3300031251 Ga0265327_10000622 Ga0265327_1000062244 535
1979 3300031344 Ga0265316_10019109 Ga0265316_100191092 535
1980 3300031456 Ga0307513_10000070 Ga0307513_10000070108 535
1981 3300031456 Ga0307513_10000162 Ga0307513_1000016253 535
1982 3300031456 Ga0307513_10004918 Ga0307513_100049184 535
1983 3300031456 Ga0307513_10011662 Ga0307513_100116627 535
1984 3300031507 Ga0307509_10000032 Ga0307509_10000032194 535
1985 3300031507 Ga0307509_10008220 Ga0307509_100082208 535
1986 3300031507 Ga0307509_10075146 Ga0307509_100751462 535
1987 3300031548 Ga0307408_100000012 Ga0307408_100000012243 535
1988 3300031548 Ga0307408_100000219 Ga0307408_10000021921 535
1989 3300031548 Ga0307408_100002474 Ga0307408_1000024746 535
1990 3300031616 Ga0307508_10000023 Ga0307508_10000023120 535
1991 3300031616 Ga0307508_10020567 Ga0307508_100205672 535
1992 3300031649 Ga0307514_10003961 Ga0307514_100039615 535
1993 3300031649 Ga0307514_10016384 Ga0307514_100163844 535
1994 3300031711 Ga0265314_10000013 Ga0265314_1000001320 535
1995 3300031727 Ga0316576_10005251 Ga0316576_100052513 535
1996 3300031727 Ga0316576_10056466 Ga0316576_100564661 535
1997 3300031730 Ga0307516_10000045 Ga0307516_10000045127 535
1998 3300031730 Ga0307516_10003224 Ga0307516_100032248 535
1999 3300031730 Ga0307516_10010031 Ga0307516_100100319 535
2000 3300031733 Ga0316577_10016321 Ga0316577_100163213 535
2001 3300031901 Ga0307406_10000407 Ga0307406_1000040721 535
2002 3300031901 Ga0307406_10005726 Ga0307406_100057264 535
2003 3300031911 Ga0307412_10000002 Ga0307412_10000002204 535
2004 3300031967 Ga0315914_1020806 Ga0315914_10208064 535
2005 3300032002 Ga0307416_100004227 Ga0307416_1000042275 535
2006 3300032004 Ga0307414_10029553 Ga0307414_100295532 535
2007 3300032004 Ga0307414_10039044 Ga0307414_100390442 535
2008 3300032004 Ga0307414_10063992 Ga0307414_100639922 535
2009 3300032005 Ga0307411_10126242 Ga0307411_101262422 535
2010 3300033430 Ga0315913_1002536 Ga0315913_10025368 535
2011 3300033464 Ga0315915_1000007 Ga0315915_1000007297 535
2012 3300035121 Ga0373960_0000576 Ga0373960_0000576_5761_7368 535
2013 3300035691 Ga0373931_0003169 Ga0373931_0003169_872_2479 535
2014 3300036647 Ga0316582_0076106 Ga0316582_0076106_489_2096 535
2015 3300037068 Ga0373925_0087351 Ga0373925_0087351_344_1951 535
2016 3300037312 Ga0395899_0000013 Ga0395899_0000013_252302_253909 535
2017 3300037312 Ga0395899_0000023 Ga0395899_0000023_28883_30490 535
2018 3300037312 Ga0395899_0000078 Ga0395899_0000078_24630_26237 535
2019 3300037312 Ga0395899_0002871 Ga0395899_0002871_6701_8308 535
2020 3300037312 Ga0395899_0022135 Ga0395899_0022135_788_2395 535
2021 3300037312 Ga0395899_0027406 Ga0395899_0027406_1042_2649 535
2022 3300037418 Ga0395900_0000019 Ga0395900_0000019_336670_338277 535
2023 3300037418 Ga0395900_0000211 Ga0395900_0000211_29569_31176 535
2024 3300037418 Ga0395900_0019625 Ga0395900_0019625_4329_5936 535
