F496500
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2169 | 1196 | 1526 | 530 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0047994|Ga0395905_0047994_296_2032 |
| Length | 578 |
| Sequence | MTRAKAIGVAATGGAAGMAGASLTGTICDLRVGLPPGALALRFAMILESQLNPRSAEFQSNAQAMQALVDDLARQVAKAAAGGGEAARAKHTARGKLLPRDRVQMLLDPGTPFLEIAPLAAHDMYNGDAPCAGVIAGIGRVSGVDCMIVCNDATVKGGTYYPMTVKKHLRAQEIAAQNRLPCIYLVDSGGANLPNQDDVFPDRDHFGRIFYNQANLSAQGIAQIAVVMGSCTAGGAYVPAMSDETIIVKNQGTIFLGGPPLVKAATGEIVSAEDLGGGDAHTRLSGVADHLAQNDMHALALARQAVATLDKRKDWPVEVREPRAPKYDPRQIGGVVPQDTRKPYDVREVIARLVDASEFHEFKARFGTTLVCGFAHIEGMPVGIVANNGILFSESAQKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIARHGAKMVTAVATASVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVKRDGIEGKGGKWSAEEEAAFKQPLLDQFAHQSHPYFSSARLWDDGVIDPADTRRVLALGLSAAMNAPIGEPKFGVFRM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 8 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 15 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 16 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 17 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 18 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 19 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 20 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 21 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 22 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 23 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 24 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 25 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 26 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 27 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 28 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 29 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 30 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 31 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 32 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 33 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 34 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 35 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 36 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 37 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 38 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 39 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 40 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 41 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 42 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 43 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 44 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 45 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 46 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 47 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 48 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 49 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 50 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 51 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 52 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 53 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 54 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 55 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 56 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 57 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 58 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 59 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 60 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 61 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 62 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 63 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 64 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 65 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 66 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 67 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 68 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 69 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 70 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 71 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 72 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 73 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 74 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 75 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 76 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 77 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 78 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 79 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 80 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 81 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 82 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 83 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 84 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 85 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 86 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 87 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 88 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 89 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 90 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 91 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 92 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 93 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 94 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 95 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 96 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 97 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 98 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 99 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 100 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 101 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 102 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 103 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 104 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 105 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 106 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 107 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 108 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 109 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 110 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 111 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 112 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 113 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 114 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 115 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 116 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 117 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 118 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 119 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 120 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 121 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 122 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 123 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 124 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 125 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 126 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 127 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 128 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 129 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 130 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 131 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 132 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 133 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 134 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 135 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 136 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 137 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 138 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 139 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 140 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 141 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 142 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 143 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 144 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 145 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 146 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 147 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 148 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 149 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 150 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 151 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 152 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 153 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 154 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 155 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 156 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 157 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 158 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 159 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 160 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 161 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 162 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 163 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 164 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 165 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 166 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 167 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 168 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 169 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 170 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 171 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 172 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 173 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 174 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 175 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 176 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 177 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 178 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 179 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 180 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 181 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 182 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 183 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 184 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 185 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 186 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 187 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 188 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 189 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 190 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 191 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 192 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 193 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 194 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 195 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 196 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 197 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 198 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 199 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 200 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 201 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 202 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 203 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 204 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 205 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 206 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 207 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 208 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 209 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 210 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 211 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 212 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 213 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 214 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 215 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 216 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 217 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 218 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 219 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 220 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 221 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 222 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 223 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 224 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 225 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 226 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 227 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 228 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 229 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 230 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 231 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 232 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 233 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 234 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 235 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 236 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 237 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 238 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 239 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 240 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 241 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 242 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 243 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 244 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 245 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 246 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 247 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 248 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 249 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 250 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 251 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 252 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 253 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 254 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 255 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 256 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 257 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 258 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 259 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 260 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 261 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 262 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 263 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 264 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 265 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 266 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 267 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 268 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 269 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 270 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 271 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 272 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 273 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 274 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 275 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 276 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 277 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 278 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 279 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 280 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 281 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 282 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 283 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 284 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 285 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 286 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 287 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 288 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 289 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 290 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 291 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 292 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 293 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 294 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 295 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 296 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 297 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 298 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 299 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 300 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 301 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 302 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 303 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 304 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 305 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 306 | 2904699407 | |||
| 307 | 2906610324 | |||
| 308 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 309 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 310 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 311 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 312 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 313 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 314 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 315 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 316 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 317 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 318 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 319 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 320 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 321 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 322 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 323 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 324 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 325 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 326 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 327 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 328 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 329 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 330 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 331 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 332 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 333 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 334 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 335 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 336 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 337 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 338 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 339 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 340 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 341 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 342 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 343 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 344 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 345 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 346 | 2922368715 | |||
| 347 | 2922425934 | |||
| 348 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 349 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 350 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 351 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 352 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 353 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 354 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 355 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 356 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 357 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 358 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 359 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 360 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 361 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 362 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 363 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 364 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 365 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 366 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 367 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 368 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 369 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 370 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 371 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 372 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 373 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 374 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 375 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 376 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 377 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 378 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 379 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 380 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 381 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 382 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 383 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 384 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 385 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 386 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 387 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 388 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 389 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 390 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 391 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 392 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 393 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 394 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 395 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 396 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 397 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 398 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 399 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 400 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 401 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 402 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 403 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 404 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 405 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 406 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 407 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 408 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 409 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 410 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 411 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 412 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 413 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 414 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 415 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 416 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 417 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 418 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 419 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 420 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 421 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 422 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 423 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 424 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 425 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 426 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 427 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 428 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 429 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 430 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 431 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 432 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 433 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 434 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 435 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 436 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 437 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 438 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 439 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 440 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 441 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 442 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 443 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 444 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 445 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 446 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 447 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 448 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 449 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 450 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 451 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 452 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 453 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 454 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 455 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 456 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 457 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 458 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 459 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 460 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 461 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 462 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 463 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 464 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 465 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 466 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 467 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 468 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 469 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 470 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 471 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 472 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 473 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 474 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 475 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 476 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 477 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 478 