2025 3300037418 Ga0395900_0035336 Ga0395900_0035336_3004_4611 535
2026 3300037418 Ga0395900_0105174 Ga0395900_0105174_941_2548 535
2027 3300037418 Ga0395900_0157547 Ga0395900_0157547_500_2107 535
2028 3300037466 Ga0395898_0000016 Ga0395898_0000016_331816_333423 535
2029 3300037466 Ga0395898_0007259 Ga0395898_0007259_1316_2923 535
2030 3300037466 Ga0395898_0010588 Ga0395898_0010588_6428_8050 535
2031 3300037466 Ga0395898_0053635 Ga0395898_0053635_2079_3686 535
2032 3300037466 Ga0395898_0056493 Ga0395898_0056493_1643_3250 535
2033 3300037471 Ga0395905_0000117 Ga0395905_0000117_46546_48153 535
2034 3300037471 Ga0395905_0000283 Ga0395905_0000283_13776_15383 535
2035 3300037471 Ga0395905_0000352 Ga0395905_0000352_14582_16189 535
2036 3300037471 Ga0395905_0001425 Ga0395905_0001425_11612_13219 535
2037 3300037471 Ga0395905_0003331 Ga0395905_0003331_6060_7667 535
2038 3300037471 Ga0395905_0003956 Ga0395905_0003956_899_2680 535
2039 3300037471 Ga0395905_0011137 Ga0395905_0011137_4201_5808 535
2040 3300037471 Ga0395905_0017915 Ga0395905_0017915_3892_5499 535
2041 3300037471 Ga0395905_0018137 Ga0395905_0018137_801_2408 535
2042 3300037471 Ga0395905_0031988 Ga0395905_0031988_2253_3860 535
2043 3300037471 Ga0395905_0047994 Ga0395905_0047994_296_2032 535
2044 3300038443 Ga0395901_0011033 Ga0395901_0011033_3935_5542 535
2045 3300038443 Ga0395901_0047204 Ga0395901_0047204_1908_3515 535
2046 3300039447 Ga0436361_0067858 Ga0436361_0067858_1107_2714 535
2047 3300039447 Ga0436361_0192229 Ga0436361_0192229_564_2171 535
2048 3300039447 Ga0436361_0208418 Ga0436361_0208418_6622_8229 535
2049 3300039447 Ga0436361_0224368 Ga0436361_0224368_5140_6780 535
2050 3300039447 Ga0436361_0424891 Ga0436361_0424891_1756_3363 535
2051 3300039447 Ga0436361_0437880 Ga0436361_0437880_5692_7299 535
2052 3300039447 Ga0436361_0807409 Ga0436361_0807409_8029_9636 535
2053 3300039447 Ga0436361_0913791 Ga0436361_0913791_2611_4218 535
2054 3300039447 Ga0436361_0937617 Ga0436361_0937617_1294_2901 535
2055 3300039447 Ga0436361_0941839 Ga0436361_0941839_119321_120928 535
2056 3300039447 Ga0436361_1034384 Ga0436361_1034384_3783_5390 535
2057 3300039450 Ga0436363_0794016 Ga0436363_0794016_1610_3217 535
2058 3300042007 Ga0439449_0016081 Ga0439449_0016081_570_2177 535
2059 3300042438 Ga0439459_0000205 Ga0439459_0000205_2981_4588 535
2060 3300042876 Ga0451577_0000014 Ga0451577_0000014_303520_305127 535
2061 3300042876 Ga0451577_0000388 Ga0451577_0000388_24086_25720 535
2062 3300042876 Ga0451577_0006997 Ga0451577_0006997_7321_8928 535
2063 3300042876 Ga0451577_0013489 Ga0451577_0013489_3956_5563 535
2064 3300044656 Ga0466969_0054442 Ga0466969_0054442_291_1898 535
2065 3300044673 Ga0453683_0002610 Ga0453683_0002610_8384_9991 535
2066 3300044673 Ga0453683_0003826 Ga0453683_0003826_9138_10745 535
2067 3300044684 Ga0466966_0000009 Ga0466966_0000009_112434_114041 535
2068 3300044684 Ga0466966_0033613 Ga0466966_0033613_1189_2796 535
2069 3300044693 Ga0466961_0000353 Ga0466961_0000353_16125_17732 535
2070 3300044693 Ga0466961_0006262 Ga0466961_0006262_751_2358 535
2071 3300044694 Ga0466963_0040009 Ga0466963_0040009_1198_2805 535
2072 3300044712 Ga0453684_0000082 Ga0453684_0000082_304846_306453 535
2073 3300044712 Ga0453684_0000187 Ga0453684_0000187_24988_26622 535
2074 3300044712 Ga0453684_0000204 Ga0453684_0000204_39217_40824 535
2075 3300044712 Ga0453684_0001066 Ga0453684_0001066_41797_43404 535
2076 3300044712 Ga0453684_0002858 Ga0453684_0002858_3556_5163 535
2077 3300044712 Ga0453684_0007830 Ga0453684_0007830_11674_13281 535
2078 3300044712 Ga0453684_0031157 Ga0453684_0031157_3933_5540 535
2079 3300044712 Ga0453684_0048661 Ga0453684_0048661_860_2467 535
2080 3300044712 Ga0453684_0239155 Ga0453684_0239155_238_1845 535
2081 3300044719 Ga0466971_0022622 Ga0466971_0022622_562_2169 535
2082 3300044735 Ga0466968_0017610 Ga0466968_0017610_508_2115 535
2083 3300045049 Ga0466959_0000938 Ga0466959_0000938_3179_4786 535
2084 3300045049 Ga0466959_0005843 Ga0466959_0005843_1700_3307 535
2085 3300045051 Ga0451576_0000096 Ga0451576_0000096_59369_60976 535
2086 3300045051 Ga0451576_0005438 Ga0451576_0005438_9014_10621 535
2087 3300045051 Ga0451576_0028947 Ga0451576_0028947_1111_2718 535
2088 3300045051 Ga0451576_0055246 Ga0451576_0055246_1594_3201 535
2089 3300045836 Ga0466958_0008156 Ga0466958_0008156_937_2544 535
2090 3300045836 Ga0466958_0027790 Ga0466958_0027790_608_2215 535
2091 3300046471 Ga0495650_0007201 Ga0495650_0007201_3440_5047 535
2092 3300046507 Ga0495606_0000873 Ga0495606_0000873_8363_9970 535
2093 3300046507 Ga0495606_0019756 Ga0495606_0019756_2887_4494 535
2094 3300046507 Ga0495606_0037209 Ga0495606_0037209_525_2132 535
2095 3300046512 Ga0495610_0000092 Ga0495610_0000092_83773_85443 535
2096 3300046513 Ga0495616_0002407 Ga0495616_0002407_7532_9202 535
2097 3300046522 Ga0495643_0050007 Ga0495643_0050007_54_1661 535
2098 3300046530 Ga0495654_0000010 Ga0495654_0000010_149736_151406 535
2099 3300046542 Ga0495597_0002137 Ga0495597_0002137_9415_11022 535
2100 3300046557 Ga0495622_0000692 Ga0495622_0000692_3288_4895 535
2101 3300046558 Ga0495633_0007327 Ga0495633_0007327_2461_4068 535
2102 3300046616 Ga0495668_0005568 Ga0495668_0005568_2202_3872 535
2103 3300046660 Ga0495625_0000295 Ga0495625_0000295_23118_24725 535
2104 3300047320 Ga0495672_0003177 Ga0495672_0003177_11111_12718 535
2105 3300047472 Ga0495686_0000090 Ga0495686_0000090_41071_42678 535
2106 3300048903 Ga0496100_0025105 Ga0496100_0025105_1731_3341 535
2107 3300048904 Ga0496101_0068987 Ga0496101_0068987_91_1698 535
2108 3300048905 Ga0496102_0044851 Ga0496102_0044851_2031_3641 535
2109 3300048908 Ga0496105_0038978 Ga0496105_0038978_195_1805 535
2110 3300048909 Ga0496106_0000852 Ga0496106_0000852_14783_16390 535