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 479 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 480 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 481 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 482 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 483 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 484 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 485 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 486 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 487 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 488 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 489 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 490 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 491 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 492 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 493 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 494 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 495 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 496 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 497 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 498 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 499 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 500 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 501 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 502 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 503 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 504 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 505 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 506 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 507 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 508 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 509 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 510 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 511 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 512 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 513 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 514 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 515 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 516 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 517 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 518 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 519 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 520 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 521 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 522 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 523 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 524 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 525 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 526 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 527 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 528 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 529 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 530 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 531 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 532 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 533 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 534 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 535 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 536 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 537 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 538 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 539 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 540 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 541 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 542 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 543 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 544 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 545 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 546 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 547 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 548 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 549 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 550 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 551 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 552 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 553 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 554 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 555 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 556 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 557 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 558 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 559 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 560 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 561 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 562 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 563 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 564 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 565 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 566 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 567 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 568 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 569 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 570 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 571 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 572 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 573 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 574 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 575 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 576 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 577 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 578 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 579 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 580 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 581 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 582 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 583 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 584 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 585 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 586 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 587 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 588 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 589 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 590 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 591 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 592 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 593 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 594 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 595 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 596 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 597 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 598 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 599 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 600 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 601 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 602 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 603 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 604 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 605 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 606 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 607 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 608 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 609 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 610 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 611 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 612 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 613 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 614 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 615 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 616 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 617 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 618 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 619 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 620 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 621 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 622 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 623 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 624 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 625 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 626 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 627 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 628 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 629 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 630 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 631 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 632 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 633 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 634 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 635 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 636 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 637 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 638 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 639 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 640 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 641 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 642 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 643 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 644 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 645 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 646 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 647 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 648 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 649 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 650 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 651 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 652 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 653 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 654 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 655 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 656 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 657 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 658 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 659 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 660 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 661 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 662 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 663 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 664 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 665 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 666 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 667 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 668 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 669 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 670 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 671 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 672 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 673 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 674 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 675 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 676 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 677 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 678 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 679 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 680 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 681 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 682 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 683 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 684 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 685 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 686 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 687 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 688 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 689 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 690 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 691 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 692 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 693 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 694 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 695 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 696 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 697 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 698 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 699 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 700 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 702 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 703 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 704 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 705 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 706 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 707 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 708 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 709 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 710 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 711 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 712 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 713 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 714 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 715 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 716 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 717 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 718 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 719 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 720 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 721 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 722 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 723 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 724 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 725 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 726 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 727 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 728 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 729 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 730 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 731 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 732 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 733 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 734 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 735 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 736 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 737 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 738 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 739 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 740 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 741 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 742 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 743 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 744 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 745 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 746 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 747 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 748 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 749 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 750 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 751 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 752 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 753 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 754 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 755 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 756 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 757 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 758 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 759 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 760 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 761 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 762 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 763 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 764 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 765 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 766 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 767 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 768 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 769 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 770 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 771 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 772 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 773 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 774 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 775 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 776 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 777 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 778 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 779 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 780 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 781 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 782 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 783 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 784 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 785 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 786 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 787 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 788 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 789 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 790 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 791 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 792 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 793 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 794 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 795 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 796 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 797 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 798 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 799 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 800 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 801 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 802 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 803 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 804 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 805 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 806 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 807 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 808 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 809 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 810 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 811 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 812 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 813 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 814 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 815 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 816 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 817 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 818 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 819 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 820 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 821 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 822 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 823 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 824 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 825 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 826 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 827 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 828 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 829 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 830 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 831 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 832 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 833 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 834 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 835 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 836 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 837 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 838 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 839 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 840 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 841 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 842 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 843 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 844 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 845 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 846 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 847 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 848 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 849 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 850 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 851 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 852 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 853 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 854 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 855 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 856 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 857 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 858 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 859 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 860 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 861 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 862 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 863 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 864 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 865 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 866 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 867 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 868 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 869 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 870 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 871 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 872 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 873 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 874 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 875 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 876 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 877 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 878 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 879 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 880 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 881 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 882 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 883 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 884 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 885 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 886 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 887 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 888 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 889 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 890 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 891 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 892 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 893 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 894 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 895 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 896 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 897 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 898 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 899 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 900 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 901 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 902 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 903 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 904 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 905 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 906 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 907 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 908 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 909 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 910 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 911 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 912 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 913 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 914 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 915 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 916 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 917 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 918 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 919 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 920 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 921 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 922 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 923 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 924 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 925 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 926 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 927 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 928 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 929 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 930 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 931 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 932 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 933 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 934 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 935 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 936 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 937 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 938 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 939 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 940 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 941 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 942 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 943 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 944 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 945 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 946 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 947 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 948 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 949 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 950 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 951 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 952 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 953 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 954 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 955 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 956 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 957 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 958 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 959 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 960 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 961 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 962 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 963 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 964 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 965 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 966 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 967 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 968 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 969 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 970 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 971 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 972 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 973 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 974 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 975 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 976 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 977 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 978 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 979 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 980 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 981 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 982 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 983 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 984 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 985 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 986 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 987 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 988 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 989 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 990 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 991 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 992 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 993 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 994 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 995 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 996 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 997 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 998 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 999 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1000 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1001 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1002 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 1003 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1004 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 1005 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1006 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1007 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1008 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1009 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1010 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1011 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1012 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1013 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1014 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1015 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1016 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1017 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1018 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 1019 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1020 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1021 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1022 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1023 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1024 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1025 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1026 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1027 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1028 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1029 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1030 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1031 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1032 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1033 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1034 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1035 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1036 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1037 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1038 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1039 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1040 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1041 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1042 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1043 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1044 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1045 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1046 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1047 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1048 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1049 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1050 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1051 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1052 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1053 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1054 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1055 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1056 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1057 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1058 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1059 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1060 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1061 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1062 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1063 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1064 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1065 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1066 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1067 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1068 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1069 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1070 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1071 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1072 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1073 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1074 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1075 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1076 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1077 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1078 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1079 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1080 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1081 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1082 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1083 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1084 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1085 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1086 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1087 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1088 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1089 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1090 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 1091 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1092 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1093 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1094 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1095 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1096 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1097 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1098 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1099 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1100 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1101 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1102 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1103 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1104 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1105 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1106 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1107 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 1108 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1111 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1112 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1113 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1114 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 1115 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 1116 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 1117 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1118 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1119 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 1120 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1121 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 1122 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1123 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1124 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1125 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 1126 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1127 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1128 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1129 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1130 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1131 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1132 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 1133 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1134 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1135 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1136 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 1137 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1138 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1139 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 1140 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 1141 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1142 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1143 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 1144 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 1145 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1146 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1147 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 1148 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1149 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1150 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1151 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 1152 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 1153 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 1154 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 1155 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 1156 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 1157 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 1158 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 1159 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 1160 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 1161 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 1162 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1163 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1164 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1165 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1166 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1167 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1168 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1169 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 1170 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 1171 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 1172 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 1173 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 1174 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 1175 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1176 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 1177 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 1178 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1179 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1180 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 1181 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 1182 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 1183 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 1184 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 1185 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 1186 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 1187 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 1188 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 1189 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1190 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 1191 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 1192 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 1193 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1194 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 1195 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 1196 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.25 |
| Metatranscriptomes | 0.23 |
| Isolates | 29.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 12.82 |
| Nodule | 17.15 |
| Rhizoplane | 3.64 |
| Rhizosphere | 52.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000834 | 3300001915 | Bacteria | 9275 |
| 2 | JGI24740J21852_10002020 | 3300001979 | Bacteria | 9279 |
| 3 | JGI24740J21852_10002025 | 3300001979 | Bacteria | 9271 |
| 4 | JGI24740J21852_10005408 | 3300001979 | Bacteria | 5406 |
| 5 | JGI24739J22299_10002379 | 3300001989 | Bacteria | 7254 |
| 6 | JGI24735J21928_10001288 | 3300002067 | Bacteria | 8898 |
| 7 | JGI25155J39150_1000064 | 3300002704 | Bacteria | 69949 |
| 8 | JGI25156J39149_1000085 | 3300002705 | Bacteria | 69953 |
| 9 | JGI25156J39149_1000327 | 3300002705 | Bacteria | 31279 |
| 10 | JGI25154J39366_1000112 | 3300002738 | Bacteria | 69961 |
| 11 | JGI25158J39367_1002906 | 3300002739 | Bacteria | 2708 |
| 12 | JGI25157J39369_1000109 | 3300002741 | Bacteria | 69961 |
| 13 | JGI25152J39213_1001187 | 3300002773 | Bacteria | 11980 |
| 14 | JGI25152J39213_1003929 | 3300002773 | Bacteria | 4871 |
| 15 | JGI25150J39212_1002997 | 3300002774 | Bacteria | 4062 |
| 16 | JGI25159J45721_1000075 | 3300002987 | Bacteria | 47795 |
| 17 | JGI25159J45721_1000246 | 3300002987 | Bacteria | 25617 |
| 18 | JGI25159J45721_1000672 | 3300002987 | Bacteria | 15094 |
| 19 | JGI25159J45721_1008005 | 3300002987 | Bacteria | 2957 |
| 20 | JGI25151J46595_10001019 | 3300003187 | Bacteria | 21035 |
| 21 | JGI25151J46595_10004632 | 3300003187 | Bacteria | 7236 |
| 22 | JGI25151J46595_10008365 | 3300003187 | Bacteria | 4982 |
| 23 | JGI25406J46586_10000038 | 3300003203 | Bacteria | 59759 |
| 24 | JGI25406J46586_10013251 | 3300003203 | Bacteria | 3550 |
| 25 | JGI25406J46586_10013287 | 3300003203 | Bacteria | 3542 |
| 26 | JGI25153J46596_10004138 | 3300003215 | Bacteria | 7886 |
| 27 | JGI25153J46596_10006260 | 3300003215 | Bacteria | 6084 |
| 28 | JGI25153J46596_10016966 | 3300003215 | Bacteria | 2889 |
| 29 | JGI25160J50197_1000073 | 3300003354 | Bacteria | 104247 |
| 30 | JGI25160J50197_1000451 | 3300003354 | Bacteria | 25633 |
| 31 | JGI25160J50197_1008868 | 3300003354 | Bacteria | 3784 |
| 32 | JGI25160J50197_1013618 | 3300003354 | Bacteria | 2762 |
| 33 | JGI25161J50226_1000077 | 3300003374 | Bacteria | 83588 |
| 34 | JGI25161J50226_1003303 | 3300003374 | Bacteria | 3738 |
| 35 | JGI25161J50226_1005007 | 3300003374 | Bacteria | 2663 |
| 36 | JGI25161J50226_1005903 | 3300003374 | Bacteria | 2292 |
| 37 | Ga0006562J51391_1081476 | 3300003578 | Bacteria | 4210 |
| 38 | Ga0006562J51391_1087736 | 3300003578 | Bacteria | 4450 |
| 39 | Ga0055539_1000645 | 3300003752 | Bacteria | 9292 |
| 40 | Ga0055532_1000006 | 3300003758 | Bacteria | 451244 |
| 41 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 42 | Ga0055525_1000837 | 3300003759 | Bacteria | 9292 |
| 43 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 44 | Ga0055535_1000308 | 3300003761 | Bacteria | 49802 |
| 45 | Ga0055542_1000036 | 3300003762 | Bacteria | 227346 |
| 46 | Ga0055529_1000273 | 3300003763 | Bacteria | 61443 |
| 47 | Ga0055529_1000539 | 3300003763 | Bacteria | 32431 |
| 48 | Ga0055526_1001057 | 3300003771 | Bacteria | 20116 |
| 49 | Ga0055526_1001658 | 3300003771 | Bacteria | 15627 |
| 50 | Ga0055526_1010931 | 3300003771 | Bacteria | 4157 |
| 51 | Ga0055526_1016079 | 3300003771 | Bacteria | 2956 |
| 52 | Ga0055526_1026338 | 3300003771 | Bacteria | 1837 |
| 53 | Ga0055537_1000286 | 3300003773 | Bacteria | 36111 |
| 54 | Ga0055537_1000621 | 3300003773 | Bacteria | 19397 |
| 55 | Ga0055537_1003681 | 3300003773 | Bacteria | 4642 |
| 56 | Ga0055524_1000294 | 3300003775 | Bacteria | 48038 |
| 57 | Ga0055524_1000344 | 3300003775 | Bacteria | 42440 |
| 58 | Ga0055524_1001108 | 3300003775 | Bacteria | 16289 |
| 59 | Ga0055524_1003409 | 3300003775 | Bacteria | 7722 |
| 60 | Ga0055524_1004948 | 3300003775 | Bacteria | 6041 |
| 61 | Ga0055524_1013468 | 3300003775 | Bacteria | 3082 |
| 62 | Ga0055536_1000700 | 3300003781 | Bacteria | 22454 |
| 63 | Ga0055534_1000413 | 3300003784 | Bacteria | 26032 |
| 64 | Ga0055534_1005181 | 3300003784 | Bacteria | 3567 |
| 65 | Ga0055530_10000853 | 3300003791 | Bacteria | 25164 |
| 66 | Ga0055530_10000981 | 3300003791 | Bacteria | 22980 |
| 67 | Ga0055530_10009711 | 3300003791 | Bacteria | 3657 |
| 68 | Ga0055540_1000028 | 3300003792 | Bacteria | 184864 |
| 69 | Ga0055540_1000139 | 3300003792 | Bacteria | 72664 |
| 70 | Ga0055540_1013518 | 3300003792 | Bacteria | 2489 |
| 71 | Ga0055531_10000393 | 3300003794 | Bacteria | 42247 |
| 72 | Ga0055531_10000440 | 3300003794 | Bacteria | 39086 |
| 73 | Ga0055531_10000717 | 3300003794 | Bacteria | 28240 |
| 74 | Ga0055531_10005930 | 3300003794 | Bacteria | 7027 |
| 75 | Ga0055531_10007154 | 3300003794 | Bacteria | 6153 |
| 76 | Ga0055531_10008527 | 3300003794 | Bacteria | 5383 |
| 77 | Ga0055531_10019798 | 3300003794 | Bacteria | 2701 |
| 78 | Ga0055543_1000629 | 3300004625 | Bacteria | 18923 |
| 79 | Ga0055543_1001603 | 3300004625 | Bacteria | 8685 |
| 80 | Ga0065165_1000081 | 3300005262 | Bacteria | 158849 |
| 81 | Ga0065165_1000198 | 3300005262 | Bacteria | 104285 |
| 82 | Ga0065165_1000289 | 3300005262 | Bacteria | 85848 |
| 83 | Ga0065165_1001190 | 3300005262 | Bacteria | 30067 |
| 84 | Ga0065165_1001706 | 3300005262 | Bacteria | 22057 |
| 85 | Ga0065165_1002138 | 3300005262 | Bacteria | 17933 |
| 86 | Ga0065165_1008159 | 3300005262 | Bacteria | 4977 |
| 87 | Ga0065714_10009699 | 3300005288 | Bacteria | 4362 |
| 88 | Ga0065715_10144125 | 3300005293 | Bacteria | 1812 |
| 89 | Ga0070658_10001297 | 3300005327 | Bacteria | 21337 |
| 90 | Ga0070658_10019632 | 3300005327 | Bacteria | 5411 |
| 91 | Ga0070658_10081232 | 3300005327 | Bacteria | 2662 |
| 92 | Ga0070683_100002520 | 3300005329 | Bacteria | 14596 |
| 93 | Ga0070683_100010112 | 3300005329 | Bacteria | 8094 |
| 94 | Ga0070690_100005241 | 3300005330 | Bacteria | 7265 |
| 95 | Ga0070670_100004996 | 3300005331 | Bacteria | 11158 |
| 96 | Ga0068869_100035862 | 3300005334 | Bacteria | 3518 |
| 97 | Ga0070666_10000934 | 3300005335 | Bacteria | 17757 |
| 98 | Ga0070666_10019991 | 3300005335 | Bacteria | 4327 |
| 99 | Ga0070682_100010975 | 3300005337 | Bacteria | 5163 |
| 100 | Ga0068868_100000761 | 3300005338 | Bacteria | 21829 |
| 101 | Ga0068868_100001788 | 3300005338 | Bacteria | 14746 |
| 102 | Ga0068868_100056123 | 3300005338 | Bacteria | 3109 |
| 103 | Ga0068868_100154722 | 3300005338 | Bacteria | 1890 |
| 104 | Ga0070660_100000277 | 3300005339 | Bacteria | 34197 |
| 105 | Ga0070660_100003674 | 3300005339 | Bacteria | 10596 |
| 106 | Ga0070660_100051219 | 3300005339 | Bacteria | 3179 |
| 107 | Ga0070660_100092472 | 3300005339 | Bacteria | 2388 |
| 108 | Ga0070660_100142088 | 3300005339 | Bacteria | 1926 |
| 109 | Ga0070687_100001183 | 3300005343 | Bacteria | 9042 |
| 110 | Ga0070661_100004670 | 3300005344 | Bacteria | 9433 |
| 111 | Ga0070661_100009592 | 3300005344 | Bacteria | 6705 |
| 112 | Ga0070661_100031498 | 3300005344 | Bacteria | 3837 |
| 113 | Ga0070668_100046300 | 3300005347 | Bacteria | 3339 |
| 114 | Ga0070669_100036550 | 3300005353 | Bacteria | 3559 |
| 115 | Ga0070675_100000783 | 3300005354 | Bacteria | 22262 |
| 116 | Ga0070671_100011241 | 3300005355 | Bacteria | 7191 |
| 117 | Ga0070671_100064802 | 3300005355 | Bacteria | 3043 |
| 118 | Ga0070671_100106772 | 3300005355 | Bacteria | 2351 |
| 119 | Ga0070674_100036475 | 3300005356 | Bacteria | 3301 |
| 120 | Ga0070674_100127978 | 3300005356 | Bacteria | 1889 |
| 121 | Ga0070673_100009622 | 3300005364 | Bacteria | 6499 |
| 122 | Ga0070688_100050598 | 3300005365 | Bacteria | 2589 |
| 123 | Ga0070659_100000616 | 3300005366 | Bacteria | 26101 |
| 124 | Ga0070659_100000738 | 3300005366 | Bacteria | 23779 |
| 125 | Ga0070659_100049370 | 3300005366 | Bacteria | 3308 |
| 126 | Ga0070667_100002525 | 3300005367 | Bacteria | 15955 |
| 127 | Ga0070667_100055714 | 3300005367 | Bacteria | 3338 |
| 128 | Ga0070709_10023418 | 3300005434 | Bacteria | 3626 |
| 129 | Ga0070714_100002055 | 3300005435 | Bacteria | 14750 |
| 130 | Ga0070714_100024992 | 3300005435 | Bacteria | 4925 |
| 131 | Ga0070714_100027807 | 3300005435 | Bacteria | 4685 |
| 132 | Ga0070714_100034976 | 3300005435 | Bacteria | 4208 |
| 133 | Ga0070714_100038399 | 3300005435 | Bacteria | 4025 |
| 134 | Ga0070714_100049920 | 3300005435 | Bacteria | 3562 |
| 135 | Ga0070714_100082076 | 3300005435 | Bacteria | 2808 |
| 136 | Ga0070713_100000093 | 3300005436 | Bacteria | 57164 |
| 137 | Ga0070713_100003848 | 3300005436 | Bacteria | 9939 |
| 138 | Ga0070713_100073880 | 3300005436 | Bacteria | 2887 |
| 139 | Ga0070710_10028988 | 3300005437 | Bacteria | 2966 |
| 140 | Ga0070701_10013032 | 3300005438 | Bacteria | 3772 |
| 141 | Ga0070711_100070951 | 3300005439 | Bacteria | 2454 |
| 142 | Ga0070705_100055992 | 3300005440 | Bacteria | 2320 |
| 143 | Ga0070700_100009093 | 3300005441 | Bacteria | 5444 |
| 144 | Ga0070700_100010228 | 3300005441 | Bacteria | 5175 |
| 145 | Ga0070694_100097834 | 3300005444 | Bacteria | 2071 |
| 146 | Ga0070708_100035997 | 3300005445 | Bacteria | 4316 |
| 147 | Ga0070708_100046848 | 3300005445 | Bacteria | 3817 |
| 148 | Ga0070663_100000239 | 3300005455 | Bacteria | 27754 |
| 149 | Ga0070663_100003172 | 3300005455 | Bacteria | 9436 |
| 150 | Ga0070663_100005073 | 3300005455 | Bacteria | 7783 |
| 151 | Ga0070663_100006029 | 3300005455 | Bacteria | 7256 |
| 152 | Ga0070663_100013477 | 3300005455 | Bacteria | 5216 |
| 153 | Ga0070678_100004435 | 3300005456 | Bacteria | 7966 |
| 154 | Ga0070678_100022120 | 3300005456 | Bacteria | 4205 |
| 155 | Ga0070662_100001899 | 3300005457 | Bacteria | 12825 |
| 156 | Ga0070681_10010220 | 3300005458 | Bacteria | 9258 |
| 157 | Ga0070681_10012720 | 3300005458 | Bacteria | 8354 |
| 158 | Ga0070681_10042524 | 3300005458 | Bacteria | 4553 |
| 159 | Ga0070681_10075162 | 3300005458 | Bacteria | 3338 |
| 160 | Ga0070681_10150280 | 3300005458 | Bacteria | 2256 |
| 161 | Ga0070681_10171566 | 3300005458 | Bacteria | 2091 |
| 162 | Ga0068867_100004111 | 3300005459 | Bacteria | 10218 |
| 163 | Ga0068867_100005090 | 3300005459 | Bacteria | 9290 |
| 164 | Ga0070706_100000369 | 3300005467 | Bacteria | 54197 |
| 165 | Ga0070706_100004243 | 3300005467 | Bacteria | 13910 |
| 166 | Ga0070706_100004591 | 3300005467 | Bacteria | 13254 |
| 167 | Ga0070706_100024617 | 3300005467 | Bacteria | 5542 |
| 168 | Ga0070706_100041253 | 3300005467 | Bacteria | 4261 |
| 169 | Ga0070707_100001417 | 3300005468 | Bacteria | 23529 |
| 170 | Ga0070707_100005118 | 3300005468 | Bacteria | 12293 |
| 171 | Ga0070707_100106642 | 3300005468 | Bacteria | 2717 |
| 172 | Ga0070698_100002589 | 3300005471 | Bacteria | 19918 |
| 173 | Ga0070698_100013970 | 3300005471 | Bacteria | 8492 |
| 174 | Ga0070698_100017687 | 3300005471 | Bacteria | 7508 |
| 175 | Ga0070698_100033831 | 3300005471 | Bacteria | 5295 |
| 176 | Ga0070698_100038577 | 3300005471 | Bacteria | 4921 |
| 177 | Ga0070698_100041887 | 3300005471 | Bacteria | 4700 |
| 178 | Ga0070698_100048036 | 3300005471 | Bacteria | 4361 |
| 179 | Ga0070698_100053249 | 3300005471 | Bacteria | 4113 |
| 180 | Ga0070698_100053959 | 3300005471 | Bacteria | 4083 |
| 181 | Ga0070699_100000775 | 3300005518 | Bacteria | 29508 |
| 182 | Ga0070699_100022285 | 3300005518 | Bacteria | 5458 |
| 183 | Ga0070699_100039502 | 3300005518 | Bacteria | 4085 |
| 184 | Ga0070699_100061063 | 3300005518 | Bacteria | 3267 |
| 185 | Ga0070699_100091366 | 3300005518 | Bacteria | 2661 |
| 186 | Ga0070679_100010473 | 3300005530 | Bacteria | 8796 |
| 187 | Ga0070679_100020760 | 3300005530 | Bacteria | 6407 |
| 188 | Ga0070679_100038055 | 3300005530 | Bacteria | 4781 |
| 189 | Ga0070679_100055349 | 3300005530 | Bacteria | 3950 |
| 190 | Ga0070684_100003247 | 3300005535 | Bacteria | 12170 |
| 191 | Ga0070684_100026787 | 3300005535 | Bacteria | 4859 |
| 192 | Ga0070684_100106450 | 3300005535 | Bacteria | 2511 |
| 193 | Ga0070697_100006226 | 3300005536 | Bacteria | 9240 |
| 194 | Ga0070697_100051710 | 3300005536 | Bacteria | 3339 |
| 195 | Ga0068853_100004240 | 3300005539 | Bacteria | 11071 |
| 196 | Ga0068853_100095410 | 3300005539 | Bacteria | 2623 |
| 197 | Ga0070672_100014412 | 3300005543 | Bacteria | 5602 |
| 198 | Ga0070672_100018023 | 3300005543 | Bacteria | 5096 |
| 199 | Ga0070672_100100681 | 3300005543 | Bacteria | 2344 |
| 200 | Ga0070686_100004762 | 3300005544 | Bacteria | 7486 |
| 201 | Ga0070686_100044593 | 3300005544 | Bacteria | 2789 |
| 202 | Ga0070686_100061849 | 3300005544 | Bacteria | 2420 |
| 203 | Ga0070686_100126171 | 3300005544 | Bacteria | 1764 |
| 204 | Ga0070695_100010900 | 3300005545 | Bacteria | 5431 |
| 205 | Ga0070695_100015945 | 3300005545 | Bacteria | 4542 |
| 206 | Ga0070696_100012095 | 3300005546 | Bacteria | 5783 |
| 207 | Ga0070696_100067165 | 3300005546 | Bacteria | 2516 |
| 208 | Ga0070665_100004574 | 3300005548 | Bacteria | 14484 |
| 209 | Ga0070665_100008438 | 3300005548 | Bacteria | 10422 |
| 210 | Ga0070665_100021746 | 3300005548 | Bacteria | 6449 |
| 211 | Ga0070665_100038984 | 3300005548 | Bacteria | 4777 |
| 212 | Ga0070665_100133251 | 3300005548 | Bacteria | 2487 |
| 213 | Ga0068855_100000104 | 3300005563 | Bacteria | 104587 |
| 214 | Ga0068855_100001097 | 3300005563 | Bacteria | 33624 |
| 215 | Ga0068855_100022771 | 3300005563 | Bacteria | 7508 |
| 216 | Ga0068855_100023215 | 3300005563 | Bacteria | 7431 |
| 217 | Ga0068855_100037776 | 3300005563 | Bacteria | 5740 |
| 218 | Ga0068855_100070225 | 3300005563 | Bacteria | 4075 |
| 219 | Ga0070664_100000712 | 3300005564 | Bacteria | 25469 |