2111 3300048909 Ga0496106_0013667 Ga0496106_0013667_1832_3442 535
2112 3300048909 Ga0496106_0025589 Ga0496106_0025589_1540_3147 535
2113 3300048909 Ga0496106_0052408 Ga0496106_0052408_137_1744 535
2114 3300048911 Ga0496108_0009068 Ga0496108_0009068_2707_4317 535
2115 3300048912 Ga0496109_0025721 Ga0496109_0025721_1987_3597 535
2116 3300048913 Ga0496110_0034208 Ga0496110_0034208_1846_3456 535
2117 3300048914 Ga0496111_0014357 Ga0496111_0014357_1914_3524 535
2118 3300048915 Ga0496112_0089671 Ga0496112_0089671_10_1617 535
2119 3300048916 Ga0496113_0005533 Ga0496113_0005533_181_1791 535
2120 3300048917 Ga0496114_0013825 Ga0496114_0013825_2739_4349 535
2121 3300048918 Ga0496115_0025731 Ga0496115_0025731_2207_3877 535
2122 3300048924 Ga0496121_0000303 Ga0496121_0000303_444_2051 535
2123 3300048924 Ga0496121_0029495 Ga0496121_0029495_2164_3834 535
2124 3300048925 Ga0496122_0011264 Ga0496122_0011264_2319_3926 535
2125 3300048925 Ga0496122_0037915 Ga0496122_0037915_1074_2681 535
2126 3300048927 Ga0496124_0002789 Ga0496124_0002789_2284_3891 535
2127 3300048928 Ga0496125_0001159 Ga0496125_0001159_12451_14058 535
2128 3300048928 Ga0496125_0013587 Ga0496125_0013587_2186_3817 535
2129 3300048928 Ga0496125_0038602 Ga0496125_0038602_1223_2830 535
2130 3300048929 Ga0496126_0000315 Ga0496126_0000315_65599_67206 535
2131 3300048929 Ga0496126_0038837 Ga0496126_0038837_1679_3286 535
2132 3300049459 Ga0495678_013497 Ga0495678_013497_213_1820 535
2133 3300049570 Ga0501033_0016641 Ga0501033_0016641_506_2113 535
2134 3300049576 Ga0501040_0006452 Ga0501040_0006452_4650_6257 535
2135 3300049581 Ga0501047_0005327 Ga0501047_0005327_695_2302 535
2136 3300049586 Ga0501070_0061236 Ga0501070_0061236_515_2122 535
2137 3300049588 Ga0501072_0008620 Ga0501072_0008620_1434_3041 535
2138 3300049589 Ga0501073_0007988 Ga0501073_0007988_2694_4301 535
2139 3300049589 Ga0501073_0017803 Ga0501073_0017803_62_1669 535
2140 3300049592 Ga0501076_0000337 Ga0501076_0000337_16441_18048 535
2141 3300049742 Ga0501080_0000476 Ga0501080_0000476_23355_24962 535
2142 3300049742 Ga0501080_0126781 Ga0501080_0126781_58_1665 535
2143 3300049775 Ga0501279_001251 Ga0501279_001251_661_2268 535
2144 3300049822 Ga0501035_0012407 Ga0501035_0012407_4591_6198 535
2145 3300049822 Ga0501035_0158625 Ga0501035_0158625_99_1706 535
2146 3300049824 Ga0501045_0003147 Ga0501045_0003147_6025_7632 535
2147 3300050492 nmdc:mga0yw44_14167_c1 nmdc:mga0yw44_14167_c1_2406_4016 535
2148 3300050496 nmdc:mga07m45_503_c1 nmdc:mga07m45_503_c1_635_2299 535
2149 3300050496 nmdc:mga07m45_7110_c1 nmdc:mga07m45_7110_c1_2077_3687 535
2150 3300050508 nmdc:mga09592_30307_c1 nmdc:mga09592_30307_c1_1350_2957 535
2151 3300050512 nmdc:mga0n895_90066_c1 nmdc:mga0n895_90066_c1_678_2285 535
2152 3300053080 Ga0500635_0004585 Ga0500635_0004585_1740_3347 535