| 220 | Ga0070664_100003001 | 3300005564 | Bacteria | 13649 |
| 221 | Ga0070664_100006480 | 3300005564 | Bacteria | 9436 |
| 222 | Ga0070664_100010765 | 3300005564 | Bacteria | 7416 |
| 223 | Ga0070664_100020858 | 3300005564 | Bacteria | 5398 |
| 224 | Ga0070664_100028614 | 3300005564 | Bacteria | 4638 |
| 225 | Ga0068857_100145432 | 3300005577 | Bacteria | 2145 |
| 226 | Ga0068854_100005268 | 3300005578 | Bacteria | 8161 |
| 227 | Ga0068854_100016111 | 3300005578 | Bacteria | 4972 |
| 228 | Ga0068856_100003602 | 3300005614 | Bacteria | 15590 |
| 229 | Ga0068856_100004835 | 3300005614 | Bacteria | 13357 |
| 230 | Ga0068856_100005726 | 3300005614 | Bacteria | 12242 |
| 231 | Ga0068856_100009539 | 3300005614 | Bacteria | 9431 |
| 232 | Ga0068856_100024791 | 3300005614 | Bacteria | 5842 |
| 233 | Ga0068856_100048274 | 3300005614 | Bacteria | 4194 |
| 234 | Ga0070702_100000150 | 3300005615 | Bacteria | 21785 |
| 235 | Ga0068852_100022892 | 3300005616 | Bacteria | 5019 |
| 236 | Ga0068852_100026749 | 3300005616 | Bacteria | 4695 |
| 237 | Ga0068859_100011261 | 3300005617 | Bacteria | 9000 |
| 238 | Ga0068859_100139880 | 3300005617 | Bacteria | 2494 |
| 239 | Ga0068864_100000022 | 3300005618 | Bacteria | 261941 |
| 240 | Ga0068864_100017222 | 3300005618 | Bacteria | 6026 |
| 241 | Ga0068864_100025538 | 3300005618 | Bacteria | 4977 |
| 242 | Ga0068864_100052232 | 3300005618 | Bacteria | 3522 |
| 243 | Ga0068866_10006202 | 3300005718 | Bacteria | 4976 |
| 244 | Ga0068866_10006888 | 3300005718 | Bacteria | 4747 |
| 245 | Ga0068861_100118575 | 3300005719 | Bacteria | 2132 |
| 246 | Ga0068851_10026514 | 3300005834 | Bacteria | 2848 |
| 247 | Ga0068863_100002456 | 3300005841 | Bacteria | 18419 |
| 248 | Ga0068863_100051325 | 3300005841 | Bacteria | 3909 |
| 249 | Ga0068858_100045219 | 3300005842 | Bacteria | 4079 |
| 250 | Ga0068858_100109774 | 3300005842 | Bacteria | 2575 |
| 251 | Ga0068860_100000253 | 3300005843 | Bacteria | 79802 |
| 252 | Ga0068860_100000738 | 3300005843 | Bacteria | 37292 |
| 253 | Ga0068860_100017416 | 3300005843 | Bacteria | 7000 |
| 254 | Ga0068860_100031234 | 3300005843 | Bacteria | 5121 |
| 255 | Ga0068860_100041225 | 3300005843 | Bacteria | 4410 |
| 256 | Ga0068860_100049570 | 3300005843 | Bacteria | 3999 |
| 257 | Ga0068860_100077969 | 3300005843 | Bacteria | 3151 |
| 258 | Ga0068860_100226450 | 3300005843 | Bacteria | 1816 |
| 259 | Ga0068862_100000492 | 3300005844 | Bacteria | 42127 |
| 260 | Ga0068862_100026901 | 3300005844 | Bacteria | 4838 |
| 261 | Ga0068862_100140068 | 3300005844 | Bacteria | 2146 |
| 262 | Ga0081455_10000525 | 3300005937 | Bacteria | 49722 |
| 263 | Ga0081455_10001075 | 3300005937 | Bacteria | 34374 |
| 264 | Ga0081455_10001410 | 3300005937 | Bacteria | 29737 |
| 265 | Ga0081538_10001281 | 3300005981 | Bacteria | 26128 |
| 266 | Ga0081538_10001832 | 3300005981 | Bacteria | 21423 |
| 267 | Ga0081538_10003883 | 3300005981 | Bacteria | 13958 |
| 268 | Ga0081538_10015080 | 3300005981 | Bacteria | 6005 |
| 269 | Ga0081540_1006873 | 3300005983 | Bacteria | 8210 |
| 270 | Ga0081540_1012947 | 3300005983 | Bacteria | 5450 |
| 271 | Ga0081540_1029910 | 3300005983 | Bacteria | 3026 |
| 272 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 273 | Ga0081539_10000720 | 3300005985 | Bacteria | 66266 |
| 274 | Ga0081539_10000917 | 3300005985 | Bacteria | 55614 |
| 275 | Ga0081539_10001055 | 3300005985 | Bacteria | 50436 |
| 276 | Ga0081539_10002418 | 3300005985 | Bacteria | 26381 |
| 277 | Ga0081539_10002997 | 3300005985 | Bacteria | 22067 |
| 278 | Ga0081539_10004249 | 3300005985 | Bacteria | 16077 |
| 279 | Ga0081539_10011542 | 3300005985 | Bacteria | 6967 |
| 280 | Ga0081539_10014676 | 3300005985 | Bacteria | 5766 |
| 281 | Ga0070717_10002063 | 3300006028 | Bacteria | 14061 |
| 282 | Ga0070717_10013078 | 3300006028 | Bacteria | 6342 |
| 283 | Ga0070717_10034110 | 3300006028 | Bacteria | 4111 |
| 284 | Ga0075365_10004340 | 3300006038 | Bacteria | 7491 |
| 285 | Ga0075365_10005337 | 3300006038 | Bacteria | 6920 |
| 286 | Ga0075365_10116084 | 3300006038 | Bacteria | 1843 |
| 287 | Ga0075368_10010447 | 3300006042 | Bacteria | 3355 |
| 288 | Ga0075363_100006026 | 3300006048 | Bacteria | 5464 |
| 289 | Ga0075364_10000557 | 3300006051 | Bacteria | 19122 |
| 290 | Ga0075364_10039185 | 3300006051 | Bacteria | 3071 |
| 291 | Ga0075364_10075295 | 3300006051 | Bacteria | 2227 |
| 292 | Ga0070715_10004225 | 3300006163 | Bacteria | 4685 |
| 293 | Ga0070715_10007253 | 3300006163 | Bacteria | 3812 |
| 294 | Ga0070716_100021983 | 3300006173 | Bacteria | 3367 |
| 295 | Ga0070712_100049698 | 3300006175 | Bacteria | 2913 |
| 296 | Ga0075362_10005886 | 3300006177 | Bacteria | 4526 |
| 297 | Ga0075367_10002592 | 3300006178 | Bacteria | 8305 |
| 298 | Ga0075366_10044974 | 3300006195 | Bacteria | 2617 |
| 299 | Ga0097621_100015779 | 3300006237 | Bacteria | 5694 |
| 300 | Ga0075370_10004866 | 3300006353 | Bacteria | 6587 |
| 301 | Ga0075370_10010108 | 3300006353 | Bacteria | 4922 |
| 302 | Ga0075370_10068181 | 3300006353 | Bacteria | 2031 |
| 303 | Ga0075370_10070139 | 3300006353 | Bacteria | 2004 |
| 304 | Ga0068871_100007963 | 3300006358 | Bacteria | 7601 |
| 305 | Ga0068871_100011189 | 3300006358 | Bacteria | 6576 |
| 306 | Ga0068871_100013192 | 3300006358 | Bacteria | 6128 |
| 307 | Ga0075428_100002475 | 3300006844 | Bacteria | 20049 |
| 308 | Ga0075428_100003558 | 3300006844 | Bacteria | 17062 |
| 309 | Ga0075428_100015422 | 3300006844 | Bacteria | 8470 |
| 310 | Ga0075428_100029340 | 3300006844 | Bacteria | 6086 |
| 311 | Ga0075430_100008937 | 3300006846 | Bacteria | 8460 |
| 312 | Ga0075430_100045091 | 3300006846 | Bacteria | 3726 |
| 313 | Ga0075430_100067230 | 3300006846 | Bacteria | 3009 |
| 314 | Ga0075431_100017790 | 3300006847 | Bacteria | 7226 |
| 315 | Ga0075431_100163836 | 3300006847 | Bacteria | 2286 |
| 316 | Ga0075433_10003619 | 3300006852 | Bacteria | 11940 |
| 317 | Ga0075433_10025485 | 3300006852 | Bacteria | 5000 |
| 318 | Ga0075433_10065998 | 3300006852 | Bacteria | 3174 |
| 319 | Ga0075434_100000003 | 3300006871 | Bacteria | 134839 |
| 320 | Ga0075434_100002400 | 3300006871 | Bacteria | 16442 |
| 321 | Ga0075434_100096958 | 3300006871 | Bacteria | 2953 |
| 322 | Ga0075434_100104246 | 3300006871 | Bacteria | 2845 |
| 323 | Ga0075429_100030646 | 3300006880 | Bacteria | 4672 |
| 324 | Ga0075429_100040012 | 3300006880 | Bacteria | 4080 |
| 325 | Ga0075429_100045029 | 3300006880 | Bacteria | 3839 |
| 326 | Ga0068865_100007151 | 3300006881 | Bacteria | 6855 |
| 327 | Ga0068865_100014246 | 3300006881 | Bacteria | 5049 |
| 328 | Ga0068865_100018710 | 3300006881 | Bacteria | 4474 |
| 329 | Ga0075436_100004352 | 3300006914 | Bacteria | 9719 |
| 330 | Ga0075436_100012300 | 3300006914 | Bacteria | 5863 |
| 331 | Ga0075436_100058444 | 3300006914 | Bacteria | 2663 |
| 332 | Ga0097620_100011261 | 3300006931 | Bacteria | 9000 |
| 333 | Ga0097620_100139876 | 3300006931 | Bacteria | 2494 |
| 334 | Ga0099823_1000051 | 3300006944 | Bacteria | 57175 |
| 335 | Ga0079104_1000058 | 3300006946 | Bacteria | 165039 |
| 336 | Ga0079104_1010357 | 3300006946 | Bacteria | 3077 |
| 337 | Ga0079104_1014509 | 3300006946 | Bacteria | 2374 |
| 338 | Ga0075435_100000265 | 3300007076 | Bacteria | 32624 |
| 339 | Ga0075435_100006583 | 3300007076 | Bacteria | 8222 |
| 340 | Ga0075435_100012648 | 3300007076 | Bacteria | 6253 |
| 341 | Ga0075435_100014752 | 3300007076 | Bacteria | 5856 |
| 342 | Ga0075435_100021661 | 3300007076 | Bacteria | 4947 |
| 343 | Ga0099794_10000111 | 3300007265 | Bacteria | 29740 |
| 344 | Ga0099795_10000018 | 3300007788 | Bacteria | 61029 |
| 345 | Ga0105250_10000418 | 3300009092 | Bacteria | 31113 |
| 346 | Ga0105250_10002429 | 3300009092 | Bacteria | 9361 |
| 347 | Ga0105240_10001792 | 3300009093 | Bacteria | 36155 |
| 348 | Ga0105240_10002741 | 3300009093 | Bacteria | 27878 |
| 349 | Ga0105240_10116124 | 3300009093 | Bacteria | 3230 |
| 350 | Ga0105240_10183917 | 3300009093 | Bacteria | 2464 |
| 351 | Ga0105240_10199740 | 3300009093 | Bacteria | 2344 |
| 352 | Ga0105240_10202053 | 3300009093 | Bacteria | 2328 |
| 353 | Ga0111539_10000584 | 3300009094 | Bacteria | 47005 |
| 354 | Ga0111539_10040746 | 3300009094 | Bacteria | 5589 |
| 355 | Ga0111539_10051137 | 3300009094 | Bacteria | 4922 |
| 356 | Ga0105245_10007925 | 3300009098 | Bacteria | 9289 |
| 357 | Ga0105247_10049743 | 3300009101 | Bacteria | 2578 |
| 358 | Ga0114129_10005124 | 3300009147 | Bacteria | 18449 |
| 359 | Ga0114129_10142954 | 3300009147 | Bacteria | 3278 |
| 360 | Ga0114129_10175477 | 3300009147 | Bacteria | 2919 |
| 361 | Ga0105243_10002121 | 3300009148 | Bacteria | 16784 |
| 362 | Ga0105243_10006862 | 3300009148 | Bacteria | 8777 |
| 363 | Ga0105243_10087266 | 3300009148 | Bacteria | 2560 |
| 364 | Ga0105241_10006534 | 3300009174 | Bacteria | 8593 |
| 365 | Ga0105241_10018460 | 3300009174 | Bacteria | 5130 |
| 366 | Ga0105242_10000242 | 3300009176 | Bacteria | 43023 |
| 367 | Ga0105242_10007348 | 3300009176 | Bacteria | 8482 |
| 368 | Ga0105242_10011026 | 3300009176 | Bacteria | 6943 |
| 369 | Ga0105248_10003122 | 3300009177 | Bacteria | 18333 |
| 370 | Ga0105248_10003925 | 3300009177 | Bacteria | 16439 |
| 371 | Ga0105248_10235281 | 3300009177 | Bacteria | 2062 |
| 372 | Ga0105237_10010949 | 3300009545 | Bacteria | 9624 |
| 373 | Ga0105237_10019662 | 3300009545 | Bacteria | 6973 |
| 374 | Ga0105237_10033777 | 3300009545 | Bacteria | 5182 |
| 375 | Ga0105237_10102216 | 3300009545 | Bacteria | 2858 |
| 376 | Ga0105238_10015030 | 3300009551 | Bacteria | 7838 |
| 377 | Ga0105238_10049660 | 3300009551 | Bacteria | 4224 |
| 378 | Ga0105249_10006840 | 3300009553 | Bacteria | 9943 |
| 379 | Ga0105249_10113727 | 3300009553 | Bacteria | 2562 |
| 380 | Ga0123342_1008310 | 3300009766 | Bacteria | 13149 |
| 381 | Ga0099796_10000048 | 3300010159 | Bacteria | 22808 |
| 382 | Ga0105239_10001197 | 3300010375 | Eukaryota | 35483 |
| 383 | Ga0105239_10009133 | 3300010375 | Bacteria | 11213 |
| 384 | Ga0105239_10021898 | 3300010375 | Bacteria | 7046 |
| 385 | Ga0105246_10045437 | 3300011119 | Bacteria | 2990 |
| 386 | Ga0157319_1000004 | 3300012497 | Bacteria | 394735 |
| 387 | Ga0157373_10005110 | 3300013100 | Bacteria | 9862 |
| 388 | Ga0157373_10007554 | 3300013100 | Bacteria | 8080 |
| 389 | Ga0157373_10036275 | 3300013100 | Bacteria | 3540 |
| 390 | Ga0157371_10000330 | 3300013102 | Bacteria | 61144 |
| 391 | Ga0157371_10006672 | 3300013102 | Bacteria | 9442 |
| 392 | Ga0157370_10000031 | 3300013104 | Bacteria | 139879 |
| 393 | Ga0157370_10005558 | 3300013104 | Bacteria | 14131 |
| 394 | Ga0157370_10017083 | 3300013104 | Bacteria | 7330 |
| 395 | Ga0157370_10118328 | 3300013104 | Bacteria | 2475 |
| 396 | Ga0157369_10000905 | 3300013105 | Bacteria | 37874 |
| 397 | Ga0157369_10001415 | 3300013105 | Bacteria | 29510 |
| 398 | Ga0157369_10003573 | 3300013105 | Bacteria | 18478 |
| 399 | Ga0157369_10047479 | 3300013105 | Bacteria | 4661 |
| 400 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 401 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 402 | Ga0157374_10000012 | 3300013296 | Bacteria | 462353 |
| 403 | Ga0157374_10000141 | 3300013296 | Bacteria | 65347 |
| 404 | Ga0157374_10072501 | 3300013296 | Bacteria | 3249 |
| 405 | Ga0157378_10002977 | 3300013297 | Bacteria | 15048 |
| 406 | Ga0157378_10138858 | 3300013297 | Bacteria | 2255 |
| 407 | Ga0163162_10241039 | 3300013306 | Bacteria | 1939 |
| 408 | Ga0157372_10003374 | 3300013307 | Bacteria | 17228 |
| 409 | Ga0157372_10013312 | 3300013307 | Bacteria | 8780 |
| 410 | Ga0157372_10018145 | 3300013307 | Bacteria | 7565 |
| 411 | Ga0157375_10000007 | 3300013308 | Bacteria | 377743 |
| 412 | Ga0157375_10110400 | 3300013308 | Bacteria | 2848 |
| 413 | Ga0163163_10009795 | 3300014325 | Bacteria | 8585 |
| 414 | Ga0163163_10034114 | 3300014325 | Bacteria | 4926 |
| 415 | Ga0157380_10042129 | 3300014326 | Bacteria | 3567 |
| 416 | Ga0157377_10000002 | 3300014745 | Bacteria | 473827 |
| 417 | Ga0157377_10000069 | 3300014745 | Bacteria | 80723 |
| 418 | Ga0157377_10009663 | 3300014745 | Bacteria | 4744 |
| 419 | Ga0157379_10005458 | 3300014968 | Bacteria | 10925 |
| 420 | Ga0157379_10137126 | 3300014968 | Bacteria | 2205 |
| 421 | Ga0157376_10000020 | 3300014969 | Bacteria | 246318 |
| 422 | Ga0183362_10012 | 3300015683 | Bacteria | 49008 |
| 423 | Ga0183362_10018 | 3300015683 | Bacteria | 25088 |
| 424 | Ga0183363_1304 | 3300015690 | Bacteria | 6855 |
| 425 | Ga0163161_10001893 | 3300017792 | Bacteria | 15281 |
| 426 | Ga0163161_10033338 | 3300017792 | Bacteria | 3680 |
| 427 | Ga0197907_11229304 | 3300020069 | Eukaryota | 1950 |
| 428 | Ga0206351_10150708 | 3300020077 | Eukaryota | 1968 |
| 429 | Ga0214544_1000646 | 3300021320 | Bacteria | 66087 |
| 430 | Ga0214542_1000027 | 3300021321 | Bacteria | 175107 |
| 431 | Ga0214543_1000025 | 3300021327 | Bacteria | 225351 |
| 432 | Ga0214543_1000047 | 3300021327 | Bacteria | 150894 |
| 433 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 434 | Ga0213872_10000031 | 3300021361 | Bacteria | 139321 |
| 435 | Ga0213872_10000037 | 3300021361 | Bacteria | 125032 |
| 436 | Ga0213872_10000107 | 3300021361 | Bacteria | 77234 |
| 437 | Ga0213872_10000836 | 3300021361 | Bacteria | 22348 |
| 438 | Ga0213872_10026117 | 3300021361 | Bacteria | 2683 |
| 439 | Ga0213874_10002184 | 3300021377 | Bacteria | 4152 |
| 440 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 441 | Ga0213876_10000063 | 3300021384 | Bacteria | 128550 |
| 442 | Ga0213876_10036700 | 3300021384 | Bacteria | 2585 |
| 443 | Ga0213875_10000001 | 3300021388 | Bacteria | 2793540 |
| 444 | Ga0213875_10014263 | 3300021388 | Bacteria | 3880 |
| 445 | Ga0224712_10025821 | 3300022467 | Eukaryota | 2069 |
| 446 | Ga0228711_1021534 | 3300022739 | Bacteria | 5279 |
| 447 | Ga0228710_1006811 | 3300022740 | Bacteria | 17155 |
| 448 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 449 | Ga0209436_100108 | 3300025208 | Bacteria | 41289 |
| 450 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 451 | Ga0209784_100597 | 3300025224 | Bacteria | 11909 |
| 452 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 453 | Ga0209566_100700 | 3300025225 | Bacteria | 19345 |
| 454 | Ga0209566_101395 | 3300025225 | Bacteria | 7398 |
| 455 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 456 | Ga0209674_101858 | 3300025226 | Bacteria | 5000 |
| 457 | Ga0209674_102689 | 3300025226 | Bacteria | 3660 |
| 458 | Ga0209672_100020 | 3300025228 | Bacteria | 429003 |
| 459 | Ga0209672_100145 | 3300025228 | Bacteria | 66093 |
| 460 | Ga0209672_100390 | 3300025228 | Bacteria | 26529 |
| 461 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 462 | Ga0209147_100024 | 3300025229 | Bacteria | 429003 |
| 463 | Ga0209147_100201 | 3300025229 | Bacteria | 65943 |
| 464 | Ga0209147_100256 | 3300025229 | Bacteria | 49622 |
| 465 | Ga0209147_101035 | 3300025229 | Bacteria | 11855 |
| 466 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 467 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 468 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 469 | Ga0209258_100084 | 3300025242 | Bacteria | 244783 |
| 470 | Ga0209258_100091 | 3300025242 | Bacteria | 227454 |
| 471 | Ga0209258_100350 | 3300025242 | Bacteria | 66093 |
| 472 | Ga0207425_1000036 | 3300025245 | Bacteria | 225783 |
| 473 | Ga0207425_1000238 | 3300025245 | Bacteria | 42734 |
| 474 | Ga0207425_1003268 | 3300025245 | Bacteria | 5280 |
| 475 | Ga0207425_1005562 | 3300025245 | Bacteria | 3573 |
| 476 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 477 | Ga0209026_1000121 | 3300025250 | Bacteria | 126801 |
| 478 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 479 | Ga0209677_103362 | 3300025253 | Bacteria | 5247 |
| 480 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 481 | Ga0209148_1000327 | 3300025254 | Bacteria | 65997 |
| 482 | Ga0209148_1001409 | 3300025254 | Bacteria | 12349 |
| 483 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 484 | Ga0209759_1000052 | 3300025256 | Bacteria | 213964 |
| 485 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 486 | Ga0209129_1001728 | 3300025258 | Bacteria | 11774 |
| 487 | Ga0209129_1002948 | 3300025258 | Bacteria | 7777 |
| 488 | Ga0209233_1001798 | 3300025261 | Bacteria | 8262 |
| 489 | Ga0209565_1000016 | 3300025263 | Bacteria | 477707 |
| 490 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 491 | Ga0209565_1000141 | 3300025263 | Bacteria | 99867 |
| 492 | Ga0209565_1002645 | 3300025263 | Bacteria | 6305 |
| 493 | Ga0209565_1002766 | 3300025263 | Bacteria | 6080 |
| 494 | Ga0209565_1003483 | 3300025263 | Bacteria | 5067 |
| 495 | Ga0209565_1004056 | 3300025263 | Bacteria | 4565 |
| 496 | Ga0209565_1004057 | 3300025263 | Bacteria | 4565 |
| 497 | Ga0209565_1012570 | 3300025263 | Bacteria | 2015 |
| 498 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 499 | Ga0209455_1000248 | 3300025272 | Bacteria | 65943 |
| 500 | Ga0209673_1000057 | 3300025273 | Bacteria | 270150 |
| 501 | Ga0209673_1000072 | 3300025273 | Bacteria | 236935 |
| 502 | Ga0209673_1000073 | 3300025273 | Bacteria | 233645 |
| 503 | Ga0209673_1003353 | 3300025273 | Bacteria | 9563 |
| 504 | Ga0209673_1003969 | 3300025273 | Bacteria | 8254 |
| 505 | Ga0209673_1005102 | 3300025273 | Bacteria | 6739 |
| 506 | Ga0209673_1005325 | 3300025273 | Bacteria | 6514 |
| 507 | Ga0209673_1016859 | 3300025273 | Bacteria | 2715 |
| 508 | Ga0209130_1000040 | 3300025284 | Bacteria | 262926 |
| 509 | Ga0209130_1000153 | 3300025284 | Bacteria | 104299 |
| 510 | Ga0209130_1000354 | 3300025284 | Bacteria | 52516 |
| 511 | Ga0209130_1001487 | 3300025284 | Bacteria | 15232 |
| 512 | Ga0209130_1004819 | 3300025284 | Bacteria | 4944 |
| 513 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 514 | Ga0209675_1000122 | 3300025291 | Bacteria | 106769 |
| 515 | Ga0209675_1006650 | 3300025291 | Bacteria | 4595 |
| 516 | Ga0209675_1012694 | 3300025291 | Bacteria | 2693 |
| 517 | Ga0209676_1000088 | 3300025292 | Bacteria | 263010 |
| 518 | Ga0209676_1000395 | 3300025292 | Bacteria | 79555 |
| 519 | Ga0209676_1000420 | 3300025292 | Bacteria | 74714 |
| 520 | Ga0209676_1000666 | 3300025292 | Bacteria | 49043 |
| 521 | Ga0209676_1000931 | 3300025292 | Bacteria | 36157 |
| 522 | Ga0209676_1028900 | 3300025292 | Bacteria | 1719 |
| 523 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 524 | Ga0209025_1000333 | 3300025294 | Bacteria | 104266 |
| 525 | Ga0209025_1000694 | 3300025294 | Bacteria | 57446 |
| 526 | Ga0209025_1001471 | 3300025294 | Bacteria | 30670 |
| 527 | Ga0209025_1003349 | 3300025294 | Bacteria | 15378 |
| 528 | Ga0209025_1004234 | 3300025294 | Bacteria | 12629 |
| 529 | Ga0209025_1005849 | 3300025294 | Bacteria | 9838 |
| 530 | Ga0209025_1013423 | 3300025294 | Bacteria | 5151 |
| 531 | Ga0209025_1015598 | 3300025294 | Bacteria | 4562 |
| 532 | Ga0209025_1016423 | 3300025294 | Bacteria | 4369 |
| 533 | Ga0209025_1017124 | 3300025294 | Bacteria | 4211 |
| 534 | Ga0209025_1024509 | 3300025294 | Bacteria | 3108 |
| 535 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 536 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 537 | Ga0209564_1000280 | 3300025295 | Bacteria | 104429 |
| 538 | Ga0209564_1001246 | 3300025295 | Bacteria | 28344 |
| 539 | Ga0209564_1001716 | 3300025295 | Bacteria | 20589 |
| 540 | Ga0209564_1001744 | 3300025295 | Bacteria | 20355 |
| 541 | Ga0209564_1001751 | 3300025295 | Bacteria | 20266 |
| 542 | Ga0209564_1002020 | 3300025295 | Bacteria | 17645 |
| 543 | Ga0209564_1003797 | 3300025295 | Bacteria | 9803 |
| 544 | Ga0209564_1012428 | 3300025295 | Bacteria | 3713 |
| 545 | Ga0209564_1019034 | 3300025295 | Bacteria | 2585 |
| 546 | Ga0209564_1019348 | 3300025295 | Bacteria | 2549 |
| 547 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 548 | Ga0209758_1000126 | 3300025297 | Bacteria | 189761 |
| 549 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 550 | Ga0209758_1001159 | 3300025297 | Bacteria | 33705 |
| 551 | Ga0209758_1001994 | 3300025297 | Bacteria | 21994 |
| 552 | Ga0209758_1002553 | 3300025297 | Bacteria | 18345 |
| 553 | Ga0209758_1003114 | 3300025297 | Bacteria | 15668 |
| 554 | Ga0209758_1003909 | 3300025297 | Bacteria | 12999 |
| 555 | Ga0209758_1007220 | 3300025297 | Bacteria | 7646 |
| 556 | Ga0209758_1009132 | 3300025297 | Bacteria | 6242 |
| 557 | Ga0209758_1011179 | 3300025297 | Bacteria | 5238 |
| 558 | Ga0209050_1000084 | 3300025298 | Bacteria | 263245 |
| 559 | Ga0209050_1000110 | 3300025298 | Bacteria | 216664 |
| 560 | Ga0209050_1000282 | 3300025298 | Bacteria | 108629 |
| 561 | Ga0209050_1000447 | 3300025298 | Bacteria | 74743 |
| 562 | Ga0209050_1000502 | 3300025298 | Bacteria | 66494 |
| 563 | Ga0209050_1000852 | 3300025298 | Bacteria | 41567 |
| 564 | Ga0209050_1002252 | 3300025298 | Bacteria | 17173 |
| 565 | Ga0209050_1011864 | 3300025298 | Bacteria | 4072 |
| 566 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 567 | Ga0209256_1000064 | 3300025299 | Bacteria | 250853 |
| 568 | Ga0209256_1000065 | 3300025299 | Bacteria | 248104 |
| 569 | Ga0209256_1000223 | 3300025299 | Bacteria | 104801 |
| 570 | Ga0209256_1000313 | 3300025299 | Bacteria | 84424 |
| 571 | Ga0209256_1000811 | 3300025299 | Bacteria | 39987 |
| 572 | Ga0209256_1001123 | 3300025299 | Bacteria | 30560 |
| 573 | Ga0209256_1001124 | 3300025299 | Bacteria | 30526 |
| 574 | Ga0209256_1002149 | 3300025299 | Bacteria | 17030 |
| 575 | Ga0209256_1010626 | 3300025299 | Bacteria | 3823 |
| 576 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 577 | Ga0207426_1000124 | 3300025302 | Bacteria | 218145 |
| 578 | Ga0207426_1000280 | 3300025302 | Bacteria | 104299 |
| 579 | Ga0207426_1000359 | 3300025302 | Bacteria | 82359 |
| 580 | Ga0207426_1001223 | 3300025302 | Bacteria | 22633 |
| 581 | Ga0207426_1001336 | 3300025302 | Bacteria | 20936 |
| 582 | Ga0207426_1001977 | 3300025302 | Bacteria | 14553 |
| 583 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 584 | Ga0209051_1000058 | 3300025303 | Bacteria | 263137 |
| 585 | Ga0209051_1000069 | 3300025303 | Bacteria | 219208 |
| 586 | Ga0209051_1000280 | 3300025303 | Bacteria | 83521 |
| 587 | Ga0209051_1000285 | 3300025303 | Bacteria | 82429 |
| 588 | Ga0209051_1000986 | 3300025303 | Bacteria | 27534 |
| 589 | Ga0209051_1001259 | 3300025303 | Bacteria | 22635 |
| 590 | Ga0209051_1002965 | 3300025303 | Bacteria | 11559 |
| 591 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 592 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 593 | Ga0209257_1000087 | 3300025304 | Bacteria | 282503 |
| 594 | Ga0209257_1000092 | 3300025304 | Bacteria | 263137 |
| 595 | Ga0209257_1000093 | 3300025304 | Bacteria | 263088 |
| 596 | Ga0209257_1000165 | 3300025304 | Bacteria | 172773 |
| 597 | Ga0209257_1000417 | 3300025304 | Bacteria | 82249 |
| 598 | Ga0209257_1000527 | 3300025304 | Bacteria | 66423 |
| 599 | Ga0209257_1001027 | 3300025304 | Bacteria | 37515 |
| 600 | Ga0209257_1002180 | 3300025304 | Bacteria | 20273 |
| 601 | Ga0209257_1004584 | 3300025304 | Bacteria | 10552 |
| 602 | Ga0209257_1007169 | 3300025304 | Bacteria | 6849 |
| 603 | Ga0207696_1000147 | 3300025711 | Bacteria | 120603 |
| 604 | Ga0207696_1001154 | 3300025711 | Bacteria | 15193 |
| 605 | Ga0207655_1012876 | 3300025728 | Bacteria | 4845 |
| 606 | Ga0207680_10059878 | 3300025903 | Bacteria | 2315 |
| 607 | Ga0207647_10000264 | 3300025904 | Bacteria | 43118 |
| 608 | Ga0207685_10001447 | 3300025905 | Bacteria | 4977 |
| 609 | Ga0207699_10003289 | 3300025906 | Bacteria | 7703 |
| 610 | Ga0207645_10005837 | 3300025907 | Bacteria | 8876 |
| 611 | Ga0207645_10027593 | 3300025907 | Bacteria | 3665 |
| 612 | Ga0207643_10035227 | 3300025908 | Bacteria | 2805 |
| 613 | Ga0207643_10042854 | 3300025908 | Bacteria | 2552 |
| 614 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 615 | Ga0207705_10036568 | 3300025909 | Bacteria | 3513 |
| 616 | Ga0207705_10058069 | 3300025909 | Bacteria | 2791 |
| 617 | Ga0207684_10000077 | 3300025910 | Bacteria | 182957 |
| 618 | Ga0207684_10022988 | 3300025910 | Bacteria | 5325 |
| 619 | Ga0207684_10043948 | 3300025910 | Bacteria | 3788 |
| 620 | Ga0207654_10012461 | 3300025911 | Bacteria | 4357 |
| 621 | Ga0207707_10001948 | 3300025912 | Bacteria | 18787 |
| 622 | Ga0207707_10002051 | 3300025912 | Bacteria | 18286 |
| 623 | Ga0207707_10012301 | 3300025912 | Bacteria | 7438 |
| 624 | Ga0207707_10029214 | 3300025912 | Bacteria | 4819 |
| 625 | Ga0207707_10114941 | 3300025912 | Bacteria | 2352 |
| 626 | Ga0207695_10005557 | 3300025913 | Bacteria | 16655 |
| 627 | Ga0207695_10006723 | 3300025913 | Bacteria | 14842 |
| 628 | Ga0207695_10009029 | 3300025913 | Bacteria | 12394 |
| 629 | Ga0207695_10050782 | 3300025913 | Bacteria | 4360 |
| 630 | Ga0207695_10087061 | 3300025913 | Bacteria | 3148 |
| 631 | Ga0207695_10143712 | 3300025913 | Bacteria | 2332 |
| 632 | Ga0207671_10009367 | 3300025914 | Bacteria | 8189 |
| 633 | Ga0207693_10021947 | 3300025915 | Bacteria | 5075 |
| 634 | Ga0207693_10030540 | 3300025915 | Bacteria | 4256 |
| 635 | Ga0207693_10046133 | 3300025915 | Bacteria | 3423 |
| 636 | Ga0207693_10055438 | 3300025915 | Bacteria | 3110 |
| 637 | Ga0207663_10000963 | 3300025916 | Bacteria | 13168 |
| 638 | Ga0207663_10101314 | 3300025916 | Bacteria | 1935 |
| 639 | Ga0207662_10000110 | 3300025918 | Bacteria | 39525 |
| 640 | Ga0207662_10021496 | 3300025918 | Bacteria | 3688 |
| 641 | Ga0207657_10000003 | 3300025919 | Bacteria | 263148 |
| 642 | Ga0207657_10000169 | 3300025919 | Bacteria | 66914 |
| 643 | Ga0207657_10000745 | 3300025919 | Bacteria | 34547 |
| 644 | Ga0207657_10000927 | 3300025919 | Bacteria | 31004 |
| 645 | Ga0207657_10022126 | 3300025919 | Bacteria | 5965 |
| 646 | Ga0207657_10032334 | 3300025919 | Bacteria | 4729 |
| 647 | Ga0207657_10041878 | 3300025919 | Bacteria | 4045 |
| 648 | Ga0207649_10002908 | 3300025920 | Bacteria | 9428 |
| 649 | Ga0207649_10061573 | 3300025920 | Bacteria | 2363 |
| 650 | Ga0207652_10002113 | 3300025921 | Bacteria | 17039 |
| 651 | Ga0207652_10002264 | 3300025921 | Bacteria | 16327 |
| 652 | Ga0207652_10007510 | 3300025921 | Bacteria | 8777 |
| 653 | Ga0207652_10013940 | 3300025921 | Bacteria | 6508 |
| 654 | Ga0207652_10039102 | 3300025921 | Bacteria | 4025 |
| 655 | Ga0207646_10001485 | 3300025922 | Bacteria | 28893 |
| 656 | Ga0207646_10001492 | 3300025922 | Bacteria | 28758 |
| 657 | Ga0207646_10016391 | 3300025922 | Bacteria | 6952 |
| 658 | Ga0207646_10031703 | 3300025922 | Bacteria | 4785 |
| 659 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 660 | Ga0207694_10012840 | 3300025924 | Bacteria | 6308 |
| 661 | Ga0207694_10016717 | 3300025924 | Bacteria | 5546 |
| 662 | Ga0207694_10165432 | 3300025924 | Bacteria | 1788 |
| 663 | Ga0207650_10014656 | 3300025925 | Bacteria | 5446 |
| 664 | Ga0207650_10015087 | 3300025925 | Bacteria | 5375 |
| 665 | Ga0207659_10026627 | 3300025926 | Bacteria | 3904 |
| 666 | Ga0207659_10058318 | 3300025926 | Bacteria | 2771 |
| 667 | Ga0207687_10001209 | 3300025927 | Bacteria | 17685 |
| 668 | Ga0207687_10037904 | 3300025927 | Bacteria | 3292 |
| 669 | Ga0207687_10106109 | 3300025927 | Bacteria | 2076 |
| 670 | Ga0207700_10000073 | 3300025928 | Bacteria | 61784 |
| 671 | Ga0207700_10003148 | 3300025928 | Bacteria | 9523 |
| 672 | Ga0207700_10010941 | 3300025928 | Bacteria | 5759 |
| 673 | Ga0207700_10171684 | 3300025928 | Bacteria | 1809 |
| 674 | Ga0207664_10000542 | 3300025929 | Bacteria | 26749 |
| 675 | Ga0207664_10014981 | 3300025929 | Bacteria | 5615 |
| 676 | Ga0207664_10015163 | 3300025929 | Bacteria | 5585 |
| 677 | Ga0207664_10028741 | 3300025929 | Bacteria | 4228 |
| 678 | Ga0207664_10097651 | 3300025929 | Bacteria | 2420 |
| 679 | Ga0207664_10104572 | 3300025929 | Bacteria | 2345 |
| 680 | Ga0207644_10011232 | 3300025931 | Bacteria | 5920 |
| 681 | Ga0207644_10088173 | 3300025931 | Bacteria | 2307 |
| 682 | Ga0207690_10000007 | 3300025932 | Bacteria | 388533 |
| 683 | Ga0207690_10001061 | 3300025932 | Bacteria | 17606 |
| 684 | Ga0207690_10008488 | 3300025932 | Bacteria | 6095 |
| 685 | Ga0207706_10000023 | 3300025933 | Bacteria | 153979 |
| 686 | Ga0207686_10004180 | 3300025934 | Bacteria | 7743 |
| 687 | Ga0207709_10000160 | 3300025935 | Bacteria | 91486 |
| 688 | Ga0207709_10001196 | 3300025935 | Bacteria | 18730 |
| 689 | Ga0207709_10002053 | 3300025935 | Bacteria | 13023 |
| 690 | Ga0207709_10002264 | 3300025935 | Bacteria | 12219 |
| 691 | Ga0207709_10003963 | 3300025935 | Bacteria | 8638 |
| 692 | Ga0207709_10024451 | 3300025935 | Bacteria | 3450 |
| 693 | Ga0207709_10055086 | 3300025935 | Bacteria | 2455 |
| 694 | Ga0207709_10057896 | 3300025935 | Bacteria | 2406 |
| 695 | Ga0207670_10043643 | 3300025936 | Bacteria | 2963 |
| 696 | Ga0207669_10022675 | 3300025937 | Bacteria | 3339 |
| 697 | Ga0207669_10121924 | 3300025937 | Bacteria | 1772 |
| 698 | Ga0207665_10010799 | 3300025939 | Bacteria | 5995 |
| 699 | Ga0207665_10033990 | 3300025939 | Bacteria | 3383 |
| 700 | Ga0207691_10014621 | 3300025940 | Bacteria | 7482 |
| 701 | Ga0207691_10081360 | 3300025940 | Bacteria | 2911 |
| 702 | Ga0207711_10057311 | 3300025941 | Bacteria | 3349 |
| 703 | Ga0207689_10007725 | 3300025942 | Bacteria | 9411 |
| 704 | Ga0207689_10009885 | 3300025942 | Bacteria | 8224 |
| 705 | Ga0207689_10124366 | 3300025942 | Bacteria | 2122 |
| 706 | Ga0207661_10003557 | 3300025944 | Bacteria | 10830 |
| 707 | Ga0207661_10010000 | 3300025944 | Bacteria | 6816 |
| 708 | Ga0207661_10046617 | 3300025944 | Bacteria | 3437 |
| 709 | Ga0207661_10213964 | 3300025944 | Bacteria | 1700 |
| 710 | Ga0207679_10000007 | 3300025945 | Bacteria | 460140 |
| 711 | Ga0207679_10013781 | 3300025945 | Bacteria | 5302 |
| 712 | Ga0207679_10026592 | 3300025945 | Bacteria | 3992 |
| 713 | Ga0207679_10029885 | 3300025945 | Bacteria | 3798 |
| 714 | Ga0207679_10041837 | 3300025945 | Bacteria | 3289 |
| 715 | Ga0207667_10000058 | 3300025949 | Bacteria | 200529 |
| 716 | Ga0207667_10001383 | 3300025949 | Bacteria | 30431 |
| 717 | Ga0207667_10003202 | 3300025949 | Bacteria | 20233 |
| 718 | Ga0207667_10006874 | 3300025949 | Bacteria | 13743 |
| 719 | Ga0207667_10008850 | 3300025949 | Bacteria | 11915 |
| 720 | Ga0207667_10016327 | 3300025949 | Bacteria | 8391 |
| 721 | Ga0207667_10019658 | 3300025949 | Bacteria | 7531 |
| 722 | Ga0207667_10044504 | 3300025949 | Bacteria | 4703 |
| 723 | Ga0207667_10089052 | 3300025949 | Bacteria | 3191 |
| 724 | Ga0207651_10039683 | 3300025960 | Bacteria | 3107 |
| 725 | Ga0207712_10014233 | 3300025961 | Bacteria | 5110 |
| 726 | Ga0207668_10005766 | 3300025972 | Bacteria | 7300 |
| 727 | Ga0207640_10000107 | 3300025981 | Bacteria | 63143 |
| 728 | Ga0207640_10019654 | 3300025981 | Bacteria | 3995 |
| 729 | Ga0207640_10144269 | 3300025981 | Bacteria | 1740 |
| 730 | Ga0207658_10012781 | 3300025986 | Bacteria | 5733 |
| 731 | Ga0207658_10031607 | 3300025986 | Bacteria | 3761 |
| 732 | Ga0207658_10059842 | 3300025986 | Bacteria | 2840 |
| 733 | Ga0207677_10000009 | 3300026023 | Bacteria | 252751 |
| 734 | Ga0207677_10020339 | 3300026023 | Bacteria | 4028 |
| 735 | Ga0207677_10153420 | 3300026023 | Bacteria | 1780 |
| 736 | Ga0207703_10006237 | 3300026035 | Bacteria | 9539 |
| 737 | Ga0207703_10127395 | 3300026035 | Bacteria | 2194 |
| 738 | Ga0207639_10010939 | 3300026041 | Bacteria | 6292 |
| 739 | Ga0207678_10001969 | 3300026067 | Bacteria | 18714 |
| 740 | Ga0207678_10002335 | 3300026067 | Bacteria | 17195 |
| 741 | Ga0207678_10008085 | 3300026067 | Bacteria | 9275 |
| 742 | Ga0207678_10011358 | 3300026067 | Bacteria | 7817 |
| 743 | Ga0207678_10012488 | 3300026067 | Bacteria | 7458 |
| 744 | Ga0207678_10017713 | 3300026067 | Bacteria | 6255 |
| 745 | Ga0207678_10018918 | 3300026067 | Bacteria | 6053 |
| 746 | Ga0207678_10107168 | 3300026067 | Bacteria | 2384 |
| 747 | Ga0207708_10002903 | 3300026075 | Bacteria | 12635 |
| 748 | Ga0207708_10023705 | 3300026075 | Bacteria | 4639 |
| 749 | Ga0207708_10081144 | 3300026075 | Bacteria | 2493 |
| 750 | Ga0207702_10000260 | 3300026078 | Bacteria | 61036 |
| 751 | Ga0207702_10000337 | 3300026078 | Bacteria | 53931 |
| 752 | Ga0207702_10004398 | 3300026078 | Bacteria | 12551 |
| 753 | Ga0207702_10005167 | 3300026078 | Bacteria | 11484 |
| 754 | Ga0207702_10020136 | 3300026078 | Bacteria | 5527 |
| 755 | Ga0207702_10033148 | 3300026078 | Bacteria | 4313 |
| 756 | Ga0207702_10163310 | 3300026078 | Bacteria | 2035 |
| 757 | Ga0207648_10008955 | 3300026089 | Bacteria | 9628 |
| 758 | Ga0207648_10015226 | 3300026089 | Bacteria | 7075 |
| 759 | Ga0207648_10029600 | 3300026089 | Bacteria | 4856 |
| 760 | Ga0207648_10117322 | 3300026089 | Bacteria | 2339 |
| 761 | Ga0207676_10000029 | 3300026095 | Bacteria | 232795 |
| 762 | Ga0207676_10010708 | 3300026095 | Bacteria | 6539 |
| 763 | Ga0207676_10013864 | 3300026095 | Bacteria | 5787 |
| 764 | Ga0207674_10000429 | 3300026116 | Bacteria | 54858 |
| 765 | Ga0207674_10018062 | 3300026116 | Bacteria | 7681 |
| 766 | Ga0207675_100004715 | 3300026118 | Bacteria | 13128 |
| 767 | Ga0207675_100005732 | 3300026118 | Bacteria | 11884 |
| 768 | Ga0207675_100008757 | 3300026118 | Bacteria | 9506 |
| 769 | Ga0207675_100015056 | 3300026118 | Bacteria | 7217 |
| 770 | Ga0207675_100113155 | 3300026118 | Bacteria | 2562 |
| 771 | Ga0207683_10000123 | 3300026121 | Bacteria | 63353 |
| 772 | Ga0207683_10023126 | 3300026121 | Bacteria | 5340 |
| 773 | Ga0207698_10009610 | 3300026142 | Bacteria | 6174 |
| 774 | Ga0207698_10011139 | 3300026142 | Bacteria | 5815 |
| 775 | Ga0207698_10027312 | 3300026142 | Bacteria | 4050 |
| 776 | Ga0207698_10032212 | 3300026142 | Bacteria | 3794 |
| 777 | Ga0209281_1000017 | 3300027111 | Bacteria | 583251 |
| 778 | Ga0209281_1000314 | 3300027111 | Bacteria | 86424 |
| 779 | Ga0209389_1003130 | 3300027296 | Bacteria | 13157 |
| 780 | Ga0209371_1000292 | 3300027312 | Bacteria | 57076 |
| 781 | Ga0209371_1002246 | 3300027312 | Bacteria | 11120 |
| 782 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 783 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 784 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 785 | Ga0210000_1000314 | 3300027462 | Bacteria | 7003 |
| 786 | Ga0209995_1001170 | 3300027471 | Bacteria | 4029 |
| 787 | Ga0209179_1000007 | 3300027512 | Bacteria | 93732 |
| 788 | Ga0209179_1002568 | 3300027512 | Bacteria | 2475 |
| 789 | Ga0209999_1000071 | 3300027543 | Bacteria | 11724 |
| 790 | Ga0209970_1000300 | 3300027614 | Bacteria | 8158 |
| 791 | Ga0209282_1000068 | 3300027666 | Bacteria | 85817 |
| 792 | Ga0209282_1004480 | 3300027666 | Bacteria | 8420 |
| 793 | Ga0209588_1002124 | 3300027671 | Bacteria | 5346 |
| 794 | Ga0209971_1001823 | 3300027682 | Bacteria | 5217 |
| 795 | Ga0209966_1000161 | 3300027695 | Bacteria | 28311 |
| 796 | Ga0209966_1003206 | 3300027695 | Bacteria | 2747 |
| 797 | Ga0209998_10000408 | 3300027717 | Bacteria | 12270 |
| 798 | Ga0209813_10007844 | 3300027866 | Bacteria | 2673 |
| 799 | Ga0209974_10001049 | 3300027876 | Bacteria | 9796 |
| 800 | Ga0207428_10002865 | 3300027907 | Bacteria | 17096 |
| 801 | Ga0207428_10056370 | 3300027907 | Bacteria | 3123 |
| 802 | Ga0268266_10000190 | 3300028379 | Bacteria | 107630 |
| 803 | Ga0268266_10002300 | 3300028379 | Bacteria | 20725 |
| 804 | Ga0268266_10032638 | 3300028379 | Bacteria | 4424 |
| 805 | Ga0268266_10052019 | 3300028379 | Bacteria | 3516 |
| 806 | Ga0268266_10053608 | 3300028379 | Bacteria | 3465 |
| 807 | Ga0268265_10001435 | 3300028380 | Bacteria | 20111 |
| 808 | Ga0268265_10002340 | 3300028380 | Bacteria | 14383 |
| 809 | Ga0268265_10009307 | 3300028380 | Bacteria | 6639 |
| 810 | Ga0268265_10079019 | 3300028380 | Bacteria | 2589 |
| 811 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 812 | Ga0268264_10000220 | 3300028381 | Bacteria | 111692 |
| 813 | Ga0268264_10047641 | 3300028381 | Bacteria | 3563 |
| 814 | Ga0268264_10143573 | 3300028381 | Bacteria | 2132 |
| 815 | Ga0265318_10011370 | 3300028577 | Bacteria | 3835 |
| 816 | Ga0265318_10020381 | 3300028577 | Bacteria | 2677 |
| 817 | Ga0307517_10000053 | 3300028786 | Bacteria | 155723 |
| 818 | Ga0307515_10000062 | 3300028794 | Bacteria | 247284 |
| 819 | Ga0307515_10000346 | 3300028794 | Bacteria | 114729 |
| 820 | Ga0307515_10000398 | 3300028794 | Bacteria | 105087 |
| 821 | Ga0307515_10000975 | 3300028794 | Bacteria | 65367 |
| 822 | Ga0307515_10001252 | 3300028794 | Bacteria | 57943 |
| 823 | Ga0307515_10005050 | 3300028794 | Bacteria | 26834 |
| 824 | Ga0307515_10006111 | 3300028794 | Bacteria | 24214 |
| 825 | Ga0307515_10011471 | 3300028794 | Bacteria | 16819 |
| 826 | Ga0307515_10024951 | 3300028794 | Bacteria | 10375 |
| 827 | Ga0307515_10066126 | 3300028794 | Bacteria | 5014 |
| 828 | Ga0307515_10113321 | 3300028794 | Bacteria | 3145 |
| 829 | Ga0265338_10052193 | 3300028800 | Bacteria | 3673 |
| 830 | Ga0268256_1000255 | 3300030500 | Bacteria | 56398 |
| 831 | Ga0268256_1003512 | 3300030500 | Bacteria | 7036 |
| 832 | Ga0314311_1190663 | 3300030733 | Bacteria | 1932 |
| 833 | Ga0265330_10000052 | 3300031235 | Bacteria | 102771 |
| 834 | Ga0265330_10026724 | 3300031235 | Bacteria | 2609 |
| 835 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 836 | Ga0265332_10006386 | 3300031238 | Bacteria | 5346 |
| 837 | Ga0265328_10002917 | 3300031239 | Bacteria | 7630 |
| 838 | Ga0265325_10002984 | 3300031241 | Bacteria | 11229 |
| 839 | Ga0265325_10013593 | 3300031241 | Bacteria | 4628 |
| 840 | Ga0265329_10007409 | 3300031242 | Bacteria | 4249 |
| 841 | Ga0265339_10001286 | 3300031249 | Bacteria | 18767 |
| 842 | Ga0265331_10007279 | 3300031250 | Bacteria | 6415 |
| 843 | Ga0265327_10000018 | 3300031251 | Bacteria | 439197 |
| 844 | Ga0265327_10000080 | 3300031251 | Bacteria | 206086 |
| 845 | Ga0265327_10000622 | 3300031251 | Bacteria | 58359 |
| 846 | Ga0265327_10000733 | 3300031251 | Bacteria | 51231 |
| 847 | Ga0265316_10019109 | 3300031344 | Bacteria | 5870 |
| 848 | Ga0265316_10066938 | 3300031344 | Bacteria | 2778 |
| 849 | Ga0265316_10069887 | 3300031344 | Bacteria | 2710 |
| 850 | Ga0307513_10000070 | 3300031456 | Bacteria | 139895 |
| 851 | Ga0307513_10000072 | 3300031456 | Bacteria | 138840 |
| 852 | Ga0307513_10000162 | 3300031456 | Bacteria | 96000 |
| 853 | Ga0307513_10004918 | 3300031456 | Bacteria | 17742 |
| 854 | Ga0307513_10011662 | 3300031456 | Bacteria | 10905 |
| 855 | Ga0307513_10021256 | 3300031456 | Bacteria | 7664 |
| 856 | Ga0307513_10069763 | 3300031456 | Bacteria | 3677 |
| 857 | Ga0307513_10108064 | 3300031456 | Bacteria | 2784 |
| 858 | Ga0307509_10000032 | 3300031507 | Bacteria | 202919 |
| 859 | Ga0307509_10008220 | 3300031507 | Bacteria | 13346 |
| 860 | Ga0307509_10075146 | 3300031507 | Bacteria | 3510 |
| 861 | Ga0307408_100000012 | 3300031548 | Bacteria | 408153 |
| 862 | Ga0307408_100000219 | 3300031548 | Bacteria | 61012 |
| 863 | Ga0307408_100002474 | 3300031548 | Bacteria | 12950 |
| 864 | Ga0307508_10000001 | 3300031616 | Bacteria | 553635 |
| 865 | Ga0307508_10000023 | 3300031616 | Bacteria | 177362 |
| 866 | Ga0307508_10013998 | 3300031616 | Bacteria | 7320 |
| 867 | Ga0307508_10020567 | 3300031616 | Bacteria | 5995 |
| 868 | Ga0307508_10098651 | 3300031616 | Bacteria | 2515 |
| 869 | Ga0307514_10003961 | 3300031649 | Bacteria | 13848 |
| 870 | Ga0307514_10010805 | 3300031649 | Bacteria | 7624 |
| 871 | Ga0307514_10015637 | 3300031649 | Bacteria | 6254 |
| 872 | Ga0307514_10016384 | 3300031649 | Bacteria | 6105 |
| 873 | Ga0307514_10047240 | 3300031649 | Bacteria | 3361 |
| 874 | Ga0316575_10002135 | 3300031665 | Bacteria | 6602 |
| 875 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 876 | Ga0265314_10001416 | 3300031711 | Bacteria | 26889 |
| 877 | Ga0265314_10003480 | 3300031711 | Bacteria | 15205 |
| 878 | Ga0265314_10009656 | 3300031711 | Bacteria | 8125 |
| 879 | Ga0265342_10015981 | 3300031712 | Bacteria | 4918 |
| 880 | Ga0265342_10050856 | 3300031712 | Bacteria | 2474 |
| 881 | Ga0316576_10005251 | 3300031727 | Bacteria | 7884 |
| 882 | Ga0316576_10044334 | 3300031727 | Bacteria | 3212 |
| 883 | Ga0316576_10056466 | 3300031727 | Bacteria | 2867 |
| 884 | Ga0316578_10033710 | 3300031728 | Bacteria | 2936 |
| 885 | Ga0307516_10000045 | 3300031730 | Bacteria | 132787 |
| 886 | Ga0307516_10003224 | 3300031730 | Bacteria | 21166 |
| 887 | Ga0307516_10006540 | 3300031730 | Bacteria | 13642 |
| 888 | Ga0307516_10007517 | 3300031730 | Bacteria | 12523 |
| 889 | Ga0307516_10010031 | 3300031730 | Bacteria | 10481 |
| 890 | Ga0307405_10000676 | 3300031731 | Bacteria | 13196 |
| 891 | Ga0307405_10024174 | 3300031731 | Bacteria | 3466 |
| 892 | Ga0316577_10016321 | 3300031733 | Bacteria | 4091 |
| 893 | Ga0307413_10038493 | 3300031824 | Bacteria | 2773 |
| 894 | Ga0307410_10036376 | 3300031852 | Bacteria | 3206 |
| 895 | Ga0307406_10000407 | 3300031901 | Bacteria | 24935 |
| 896 | Ga0307406_10005726 | 3300031901 | Bacteria | 6804 |
| 897 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 898 | Ga0307412_10025093 | 3300031911 | Bacteria | 3687 |
| 899 | Ga0315914_1020806 | 3300031967 | Bacteria | 5279 |
| 900 | Ga0307409_100082576 | 3300031995 | Bacteria | 2602 |
| 901 | Ga0307409_100103549 | 3300031995 | Bacteria | 2368 |
| 902 | Ga0307416_100004227 | 3300032002 | Bacteria | 8619 |
| 903 | Ga0307416_100008902 | 3300032002 | Bacteria | 6521 |
| 904 | Ga0307416_100191736 | 3300032002 | Bacteria | 1928 |
| 905 | Ga0307414_10021938 | 3300032004 | Bacteria | 4019 |
| 906 | Ga0307414_10029553 | 3300032004 | Bacteria | 3568 |
| 907 | Ga0307414_10039044 | 3300032004 | Bacteria | 3194 |
| 908 | Ga0307414_10063992 | 3300032004 | Bacteria | 2617 |
| 909 | Ga0307411_10044025 | 3300032005 | Bacteria | 2859 |
| 910 | Ga0307411_10126242 | 3300032005 | Bacteria | 1861 |
| 911 | Ga0307415_100084486 | 3300032126 | Bacteria | 2278 |
| 912 | Ga0316583_10004774 | 3300032133 | Bacteria | 4841 |
| 913 | Ga0316580_10002722 | 3300032139 | Bacteria | 4916 |
| 914 | Ga0307510_10106751 | 3300033180 | Bacteria | 2562 |
| 915 | Ga0315913_1002536 | 3300033430 | Bacteria | 21509 |
| 916 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 917 | Ga0373926_0001668 | 3300035083 | Bacteria | 6863 |
| 918 | Ga0373934_0000684 | 3300035086 | Bacteria | 12034 |
| 919 | Ga0373934_0026986 | 3300035086 | Bacteria | 2230 |
| 920 | Ga0373953_0000768 | 3300035117 | Bacteria | 8919 |
| 921 | Ga0373954_0000028 | 3300035118 | Bacteria | 56501 |
| 922 | Ga0373954_0000045 | 3300035118 | Bacteria | 43877 |
| 923 | Ga0373956_0000635 | 3300035119 | Bacteria | 14416 |
| 924 | Ga0373960_0000576 | 3300035121 | Bacteria | 7472 |
| 925 | Ga0373943_0018742 | 3300035170 | Bacteria | 3181 |
| 926 | Ga0373943_0038304 | 3300035170 | Bacteria | 2304 |
| 927 | Ga0373946_0002476 | 3300035171 | Bacteria | 6521 |
| 928 | Ga0373955_0000519 | 3300035172 | Bacteria | 16383 |
| 929 | Ga0373955_0009467 | 3300035172 | Bacteria | 4563 |
| 930 | Ga0373942_0001178 | 3300035207 | Bacteria | 6908 |
| 931 | Ga0316574_0016862 | 3300035398 | Bacteria | 4263 |
| 932 | Ga0373924_0010387 | 3300035410 | Bacteria | 3429 |
| 933 | Ga0373931_0001811 | 3300035691 | Bacteria | 9299 |
| 934 | Ga0373931_0003169 | 3300035691 | Bacteria | 7343 |
| 935 | Ga0373935_0007344 | 3300035692 | Bacteria | 6592 |
| 936 | Ga0373935_0149847 | 3300035692 | Bacteria | 1582 |
| 937 | Ga0373927_0002624 | 3300035695 | Bacteria | 13109 |
| 938 | Ga0373927_0012450 | 3300035695 | Bacteria | 5665 |
| 939 | Ga0373933_0000309 | 3300035724 | Bacteria | 31558 |
| 940 | Ga0373933_0001241 | 3300035724 | Bacteria | 15060 |
| 941 | Ga0373933_0025582 | 3300035724 | Bacteria | 3386 |
| 942 | Ga0373933_0034721 | 3300035724 | Bacteria | 2941 |
| 943 | Ga0373947_0015581 | 3300035725 | Bacteria | 4366 |
| 944 | Ga0373937_0000742 | 3300036401 | Bacteria | 28122 |
| 945 | Ga0373937_0001199 | 3300036401 | Bacteria | 21771 |
| 946 | Ga0373937_0045869 | 3300036401 | Bacteria | 3995 |
| 947 | Ga0373937_0143850 | 3300036401 | Bacteria | 2231 |
| 948 | Ga0316582_0076106 | 3300036647 | Bacteria | 2182 |
| 949 | Ga0373925_0087351 | 3300037068 | Bacteria | 2380 |
| 950 | Ga0373925_0089666 | 3300037068 | Bacteria | 2349 |
| 951 | Ga0395899_0000013 | 3300037312 | Bacteria | 510397 |
| 952 | Ga0395899_0000023 | 3300037312 | Bacteria | 367159 |
| 953 | Ga0395899_0000078 | 3300037312 | Bacteria | 174141 |
| 954 | Ga0395899_0002871 | 3300037312 | Bacteria | 13845 |
| 955 | Ga0395899_0022135 | 3300037312 | Bacteria | 4820 |
| 956 | Ga0395899_0027406 | 3300037312 | Bacteria | 4297 |
| 957 | Ga0395900_0000019 | 3300037418 | Bacteria | 357240 |
| 958 | Ga0395900_0000211 | 3300037418 | Bacteria | 91303 |
| 959 | Ga0395900_0013503 | 3300037418 | Bacteria | 8346 |
| 960 | Ga0395900_0019625 | 3300037418 | Bacteria | 6892 |
| 961 | Ga0395900_0035336 | 3300037418 | Bacteria | 5147 |
| 962 | Ga0395900_0105174 | 3300037418 | Bacteria | 2900 |
| 963 | Ga0395900_0124953 | 3300037418 | Bacteria | 2638 |
| 964 | Ga0395900_0157547 | 3300037418 | Bacteria | 2319 |
| 965 | Ga0395900_0241507 | 3300037418 | Bacteria | 1812 |
| 966 | Ga0395898_0000016 | 3300037466 | Bacteria | 435585 |
| 967 | Ga0395898_0002136 | 3300037466 | Bacteria | 24363 |
| 968 | Ga0395898_0007259 | 3300037466 | Bacteria | 11760 |
| 969 | Ga0395898_0010588 | 3300037466 | Bacteria | 9629 |
| 970 | Ga0395898_0012425 | 3300037466 | Bacteria | 8803 |
| 971 | Ga0395898_0021799 | 3300037466 | Bacteria | 6491 |
| 972 | Ga0395898_0053635 | 3300037466 | Bacteria | 3938 |
| 973 | Ga0395898_0056493 | 3300037466 | Bacteria | 3825 |
| 974 | Ga0395898_0061367 | 3300037466 | Bacteria | 3652 |
| 975 | Ga0395905_0000117 | 3300037471 | Bacteria | 133291 |
| 976 | Ga0395905_0000283 | 3300037471 | Bacteria | 74377 |
| 977 | Ga0395905_0000352 | 3300037471 | Bacteria | 65434 |
| 978 | Ga0395905_0001425 | 3300037471 | Bacteria | 28820 |
| 979 | Ga0395905_0003331 | 3300037471 | Bacteria | 17244 |
| 980 | Ga0395905_0003956 | 3300037471 | Bacteria | 15588 |
| 981 | Ga0395905_0009380 | 3300037471 | Bacteria | 9571 |
| 982 | Ga0395905_0011137 | 3300037471 | Bacteria | 8698 |
| 983 | Ga0395905_0017915 | 3300037471 | Bacteria | 6727 |
| 984 | Ga0395905_0018137 | 3300037471 | Bacteria | 6679 |
| 985 | Ga0395905_0031988 | 3300037471 | Bacteria | 4949 |
| 986 | Ga0395905_0047994 | 3300037471 | Bacteria | 4001 |
| 987 | Ga0436364_0273345 | 3300037853 | Bacteria | 2794207 |
| 988 | Ga0436364_0461129 | 3300037853 | Bacteria | 3432 |
| 989 | Ga0436364_0476731 | 3300037853 | Bacteria | 5156 |
| 990 | Ga0436364_1323953 | 3300037853 | Bacteria | 2207 |
| 991 | Ga0395901_0009034 | 3300038443 | Bacteria | 10088 |
| 992 | Ga0395901_0011033 | 3300038443 | Bacteria | 9152 |
| 993 | Ga0395901_0040984 | 3300038443 | Bacteria | 4797 |
| 994 | Ga0395901_0044297 | 3300038443 | Bacteria | 4615 |
| 995 | Ga0395901_0047204 | 3300038443 | Bacteria | 4471 |
| 996 | Ga0395901_0123138 | 3300038443 | Bacteria | 2725 |
| 997 | Ga0400483_041877 | 3300039062 | Bacteria | 34809 |
| 998 | Ga0400483_128917 | 3300039062 | Bacteria | 3482 |
| 999 | Ga0400483_239666 | 3300039062 | Bacteria | 2700 |
| 1000 | Ga0436365_0613835 | 3300039437 | Bacteria | 19254 |
| 1001 | Ga0436365_0774883 | 3300039437 | Bacteria | 390569 |
| 1002 | Ga0436365_0818746 | 3300039437 | Bacteria | 84606 |
| 1003 | Ga0436365_0843555 | 3300039437 | Bacteria | 2654 |
| 1004 | Ga0436365_1024917 | 3300039437 | Bacteria | 4764 |
| 1005 | Ga0436360_0242974 | 3300039438 | Bacteria | 3205 |
| 1006 | Ga0436360_0965900 | 3300039438 | Bacteria | 1749 |
| 1007 | Ga0436361_0067858 | 3300039447 | Bacteria | 4310 |
| 1008 | Ga0436361_0192229 | 3300039447 | Bacteria | 2185 |
| 1009 | Ga0436361_0208418 | 3300039447 | Bacteria | 17479 |
| 1010 | Ga0436361_0224368 | 3300039447 | Bacteria | 99317 |
| 1011 | Ga0436361_0307998 | 3300039447 | Bacteria | 2365 |
| 1012 | Ga0436361_0319598 | 3300039447 | Bacteria | 24219 |
| 1013 | Ga0436361_0394184 | 3300039447 | Bacteria | 10632 |
| 1014 | Ga0436361_0424891 | 3300039447 | Bacteria | 6785 |
| 1015 | Ga0436361_0437880 | 3300039447 | Bacteria | 10056 |
| 1016 | Ga0436361_0767394 | 3300039447 | Bacteria | 56110 |
| 1017 | Ga0436361_0807409 | 3300039447 | Bacteria | 14539 |
| 1018 | Ga0436361_0913791 | 3300039447 | Bacteria | 99691 |
| 1019 | Ga0436361_0922325 | 3300039447 | Bacteria | 2478 |
| 1020 | Ga0436361_0937617 | 3300039447 | Bacteria | 6347 |
| 1021 | Ga0436361_0941839 | 3300039447 | Bacteria | 174965 |
| 1022 | Ga0436361_1034384 | 3300039447 | Bacteria | 7100 |
| 1023 | Ga0436363_0794016 | 3300039450 | Bacteria | 7079 |
| 1024 | Ga0436363_1052713 | 3300039450 | Bacteria | 2573 |
| 1025 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 1026 | Ga0436362_0933513 | 3300039453 | Bacteria | 15871 |
| 1027 | Ga0439465_0002181 | 3300041413 | Bacteria | 6425 |
| 1028 | Ga0439442_000327 | 3300042002 | Bacteria | 11381 |
| 1029 | Ga0439449_0000741 | 3300042007 | Bacteria | 12538 |
| 1030 | Ga0439449_0016081 | 3300042007 | Bacteria | 2814 |
| 1031 | Ga0439449_0018901 | 3300042007 | Bacteria | 2583 |
| 1032 | Ga0439462_0000613 | 3300042015 | Bacteria | 7135 |
| 1033 | Ga0450894_000652 | 3300042131 | Bacteria | 5794 |
| 1034 | Ga0450908_003056 | 3300042184 | Bacteria | 3261 |
| 1035 | Ga0439434_0003053 | 3300042435 | Bacteria | 4908 |
| 1036 | Ga0439444_0001693 | 3300042437 | Bacteria | 2911 |
| 1037 | Ga0439459_0000205 | 3300042438 | Bacteria | 6630 |
| 1038 | Ga0439460_0000526 | 3300042461 | Bacteria | 8328 |
| 1039 | Ga0439460_0003588 | 3300042461 | Bacteria | 3752 |
| 1040 | Ga0451577_0000014 | 3300042876 | Bacteria | 546755 |
| 1041 | Ga0451577_0000388 | 3300042876 | Bacteria | 81462 |
| 1042 | Ga0451577_0006997 | 3300042876 | Bacteria | 11140 |
| 1043 | Ga0451577_0013489 | 3300042876 | Bacteria | 7644 |
| 1044 | Ga0466969_0054442 | 3300044656 | Bacteria | 1959 |
| 1045 | Ga0453683_0002610 | 3300044673 | Bacteria | 13817 |
| 1046 | Ga0453683_0003826 | 3300044673 | Bacteria | 10931 |
| 1047 | Ga0466965_0050337 | 3300044683 | Bacteria | 2066 |
| 1048 | Ga0466966_0000009 | 3300044684 | Bacteria | 150954 |
| 1049 | Ga0466966_0033613 | 3300044684 | Bacteria | 3320 |
| 1050 | Ga0466961_0000353 | 3300044693 | Bacteria | 29874 |
| 1051 | Ga0466961_0006262 | 3300044693 | Bacteria | 7556 |
| 1052 | Ga0466961_0019806 | 3300044693 | Bacteria | 4329 |
| 1053 | Ga0466961_0022355 | 3300044693 | Bacteria | 4068 |
| 1054 | Ga0466963_0017627 | 3300044694 | Bacteria | 4453 |
| 1055 | Ga0466963_0040009 | 3300044694 | Bacteria | 3072 |
| 1056 | Ga0453684_0000082 | 3300044712 | Bacteria | 399380 |
| 1057 | Ga0453684_0000132 | 3300044712 | Bacteria | 331157 |
| 1058 | Ga0453684_0000187 | 3300044712 | Bacteria | 272378 |
| 1059 | Ga0453684_0000204 | 3300044712 | Bacteria | 258105 |
| 1060 | Ga0453684_0001066 | 3300044712 | Bacteria | 87216 |
| 1061 | Ga0453684_0002858 | 3300044712 | Bacteria | 40576 |
| 1062 | Ga0453684_0007830 | 3300044712 | Bacteria | 19464 |
| 1063 | Ga0453684_0031157 | 3300044712 | Bacteria | 7503 |
| 1064 | Ga0453684_0033889 | 3300044712 | Bacteria | 7104 |
| 1065 | Ga0453684_0048661 | 3300044712 | Bacteria | 5600 |
| 1066 | Ga0453684_0239155 | 3300044712 | Bacteria | 2091 |
| 1067 | Ga0466971_0022622 | 3300044719 | Bacteria | 2802 |
| 1068 | Ga0466968_0001573 | 3300044735 | Bacteria | 8235 |
| 1069 | Ga0466968_0006458 | 3300044735 | Bacteria | 4421 |
| 1070 | Ga0466968_0017610 | 3300044735 | Bacteria | 2858 |
| 1071 | Ga0466957_0067691 | 3300044842 | Bacteria | 2203 |
| 1072 | Ga0466960_0003202 | 3300044901 | Bacteria | 6275 |
| 1073 | Ga0466960_0009154 | 3300044901 | Bacteria | 4075 |
| 1074 | Ga0466960_0014600 | 3300044901 | Bacteria | 3368 |
| 1075 | Ga0466960_0042521 | 3300044901 | Bacteria | 2158 |
| 1076 | Ga0466959_0000394 | 3300045049 | Bacteria | 25591 |
| 1077 | Ga0466959_0000938 | 3300045049 | Bacteria | 17303 |
| 1078 | Ga0466959_0005843 | 3300045049 | Bacteria | 8470 |
| 1079 | Ga0451576_0000096 | 3300045051 | Bacteria | 221078 |
| 1080 | Ga0451576_0005438 | 3300045051 | Bacteria | 15974 |
| 1081 | Ga0451576_0009574 | 3300045051 | Bacteria | 11217 |
| 1082 | Ga0451576_0026461 | 3300045051 | Bacteria | 6240 |
| 1083 | Ga0451576_0028947 | 3300045051 | Bacteria | 5933 |
| 1084 | Ga0451576_0031011 | 3300045051 | Bacteria | 5703 |
| 1085 | Ga0451576_0055246 | 3300045051 | Bacteria | 4155 |
| 1086 | Ga0451576_0145422 | 3300045051 | Bacteria | 2472 |
| 1087 | Ga0466958_0008156 | 3300045836 | Bacteria | 5799 |
| 1088 | Ga0466958_0023126 | 3300045836 | Bacteria | 3645 |
| 1089 | Ga0466958_0027790 | 3300045836 | Bacteria | 3348 |
| 1090 | Ga0466967_0001288 | 3300045976 | Bacteria | 14273 |
| 1091 | Ga0466967_0003130 | 3300045976 | Bacteria | 10654 |
| 1092 | Ga0466967_0005413 | 3300045976 | Bacteria | 8843 |
| 1093 | Ga0466967_0035194 | 3300045976 | Bacteria | 4259 |
| 1094 | Ga0466967_0039274 | 3300045976 | Bacteria | 4067 |
| 1095 | Ga0495617_025787 | 3300046452 | Bacteria | 1981 |
| 1096 | Ga0495592_0000436 | 3300046454 | Bacteria | 31448 |
| 1097 | Ga0495592_0002487 | 3300046454 | Bacteria | 13018 |
| 1098 | Ga0495603_0032454 | 3300046455 | Bacteria | 3141 |
| 1099 | Ga0495603_0048284 | 3300046455 | Bacteria | 2534 |
| 1100 | Ga0495629_0000257 | 3300046459 | Bacteria | 46305 |
| 1101 | Ga0495651_0003296 | 3300046462 | Bacteria | 12393 |
| 1102 | Ga0495653_0000288 | 3300046463 | Bacteria | 40866 |
| 1103 | Ga0495653_0116844 | 3300046463 | Bacteria | 1907 |
| 1104 | Ga0495650_0007201 | 3300046471 | Bacteria | 6740 |
| 1105 | Ga0495580_0018040 | 3300046472 | Bacteria | 5262 |
| 1106 | Ga0495639_0037330 | 3300046475 | Bacteria | 2177 |
| 1107 | Ga0495662_0008407 | 3300046476 | Bacteria | 5076 |
| 1108 | Ga0495664_0051708 | 3300046477 | Bacteria | 2440 |
| 1109 | Ga0495594_0033120 | 3300046499 | Bacteria | 2808 |
| 1110 | Ga0495606_0000873 | 3300046507 | Bacteria | 45086 |
| 1111 | Ga0495606_0019756 | 3300046507 | Bacteria | 4993 |
| 1112 | Ga0495606_0037209 | 3300046507 | Bacteria | 3306 |
| 1113 | Ga0495606_0055199 | 3300046507 | Bacteria | 2570 |
| 1114 | Ga0495606_0086059 | 3300046507 | Bacteria | 1943 |
| 1115 | Ga0495608_0001126 | 3300046511 | Bacteria | 18919 |
| 1116 | Ga0495608_0004197 | 3300046511 | Bacteria | 10325 |
| 1117 | Ga0495608_0023176 | 3300046511 | Bacteria | 4256 |
| 1118 | Ga0495610_0000092 | 3300046512 | Bacteria | 105874 |
| 1119 | Ga0495616_0002407 | 3300046513 | Bacteria | 12455 |
| 1120 | Ga0495616_0010237 | 3300046513 | Bacteria | 5437 |
| 1121 | Ga0495628_0016679 | 3300046516 | Bacteria | 6124 |
| 1122 | Ga0495631_0000844 | 3300046518 | Bacteria | 19424 |
| 1123 | Ga0495632_0032470 | 3300046519 | Bacteria | 2689 |
| 1124 | Ga0495643_0016919 | 3300046522 | Bacteria | 4275 |
| 1125 | Ga0495643_0050007 | 3300046522 | Bacteria | 2252 |
| 1126 | Ga0495648_0000717 | 3300046524 | Bacteria | 35307 |
| 1127 | Ga0495652_0041591 | 3300046529 | Bacteria | 3966 |
| 1128 | Ga0495652_0116214 | 3300046529 | Bacteria | 2142 |
| 1129 | Ga0495654_0000010 | 3300046530 | Bacteria | 378481 |
| 1130 | Ga0495665_0037605 | 3300046531 | Bacteria | 2583 |
| 1131 | Ga0495640_0001444 | 3300046533 | Bacteria | 18719 |
| 1132 | Ga0495586_0001370 | 3300046535 | Bacteria | 13538 |
| 1133 | Ga0495587_0000584 | 3300046536 | Bacteria | 25102 |
| 1134 | Ga0495597_0002137 | 3300046542 | Bacteria | 13088 |
| 1135 | Ga0495622_0000692 | 3300046557 | Bacteria | 19112 |