2153 3300053086 Ga0500578_0000040 Ga0500578_0000040_48938_50545 535
2154 3300053098 Ga0500650_0000121 Ga0500650_0000121_4449_6056 535
2155 3300053104 Ga0500556_0000611 Ga0500556_0000611_3349_5019 535
2156 3300053117 Ga0500593_000387 Ga0500593_000387_2181_3788 535
2157 3300053117 Ga0500593_000627 Ga0500593_000627_7634_9256 535
2158 3300053122 Ga0500608_000321 Ga0500608_000321_6386_7993 535
2159 3300053122 Ga0500608_064059 Ga0500608_064059_48_1655 535
2160 3300053131 Ga0500652_000133 Ga0500652_000133_2441_4048 535
2161 3300053156 Ga0500622_0001741 Ga0500622_0001741_5003_6610 535
2162 3300053730 Ga0500645_001733 Ga0500645_001733_535_2157 535
2163 3300054114 Ga0501084_0000907 Ga0501084_0000907_4825_6432 535
2164 3300060353 Ga0501082_0009535 Ga0501082_0009535_1241_2848 535
2165 3300061719 Ga0466962_0003462 Ga0466962_0003462_5467_7074 535
2166 3300061719 Ga0466962_0017705 Ga0466962_0017705_291_1898 535
2167 3300061734 Ga0530510_0001617 Ga0530510_0001617_6558_8165 535
2168 iso_pu_bacteria 2791355091 2792619474 535
2169 iso_pu_bacteria 2791355092 2792627245 535

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

90

576

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q0g-assembly1.cif.gz_C crystal structure of beta subunit of acyl-coa carboxylase accd1 from mycobacterium tuberculosis 0.9914 18 535
4q0g-assembly1.cif.gz_C crystal structure of beta subunit of acyl-coa carboxylase accd1 from mycobacterium tuberculosis 0.9858 18 535
3u9t-assembly1.cif.gz_B crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme 0.9843 2 535
4q0g-assembly1.cif.gz_B-2 crystal structure of beta subunit of acyl-coa carboxylase accd1 from mycobacterium tuberculosis 0.9825 18 535
3u9t-assembly1.cif.gz_B crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme 0.9821 2 535
ID Description Score Start End Superfamily
af_O86318_1_265_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9844 4 272 3.90.226.10
af_A4HUX0_21_275_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9785 42 267 3.90.226.10
af_O86318_1_265_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.977 4 272 3.90.226.10
af_O86318_267_524_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9729 276 525 3.90.226.10
3u9tB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9652 39 269 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A3B9BPN7-F1-model_v4 Methylcrotonoyl-CoA carboxylase 1 36 138 GO:0004485
GO:0006552
GO:1905202
AF-A0A2W5PZL7-F1-model_v4 deleted 0.9985 1 139
AF-A0A022FPE0-F1-model_v4 Methylmalonyl-CoA carboxyltransferase 0.9979 48 245 GO:0004485
GO:0006552
GO:0016740
GO:1905202
AF-A0A520DUF9-F1-model_v4 Methylcrotonoyl-CoA carboxylase 0.9975 348 535 GO:0004485
GO:0006552
GO:1905202
AF-A0A3B9PQF5-F1-model_v4 Methylcrotonoyl-CoA carboxylase 0.9958 1 397 GO:0004485
GO:0006552
GO:1905202

Feature Viewer

pLDDT pTM Quality
95.24 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map