| 1136 | Ga0495633_0007327 | 3300046558 | Bacteria | 6361 |
| 1137 | Ga0495667_0000700 | 3300046559 | Bacteria | 21464 |
| 1138 | Ga0495667_0048969 | 3300046559 | Bacteria | 2790 |
| 1139 | Ga0495667_0053610 | 3300046559 | Bacteria | 2655 |
| 1140 | Ga0495667_0092464 | 3300046559 | Bacteria | 1958 |
| 1141 | Ga0495667_0132831 | 3300046559 | Bacteria | 1605 |
| 1142 | Ga0495656_0013838 | 3300046615 | Bacteria | 3011 |
| 1143 | Ga0495656_0017331 | 3300046615 | Bacteria | 2748 |
| 1144 | Ga0495668_0005568 | 3300046616 | Bacteria | 8474 |
| 1145 | Ga0495634_0043826 | 3300046642 | Bacteria | 3031 |
| 1146 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 1147 | Ga0495625_0000235 | 3300046660 | Bacteria | 86400 |
| 1148 | Ga0495625_0000295 | 3300046660 | Bacteria | 77306 |
| 1149 | Ga0495635_0000040 | 3300046663 | Bacteria | 86519 |
| 1150 | Ga0495657_0001715 | 3300046675 | Bacteria | 18791 |
| 1151 | Ga0495657_0037606 | 3300046675 | Bacteria | 3335 |
| 1152 | Ga0495657_0041833 | 3300046675 | Bacteria | 3133 |
| 1153 | Ga0495599_0000120 | 3300046678 | Bacteria | 53081 |
| 1154 | Ga0495599_0016254 | 3300046678 | Bacteria | 4620 |
| 1155 | Ga0495599_0069268 | 3300046678 | Bacteria | 2202 |
| 1156 | Ga0495623_0006814 | 3300046679 | Bacteria | 7431 |
| 1157 | Ga0495647_0013904 | 3300046681 | Bacteria | 2797 |
| 1158 | Ga0495613_0002186 | 3300046689 | Bacteria | 14811 |
| 1159 | Ga0495613_0028693 | 3300046689 | Bacteria | 4140 |
| 1160 | Ga0495624_0013950 | 3300046690 | Bacteria | 5470 |
| 1161 | Ga0495600_0000074 | 3300046809 | Bacteria | 55182 |
| 1162 | Ga0495600_0004089 | 3300046809 | Bacteria | 8682 |
| 1163 | Ga0495604_0001303 | 3300047317 | Bacteria | 20381 |
| 1164 | Ga0495604_0007337 | 3300047317 | Bacteria | 8732 |
| 1165 | Ga0495604_0101818 | 3300047317 | Bacteria | 2109 |
| 1166 | Ga0495674_0009149 | 3300047319 | Bacteria | 9414 |
| 1167 | Ga0495674_0019982 | 3300047319 | Bacteria | 6208 |
| 1168 | Ga0495672_0003177 | 3300047320 | Bacteria | 14280 |
| 1169 | Ga0495676_0026484 | 3300047321 | Bacteria | 4990 |
| 1170 | Ga0495680_0001054 | 3300047322 | Bacteria | 30518 |
| 1171 | Ga0495680_0022250 | 3300047322 | Bacteria | 5287 |
| 1172 | Ga0495680_0035962 | 3300047322 | Bacteria | 3982 |
| 1173 | Ga0495675_0000382 | 3300047444 | Bacteria | 30557 |
| 1174 | Ga0495675_0024379 | 3300047444 | Bacteria | 3856 |
| 1175 | Ga0495673_0014454 | 3300047469 | Bacteria | 4104 |
| 1176 | Ga0495684_0000134 | 3300047471 | Bacteria | 54180 |
| 1177 | Ga0495686_0000090 | 3300047472 | Bacteria | 193179 |
| 1178 | Ga0495686_0007525 | 3300047472 | Bacteria | 8155 |
| 1179 | Ga0495593_0011569 | 3300047673 | Bacteria | 5063 |
| 1180 | Ga0495602_0002953 | 3300048088 | Bacteria | 17450 |
| 1181 | Ga0496100_0001853 | 3300048903 | Bacteria | 10582 |
| 1182 | Ga0496100_0008025 | 3300048903 | Bacteria | 5866 |
| 1183 | Ga0496100_0025105 | 3300048903 | Bacteria | 3641 |
| 1184 | Ga0496100_0056912 | 3300048903 | Bacteria | 2559 |
| 1185 | Ga0496100_0057940 | 3300048903 | Bacteria | 2540 |
| 1186 | Ga0496101_0010944 | 3300048904 | Bacteria | 6006 |
| 1187 | Ga0496101_0068987 | 3300048904 | Bacteria | 2586 |
| 1188 | Ga0496101_0095470 | 3300048904 | Bacteria | 2218 |
| 1189 | Ga0496101_0199414 | 3300048904 | Bacteria | 1547 |
| 1190 | Ga0496102_0002544 | 3300048905 | Bacteria | 15560 |
| 1191 | Ga0496102_0019661 | 3300048905 | Bacteria | 5951 |
| 1192 | Ga0496102_0030595 | 3300048905 | Bacteria | 4819 |
| 1193 | Ga0496102_0042879 | 3300048905 | Bacteria | 4101 |
| 1194 | Ga0496102_0044851 | 3300048905 | Bacteria | 4012 |
| 1195 | Ga0496102_0050955 | 3300048905 | Bacteria | 3771 |
| 1196 | Ga0496102_0128299 | 3300048905 | Bacteria | 2372 |
| 1197 | Ga0496102_0201107 | 3300048905 | Bacteria | 1878 |
| 1198 | Ga0496103_0024204 | 3300048906 | Bacteria | 3663 |
| 1199 | Ga0496103_0099047 | 3300048906 | Bacteria | 1844 |
| 1200 | Ga0496103_0102244 | 3300048906 | Bacteria | 1815 |
| 1201 | Ga0496104_0000334 | 3300048907 | Bacteria | 42142 |
| 1202 | Ga0496104_0001544 | 3300048907 | Bacteria | 19867 |
| 1203 | Ga0496104_0009904 | 3300048907 | Bacteria | 8509 |
| 1204 | Ga0496104_0012289 | 3300048907 | Bacteria | 7697 |
| 1205 | Ga0496105_0000114 | 3300048908 | Bacteria | 54319 |
| 1206 | Ga0496105_0018449 | 3300048908 | Bacteria | 5608 |
| 1207 | Ga0496105_0038978 | 3300048908 | Bacteria | 3915 |
| 1208 | Ga0496105_0040586 | 3300048908 | Bacteria | 3837 |
| 1209 | Ga0496105_0044334 | 3300048908 | Bacteria | 3668 |
| 1210 | Ga0496105_0090312 | 3300048908 | Bacteria | 2530 |
| 1211 | Ga0496106_0000852 | 3300048909 | Bacteria | 22131 |
| 1212 | Ga0496106_0013667 | 3300048909 | Bacteria | 5994 |
| 1213 | Ga0496106_0025589 | 3300048909 | Bacteria | 4393 |
| 1214 | Ga0496106_0052408 | 3300048909 | Bacteria | 3078 |
| 1215 | Ga0496106_0082060 | 3300048909 | Bacteria | 2477 |
| 1216 | Ga0496107_0000933 | 3300048910 | Bacteria | 17270 |
| 1217 | Ga0496107_0021676 | 3300048910 | Bacteria | 4540 |
| 1218 | Ga0496107_0057794 | 3300048910 | Bacteria | 2804 |
| 1219 | Ga0496108_0009068 | 3300048911 | Bacteria | 8058 |
| 1220 | Ga0496108_0023669 | 3300048911 | Bacteria | 5054 |
| 1221 | Ga0496108_0094016 | 3300048911 | Bacteria | 2551 |
| 1222 | Ga0496109_0025721 | 3300048912 | Bacteria | 5245 |
| 1223 | Ga0496109_0055526 | 3300048912 | Bacteria | 3613 |
| 1224 | Ga0496110_0006909 | 3300048913 | Bacteria | 9026 |
| 1225 | Ga0496110_0008766 | 3300048913 | Bacteria | 8149 |
| 1226 | Ga0496110_0034208 | 3300048913 | Bacteria | 4400 |
| 1227 | Ga0496110_0039373 | 3300048913 | Bacteria | 4115 |
| 1228 | Ga0496110_0160624 | 3300048913 | Bacteria | 2037 |
| 1229 | Ga0496111_0000116 | 3300048914 | Bacteria | 34570 |
| 1230 | Ga0496111_0004674 | 3300048914 | Bacteria | 8678 |
| 1231 | Ga0496111_0014357 | 3300048914 | Bacteria | 5409 |
| 1232 | Ga0496111_0017456 | 3300048914 | Bacteria | 4962 |
| 1233 | Ga0496111_0031131 | 3300048914 | Bacteria | 3799 |
| 1234 | Ga0496111_0089710 | 3300048914 | Bacteria | 2252 |
| 1235 | Ga0496111_0168652 | 3300048914 | Bacteria | 1626 |
| 1236 | Ga0496112_0012770 | 3300048915 | Bacteria | 7729 |
| 1237 | Ga0496112_0089671 | 3300048915 | Bacteria | 3043 |
| 1238 | Ga0496113_0005533 | 3300048916 | Bacteria | 7887 |
| 1239 | Ga0496113_0103365 | 3300048916 | Bacteria | 2210 |
| 1240 | Ga0496114_0000208 | 3300048917 | Bacteria | 42600 |
| 1241 | Ga0496114_0000497 | 3300048917 | Bacteria | 28761 |
| 1242 | Ga0496114_0004155 | 3300048917 | Bacteria | 11201 |
| 1243 | Ga0496114_0013825 | 3300048917 | Bacteria | 6471 |
| 1244 | Ga0496114_0020551 | 3300048917 | Bacteria | 5358 |
| 1245 | Ga0496114_0020869 | 3300048917 | Bacteria | 5320 |
| 1246 | Ga0496114_0024569 | 3300048917 | Bacteria | 4920 |
| 1247 | Ga0496115_0000406 | 3300048918 | Bacteria | 35489 |
| 1248 | Ga0496115_0001480 | 3300048918 | Bacteria | 16879 |
| 1249 | Ga0496115_0025731 | 3300048918 | Bacteria | 4586 |
| 1250 | Ga0496115_0050208 | 3300048918 | Bacteria | 3341 |
| 1251 | Ga0496116_0000600 | 3300048919 | Bacteria | 47814 |
| 1252 | Ga0496117_0007455 | 3300048920 | Bacteria | 10681 |
| 1253 | Ga0496119_0001210 | 3300048922 | Bacteria | 32241 |
| 1254 | Ga0496119_0003780 | 3300048922 | Bacteria | 15490 |
| 1255 | Ga0496120_0017294 | 3300048923 | Bacteria | 4681 |
| 1256 | Ga0496121_0000303 | 3300048924 | Bacteria | 102261 |
| 1257 | Ga0496121_0029495 | 3300048924 | Bacteria | 5071 |
| 1258 | Ga0496121_0057624 | 3300048924 | Bacteria | 3218 |
| 1259 | Ga0496121_0068817 | 3300048924 | Bacteria | 2861 |
| 1260 | Ga0496121_0176326 | 3300048924 | Bacteria | 1547 |
| 1261 | Ga0496122_0003710 | 3300048925 | Bacteria | 19747 |
| 1262 | Ga0496122_0007800 | 3300048925 | Bacteria | 11767 |
| 1263 | Ga0496122_0011264 | 3300048925 | Bacteria | 9085 |
| 1264 | Ga0496122_0037915 | 3300048925 | Bacteria | 3870 |
| 1265 | Ga0496123_0008925 | 3300048926 | Bacteria | 9116 |
| 1266 | Ga0496124_0002789 | 3300048927 | Bacteria | 22161 |
| 1267 | Ga0496124_0038597 | 3300048927 | Bacteria | 4146 |
| 1268 | Ga0496124_0107817 | 3300048927 | Bacteria | 2247 |
| 1269 | Ga0496125_0001159 | 3300048928 | Bacteria | 39918 |
| 1270 | Ga0496125_0013587 | 3300048928 | Bacteria | 7996 |
| 1271 | Ga0496125_0032941 | 3300048928 | Bacteria | 4594 |
| 1272 | Ga0496125_0038602 | 3300048928 | Bacteria | 4129 |
| 1273 | Ga0496125_0047535 | 3300048928 | Bacteria | 3587 |
| 1274 | Ga0496126_0000315 | 3300048929 | Bacteria | 102933 |
| 1275 | Ga0496126_0000480 | 3300048929 | Bacteria | 79257 |
| 1276 | Ga0496126_0009379 | 3300048929 | Bacteria | 10400 |
| 1277 | Ga0496126_0025520 | 3300048929 | Bacteria | 5683 |
| 1278 | Ga0496126_0038634 | 3300048929 | Bacteria | 4438 |
| 1279 | Ga0496126_0038837 | 3300048929 | Bacteria | 4425 |
| 1280 | Ga0495678_013497 | 3300049459 | Bacteria | 3835 |
| 1281 | Ga0501031_0006699 | 3300049568 | Bacteria | 7515 |
| 1282 | Ga0501031_0045163 | 3300049568 | Bacteria | 2874 |
| 1283 | Ga0501031_0068113 | 3300049568 | Bacteria | 2318 |
| 1284 | Ga0501032_0005601 | 3300049569 | Bacteria | 9305 |
| 1285 | Ga0501032_0006523 | 3300049569 | Bacteria | 8572 |
| 1286 | Ga0501032_0022099 | 3300049569 | Bacteria | 4415 |
| 1287 | Ga0501032_0076794 | 3300049569 | Bacteria | 2224 |
| 1288 | Ga0501033_0000025 | 3300049570 | Bacteria | 173634 |
| 1289 | Ga0501033_0004074 | 3300049570 | Bacteria | 11790 |
| 1290 | Ga0501033_0005255 | 3300049570 | Bacteria | 10274 |
| 1291 | Ga0501033_0016641 | 3300049570 | Bacteria | 5562 |
| 1292 | Ga0501033_0028306 | 3300049570 | Bacteria | 4210 |
| 1293 | Ga0501033_0056476 | 3300049570 | Bacteria | 2901 |
| 1294 | Ga0501034_0000656 | 3300049571 | Bacteria | 53197 |
| 1295 | Ga0501034_0001007 | 3300049571 | Bacteria | 40401 |
| 1296 | Ga0501034_0005401 | 3300049571 | Bacteria | 13969 |
| 1297 | Ga0501034_0011724 | 3300049571 | Bacteria | 9068 |
| 1298 | Ga0501034_0027517 | 3300049571 | Bacteria | 5785 |
| 1299 | Ga0501034_0044594 | 3300049571 | Bacteria | 4484 |
| 1300 | Ga0501036_0001771 | 3300049572 | Bacteria | 16761 |
| 1301 | Ga0501036_0002177 | 3300049572 | Bacteria | 15289 |
| 1302 | Ga0501036_0002532 | 3300049572 | Bacteria | 14356 |
| 1303 | Ga0501036_0004395 | 3300049572 | Bacteria | 11377 |
| 1304 | Ga0501036_0023231 | 3300049572 | Bacteria | 5220 |
| 1305 | Ga0501036_0031880 | 3300049572 | Bacteria | 4452 |
| 1306 | Ga0501036_0157786 | 3300049572 | Bacteria | 1913 |
| 1307 | Ga0501037_0000034 | 3300049573 | Bacteria | 126321 |
| 1308 | Ga0501037_0002486 | 3300049573 | Bacteria | 13311 |
| 1309 | Ga0501037_0004111 | 3300049573 | Bacteria | 10551 |
| 1310 | Ga0501037_0009303 | 3300049573 | Bacteria | 7207 |
| 1311 | Ga0501038_0000286 | 3300049574 | Bacteria | 43041 |
| 1312 | Ga0501038_0000494 | 3300049574 | Bacteria | 34711 |
| 1313 | Ga0501038_0009471 | 3300049574 | Bacteria | 8934 |
| 1314 | Ga0501038_0015376 | 3300049574 | Bacteria | 6957 |
| 1315 | Ga0501039_0002404 | 3300049575 | Bacteria | 13918 |
| 1316 | Ga0501039_0003332 | 3300049575 | Bacteria | 12001 |
| 1317 | Ga0501040_0005237 | 3300049576 | Bacteria | 8379 |
| 1318 | Ga0501040_0006452 | 3300049576 | Bacteria | 7618 |
| 1319 | Ga0501041_0046595 | 3300049577 | Bacteria | 2638 |
| 1320 | Ga0501041_0057305 | 3300049577 | Bacteria | 2383 |
| 1321 | Ga0501041_0063804 | 3300049577 | Bacteria | 2256 |
| 1322 | Ga0501042_0010828 | 3300049578 | Bacteria | 6132 |
| 1323 | Ga0501042_0036041 | 3300049578 | Bacteria | 3509 |
| 1324 | Ga0501042_0072607 | 3300049578 | Bacteria | 2462 |
| 1325 | Ga0501043_0001194 | 3300049579 | Bacteria | 22852 |
| 1326 | Ga0501043_0001282 | 3300049579 | Bacteria | 22062 |
| 1327 | Ga0501043_0002005 | 3300049579 | Bacteria | 17378 |
| 1328 | Ga0501043_0008771 | 3300049579 | Bacteria | 7961 |
| 1329 | Ga0501043_0043791 | 3300049579 | Bacteria | 3518 |
| 1330 | Ga0501046_0004377 | 3300049580 | Bacteria | 12838 |
| 1331 | Ga0501046_0004738 | 3300049580 | Bacteria | 12272 |
| 1332 | Ga0501046_0013469 | 3300049580 | Bacteria | 6923 |
| 1333 | Ga0501047_0000061 | 3300049581 | Bacteria | 137341 |
| 1334 | Ga0501047_0000341 | 3300049581 | Bacteria | 53185 |
| 1335 | Ga0501047_0005327 | 3300049581 | Bacteria | 12091 |
| 1336 | Ga0501047_0008793 | 3300049581 | Bacteria | 9527 |
| 1337 | Ga0501047_0010493 | 3300049581 | Bacteria | 8767 |
| 1338 | Ga0501047_0045621 | 3300049581 | Bacteria | 4238 |
| 1339 | Ga0501047_0092569 | 3300049581 | Bacteria | 2901 |
| 1340 | Ga0501048_0000009 | 3300049582 | Bacteria | 84404 |
| 1341 | Ga0501048_0003281 | 3300049582 | Bacteria | 12332 |
| 1342 | Ga0501048_0004373 | 3300049582 | Bacteria | 10757 |
| 1343 | Ga0501048_0016054 | 3300049582 | Bacteria | 5522 |
| 1344 | Ga0501067_0010995 | 3300049583 | Bacteria | 5012 |
| 1345 | Ga0501068_0000288 | 3300049584 | Bacteria | 25058 |
| 1346 | Ga0501068_0000820 | 3300049584 | Bacteria | 16120 |
| 1347 | Ga0501069_0000266 | 3300049585 | Bacteria | 23651 |
| 1348 | Ga0501069_0002228 | 3300049585 | Bacteria | 9772 |
| 1349 | Ga0501069_0002802 | 3300049585 | Bacteria | 8917 |
| 1350 | Ga0501069_0046880 | 3300049585 | Bacteria | 2398 |
| 1351 | Ga0501070_0000245 | 3300049586 | Bacteria | 51075 |
| 1352 | Ga0501070_0003719 | 3300049586 | Bacteria | 13176 |
| 1353 | Ga0501070_0004387 | 3300049586 | Bacteria | 12121 |
| 1354 | Ga0501070_0011450 | 3300049586 | Bacteria | 7494 |
| 1355 | Ga0501070_0061236 | 3300049586 | Bacteria | 3118 |
| 1356 | Ga0501070_0071430 | 3300049586 | Bacteria | 2873 |
| 1357 | Ga0501070_0097520 | 3300049586 | Bacteria | 2431 |
| 1358 | Ga0501070_0126075 | 3300049586 | Bacteria | 2116 |
| 1359 | Ga0501071_0007283 | 3300049587 | Bacteria | 7242 |
| 1360 | Ga0501071_0015105 | 3300049587 | Bacteria | 5295 |
| 1361 | Ga0501071_0042043 | 3300049587 | Bacteria | 3273 |
| 1362 | Ga0501071_0105512 | 3300049587 | Bacteria | 2080 |
| 1363 | Ga0501072_0001729 | 3300049588 | Bacteria | 16275 |
| 1364 | Ga0501072_0008620 | 3300049588 | Bacteria | 7740 |
| 1365 | Ga0501072_0010747 | 3300049588 | Bacteria | 6976 |
| 1366 | Ga0501072_0011452 | 3300049588 | Bacteria | 6780 |
| 1367 | Ga0501072_0013474 | 3300049588 | Bacteria | 6258 |
| 1368 | Ga0501072_0014012 | 3300049588 | Bacteria | 6144 |
| 1369 | Ga0501072_0021437 | 3300049588 | Bacteria | 5010 |
| 1370 | Ga0501072_0028417 | 3300049588 | Bacteria | 4366 |
| 1371 | Ga0501072_0034545 | 3300049588 | Bacteria | 3963 |
| 1372 | Ga0501072_0160021 | 3300049588 | Bacteria | 1796 |
| 1373 | Ga0501073_0001985 | 3300049589 | Bacteria | 15256 |
| 1374 | Ga0501073_0007988 | 3300049589 | Bacteria | 7855 |
| 1375 | Ga0501073_0008527 | 3300049589 | Bacteria | 7599 |
| 1376 | Ga0501073_0017803 | 3300049589 | Bacteria | 5141 |
| 1377 | Ga0501073_0073952 | 3300049589 | Bacteria | 2372 |
| 1378 | Ga0501073_0098755 | 3300049589 | Bacteria | 2027 |
| 1379 | Ga0501074_0000048 | 3300049590 | Bacteria | 56982 |
| 1380 | Ga0501074_0006514 | 3300049590 | Bacteria | 8429 |
| 1381 | Ga0501074_0015861 | 3300049590 | Bacteria | 5479 |
| 1382 | Ga0501074_0020795 | 3300049590 | Bacteria | 4767 |
| 1383 | Ga0501075_0028297 | 3300049591 | Bacteria | 4136 |
| 1384 | Ga0501075_0031307 | 3300049591 | Bacteria | 3948 |
| 1385 | Ga0501075_0065027 | 3300049591 | Bacteria | 2751 |
| 1386 | Ga0501076_0000337 | 3300049592 | Bacteria | 28949 |
| 1387 | Ga0501076_0002331 | 3300049592 | Bacteria | 13011 |
| 1388 | Ga0501076_0027193 | 3300049592 | Bacteria | 4437 |
| 1389 | Ga0501076_0043645 | 3300049592 | Bacteria | 3534 |
| 1390 | Ga0501077_0038694 | 3300049593 | Bacteria | 3038 |
| 1391 | Ga0501077_0067423 | 3300049593 | Bacteria | 2269 |
| 1392 | Ga0501077_0086679 | 3300049593 | Bacteria | 1985 |
| 1393 | Ga0501079_0009609 | 3300049741 | Bacteria | 7334 |
| 1394 | Ga0501079_0025132 | 3300049741 | Bacteria | 4569 |
| 1395 | Ga0501079_0058039 | 3300049741 | Bacteria | 2986 |
| 1396 | Ga0501079_0069819 | 3300049741 | Bacteria | 2712 |
| 1397 | Ga0501079_0071871 | 3300049741 | Bacteria | 2673 |
| 1398 | Ga0501079_0103320 | 3300049741 | Bacteria | 2210 |
| 1399 | Ga0501080_0000342 | 3300049742 | Bacteria | 35816 |
| 1400 | Ga0501080_0000476 | 3300049742 | Bacteria | 31184 |
| 1401 | Ga0501080_0000599 | 3300049742 | Bacteria | 28495 |
| 1402 | Ga0501080_0003302 | 3300049742 | Bacteria | 14255 |
| 1403 | Ga0501080_0080104 | 3300049742 | Bacteria | 3036 |
| 1404 | Ga0501080_0126287 | 3300049742 | Bacteria | 2369 |
| 1405 | Ga0501080_0126781 | 3300049742 | Bacteria | 2364 |
| 1406 | Ga0501081_0001984 | 3300049743 | Bacteria | 12761 |
| 1407 | Ga0501081_0008274 | 3300049743 | Bacteria | 6751 |
| 1408 | Ga0501083_0000765 | 3300049744 | Bacteria | 21045 |
| 1409 | Ga0501083_0002138 | 3300049744 | Bacteria | 13562 |
| 1410 | Ga0501083_0007356 | 3300049744 | Bacteria | 7813 |
| 1411 | Ga0501083_0013613 | 3300049744 | Bacteria | 5686 |
| 1412 | Ga0501083_0042917 | 3300049744 | Bacteria | 3065 |
| 1413 | Ga0501279_001251 | 3300049775 | Bacteria | 3344 |
| 1414 | Ga0501035_0000300 | 3300049822 | Bacteria | 58171 |
| 1415 | Ga0501035_0005485 | 3300049822 | Bacteria | 11985 |
| 1416 | Ga0501035_0012407 | 3300049822 | Bacteria | 7877 |
| 1417 | Ga0501035_0019919 | 3300049822 | Bacteria | 6162 |
| 1418 | Ga0501035_0034003 | 3300049822 | Bacteria | 4633 |
| 1419 | Ga0501035_0048332 | 3300049822 | Bacteria | 3815 |
| 1420 | Ga0501035_0158625 | 3300049822 | Bacteria | 1959 |
| 1421 | Ga0501044_0000028 | 3300049823 | Bacteria | 179203 |
| 1422 | Ga0501044_0002168 | 3300049823 | Bacteria | 22515 |
| 1423 | Ga0501044_0006203 | 3300049823 | Bacteria | 13211 |
| 1424 | Ga0501044_0008979 | 3300049823 | Bacteria | 10929 |
| 1425 | Ga0501044_0027416 | 3300049823 | Bacteria | 6020 |
| 1426 | Ga0501044_0107446 | 3300049823 | Bacteria | 2801 |
| 1427 | Ga0501045_0003147 | 3300049824 | Bacteria | 11286 |
| 1428 | Ga0501045_0008635 | 3300049824 | Bacteria | 7102 |
| 1429 | Ga0501045_0012663 | 3300049824 | Bacteria | 5938 |
| 1430 | Ga0501045_0020968 | 3300049824 | Bacteria | 4672 |
| 1431 | nmdc:mga03683_5726_c1 | 3300050489 | Bacteria | 4216 |
| 1432 | nmdc:mga0yw44_14167_c1 | 3300050492 | Bacteria | 4222 |
| 1433 | nmdc:mga0yw44_4982_c1 | 3300050492 | Bacteria | 6197 |
| 1434 | nmdc:mga0yw44_62166_c1 | 3300050492 | Bacteria | 2293 |
| 1435 | nmdc:mga0yw44_7896_c1 | 3300050492 | Bacteria | 5270 |
| 1436 | nmdc:mga07m45_503_c1 | 3300050496 | Bacteria | 16544 |
| 1437 | nmdc:mga07m45_6605_c2 | 3300050496 | Bacteria | 5691 |
| 1438 | nmdc:mga07m45_7110_c1 | 3300050496 | Bacteria | 5700 |
| 1439 | nmdc:mga05p37_46055_c1 | 3300050507 | Bacteria | 5363 |
| 1440 | nmdc:mga05p37_512_c1 | 3300050507 | Bacteria | 42901 |
| 1441 | nmdc:mga05p37_712_c1 | 3300050507 | Bacteria | 36873 |
| 1442 | nmdc:mga09592_225_c1 | 3300050508 | Bacteria | 40713 |
| 1443 | nmdc:mga09592_29911_c1 | 3300050508 | Bacteria | 4530 |
| 1444 | nmdc:mga09592_30307_c1 | 3300050508 | Bacteria | 4501 |
| 1445 | nmdc:mga09592_496_c1 | 3300050508 | Bacteria | 29603 |
| 1446 | nmdc:mga09592_58871_c1 | 3300050508 | Bacteria | 3248 |
| 1447 | nmdc:mga0qj67_160540_c1 | 3300050509 | Bacteria | 1825 |
| 1448 | nmdc:mga0qj67_61308_c1 | 3300050509 | Bacteria | 2986 |
| 1449 | nmdc:mga0qj67_62958_c1 | 3300050509 | Bacteria | 2949 |
| 1450 | nmdc:mga0qj67_7506_c1 | 3300050509 | Bacteria | 8055 |
| 1451 | nmdc:mga06r32_439_c1 | 3300050510 | Bacteria | 35271 |
| 1452 | nmdc:mga08y16_32621_c1 | 3300050511 | Bacteria | 5474 |
| 1453 | nmdc:mga08y16_34152_c1 | 3300050511 | Bacteria | 5343 |
| 1454 | nmdc:mga08y16_9134_c1 | 3300050511 | Bacteria | 10406 |
| 1455 | nmdc:mga0n895_1108_c1 | 3300050512 | Bacteria | 19675 |
| 1456 | nmdc:mga0n895_1527_c1 | 3300050512 | Bacteria | 17386 |
| 1457 | nmdc:mga0n895_23081_c1 | 3300050512 | Bacteria | 5844 |
| 1458 | nmdc:mga0n895_90066_c1 | 3300050512 | Bacteria | 3069 |
| 1459 | nmdc:mga0rr50_11010_c1 | 3300050513 | Bacteria | 5768 |
| 1460 | nmdc:mga0rr50_14857_c1 | 3300050513 | Bacteria | 5124 |
| 1461 | nmdc:mga0rr50_2902_c1 | 3300050513 | Bacteria | 9778 |
| 1462 | nmdc:mga0rr50_30623_c1 | 3300050513 | Bacteria | 3812 |
| 1463 | nmdc:mga08x19_16842_c1 | 3300050514 | Bacteria | 4464 |
| 1464 | nmdc:mga08x19_19378_c1 | 3300050514 | Bacteria | 4174 |
| 1465 | nmdc:mga08x19_45422_c1 | 3300050514 | Bacteria | 2808 |
| 1466 | nmdc:mga0a205_179401_c1 | 3300050515 | Bacteria | 2012 |
| 1467 | nmdc:mga0a205_2500_c1 | 3300050515 | Bacteria | 16211 |
| 1468 | nmdc:mga0a205_85319_c1 | 3300050515 | Bacteria | 3049 |
| 1469 | nmdc:mga0sz30_33994_c1 | 3300050516 | Bacteria | 2121 |
| 1470 | nmdc:mga0sz30_40789_c1 | 3300050516 | Bacteria | 1951 |
| 1471 | Ga0500635_0000039 | 3300053080 | Bacteria | 93004 |
| 1472 | Ga0500635_0004585 | 3300053080 | Bacteria | 3567 |
| 1473 | Ga0495595_0000064 | 3300053084 | Bacteria | 54079 |
| 1474 | Ga0495595_0011328 | 3300053084 | Bacteria | 3725 |
| 1475 | Ga0495595_0021702 | 3300053084 | Bacteria | 2808 |
| 1476 | Ga0495619_0000995 | 3300053085 | Bacteria | 18591 |
| 1477 | Ga0495619_0021913 | 3300053085 | Bacteria | 4084 |
| 1478 | Ga0495619_0022271 | 3300053085 | Bacteria | 4053 |
| 1479 | Ga0495619_0036626 | 3300053085 | Bacteria | 3195 |
| 1480 | Ga0500578_0000040 | 3300053086 | Bacteria | 133601 |
| 1481 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 1482 | Ga0500651_0001995 | 3300053093 | Bacteria | 10593 |
| 1483 | Ga0500566_0000010 | 3300053094 | Bacteria | 119976 |
| 1484 | Ga0500640_031403 | 3300053095 | Bacteria | 2327 |
| 1485 | Ga0500650_0000121 | 3300053098 | Bacteria | 21143 |
| 1486 | Ga0500554_027261 | 3300053102 | Bacteria | 1650 |
| 1487 | Ga0500556_0000022 | 3300053104 | Bacteria | 174894 |
| 1488 | Ga0500556_0000611 | 3300053104 | Bacteria | 22870 |
| 1489 | Ga0500556_0000961 | 3300053104 | Bacteria | 15444 |
| 1490 | Ga0500557_000002 | 3300053105 | Bacteria | 234207 |
| 1491 | Ga0500571_015394 | 3300053110 | Bacteria | 4274 |
| 1492 | Ga0500572_000031 | 3300053111 | Bacteria | 43489 |
| 1493 | Ga0500593_000387 | 3300053117 | Bacteria | 17529 |
| 1494 | Ga0500593_000627 | 3300053117 | Bacteria | 13548 |
| 1495 | Ga0500595_000914 | 3300053119 | Bacteria | 16816 |
| 1496 | Ga0500608_000321 | 3300053122 | Bacteria | 18349 |
| 1497 | Ga0500608_064059 | 3300053122 | Bacteria | 1754 |
| 1498 | Ga0500642_0000043 | 3300053130 | Bacteria | 84852 |
| 1499 | Ga0500652_000133 | 3300053131 | Bacteria | 27855 |
| 1500 | Ga0500658_0027562 | 3300053134 | Bacteria | 2198 |
| 1501 | Ga0500559_0008850 | 3300053136 | Bacteria | 4384 |
| 1502 | Ga0500568_0003061 | 3300053139 | Bacteria | 9548 |
| 1503 | Ga0500616_0002646 | 3300053153 | Bacteria | 14590 |
| 1504 | Ga0500616_0023420 | 3300053153 | Bacteria | 3440 |
| 1505 | Ga0500622_0001741 | 3300053156 | Bacteria | 16823 |
| 1506 | Ga0500622_0028141 | 3300053156 | Bacteria | 2959 |
| 1507 | Ga0500627_0004513 | 3300053158 | Bacteria | 4488 |
| 1508 | Ga0500639_000084 | 3300053163 | Bacteria | 44199 |
| 1509 | Ga0500645_001733 | 3300053730 | Bacteria | 10579 |
| 1510 | Ga0501084_0000111 | 3300054114 | Bacteria | 61429 |
| 1511 | Ga0501084_0000907 | 3300054114 | Bacteria | 22887 |
| 1512 | Ga0501084_0001128 | 3300054114 | Bacteria | 20843 |
| 1513 | Ga0501084_0007216 | 3300054114 | Bacteria | 9158 |
| 1514 | Ga0501084_0042590 | 3300054114 | Bacteria | 3798 |
| 1515 | Ga0501084_0078522 | 3300054114 | Bacteria | 2767 |
| 1516 | Ga0501084_0089174 | 3300054114 | Bacteria | 2589 |
| 1517 | Ga0501084_0115344 | 3300054114 | Bacteria | 2258 |
| 1518 | Ga0501082_0009535 | 3300060353 | Bacteria | 8354 |
| 1519 | Ga0501082_0021656 | 3300060353 | Bacteria | 5541 |
| 1520 | Ga0501082_0030399 | 3300060353 | Bacteria | 4655 |
| 1521 | Ga0501082_0048022 | 3300060353 | Bacteria | 3679 |
| 1522 | Ga0501082_0093964 | 3300060353 | Bacteria | 2591 |
| 1523 | Ga0501082_0264404 | 3300060353 | Bacteria | 1497 |
| 1524 | Ga0466962_0003462 | 3300061719 | Bacteria | 7525 |
| 1525 | Ga0466962_0017705 | 3300061719 | Bacteria | 3430 |
| 1526 | Ga0530510_0001617 | 3300061734 | Bacteria | 15209 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10021496 | Ga0207662_100214962 | 398 |
| 2 | 3300046559 | Ga0495667_0092464 | Ga0495667_0092464_17_1222 | 399 |
| 3 | 3300049578 | Ga0501042_0072607 | Ga0501042_0072607_38_1318 | 423 |
| 4 | 3300060353 | Ga0501082_0264404 | Ga0501082_0264404_165_1481 | 435 |
| 5 | 3300025915 | Ga0207693_10030540 | Ga0207693_100305405 | 437 |
| 6 | 3300049741 | Ga0501079_0058039 | Ga0501079_0058039_1608_2957 | 446 |
| 7 | 3300046529 | Ga0495652_0116214 | Ga0495652_0116214_12_1442 | 462 |
| 8 | 3300049568 | Ga0501031_0006699 | Ga0501031_0006699_6091_7491 | 464 |
| 9 | 3300048928 | Ga0496125_0032941 | Ga0496125_0032941_2227_3927 | 465 |
| 10 | iso_pu_bacteria | 2551306087 | 2551697836 | 468 |
| 11 | 3300033180 | Ga0307510_10106751 | Ga0307510_101067512 | 470 |
| 12 | 3300039062 | Ga0400483_239666 | Ga0400483_239666_376_1821 | 471 |
| 13 | 3300049578 | Ga0501042_0036041 | Ga0501042_0036041_10_1533 | 472 |
| 14 | iso_pu_bacteria | 2551306090 | 2551721599 | 472 |
| 15 | 3300025986 | Ga0207658_10012781 | Ga0207658_100127812 | 474 |
| 16 | iso_pu_bacteria | 2551306092 | 2551735403 | 474 |
| 17 | 3300046559 | Ga0495667_0132831 | Ga0495667_0132831_50_1477 | 475 |
| 18 | iso_pu_bacteria | 2551306089 | 2551708264 | 475 |
| 19 | 3300049583 | Ga0501067_0010995 | Ga0501067_0010995_1650_3080 | 476 |
| 20 | 3300048909 | Ga0496106_0082060 | Ga0496106_0082060_925_2424 | 479 |
| 21 | 3300045976 | Ga0466967_0035194 | Ga0466967_0035194_1346_2845 | 481 |
| 22 | 3300009147 | Ga0114129_10175477 | Ga0114129_101754772 | 482 |
| 23 | 3300035692 | Ga0373935_0149847 | Ga0373935_0149847_17_1471 | 482 |
| 24 | 3300048904 | Ga0496101_0199414 | Ga0496101_0199414_12_1460 | 482 |
| 25 | 3300048924 | Ga0496121_0176326 | Ga0496121_0176326_41_1489 | 482 |
| 26 | 3300048929 | Ga0496126_0025520 | Ga0496126_0025520_4200_5648 | 482 |
| 27 | 3300049568 | Ga0501031_0068113 | Ga0501031_0068113_36_1484 | 482 |
| 28 | 3300049572 | Ga0501036_0157786 | Ga0501036_0157786_424_1872 | 482 |
| 29 | 3300050492 | nmdc:mga0yw44_4982_c1 | nmdc:mga0yw44_4982_c1_1166_2677 | 484 |
| 30 | 3300046675 | Ga0495657_0041833 | Ga0495657_0041833_106_1605 | 485 |
| 31 | 3300053085 | Ga0495619_0022271 | Ga0495619_0022271_1946_3415 | 487 |
| 32 | 3300005329 | Ga0070683_100002520 | Ga0070683_1000025202 | 488 |
| 33 | 3300005337 | Ga0070682_100010975 | Ga0070682_1000109756 | 488 |
| 34 | 3300005458 | Ga0070681_10042524 | Ga0070681_100425242 | 488 |
| 35 | 3300005535 | Ga0070684_100003247 | Ga0070684_1000032473 | 488 |
| 36 | 3300005614 | Ga0068856_100024791 | Ga0068856_1000247916 | 488 |
| 37 | 3300005985 | Ga0081539_10011542 | Ga0081539_100115423 | 488 |
| 38 | 3300025921 | Ga0207652_10002113 | Ga0207652_1000211310 | 488 |
| 39 | 3300025927 | Ga0207687_10001209 | Ga0207687_100012098 | 488 |
| 40 | 3300025935 | Ga0207709_10055086 | Ga0207709_100550861 | 488 |
| 41 | 3300025944 | Ga0207661_10003557 | Ga0207661_100035572 | 488 |
| 42 | 3300048905 | Ga0496102_0019661 | Ga0496102_0019661_1785_3344 | 488 |
| 43 | 3300048908 | Ga0496105_0018449 | Ga0496105_0018449_3184_4743 | 488 |
| 44 | 3300048911 | Ga0496108_0094016 | Ga0496108_0094016_891_2519 | 488 |
| 45 | 3300048917 | Ga0496114_0000208 | Ga0496114_0000208_8906_10465 | 488 |
| 46 | 3300049571 | Ga0501034_0044594 | Ga0501034_0044594_720_2345 | 488 |
| 47 | 3300049586 | Ga0501070_0004387 | Ga0501070_0004387_3426_5051 | 488 |
| 48 | 3300049588 | Ga0501072_0028417 | Ga0501072_0028417_647_2272 | 488 |
| 49 | 3300049589 | Ga0501073_0073952 | Ga0501073_0073952_204_1829 | 488 |
| 50 | 3300053102 | Ga0500554_027261 | Ga0500554_027261_12_1529 | 488 |
| 51 | 3300060353 | Ga0501082_0030399 | Ga0501082_0030399_2151_3776 | 488 |
| 52 | 3300005471 | Ga0070698_100033831 | Ga0070698_1000338312 | 489 |
| 53 | 3300044683 | Ga0466965_0050337 | Ga0466965_0050337_290_1825 | 489 |
| 54 | 3300044901 | Ga0466960_0042521 | Ga0466960_0042521_471_2006 | 489 |
| 55 | 3300049742 | Ga0501080_0080104 | Ga0501080_0080104_10_1503 | 489 |
| 56 | 3300005327 | Ga0070658_10081232 | Ga0070658_100812323 | 490 |
| 57 | 3300050492 | nmdc:mga0yw44_7896_c1 | nmdc:mga0yw44_7896_c1_1839_3413 | 491 |
| 58 | 3300048905 | Ga0496102_0128299 | Ga0496102_0128299_13_1545 | 492 |
| 59 | 3300049587 | Ga0501071_0015105 | Ga0501071_0015105_1847_3403 | 492 |
| 60 | 3300049592 | Ga0501076_0043645 | Ga0501076_0043645_391_1947 | 492 |
| 61 | 3300005548 | Ga0070665_100004574 | Ga0070665_1000045743 | 493 |
| 62 | iso_pu_bacteria | 2773857762 | 2774395289 | 494 |
| 63 | iso_pu_bacteria | 2808606439 | 2809193872 | 494 |
| 64 | 3300005543 | Ga0070672_100018023 | Ga0070672_1000180232 | 495 |
| 65 | 3300049568 | Ga0501031_0045163 | Ga0501031_0045163_941_2536 | 496 |
| 66 | 3300049582 | Ga0501048_0016054 | Ga0501048_0016054_728_2323 | 496 |
| 67 | 3300049587 | Ga0501071_0007283 | Ga0501071_0007283_2268_3863 | 496 |
| 68 | 3300049592 | Ga0501076_0027193 | Ga0501076_0027193_565_2160 | 496 |
| 69 | 3300049593 | Ga0501077_0038694 | Ga0501077_0038694_1039_2634 | 496 |
| 70 | 3300049742 | Ga0501080_0126287 | Ga0501080_0126287_558_2153 | 496 |
| 71 | 3300054114 | Ga0501084_0007216 | Ga0501084_0007216_4468_6063 | 496 |
| 72 | iso_pu_bacteria | 2643221615 | 2644092159 | 496 |
| 73 | iso_pu_bacteria | 2643221657 | 2644321962 | 496 |
| 74 | 3300005456 | Ga0070678_100004435 | Ga0070678_1000044352 | 497 |
| 75 | 3300005843 | Ga0068860_100000253 | Ga0068860_10000025361 | 497 |
| 76 | 3300006358 | Ga0068871_100011189 | Ga0068871_1000111894 | 497 |
| 77 | 3300026121 | Ga0207683_10000123 | Ga0207683_1000012311 | 497 |
| 78 | 3300028381 | Ga0268264_10000220 | Ga0268264_1000022040 | 497 |
| 79 | 3300047322 | Ga0495680_0035962 | Ga0495680_0035962_1946_3445 | 497 |
| 80 | 3300048907 | Ga0496104_0009904 | Ga0496104_0009904_6950_8494 | 497 |
| 81 | 3300050514 | nmdc:mga08x19_45422_c1 | nmdc:mga08x19_45422_c1_191_1690 | 497 |
| 82 | 3300053084 | Ga0495595_0021702 | Ga0495595_0021702_1214_2713 | 497 |
| 83 | 3300006844 | Ga0075428_100015422 | Ga0075428_1000154222 | 498 |
| 84 | 3300006846 | Ga0075430_100008937 | Ga0075430_1000089372 | 498 |
| 85 | 3300009094 | Ga0111539_10051137 | Ga0111539_100511372 | 498 |
| 86 | 3300027907 | Ga0207428_10056370 | Ga0207428_100563703 | 498 |
| 87 | 3300045049 | Ga0466959_0000394 | Ga0466959_0000394_19037_20539 | 498 |
| 88 | 3300050507 | nmdc:mga05p37_512_c1 | nmdc:mga05p37_512_c1_38788_40401 | 498 |
| 89 | 3300050508 | nmdc:mga09592_225_c1 | nmdc:mga09592_225_c1_8167_9780 | 498 |
| 90 | 3300050509 | nmdc:mga0qj67_7506_c1 | nmdc:mga0qj67_7506_c1_645_2258 | 498 |
| 91 | 3300050510 | nmdc:mga06r32_439_c1 | nmdc:mga06r32_439_c1_28595_30208 | 498 |
| 92 | 3300050511 | nmdc:mga08y16_9134_c1 | nmdc:mga08y16_9134_c1_8723_10336 | 498 |
| 93 | iso_pu_bacteria | 2891968417 | 2891973654 | 498 |
| 94 | 3300005439 | Ga0070711_100070951 | Ga0070711_1000709512 | 499 |
| 95 | 3300005985 | Ga0081539_10002997 | Ga0081539_1000299716 | 499 |
| 96 | 3300047319 | Ga0495674_0019982 | Ga0495674_0019982_1928_3487 | 499 |
| 97 | 3300048903 | Ga0496100_0001853 | Ga0496100_0001853_931_2490 | 499 |
| 98 | 3300048905 | Ga0496102_0002544 | Ga0496102_0002544_6341_7900 | 499 |
| 99 | 3300048907 | Ga0496104_0001544 | Ga0496104_0001544_7140_8699 | 499 |
| 100 | 3300048908 | Ga0496105_0090312 | Ga0496105_0090312_492_2051 | 499 |
| 101 | 3300048910 | Ga0496107_0000933 | Ga0496107_0000933_8219_9778 | 499 |
| 102 | 3300048911 | Ga0496108_0023669 | Ga0496108_0023669_132_1691 | 499 |
| 103 | 3300048913 | Ga0496110_0039373 | Ga0496110_0039373_1398_2957 | 499 |
| 104 | 3300048914 | Ga0496111_0089710 | Ga0496111_0089710_224_1783 | 499 |
| 105 | 3300048914 | Ga0496111_0168652 | Ga0496111_0168652_30_1589 | 499 |
| 106 | 3300048917 | Ga0496114_0004155 | Ga0496114_0004155_1425_2984 | 499 |
| 107 | 3300048917 | Ga0496114_0020869 | Ga0496114_0020869_605_2164 | 499 |
| 108 | 3300048918 | Ga0496115_0000406 | Ga0496115_0000406_16479_18038 | 499 |
| 109 | 3300005937 | Ga0081455_10000525 | Ga0081455_1000052514 | 500 |
| 110 | 3300005981 | Ga0081538_10003883 | Ga0081538_100038834 | 500 |
| 111 | 3300038443 | Ga0395901_0044297 | Ga0395901_0044297_1469_3037 | 500 |
| 112 | 3300046463 | Ga0495653_0116844 | Ga0495653_0116844_42_1595 | 500 |
| 113 | iso_pu_bacteria | 2857481737 | 2857484431 | 500 |
| 114 | 3300039438 | Ga0436360_0965900 | Ga0436360_0965900_174_1736 | 501 |
| 115 | 3300046642 | Ga0495634_0043826 | Ga0495634_0043826_339_1898 | 501 |
| 116 | 3300025294 | Ga0209025_1017124 | Ga0209025_10171242 | 502 |
| 117 | 3300025297 | Ga0209758_1007220 | Ga0209758_10072203 | 502 |
| 118 | 3300025927 | Ga0207687_10037904 | Ga0207687_100379044 | 502 |
| 119 | 3300044901 | Ga0466960_0003202 | Ga0466960_0003202_3666_5186 | 502 |
| 120 | 3300045976 | Ga0466967_0005413 | Ga0466967_0005413_1249_2811 | 502 |
| 121 | 3300048916 | Ga0496113_0103365 | Ga0496113_0103365_163_1725 | 502 |
| 122 | 3300049581 | Ga0501047_0010493 | Ga0501047_0010493_4982_6544 | 502 |
| 123 | 3300049588 | Ga0501072_0021437 | Ga0501072_0021437_2926_4539 | 502 |
| 124 | 3300049741 | Ga0501079_0069819 | Ga0501079_0069819_261_1874 | 502 |
| 125 | 3300060353 | Ga0501082_0048022 | Ga0501082_0048022_1695_3308 | 502 |
| 126 | iso_pu_bacteria | 2811994878 | 2812348617 | 502 |
| 127 | 3300044693 | Ga0466961_0019806 | Ga0466961_0019806_152_1708 | 503 |
| 128 | iso_pu_bacteria | 8016630954 | 8016640612 | 503 |
| 129 | 3300003203 | JGI25406J46586_10013251 | JGI25406J46586_100132512 | 504 |
| 130 | 3300005344 | Ga0070661_100031498 | Ga0070661_1000314982 | 504 |
| 131 | 3300005435 | Ga0070714_100024992 | Ga0070714_1000249923 | 504 |
| 132 | 3300005842 | Ga0068858_100109774 | Ga0068858_1001097742 | 504 |
| 133 | 3300005985 | Ga0081539_10002418 | Ga0081539_1000241826 | 504 |
| 134 | 3300006852 | Ga0075433_10003619 | Ga0075433_100036192 | 504 |
| 135 | 3300006871 | Ga0075434_100002400 | Ga0075434_10000240011 | 504 |
| 136 | 3300006871 | Ga0075434_100096958 | Ga0075434_1000969583 | 504 |
| 137 | 3300006914 | Ga0075436_100004352 | Ga0075436_10000435210 | 504 |
| 138 | 3300007076 | Ga0075435_100000265 | Ga0075435_10000026510 | 504 |
| 139 | 3300007076 | Ga0075435_100014752 | Ga0075435_1000147524 | 504 |
| 140 | 3300021384 | Ga0213876_10036700 | Ga0213876_100367002 | 504 |
| 141 | 3300025936 | Ga0207670_10043643 | Ga0207670_100436433 | 504 |
| 142 | 3300026035 | Ga0207703_10127395 | Ga0207703_101273952 | 504 |
| 143 | 3300039062 | Ga0400483_128917 | Ga0400483_128917_611_2170 | 504 |
| 144 | 3300045976 | Ga0466967_0001288 | Ga0466967_0001288_9180_10700 | 504 |
| 145 | 3300050513 | nmdc:mga0rr50_14857_c1 | nmdc:mga0rr50_14857_c1_3508_5106 | 504 |
| 146 | 3300053104 | Ga0500556_0000961 | Ga0500556_0000961_505_2022 | 504 |
| 147 | iso_pu_bacteria | 2643221641 | 2644231839 | 504 |
| 148 | iso_pu_bacteria | 2739367898 | 2740168789 | 504 |
| 149 | 3300013306 | Ga0163162_10241039 | Ga0163162_102410392 | 505 |
| 150 | 3300026078 | Ga0207702_10000337 | Ga0207702_1000033734 | 505 |
| 151 | 3300031728 | Ga0316578_10033710 | Ga0316578_100337102 | 505 |
| 152 | 3300035398 | Ga0316574_0016862 | Ga0316574_0016862_2346_3929 | 505 |
| 153 | 3300048905 | Ga0496102_0201107 | Ga0496102_0201107_309_1844 | 505 |
| 154 | 3300049572 | Ga0501036_0031880 | Ga0501036_0031880_1842_3380 | 505 |
| 155 | 3300054114 | Ga0501084_0078522 | Ga0501084_0078522_12_1550 | 505 |
| 156 | iso_pu_bacteria | 2643221697 | 2644539309 | 506 |
| 157 | iso_pu_bacteria | 8054609563 | 8054611699 | 506 |
| 158 | 3300005435 | Ga0070714_100049920 | Ga0070714_1000499202 | 507 |
| 159 | 3300005545 | Ga0070695_100010900 | Ga0070695_1000109005 | 507 |
| 160 | 3300025912 | Ga0207707_10002051 | Ga0207707_1000205111 | 507 |
| 161 | 3300025916 | Ga0207663_10101314 | Ga0207663_101013142 | 507 |
| 162 | 3300028800 | Ga0265338_10052193 | Ga0265338_100521932 | 507 |
| 163 | 3300042461 | Ga0439460_0003588 | Ga0439460_0003588_953_2476 | 507 |
| 164 | 3300049588 | Ga0501072_0034545 | Ga0501072_0034545_974_2557 | 507 |
| 165 | 3300049589 | Ga0501073_0098755 | Ga0501073_0098755_352_1935 | 507 |
| 166 | 3300049593 | Ga0501077_0067423 | Ga0501077_0067423_656_2239 | 507 |
| 167 | 3300049744 | Ga0501083_0042917 | Ga0501083_0042917_827_2410 | 507 |
| 168 | 3300050509 | nmdc:mga0qj67_62958_c1 | nmdc:mga0qj67_62958_c1_1185_2708 | 507 |
| 169 | 3300050515 | nmdc:mga0a205_85319_c1 | nmdc:mga0a205_85319_c1_11_1534 | 507 |
| 170 | iso_pu_bacteria | 2643221961 | 2645721569 | 507 |
| 171 | iso_pu_bacteria | 2643221962 | 2645724475 | 507 |
| 172 | iso_pu_bacteria | 2984576629 | 2984577595 | 507 |
| 173 | iso_pu_bacteria | 2990256926 | 2990259753 | 507 |
| 174 | 3300025949 | Ga0207667_10006874 | Ga0207667_1000687411 | 508 |
| 175 | iso_pu_bacteria | 2643221681 | 2644455265 | 508 |
| 176 | 3300010375 | Ga0105239_10001197 | Ga0105239_1000119732 | 509 |
| 177 | 3300048905 | Ga0496102_0042879 | Ga0496102_0042879_1195_2751 | 509 |
| 178 | 3300003761 | Ga0055535_1000308 | Ga0055535_100030840 | 510 |
| 179 | 3300003762 | Ga0055542_1000036 | Ga0055542_10000367 | 510 |
| 180 | 3300025229 | Ga0209147_101035 | Ga0209147_1010357 | 510 |
| 181 | 3300025242 | Ga0209258_100091 | Ga0209258_1000917 | 510 |
| 182 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033477 | 510 |
| 183 | 3300025263 | Ga0209565_1002766 | Ga0209565_10027662 | 510 |
| 184 | 3300025291 | Ga0209675_1012694 | Ga0209675_10126942 | 510 |
| 185 | 3300025294 | Ga0209025_1016423 | Ga0209025_10164232 | 510 |
| 186 | 3300025295 | Ga0209564_1001716 | Ga0209564_10017163 | 510 |
| 187 | 3300025297 | Ga0209758_1011179 | Ga0209758_10111794 | 510 |
| 188 | 3300025299 | Ga0209256_1000065 | Ga0209256_1000065176 | 510 |
| 189 | 3300031852 | Ga0307410_10036376 | Ga0307410_100363761 | 510 |
| 190 | 3300039447 | Ga0436361_0394184 | Ga0436361_0394184_7336_8964 | 510 |
| 191 | iso_pu_bacteria | 2885366525 | 2885372289 | 510 |
| 192 | 3300025292 | Ga0209676_1000931 | Ga0209676_100093126 | 511 |
| 193 | 3300025298 | Ga0209050_1000447 | Ga0209050_100044723 | 511 |
| 194 | 3300025303 | Ga0209051_1001259 | Ga0209051_100125914 | 511 |
| 195 | 3300025304 | Ga0209257_1000417 | Ga0209257_100041726 | 511 |
| 196 | 3300031730 | Ga0307516_10006540 | Ga0307516_100065403 | 511 |
| 197 | 3300044735 | Ga0466968_0001573 | Ga0466968_0001573_2808_4346 | 511 |
| 198 | 3300044901 | Ga0466960_0009154 | Ga0466960_0009154_1555_3093 | 511 |
| 199 | 3300048923 | Ga0496120_0017294 | Ga0496120_0017294_3085_4623 | 511 |
| 200 | 3300048927 | Ga0496124_0107817 | Ga0496124_0107817_608_2149 | 511 |
| 201 | 3300005518 | Ga0070699_100039502 | Ga0070699_1000395023 | 512 |
| 202 | 3300035724 | Ga0373933_0025582 | Ga0373933_0025582_749_2356 | 512 |
| 203 | 3300046678 | Ga0495599_0069268 | Ga0495599_0069268_516_2096 | 512 |
| 204 | 3300048917 | Ga0496114_0020551 | Ga0496114_0020551_2836_4449 | 512 |
| 205 | 3300049586 | Ga0501070_0126075 | Ga0501070_0126075_217_1779 | 512 |
| 206 | iso_pu_bacteria | 2643221542 | 2643733773 | 512 |
| 207 | iso_pu_bacteria | 2643221630 | 2644170354 | 512 |
| 208 | iso_pu_bacteria | 2643221724 | 2644680043 | 512 |
| 209 | iso_pu_bacteria | 2728369380 | 2730229541 | 512 |
| 210 | iso_pu_bacteria | 2747842429 | 2747951793 | 512 |
| 211 | 3300005364 | Ga0070673_100009622 | Ga0070673_1000096223 | 513 |
| 212 | 3300005455 | Ga0070663_100013477 | Ga0070663_1000134772 | 513 |
| 213 | 3300005458 | Ga0070681_10171566 | Ga0070681_101715662 | 513 |
| 214 | 3300005471 | Ga0070698_100041887 | Ga0070698_1000418873 | 513 |
| 215 | 3300005530 | Ga0070679_100038055 | Ga0070679_1000380552 | 513 |
| 216 | 3300005535 | Ga0070684_100106450 | Ga0070684_1001064502 | 513 |
| 217 | 3300025912 | Ga0207707_10114941 | Ga0207707_101149412 | 513 |
| 218 | 3300025921 | Ga0207652_10002264 | Ga0207652_1000226413 | 513 |
| 219 | 3300025944 | Ga0207661_10213964 | Ga0207661_102139641 | 513 |
| 220 | 3300026067 | Ga0207678_10002335 | Ga0207678_100023352 | 513 |
| 221 | 3300049579 | Ga0501043_0008771 | Ga0501043_0008771_3420_4976 | 513 |
| 222 | iso_pu_bacteria | 2643221561 | 2643825117 | 513 |
| 223 | iso_pu_bacteria | 2643221696 | 2644534579 | 513 |
| 224 | 3300005983 | Ga0081540_1006873 | Ga0081540_10068733 | 514 |
| 225 | 3300025302 | Ga0207426_1001977 | Ga0207426_10019773 | 514 |
| 226 | 3300039438 | Ga0436360_0242974 | Ga0436360_0242974_1432_2976 | 514 |
| 227 | 3300045051 | Ga0451576_0145422 | Ga0451576_0145422_637_2223 | 514 |
| 228 | 3300046559 | Ga0495667_0053610 | Ga0495667_0053610_1089_2633 | 514 |
| 229 | 3300047472 | Ga0495686_0007525 | Ga0495686_0007525_6189_7733 | 514 |
| 230 | iso_pu_bacteria | 2773857759 | 2774382791 | 514 |
| 231 | iso_pu_bacteria | 2984592036 | 2984592889 | 514 |
| 232 | 3300046507 | Ga0495606_0055199 | Ga0495606_0055199_969_2555 | 515 |
| 233 | 3300049744 | Ga0501083_0007356 | Ga0501083_0007356_3903_5453 | 515 |
| 234 | 3300006163 | Ga0070715_10007253 | Ga0070715_100072535 | 516 |
| 235 | 3300025915 | Ga0207693_10046133 | Ga0207693_100461332 | 516 |
| 236 | 3300025927 | Ga0207687_10106109 | Ga0207687_101061092 | 516 |
| 237 | 3300032004 | Ga0307414_10021938 | Ga0307414_100219382 | 516 |
| 238 | 3300048906 | Ga0496103_0099047 | Ga0496103_0099047_52_1611 | 516 |
| 239 | 3300048906 | Ga0496103_0102244 | Ga0496103_0102244_85_1644 | 516 |
| 240 | 3300048908 | Ga0496105_0040586 | Ga0496105_0040586_203_1762 | 516 |
| 241 | 3300048910 | Ga0496107_0057794 | Ga0496107_0057794_1070_2629 | 516 |
| 242 | 3300048912 | Ga0496109_0055526 | Ga0496109_0055526_623_2182 | 516 |
| 243 | 3300048914 | Ga0496111_0017456 | Ga0496111_0017456_1352_2911 | 516 |
| 244 | 3300048925 | Ga0496122_0007800 | Ga0496122_0007800_3672_5261 | 516 |
| 245 | 3300005981 | Ga0081538_10015080 | Ga0081538_100150804 | 517 |
| 246 | 3300006871 | Ga0075434_100104246 | Ga0075434_1001042461 | 517 |
| 247 | 3300007076 | Ga0075435_100021661 | Ga0075435_1000216615 | 517 |
| 248 | 3300028577 | Ga0265318_10020381 | Ga0265318_100203813 | 517 |
| 249 | 3300031649 | Ga0307514_10047240 | Ga0307514_100472402 | 517 |
| 250 | 3300035170 | Ga0373943_0038304 | Ga0373943_0038304_434_1993 | 517 |
| 251 | 3300037466 | Ga0395898_0002136 | Ga0395898_0002136_9605_11164 | 517 |
| 252 | 3300037466 | Ga0395898_0061367 | Ga0395898_0061367_1608_3209 | 517 |
| 253 | 3300046477 | Ga0495664_0051708 | Ga0495664_0051708_233_1792 | 517 |
| 254 | 3300046518 | Ga0495631_0000844 | Ga0495631_0000844_16984_18606 | 517 |
| 255 | 3300046675 | Ga0495657_0037606 | Ga0495657_0037606_1293_2861 | 517 |
| 256 | 3300047317 | Ga0495604_0101818 | Ga0495604_0101818_37_1596 | 517 |
| 257 | 3300047319 | Ga0495674_0009149 | Ga0495674_0009149_4248_5807 | 517 |
| 258 | 3300048903 | Ga0496100_0008025 | Ga0496100_0008025_3220_4848 | 517 |
| 259 | 3300048905 | Ga0496102_0050955 | Ga0496102_0050955_778_2406 | 517 |
| 260 | 3300048907 | Ga0496104_0000334 | Ga0496104_0000334_11403_13031 | 517 |
| 261 | 3300048907 | Ga0496104_0012289 | Ga0496104_0012289_2814_4373 | 517 |
| 262 | 3300048908 | Ga0496105_0000114 | Ga0496105_0000114_41775_43403 | 517 |
| 263 | 3300048913 | Ga0496110_0006909 | Ga0496110_0006909_3764_5323 | 517 |
| 264 | 3300048913 | Ga0496110_0008766 | Ga0496110_0008766_339_1967 | 517 |
| 265 | 3300048914 | Ga0496111_0000116 | Ga0496111_0000116_26586_28214 | 517 |
| 266 | 3300048914 | Ga0496111_0031131 | Ga0496111_0031131_677_2236 | 517 |
| 267 | 3300048917 | Ga0496114_0000497 | Ga0496114_0000497_8370_9998 | 517 |
| 268 | 3300049569 | Ga0501032_0022099 | Ga0501032_0022099_646_2205 | 517 |
| 269 | 3300049570 | Ga0501033_0004074 | Ga0501033_0004074_3234_4793 | 517 |
| 270 | 3300049572 | Ga0501036_0002532 | Ga0501036_0002532_3076_4635 | 517 |
| 271 | 3300049573 | Ga0501037_0002486 | Ga0501037_0002486_8604_10163 | 517 |
| 272 | 3300049575 | Ga0501039_0003332 | Ga0501039_0003332_7072_8631 | 517 |
| 273 | 3300049576 | Ga0501040_0005237 | Ga0501040_0005237_3017_4576 | 517 |
| 274 | 3300049578 | Ga0501042_0010828 | Ga0501042_0010828_2897_4456 | 517 |
| 275 | 3300049580 | Ga0501046_0004377 | Ga0501046_0004377_6290_7849 | 517 |
| 276 | 3300049582 | Ga0501048_0003281 | Ga0501048_0003281_6970_8529 | 517 |
| 277 | 3300049584 | Ga0501068_0000820 | Ga0501068_0000820_2949_4508 | 517 |
| 278 | 3300049585 | Ga0501069_0002228 | Ga0501069_0002228_139_1698 | 517 |
| 279 | 3300049586 | Ga0501070_0011450 | Ga0501070_0011450_2914_4473 | 517 |
| 280 | 3300049588 | Ga0501072_0014012 | Ga0501072_0014012_1460_3019 | 517 |
| 281 | 3300049589 | Ga0501073_0001985 | Ga0501073_0001985_12592_14151 | 517 |
| 282 | 3300049590 | Ga0501074_0006514 | Ga0501074_0006514_4550_6109 | 517 |
| 283 | 3300049591 | Ga0501075_0028297 | Ga0501075_0028297_2000_3559 | 517 |
| 284 | 3300049591 | Ga0501075_0031307 | Ga0501075_0031307_2199_3758 | 517 |
| 285 | 3300049742 | Ga0501080_0003302 | Ga0501080_0003302_1609_3168 | 517 |
| 286 | 3300049743 | Ga0501081_0008274 | Ga0501081_0008274_1642_3201 | 517 |
| 287 | 3300049744 | Ga0501083_0013613 | Ga0501083_0013613_3027_4586 | 517 |
| 288 | 3300049822 | Ga0501035_0005485 | Ga0501035_0005485_8751_10310 | 517 |
| 289 | 3300050489 | nmdc:mga03683_5726_c1 | nmdc:mga03683_5726_c1_462_2120 | 517 |
| 290 | 3300050512 | nmdc:mga0n895_23081_c1 | nmdc:mga0n895_23081_c1_185_1744 | 517 |
| 291 | 3300050513 | nmdc:mga0rr50_11010_c1 | nmdc:mga0rr50_11010_c1_4081_5640 | 517 |
| 292 | 3300053085 | Ga0495619_0036626 | Ga0495619_0036626_1025_2584 | 517 |
| 293 | 3300060353 | Ga0501082_0021656 | Ga0501082_0021656_1086_2645 | 517 |
| 294 | iso_pu_bacteria | 2855386786 | 2855390386 | 517 |
| 295 | 3300005335 | Ga0070666_10000934 | Ga0070666_100009342 | 518 |
| 296 | 3300005471 | Ga0070698_100017687 | Ga0070698_1000176872 | 518 |
| 297 | 3300005544 | Ga0070686_100044593 | Ga0070686_1000445933 | 518 |
| 298 | 3300005548 | Ga0070665_100008438 | Ga0070665_1000084382 | 518 |
| 299 | 3300005981 | Ga0081538_10001832 | Ga0081538_1000183218 | 518 |
| 300 | 3300006852 | Ga0075433_10065998 | Ga0075433_100659984 | 518 |
| 301 | 3300006881 | Ga0068865_100014246 | Ga0068865_1000142463 | 518 |
| 302 | 3300009094 | Ga0111539_10000584 | Ga0111539_1000058436 | 518 |
| 303 | 3300009148 | Ga0105243_10006862 | Ga0105243_100068624 | 518 |
| 304 | 3300009176 | Ga0105242_10007348 | Ga0105242_100073486 | 518 |
| 305 | 3300013297 | Ga0157378_10002977 | Ga0157378_100029776 | 518 |
| 306 | 3300014968 | Ga0157379_10005458 | Ga0157379_100054585 | 518 |
| 307 | 3300027695 | Ga0209966_1003206 | Ga0209966_10032063 | 518 |
| 308 | 3300027717 | Ga0209998_10000408 | Ga0209998_100004084 | 518 |
| 309 | 3300027876 | Ga0209974_10001049 | Ga0209974_100010496 | 518 |
| 310 | 3300028379 | Ga0268266_10000190 | Ga0268266_1000019010 | 518 |
| 311 | 3300028379 | Ga0268266_10052019 | Ga0268266_100520192 | 518 |
| 312 | 3300048906 | Ga0496103_0024204 | Ga0496103_0024204_1561_3123 | 518 |
| 313 | 3300048908 | Ga0496105_0044334 | Ga0496105_0044334_287_1894 | 518 |
| 314 | 3300048910 | Ga0496107_0021676 | Ga0496107_0021676_2865_4472 | 518 |
| 315 | 3300048917 | Ga0496114_0024569 | Ga0496114_0024569_1239_2846 | 518 |
| 316 | 3300048919 | Ga0496116_0000600 | Ga0496116_0000600_27535_29097 | 518 |
| 317 | 3300048920 | Ga0496117_0007455 | Ga0496117_0007455_1973_3535 | 518 |
| 318 | 3300048922 | Ga0496119_0003780 | Ga0496119_0003780_9419_10981 | 518 |
| 319 | 3300048924 | Ga0496121_0057624 | Ga0496121_0057624_1359_2921 | 518 |
| 320 | 3300048928 | Ga0496125_0047535 | Ga0496125_0047535_1244_2806 | 518 |
| 321 | 3300048929 | Ga0496126_0009379 | Ga0496126_0009379_5580_7142 | 518 |
| 322 | 3300048929 | Ga0496126_0038634 | Ga0496126_0038634_2472_4034 | 518 |
| 323 | 3300049577 | Ga0501041_0063804 | Ga0501041_0063804_385_1947 | 518 |
| 324 | 3300049585 | Ga0501069_0002802 | Ga0501069_0002802_4044_5606 | 518 |
| 325 | 3300049586 | Ga0501070_0071430 | Ga0501070_0071430_944_2506 | 518 |
| 326 | 3300049587 | Ga0501071_0105512 | Ga0501071_0105512_271_1833 | 518 |
| 327 | 3300049590 | Ga0501074_0020795 | Ga0501074_0020795_428_1990 | 518 |
| 328 | 3300005331 | Ga0070670_100004996 | Ga0070670_10000499611 | 519 |
| 329 | 3300005618 | Ga0068864_100025538 | Ga0068864_1000255385 | 519 |
| 330 | 3300005843 | Ga0068860_100049570 | Ga0068860_1000495702 | 519 |
| 331 | 3300005844 | Ga0068862_100000492 | Ga0068862_10000049232 | 519 |
| 332 | 3300005981 | Ga0081538_10001281 | Ga0081538_1000128127 | 519 |
| 333 | 3300005985 | Ga0081539_10004249 | Ga0081539_1000424910 | 519 |
| 334 | 3300005985 | Ga0081539_10014676 | Ga0081539_100146764 | 519 |
| 335 | 3300009553 | Ga0105249_10006840 | Ga0105249_1000684013 | 519 |
| 336 | 3300025925 | Ga0207650_10014656 | Ga0207650_100146566 | 519 |
| 337 | 3300025961 | Ga0207712_10014233 | Ga0207712_100142336 | 519 |
| 338 | 3300025972 | Ga0207668_10005766 | Ga0207668_100057662 | 519 |
| 339 | 3300026095 | Ga0207676_10013864 | Ga0207676_100138642 | 519 |
| 340 | 3300028380 | Ga0268265_10001435 | Ga0268265_1000143515 | 519 |
| 341 | 3300046660 | Ga0495625_0000032 | Ga0495625_0000032_119262_120824 | 519 |
| 342 | 3300048922 | Ga0496119_0001210 | Ga0496119_0001210_10170_11777 | 519 |
| 343 | 3300005458 | Ga0070681_10150280 | Ga0070681_101502801 | 520 |
| 344 | 3300005548 | Ga0070665_100038984 | Ga0070665_1000389842 | 520 |
| 345 | 3300028379 | Ga0268266_10032638 | Ga0268266_100326381 | 520 |
| 346 | 3300037853 | Ga0436364_1323953 | Ga0436364_1323953_37_1620 | 520 |
| 347 | iso_pu_bacteria | 2738543034 | 2739364180 | 520 |
| 348 | iso_pu_bacteria | 2928115317 | 2928119829 | 520 |
| 349 | 3300005327 | Ga0070658_10001297 | Ga0070658_1000129727 | 521 |
| 350 | 3300005445 | Ga0070708_100035997 | Ga0070708_1000359973 | 521 |
| 351 | 3300005467 | Ga0070706_100000369 | Ga0070706_10000036942 | 521 |
| 352 | 3300005467 | Ga0070706_100024617 | Ga0070706_1000246173 | 521 |
| 353 | 3300005471 | Ga0070698_100013970 | Ga0070698_1000139702 | 521 |
| 354 | 3300005471 | Ga0070698_100048036 | Ga0070698_1000480364 | 521 |
| 355 | 3300005518 | Ga0070699_100022285 | Ga0070699_1000222854 | 521 |
| 356 | 3300005563 | Ga0068855_100037776 | Ga0068855_1000377762 | 521 |
| 357 | 3300006038 | Ga0075365_10005337 | Ga0075365_100053374 | 521 |
| 358 | 3300013104 | Ga0157370_10017083 | Ga0157370_100170833 | 521 |
| 359 | 3300013297 | Ga0157378_10138858 | Ga0157378_101388582 | 521 |
| 360 | 3300025909 | Ga0207705_10000006 | Ga0207705_1000000645 | 521 |
| 361 | 3300025910 | Ga0207684_10000077 | Ga0207684_10000077139 | 521 |
| 362 | 3300025922 | Ga0207646_10016391 | Ga0207646_100163915 | 521 |
| 363 | 3300025949 | Ga0207667_10089052 | Ga0207667_100890522 | 521 |
| 364 | 3300026067 | Ga0207678_10018918 | Ga0207678_100189182 | 521 |
| 365 | 3300031251 | Ga0265327_10000018 | Ga0265327_10000018433 | 521 |
| 366 | 3300037418 | Ga0395900_0241507 | Ga0395900_0241507_38_1621 | 521 |
| 367 | 3300049577 | Ga0501041_0046595 | Ga0501041_0046595_525_2123 | 521 |
| 368 | 3300050516 | nmdc:mga0sz30_40789_c1 | nmdc:mga0sz30_40789_c1_267_1874 | 521 |
| 369 | 3300054114 | Ga0501084_0089174 | Ga0501084_0089174_322_1920 | 521 |
| 370 | 3300005435 | Ga0070714_100038399 | Ga0070714_1000383993 | 522 |
| 371 | 3300009766 | Ga0123342_1008310 | Ga0123342_10083103 | 522 |
| 372 | 3300031616 | Ga0307508_10098651 | Ga0307508_100986513 | 522 |
| 373 | 3300037466 | Ga0395898_0012425 | Ga0395898_0012425_583_2157 | 522 |
| 374 | 3300038443 | Ga0395901_0009034 | Ga0395901_0009034_3850_5424 | 522 |
| 375 | 3300039062 | Ga0400483_041877 | Ga0400483_041877_9175_10743 | 522 |
| 376 | 3300048925 | Ga0496122_0003710 | Ga0496122_0003710_505_2112 | 522 |
| 377 | 3300048926 | Ga0496123_0008925 | Ga0496123_0008925_405_2012 | 522 |
| 378 | iso_pu_bacteria | 2954767861 | 2954769251 | 522 |
| 379 | 3300037418 | Ga0395900_0013503 | Ga0395900_0013503_4099_5742 | 523 |
| 380 | 3300037466 | Ga0395898_0021799 | Ga0395898_0021799_2585_4228 | 523 |
| 381 | 3300038443 | Ga0395901_0040984 | Ga0395901_0040984_2124_3767 | 523 |
| 382 | 3300042437 | Ga0439444_0001693 | Ga0439444_0001693_1228_2799 | 523 |
| 383 | 3300049574 | Ga0501038_0015376 | Ga0501038_0015376_3404_5008 | 523 |
| 384 | iso_pu_bacteria | 2939657138 | 2939658476 | 523 |
| 385 | iso_pu_bacteria | 637000159 | 637078049 | 523 |
| 386 | 3300031995 | Ga0307409_100103549 | Ga0307409_1001035492 | 524 |
| 387 | 3300032002 | Ga0307416_100008902 | Ga0307416_1000089023 | 524 |
| 388 | 3300044842 | Ga0466957_0067691 | Ga0466957_0067691_309_1889 | 524 |
| 389 | 3300045976 | Ga0466967_0039274 | Ga0466967_0039274_51_1631 | 524 |
| 390 | iso_pu_bacteria | 2904541872 | 2904547285 | 524 |
| 391 | iso_pu_bacteria | 2932398195 | 2932400423 | 524 |
| 392 | iso_pu_bacteria | 2977558990 | 2977565778 | 524 |
| 393 | 3300005338 | Ga0068868_100056123 | Ga0068868_1000561232 | 525 |
| 394 | 3300005435 | Ga0070714_100002055 | Ga0070714_10000205512 | 525 |
| 395 | 3300005435 | Ga0070714_100082076 | Ga0070714_1000820763 | 525 |
| 396 | 3300005437 | Ga0070710_10028988 | Ga0070710_100289882 | 525 |
| 397 | 3300005563 | Ga0068855_100000104 | Ga0068855_10000010415 | 525 |
| 398 | 3300013296 | Ga0157374_10072501 | Ga0157374_100725013 | 525 |
| 399 | 3300021377 | Ga0213874_10002184 | Ga0213874_100021843 | 525 |
| 400 | 3300021388 | Ga0213875_10000001 | Ga0213875_100000011006 | 525 |
| 401 | 3300025929 | Ga0207664_10000542 | Ga0207664_1000054229 | 525 |
| 402 | 3300025929 | Ga0207664_10097651 | Ga0207664_100976513 | 525 |
| 403 | 3300025944 | Ga0207661_10046617 | Ga0207661_100466173 | 525 |
| 404 | 3300025949 | Ga0207667_10000058 | Ga0207667_10000058196 | 525 |
| 405 | 3300026078 | Ga0207702_10033148 | Ga0207702_100331483 | 525 |
| 406 | 3300028794 | Ga0307515_10000975 | Ga0307515_1000097510 | 525 |
| 407 | 3300031456 | Ga0307513_10108064 | Ga0307513_101080641 | 525 |
| 408 | 3300031995 | Ga0307409_100082576 | Ga0307409_1000825762 | 525 |
| 409 | 3300037853 | Ga0436364_0273345 | Ga0436364_0273345_1030014_1031597 | 525 |
| 410 | 3300039437 | Ga0436365_0613835 | Ga0436365_0613835_7879_9462 | 525 |
| 411 | 3300039453 | Ga0436362_0933513 | Ga0436362_0933513_2569_4152 | 525 |
| 412 | 3300044694 | Ga0466963_0017627 | Ga0466963_0017627_860_2443 | 525 |
| 413 | 3300044901 | Ga0466960_0014600 | Ga0466960_0014600_1030_2613 | 525 |
| 414 | 3300045836 | Ga0466958_0023126 | Ga0466958_0023126_1151_2734 | 525 |
| 415 | 3300045976 | Ga0466967_0003130 | Ga0466967_0003130_782_2365 | 525 |
| 416 | 3300048904 | Ga0496101_0095470 | Ga0496101_0095470_85_1668 | 525 |
| 417 | 3300048914 | Ga0496111_0004674 | Ga0496111_0004674_883_2466 | 525 |
| 418 | 3300048918 | Ga0496115_0001480 | Ga0496115_0001480_8287_9870 | 525 |
| 419 | 3300049569 | Ga0501032_0005601 | Ga0501032_0005601_1235_2839 | 525 |
| 420 | 3300049569 | Ga0501032_0076794 | Ga0501032_0076794_60_1667 | 525 |
| 421 | 3300049570 | Ga0501033_0000025 | Ga0501033_0000025_48943_50547 | 525 |
| 422 | 3300049571 | Ga0501034_0000656 | Ga0501034_0000656_39918_41522 | 525 |
| 423 | 3300049572 | Ga0501036_0004395 | Ga0501036_0004395_5581_7185 | 525 |
| 424 | 3300049573 | Ga0501037_0000034 | Ga0501037_0000034_76738_78342 | 525 |
| 425 | 3300049574 | Ga0501038_0000286 | Ga0501038_0000286_23082_24686 | 525 |
| 426 | 3300049579 | Ga0501043_0001282 | Ga0501043_0001282_8041_9645 | 525 |
| 427 | 3300049581 | Ga0501047_0000061 | Ga0501047_0000061_23178_24782 | 525 |
| 428 | 3300049582 | Ga0501048_0000009 | Ga0501048_0000009_31600_33204 | 525 |
| 429 | 3300049584 | Ga0501068_0000288 | Ga0501068_0000288_18322_19926 | 525 |
| 430 | 3300049585 | Ga0501069_0000266 | Ga0501069_0000266_8799_10403 | 525 |
| 431 | 3300049586 | Ga0501070_0097520 | Ga0501070_0097520_92_1696 | 525 |
| 432 | 3300049588 | Ga0501072_0001729 | Ga0501072_0001729_6696_8300 | 525 |
| 433 | 3300049590 | Ga0501074_0000048 | Ga0501074_0000048_12417_14021 | 525 |
| 434 | 3300049741 | Ga0501079_0009609 | Ga0501079_0009609_2203_3807 | 525 |
| 435 | 3300049742 | Ga0501080_0000342 | Ga0501080_0000342_4495_6099 | 525 |
| 436 | 3300049744 | Ga0501083_0000765 | Ga0501083_0000765_9953_11557 | 525 |
| 437 | 3300049822 | Ga0501035_0000300 | Ga0501035_0000300_39189_40793 | 525 |
| 438 | 3300049823 | Ga0501044_0000028 | Ga0501044_0000028_51419_53023 | 525 |
| 439 | 3300054114 | Ga0501084_0001128 | Ga0501084_0001128_9075_10679 | 525 |
| 440 | iso_pu_bacteria | 2551306086 | 2551692458 | 525 |
| 441 | iso_pu_bacteria | 2738543013 | 2739249738 | 525 |
| 442 | iso_pu_bacteria | 2885192300 | 2885193240 | 525 |
| 443 | 3300005366 | Ga0070659_100049370 | Ga0070659_1000493702 | 526 |
| 444 | 3300006844 | Ga0075428_100029340 | Ga0075428_1000293404 | 526 |
| 445 | 3300006847 | Ga0075431_100163836 | Ga0075431_1001638362 | 526 |
| 446 | 3300009093 | Ga0105240_10202053 | Ga0105240_102020532 | 526 |
| 447 | 3300011119 | Ga0105246_10045437 | Ga0105246_100454372 | 526 |
| 448 | 3300025913 | Ga0207695_10143712 | Ga0207695_101437122 | 526 |
| 449 | 3300027682 | Ga0209971_1001823 | Ga0209971_10018233 | 526 |
| 450 | 3300031456 | Ga0307513_10000072 | Ga0307513_1000007248 | 526 |
| 451 | 3300035118 | Ga0373954_0000028 | Ga0373954_0000028_42869_44449 | 526 |
| 452 | 3300035172 | Ga0373955_0009467 | Ga0373955_0009467_1805_3385 | 526 |
| 453 | 3300036401 | Ga0373937_0001199 | Ga0373937_0001199_5769_7349 | 526 |
| 454 | 3300036401 | Ga0373937_0143850 | Ga0373937_0143850_589_2169 | 526 |
| 455 | 3300042461 | Ga0439460_0000526 | Ga0439460_0000526_4182_5762 | 526 |
| 456 | 3300046513 | Ga0495616_0010237 | Ga0495616_0010237_494_2104 | 526 |
| 457 | 3300049588 | Ga0501072_0011452 | Ga0501072_0011452_2121_3710 | 526 |
| 458 | 3300049592 | Ga0501076_0002331 | Ga0501076_0002331_3696_5276 | 526 |
| 459 | 3300049741 | Ga0501079_0025132 | Ga0501079_0025132_2919_4499 | 526 |
| 460 | 3300049743 | Ga0501081_0001984 | Ga0501081_0001984_4502_6082 | 526 |
| 461 | 3300049824 | Ga0501045_0012663 | Ga0501045_0012663_4267_5847 | 526 |
| 462 | 3300053104 | Ga0500556_0000022 | Ga0500556_0000022_162697_164304 | 526 |
| 463 | iso_pu_bacteria | 2585428106 | 2587919410 | 526 |
| 464 | iso_pu_bacteria | 2599185236 | 2599718348 | 526 |
| 465 | iso_pu_bacteria | 2643221574 | 2643884684 | 526 |
| 466 | iso_pu_bacteria | 2643221628 | 2644163992 | 526 |
| 467 | iso_pu_bacteria | 2643221640 | 2644225239 | 526 |
| 468 | iso_pu_bacteria | 2643221642 | 2644232547 | 526 |
| 469 | iso_pu_bacteria | 2643221683 | 2644466598 | 526 |
| 470 | iso_pu_bacteria | 2643221699 | 2644547938 | 526 |
| 471 | iso_pu_bacteria | 2738541277 | 2738721596 | 526 |
| 472 | iso_pu_bacteria | 2738541293 | 2738799638 | 526 |
| 473 | iso_pu_bacteria | 2738541307 | 2738880922 | 526 |
| 474 | iso_pu_bacteria | 2738543019 | 2739281265 | 526 |
| 475 | iso_pu_bacteria | 2791355048 | 2792461100 | 526 |
| 476 | iso_pu_bacteria | 2818991446 | 2819601398 | 526 |
| 477 | iso_pu_bacteria | 2831265667 | 2831272348 | 526 |
| 478 | iso_pu_bacteria | 2838054893 | 2838059506 | 526 |
| 479 | iso_pu_bacteria | 2838736955 | 2838740295 | 526 |
| 480 | iso_pu_bacteria | 2841840854 | 2841843580 | 526 |
| 481 | iso_pu_bacteria | 2842140634 | 2842143300 | 526 |
| 482 | iso_pu_bacteria | 2843744320 | 2843749385 | 526 |
| 483 | iso_pu_bacteria | 2849560528 | 2849562640 | 526 |
| 484 | iso_pu_bacteria | 2849573788 | 2849576969 | 526 |
| 485 | iso_pu_bacteria | 2851153111 | 2851156064 | 526 |
| 486 | iso_pu_bacteria | 2857504554 | 2857504629 | 526 |
| 487 | iso_pu_bacteria | 2857531043 | 2857535526 | 526 |
| 488 | iso_pu_bacteria | 2884960567 | 2884960733 | 526 |
| 489 | iso_pu_bacteria | 2898329390 | 2898333975 | 526 |
| 490 | iso_pu_bacteria | 2899924645 | 2899931061 | 526 |
| 491 | iso_pu_bacteria | 2904449895 | 2904452812 | 526 |
| 492 | iso_pu_bacteria | 2904456579 | 2904460159 | 526 |
| 493 | iso_pu_bacteria | 2928037797 | 2928040707 | 526 |
| 494 | iso_pu_bacteria | 2928044640 | 2928047549 | 526 |
| 495 | iso_pu_bacteria | 2928051484 | 2928055326 | 526 |
| 496 | iso_pu_bacteria | 2928064002 | 2928069427 | 526 |
| 497 | iso_pu_bacteria | 2928084124 | 2928089560 | 526 |
| 498 | iso_pu_bacteria | 2928531327 | 2928534368 | 526 |
| 499 | 3300005444 | Ga0070694_100097834 | Ga0070694_1000978342 | 527 |
| 500 | 3300025909 | Ga0207705_10058069 | Ga0207705_100580692 | 527 |
| 501 | 3300028794 | Ga0307515_10011471 | Ga0307515_100114714 | 527 |
| 502 | 3300035083 | Ga0373926_0001668 | Ga0373926_0001668_3535_5118 | 527 |
| 503 | 3300035170 | Ga0373943_0018742 | Ga0373943_0018742_389_1972 | 527 |
| 504 | 3300035171 | Ga0373946_0002476 | Ga0373946_0002476_631_2214 | 527 |
| 505 | 3300035692 | Ga0373935_0007344 | Ga0373935_0007344_3174_4757 | 527 |
| 506 | 3300035695 | Ga0373927_0012450 | Ga0373927_0012450_333_1916 | 527 |
| 507 | 3300035725 | Ga0373947_0015581 | Ga0373947_0015581_698_2281 | 527 |
| 508 | 3300037068 | Ga0373925_0089666 | Ga0373925_0089666_539_2122 | 527 |
| 509 | 3300046475 | Ga0495639_0037330 | Ga0495639_0037330_88_1671 | 527 |
| 510 | 3300046531 | Ga0495665_0037605 | Ga0495665_0037605_735_2318 | 527 |
| 511 | 3300046681 | Ga0495647_0013904 | Ga0495647_0013904_916_2499 | 527 |
| 512 | 3300050509 | nmdc:mga0qj67_160540_c1 | nmdc:mga0qj67_160540_c1_101_1684 | 527 |
| 513 | iso_pu_bacteria | 2513020051 | 2513226466 | 527 |
| 514 | iso_pu_bacteria | 2643221658 | 2644326732 | 527 |
| 515 | iso_pu_bacteria | 2643221672 | 2644400006 | 527 |
| 516 | iso_pu_bacteria | 2842677519 | 2842678589 | 527 |
| 517 | iso_pu_bacteria | 2842747753 | 2842752334 | 527 |
| 518 | iso_pu_bacteria | 2904479285 | 2904479433 | 527 |
| 519 | iso_pu_bacteria | 2919462493 | 2919463570 | 527 |
| 520 | iso_pu_bacteria | 2929160207 | 2929165798 | 527 |
| 521 | iso_pu_bacteria | 2945909444 | 2945909516 | 527 |
| 522 | iso_pu_bacteria | 2945945610 | 2945945668 | 527 |
| 523 | 3300005293 | Ga0065715_10144125 | Ga0065715_101441251 | 528 |
| 524 | 3300005330 | Ga0070690_100005241 | Ga0070690_1000052411 | 528 |
| 525 | 3300005334 | Ga0068869_100035862 | Ga0068869_1000358621 | 528 |
| 526 | 3300005335 | Ga0070666_10019991 | Ga0070666_100199914 | 528 |
| 527 | 3300005343 | Ga0070687_100001183 | Ga0070687_1000011837 | 528 |
| 528 | 3300005354 | Ga0070675_100000783 | Ga0070675_1000007835 | 528 |
| 529 | 3300005355 | Ga0070671_100106772 | Ga0070671_1001067721 | 528 |
| 530 | 3300005365 | Ga0070688_100050598 | Ga0070688_1000505982 | 528 |
| 531 | 3300005367 | Ga0070667_100055714 | Ga0070667_1000557144 | 528 |
| 532 | 3300005438 | Ga0070701_10013032 | Ga0070701_100130324 | 528 |
| 533 | 3300005440 | Ga0070705_100055992 | Ga0070705_1000559922 | 528 |
| 534 | 3300005459 | Ga0068867_100005090 | Ga0068867_1000050907 | 528 |
| 535 | 3300005518 | Ga0070699_100061063 | Ga0070699_1000610633 | 528 |
| 536 | 3300005536 | Ga0070697_100006226 | Ga0070697_1000062267 | 528 |
| 537 | 3300005544 | Ga0070686_100061849 | Ga0070686_1000618492 | 528 |
| 538 | 3300005545 | Ga0070695_100015945 | Ga0070695_1000159452 | 528 |
| 539 | 3300005546 | Ga0070696_100012095 | Ga0070696_1000120956 | 528 |
| 540 | 3300005563 | Ga0068855_100022771 | Ga0068855_1000227714 | 528 |
| 541 | 3300005564 | Ga0070664_100000712 | Ga0070664_1000007122 | 528 |
| 542 | 3300005615 | Ga0070702_100000150 | Ga0070702_10000015015 | 528 |
| 543 | 3300005618 | Ga0068864_100017222 | Ga0068864_1000172224 | 528 |
| 544 | 3300005718 | Ga0068866_10006202 | Ga0068866_100062025 | 528 |
| 545 | 3300005841 | Ga0068863_100002456 | Ga0068863_10000245613 | 528 |
| 546 | 3300005843 | Ga0068860_100031234 | Ga0068860_1000312345 | 528 |
| 547 | 3300005843 | Ga0068860_100226450 | Ga0068860_1002264502 | 528 |
| 548 | 3300005844 | Ga0068862_100026901 | Ga0068862_1000269013 | 528 |
| 549 | 3300005985 | Ga0081539_10000917 | Ga0081539_1000091722 | 528 |
| 550 | 3300006237 | Ga0097621_100015779 | Ga0097621_1000157792 | 528 |
| 551 | 3300006358 | Ga0068871_100007963 | Ga0068871_1000079634 | 528 |
| 552 | 3300006844 | Ga0075428_100002475 | Ga0075428_10000247518 | 528 |
| 553 | 3300006846 | Ga0075430_100067230 | Ga0075430_1000672302 | 528 |
| 554 | 3300006847 | Ga0075431_100017790 | Ga0075431_1000177905 | 528 |
| 555 | 3300006871 | Ga0075434_100000003 | Ga0075434_100000003128 | 528 |
| 556 | 3300006914 | Ga0075436_100012300 | Ga0075436_1000123004 | 528 |
| 557 | 3300007076 | Ga0075435_100006583 | Ga0075435_1000065834 | 528 |
| 558 | 3300007076 | Ga0075435_100012648 | Ga0075435_1000126483 | 528 |
| 559 | 3300009093 | Ga0105240_10002741 | Ga0105240_1000274113 | 528 |
| 560 | 3300009094 | Ga0111539_10040746 | Ga0111539_100407463 | 528 |
| 561 | 3300009098 | Ga0105245_10007925 | Ga0105245_100079255 | 528 |
| 562 | 3300009147 | Ga0114129_10005124 | Ga0114129_100051246 | 528 |
| 563 | 3300009174 | Ga0105241_10018460 | Ga0105241_100184604 | 528 |
| 564 | 3300009177 | Ga0105248_10003925 | Ga0105248_1000392510 | 528 |
| 565 | 3300014325 | Ga0163163_10009795 | Ga0163163_100097953 | 528 |
| 566 | 3300014745 | Ga0157377_10009663 | Ga0157377_100096632 | 528 |
| 567 | 3300015683 | Ga0183362_10012 | Ga0183362_1001244 | 528 |
| 568 | 3300025294 | Ga0209025_1000694 | Ga0209025_100069427 | 528 |
| 569 | 3300025903 | Ga0207680_10059878 | Ga0207680_100598783 | 528 |
| 570 | 3300025908 | Ga0207643_10042854 | Ga0207643_100428542 | 528 |
| 571 | 3300025913 | Ga0207695_10005557 | Ga0207695_100055576 | 528 |
| 572 | 3300025918 | Ga0207662_10000110 | Ga0207662_1000011036 | 528 |
| 573 | 3300025922 | Ga0207646_10031703 | Ga0207646_100317033 | 528 |
| 574 | 3300025929 | Ga0207664_10104572 | Ga0207664_101045722 | 528 |
| 575 | 3300025935 | Ga0207709_10003963 | Ga0207709_100039636 | 528 |
| 576 | 3300025942 | Ga0207689_10009885 | Ga0207689_100098854 | 528 |
| 577 | 3300025945 | Ga0207679_10029885 | Ga0207679_100298852 | 528 |
| 578 | 3300025949 | Ga0207667_10003202 | Ga0207667_100032029 | 528 |
| 579 | 3300025949 | Ga0207667_10044504 | Ga0207667_100445045 | 528 |
| 580 | 3300026089 | Ga0207648_10029600 | Ga0207648_100296002 | 528 |
| 581 | 3300026095 | Ga0207676_10010708 | Ga0207676_100107086 | 528 |
| 582 | 3300026118 | Ga0207675_100004715 | Ga0207675_1000047159 | 528 |
| 583 | 3300027462 | Ga0210000_1000314 | Ga0210000_10003142 | 528 |
| 584 | 3300027471 | Ga0209995_1001170 | Ga0209995_10011702 | 528 |
| 585 | 3300027543 | Ga0209999_1000071 | Ga0209999_10000713 | 528 |
| 586 | 3300028380 | Ga0268265_10002340 | Ga0268265_100023405 | 528 |
| 587 | 3300028381 | Ga0268264_10143573 | Ga0268264_101435732 | 528 |
| 588 | 3300031251 | Ga0265327_10000733 | Ga0265327_100007339 | 528 |
| 589 | 3300031727 | Ga0316576_10044334 | Ga0316576_100443343 | 528 |
| 590 | 3300031731 | Ga0307405_10024174 | Ga0307405_100241743 | 528 |
| 591 | 3300031824 | Ga0307413_10038493 | Ga0307413_100384931 | 528 |
| 592 | 3300031911 | Ga0307412_10025093 | Ga0307412_100250933 | 528 |
| 593 | 3300032002 | Ga0307416_100191736 | Ga0307416_1001917362 | 528 |
| 594 | 3300032133 | Ga0316583_10004774 | Ga0316583_100047744 | 528 |
| 595 | 3300032139 | Ga0316580_10002722 | Ga0316580_100027223 | 528 |
| 596 | 3300035207 | Ga0373942_0001178 | Ga0373942_0001178_4700_6286 | 528 |
| 597 | 3300035691 | Ga0373931_0001811 | Ga0373931_0001811_6130_7716 | 528 |
| 598 | 3300035724 | Ga0373933_0034721 | Ga0373933_0034721_142_1728 | 528 |
| 599 | 3300036401 | Ga0373937_0045869 | Ga0373937_0045869_1959_3545 | 528 |
| 600 | 3300041413 | Ga0439465_0002181 | Ga0439465_0002181_3889_5499 | 528 |
| 601 | 3300042007 | Ga0439449_0000741 | Ga0439449_0000741_2414_4024 | 528 |
| 602 | 3300042007 | Ga0439449_0018901 | Ga0439449_0018901_605_2227 | 528 |
| 603 | 3300042015 | Ga0439462_0000613 | Ga0439462_0000613_2775_4385 | 528 |
| 604 | 3300042435 | Ga0439434_0003053 | Ga0439434_0003053_2228_3838 | 528 |
| 605 | 3300044735 | Ga0466968_0006458 | Ga0466968_0006458_1496_3085 | 528 |
| 606 | 3300045051 | Ga0451576_0009574 | Ga0451576_0009574_1620_3206 | 528 |
| 607 | 3300045051 | Ga0451576_0026461 | Ga0451576_0026461_2043_3629 | 528 |
| 608 | 3300046454 | Ga0495592_0002487 | Ga0495592_0002487_2942_4528 | 528 |
| 609 | 3300046476 | Ga0495662_0008407 | Ga0495662_0008407_2974_4560 | 528 |
| 610 | 3300046511 | Ga0495608_0004197 | Ga0495608_0004197_1109_2695 | 528 |
| 611 | 3300046516 | Ga0495628_0016679 | Ga0495628_0016679_1857_3443 | 528 |
| 612 | 3300046533 | Ga0495640_0001444 | Ga0495640_0001444_9788_11374 | 528 |
| 613 | 3300046535 | Ga0495586_0001370 | Ga0495586_0001370_3867_5453 | 528 |
| 614 | 3300046559 | Ga0495667_0048969 | Ga0495667_0048969_139_1740 | 528 |
| 615 | 3300046615 | Ga0495656_0013838 | Ga0495656_0013838_114_1700 | 528 |
| 616 | 3300046689 | Ga0495613_0002186 | Ga0495613_0002186_5497_7083 | 528 |
| 617 | 3300046690 | Ga0495624_0013950 | Ga0495624_0013950_1280_2866 | 528 |
| 618 | 3300046809 | Ga0495600_0004089 | Ga0495600_0004089_6879_8465 | 528 |
| 619 | 3300047317 | Ga0495604_0007337 | Ga0495604_0007337_5953_7539 | 528 |
| 620 | 3300047322 | Ga0495680_0022250 | Ga0495680_0022250_1623_3209 | 528 |
| 621 | 3300048903 | Ga0496100_0056912 | Ga0496100_0056912_553_2163 | 528 |
| 622 | 3300048904 | Ga0496101_0010944 | Ga0496101_0010944_2256_3866 | 528 |
| 623 | 3300048905 | Ga0496102_0030595 | Ga0496102_0030595_1165_2775 | 528 |
| 624 | 3300048913 | Ga0496110_0160624 | Ga0496110_0160624_271_1875 | 528 |
| 625 | 3300049587 | Ga0501071_0042043 | Ga0501071_0042043_785_2371 | 528 |
| 626 | 3300049588 | Ga0501072_0010747 | Ga0501072_0010747_874_2460 | 528 |
| 627 | 3300049589 | Ga0501073_0008527 | Ga0501073_0008527_2103_3710 | 528 |
| 628 | 3300049591 | Ga0501075_0065027 | Ga0501075_0065027_425_2011 | 528 |
| 629 | 3300049741 | Ga0501079_0071871 | Ga0501079_0071871_33_1619 | 528 |
| 630 | 3300049742 | Ga0501080_0000599 | Ga0501080_0000599_19602_21188 | 528 |
| 631 | 3300050507 | nmdc:mga05p37_712_c1 | nmdc:mga05p37_712_c1_12196_13782 | 528 |
| 632 | 3300050508 | nmdc:mga09592_496_c1 | nmdc:mga09592_496_c1_11374_12960 | 528 |
| 633 | 3300050509 | nmdc:mga0qj67_61308_c1 | nmdc:mga0qj67_61308_c1_1043_2674 | 528 |
| 634 | 3300050511 | nmdc:mga08y16_32621_c1 | nmdc:mga08y16_32621_c1_2978_4564 | 528 |
| 635 | 3300050511 | nmdc:mga08y16_34152_c1 | nmdc:mga08y16_34152_c1_2130_3716 | 528 |
| 636 | 3300050512 | nmdc:mga0n895_1108_c1 | nmdc:mga0n895_1108_c1_5674_7260 | 528 |
| 637 | 3300050512 | nmdc:mga0n895_1527_c1 | nmdc:mga0n895_1527_c1_15144_16730 | 528 |
| 638 | 3300050513 | nmdc:mga0rr50_2902_c1 | nmdc:mga0rr50_2902_c1_6865_8451 | 528 |
| 639 | 3300050513 | nmdc:mga0rr50_30623_c1 | nmdc:mga0rr50_30623_c1_657_2243 | 528 |
| 640 | 3300050514 | nmdc:mga08x19_16842_c1 | nmdc:mga08x19_16842_c1_61_1647 | 528 |
| 641 | 3300050514 | nmdc:mga08x19_19378_c1 | nmdc:mga08x19_19378_c1_2193_3779 | 528 |
| 642 | 3300050515 | nmdc:mga0a205_2500_c1 | nmdc:mga0a205_2500_c1_9929_11515 | 528 |
| 643 | 3300054114 | Ga0501084_0000111 | Ga0501084_0000111_38588_40195 | 528 |
| 644 | 3300054114 | Ga0501084_0042590 | Ga0501084_0042590_547_2133 | 528 |
| 645 | 3300060353 | Ga0501082_0093964 | Ga0501082_0093964_360_1946 | 528 |
| 646 | iso_pu_bacteria | 2524023207 | 2524449568 | 528 |
| 647 | iso_pu_bacteria | 2846037992 | 2846038813 | 528 |
| 648 | iso_pu_bacteria | 2883577096 | 2883577799 | 528 |
| 649 | iso_pu_bacteria | 2929520902 | 2929525788 | 528 |
| 650 | iso_pu_bacteria | 2945972063 | 2945975306 | 528 |
| 651 | iso_pu_bacteria | 2945984333 | 2945988502 | 528 |
| 652 | 3300005471 | Ga0070698_100053959 | Ga0070698_1000539592 | 529 |
| 653 | 3300006844 | Ga0075428_100003558 | Ga0075428_10000355812 | 529 |
| 654 | 3300006852 | Ga0075433_10025485 | Ga0075433_100254852 | 529 |
| 655 | 3300006880 | Ga0075429_100040012 | Ga0075429_1000400122 | 529 |
| 656 | 3300009545 | Ga0105237_10102216 | Ga0105237_101022161 | 529 |
| 657 | 3300015683 | Ga0183362_10018 | Ga0183362_100183 | 529 |
| 658 | 3300020069 | Ga0197907_11229304 | Ga0197907_112293041 | 529 |
| 659 | 3300020077 | Ga0206351_10150708 | Ga0206351_101507081 | 529 |
| 660 | 3300022467 | Ga0224712_10025821 | Ga0224712_100258211 | 529 |
| 661 | 3300031456 | Ga0307513_10069763 | Ga0307513_100697632 | 529 |
| 662 | 3300037853 | Ga0436364_0461129 | Ga0436364_0461129_149_1774 | 529 |
| 663 | 3300044712 | Ga0453684_0033889 | Ga0453684_0033889_1790_3412 | 529 |
| 664 | 3300045051 | Ga0451576_0031011 | Ga0451576_0031011_3882_5504 | 529 |
| 665 | 3300046689 | Ga0495613_0028693 | Ga0495613_0028693_752_2344 | 529 |
| 666 | 3300050508 | nmdc:mga09592_29911_c1 | nmdc:mga09592_29911_c1_658_2262 | 529 |
| 667 | 3300050508 | nmdc:mga09592_58871_c1 | nmdc:mga09592_58871_c1_1575_3221 | 529 |
| 668 | iso_pu_bacteria | 2643221575 | 2643885644 | 529 |
| 669 | iso_pu_bacteria | 2643221597 | 2643995927 | 529 |
| 670 | iso_pu_bacteria | 2773857763 | 2774399728 | 529 |
| 671 | iso_pu_bacteria | 2808606447 | 2809227246 | 529 |
| 672 | iso_pu_bacteria | 2852632344 | 2852633373 | 529 |
| 673 | iso_pu_bacteria | 2857479173 | 2857481286 | 529 |
| 674 | iso_pu_bacteria | 2857632687 | 2857634718 | 529 |
| 675 | iso_pu_bacteria | 2870628048 | 2870630172 | 529 |
| 676 | iso_pu_bacteria | 2870801768 | 2870802977 | 529 |
| 677 | iso_pu_bacteria | 2870804320 | 2870805042 | 529 |
| 678 | iso_pu_bacteria | 8004212874 | 8004214125 | 529 |
| 679 | 3300002739 | JGI25158J39367_1002906 | JGI25158J39367_10029062 | 530 |
| 680 | 3300002987 | JGI25159J45721_1008005 | JGI25159J45721_10080052 | 530 |
| 681 | 3300003354 | JGI25160J50197_1013618 | JGI25160J50197_10136183 | 530 |
| 682 | 3300003374 | JGI25161J50226_1003303 | JGI25161J50226_10033033 | 530 |
| 683 | 3300003578 | Ga0006562J51391_1081476 | Ga0006562J51391_10814762 | 530 |
| 684 | 3300003792 | Ga0055540_1013518 | Ga0055540_10135182 | 530 |
| 685 | 3300025245 | Ga0207425_1003268 | Ga0207425_10032683 | 530 |
| 686 | 3300025258 | Ga0209129_1002948 | Ga0209129_10029483 | 530 |
| 687 | 3300025263 | Ga0209565_1000141 | Ga0209565_100014187 | 530 |
| 688 | 3300025263 | Ga0209565_1002645 | Ga0209565_10026455 | 530 |
| 689 | 3300025284 | Ga0209130_1001487 | Ga0209130_10014877 | 530 |
| 690 | 3300025292 | Ga0209676_1000088 | Ga0209676_1000088186 | 530 |
| 691 | 3300025292 | Ga0209676_1000420 | Ga0209676_100042030 | 530 |
| 692 | 3300025294 | Ga0209025_1005849 | Ga0209025_10058493 | 530 |
| 693 | 3300025295 | Ga0209564_1003797 | Ga0209564_10037973 | 530 |
| 694 | 3300025297 | Ga0209758_1001159 | Ga0209758_10011597 | 530 |
| 695 | 3300025297 | Ga0209758_1003909 | Ga0209758_10039093 | 530 |
| 696 | 3300025298 | Ga0209050_1000110 | Ga0209050_100011057 | 530 |
| 697 | 3300025299 | Ga0209256_1000223 | Ga0209256_100022392 | 530 |
| 698 | 3300025302 | Ga0207426_1000084 | Ga0207426_1000084281 | 530 |
| 699 | 3300025302 | Ga0207426_1000124 | Ga0207426_1000124149 | 530 |
| 700 | 3300025303 | Ga0209051_1000069 | Ga0209051_100006916 | 530 |
| 701 | 3300025303 | Ga0209051_1000285 | Ga0209051_100028537 | 530 |
| 702 | 3300025303 | Ga0209051_1000986 | Ga0209051_100098617 | 530 |
| 703 | 3300025304 | Ga0209257_1000093 | Ga0209257_100009358 | 530 |
| 704 | 3300025304 | Ga0209257_1007169 | Ga0209257_10071693 | 530 |
| 705 | 3300025935 | Ga0207709_10001196 | Ga0207709_1000119611 | 530 |
| 706 | 3300025986 | Ga0207658_10059842 | Ga0207658_100598422 | 530 |
| 707 | 3300031456 | Ga0307513_10021256 | Ga0307513_100212563 | 530 |
| 708 | 3300031731 | Ga0307405_10000676 | Ga0307405_100006763 | 530 |
| 709 | 3300032126 | Ga0307415_100084486 | Ga0307415_1000844862 | 530 |
| 710 | 3300039447 | Ga0436361_0767394 | Ga0436361_0767394_44984_46588 | 530 |
| 711 | 3300046660 | Ga0495625_0000235 | Ga0495625_0000235_54912_56534 | 530 |
| 712 | 3300047321 | Ga0495676_0026484 | Ga0495676_0026484_3130_4752 | 530 |
| 713 | 3300048929 | Ga0496126_0000480 | Ga0496126_0000480_51459_53051 | 530 |
| 714 | 3300053093 | Ga0500651_0001995 | Ga0500651_0001995_7251_8873 | 530 |
| 715 | 3300053110 | Ga0500571_015394 | Ga0500571_015394_354_1976 | 530 |
| 716 | 3300053139 | Ga0500568_0003061 | Ga0500568_0003061_6067_7689 | 530 |
| 717 | iso_pu_bacteria | 2507262055 | 2507508805 | 530 |
| 718 | iso_pu_bacteria | 2508501009 | 2508542965 | 530 |
| 719 | iso_pu_bacteria | 2508501042 | 2508691342 | 530 |
| 720 | iso_pu_bacteria | 2508501128 | 2509152722 | 530 |
| 721 | iso_pu_bacteria | 2513237102 | 2513699248 | 530 |
| 722 | iso_pu_bacteria | 2513237161 | 2514012055 | 530 |
| 723 | iso_pu_bacteria | 2515154112 | 2515626328 | 530 |
| 724 | iso_pu_bacteria | 2524023228 | 2524539094 | 530 |
| 725 | iso_pu_bacteria | 2528768022 | 2528853918 | 530 |
| 726 | iso_pu_bacteria | 2547132374 | 2548501672 | 530 |
| 727 | iso_pu_bacteria | 2643221546 | 2643753104 | 530 |
| 728 | iso_pu_bacteria | 2643221558 | 2643814025 | 530 |
| 729 | iso_pu_bacteria | 2643221651 | 2644288621 | 530 |
| 730 | iso_pu_bacteria | 2667528175 | 2671122332 | 530 |
| 731 | iso_pu_bacteria | 2684623036 | 2686544765 | 530 |
| 732 | iso_pu_bacteria | 2710264753 | 2710601871 | 530 |
| 733 | iso_pu_bacteria | 2739367653 | 2739603679 | 530 |
| 734 | iso_pu_bacteria | 2791355197 | 2793068609 | 530 |
| 735 | iso_pu_bacteria | 2808606372 | 2808902628 | 530 |
| 736 | iso_pu_bacteria | 2816332305 | 2817510204 | 530 |
| 737 | iso_pu_bacteria | 2824617872 | 2824625104 | 530 |
| 738 | iso_pu_bacteria | 2824626560 | 2824633984 | 530 |
| 739 | iso_pu_bacteria | 2824635225 | 2824641128 | 530 |
| 740 | iso_pu_bacteria | 2824644064 | 2824648278 | 530 |
| 741 | iso_pu_bacteria | 2824661429 | 2824664530 | 530 |
| 742 | iso_pu_bacteria | 2824714736 | 2824718172 | 530 |
| 743 | iso_pu_bacteria | 2824723954 | 2824728426 | 530 |
| 744 | iso_pu_bacteria | 2838122688 | 2838123959 | 530 |
| 745 | iso_pu_bacteria | 2840878972 | 2840883840 | 530 |
| 746 | iso_pu_bacteria | 2841941048 | 2841943890 | 530 |
| 747 | iso_pu_bacteria | 2841966195 | 2841966476 | 530 |
| 748 | iso_pu_bacteria | 2841974524 | 2841975211 | 530 |
| 749 | iso_pu_bacteria | 2841983080 | 2841983219 | 530 |
| 750 | iso_pu_bacteria | 2842718218 | 2842721865 | 530 |
| 751 | iso_pu_bacteria | 2849076700 | 2849079525 | 530 |
| 752 | iso_pu_bacteria | 2857727296 | 2857728164 | 530 |
| 753 | iso_pu_bacteria | 2857737099 | 2857739729 | 530 |
| 754 | iso_pu_bacteria | 2874590934 | 2874591950 | 530 |
| 755 | iso_pu_bacteria | 2874604998 | 2874608788 | 530 |
| 756 | iso_pu_bacteria | 2874620515 | 2874627319 | 530 |
| 757 | iso_pu_bacteria | 2874645413 | 2874648196 | 530 |
| 758 | iso_pu_bacteria | 2876771140 | 2876772164 | 530 |
| 759 | iso_pu_bacteria | 2876818435 | 2876819494 | 530 |
| 760 | iso_pu_bacteria | 2879074833 | 2879075946 | 530 |
| 761 | iso_pu_bacteria | 2879099564 | 2879103504 | 530 |
| 762 | iso_pu_bacteria | 2879110137 | 2879111483 | 530 |
| 763 | iso_pu_bacteria | 2879127579 | 2879131578 | 530 |
| 764 | iso_pu_bacteria | 2879142872 | 2879148129 | 530 |
| 765 | iso_pu_bacteria | 2881364244 | 2881371625 | 530 |
| 766 | iso_pu_bacteria | 2885374607 | 2885379285 | 530 |
| 767 | iso_pu_bacteria | 2888388044 | 2888394027 | 530 |
| 768 | iso_pu_bacteria | 2903748898 | 2903751251 | 530 |
| 769 | iso_pu_bacteria | 2904666416 | 2904671163 | 530 |
| 770 | iso_pu_bacteria | 2904699407 | 2904702669 | 530 |
| 771 | iso_pu_bacteria | 2906610324 | 2906618441 | 530 |
| 772 | iso_pu_bacteria | 2906626472 | 2906629937 | 530 |
| 773 | iso_pu_bacteria | 2908739725 | 2908742887 | 530 |
| 774 | iso_pu_bacteria | 2919443155 | 2919443230 | 530 |
| 775 | iso_pu_bacteria | 2922368715 | 2922374102 | 530 |
| 776 | iso_pu_bacteria | 2922425934 | 2922429662 | 530 |
| 777 | iso_pu_bacteria | 2928121344 | 2928124671 | 530 |
| 778 | iso_pu_bacteria | 2929615660 | 2929617832 | 530 |
| 779 | iso_pu_bacteria | 2929624759 | 2929627513 | 530 |
| 780 | iso_pu_bacteria | 2932784394 | 2932788387 | 530 |
| 781 | iso_pu_bacteria | 2932794094 | 2932800596 | 530 |
| 782 | iso_pu_bacteria | 2932801729 | 2932803045 | 530 |
| 783 | iso_pu_bacteria | 2932809354 | 2932810461 | 530 |
| 784 | iso_pu_bacteria | 2932818245 | 2932821394 | 530 |
| 785 | iso_pu_bacteria | 2932828146 | 2932831380 | 530 |
| 786 | iso_pu_bacteria | 2933577622 | 2933579761 | 530 |
| 787 | iso_pu_bacteria | 2935608549 | 2935608658 | 530 |
| 788 | iso_pu_bacteria | 2935616580 | 2935622817 | 530 |
| 789 | iso_pu_bacteria | 2935630451 | 2935631825 | 530 |
| 790 | iso_pu_bacteria | 2935638405 | 2935645092 | 530 |
| 791 | iso_pu_bacteria | 2935648319 | 2935649822 | 530 |
| 792 | iso_pu_bacteria | 2935656913 | 2935658663 | 530 |
| 793 | iso_pu_bacteria | 2935665750 | 2935671880 | 530 |
| 794 | iso_pu_bacteria | 2935675223 | 2935678723 | 530 |
| 795 | iso_pu_bacteria | 2935684952 | 2935689040 | 530 |
| 796 | iso_pu_bacteria | 2935694250 | 2935696367 | 530 |
| 797 | iso_pu_bacteria | 2935703347 | 2935707083 | 530 |
| 798 | iso_pu_bacteria | 2935713505 | 2935716059 | 530 |
| 799 | iso_pu_bacteria | 2935722832 | 2935725376 | 530 |
| 800 | iso_pu_bacteria | 2935732158 | 2935738347 | 530 |
| 801 | iso_pu_bacteria | 2935741537 | 2935747722 | 530 |
| 802 | iso_pu_bacteria | 2935750917 | 2935753704 | 530 |
| 803 | iso_pu_bacteria | 2935760218 | 2935762773 | 530 |
| 804 | iso_pu_bacteria | 2935769743 | 2935777214 | 530 |
| 805 | iso_pu_bacteria | 2935777560 | 2935784646 | 530 |
| 806 | iso_pu_bacteria | 2935785616 | 2935793166 | 530 |
| 807 | iso_pu_bacteria | 2935793552 | 2935801171 | 530 |
| 808 | iso_pu_bacteria | 2935801545 | 2935807572 | 530 |
| 809 | iso_pu_bacteria | 2935810662 | 2935817160 | 530 |
| 810 | iso_pu_bacteria | 2935819856 | 2935821798 | 530 |
| 811 | iso_pu_bacteria | 2935827899 | 2935834559 | 530 |
| 812 | iso_pu_bacteria | 2935837841 | 2935838699 | 530 |
| 813 | iso_pu_bacteria | 2935847175 | 2935847401 | 530 |
| 814 | iso_pu_bacteria | 2935855204 | 2935861065 | 530 |
| 815 | iso_pu_bacteria | 2935864058 | 2935865603 | 530 |
| 816 | iso_pu_bacteria | 2935873716 | 2935878104 | 530 |
| 817 | iso_pu_bacteria | 2935883170 | 2935885383 | 530 |
| 818 | iso_pu_bacteria | 2935908558 | 2935909331 | 530 |
| 819 | iso_pu_bacteria | 2935916978 | 2935924781 | 530 |
| 820 | iso_pu_bacteria | 2935926038 | 2935926095 | 530 |
| 821 | iso_pu_bacteria | 2935934488 | 2935934545 | 530 |
| 822 | iso_pu_bacteria | 2935942939 | 2935942995 | 530 |
| 823 | iso_pu_bacteria | 2935951376 | 2935951433 | 530 |
| 824 | iso_pu_bacteria | 2935967501 | 2935967558 | 530 |
| 825 | iso_pu_bacteria | 2935975950 | 2935977234 | 530 |
| 826 | iso_pu_bacteria | 2935984226 | 2935988424 | 530 |
| 827 | iso_pu_bacteria | 2935992306 | 2935995890 | 530 |
| 828 | iso_pu_bacteria | 2936002035 | 2936009610 | 530 |
| 829 | iso_pu_bacteria | 2936011229 | 2936012696 | 530 |
| 830 | iso_pu_bacteria | 2936019824 | 2936021260 | 530 |
| 831 | iso_pu_bacteria | 2936028420 | 2936029989 | 530 |
| 832 | iso_pu_bacteria | 2936037263 | 2936043562 | 530 |
| 833 | iso_pu_bacteria | 2936046547 | 2936047454 | 530 |
| 834 | iso_pu_bacteria | 2936055302 | 2936057388 | 530 |
| 835 | iso_pu_bacteria | 2940556831 | 2940560919 | 530 |
| 836 | iso_pu_bacteria | 2941507105 | 2941513060 | 530 |
| 837 | iso_pu_bacteria | 2941515067 | 2941521036 | 530 |
| 838 | iso_pu_bacteria | 2941523033 | 2941526100 | 530 |
| 839 | iso_pu_bacteria | 2941538514 | 2941538634 | 530 |
| 840 | iso_pu_bacteria | 2946024296 | 2946025199 | 530 |
| 841 | iso_pu_bacteria | 2974320154 | 2974322039 | 530 |
| 842 | iso_pu_bacteria | 3005474847 | 3005480037 | 530 |
| 843 | iso_pu_bacteria | 8006933436 | 8006941240 | 530 |
| 844 | iso_pu_bacteria | 8006973647 | 8006980554 | 530 |
| 845 | iso_pu_bacteria | 8016511872 | 8016513441 | 530 |
| 846 | iso_pu_bacteria | 8016522445 | 8016529890 | 530 |
| 847 | iso_pu_bacteria | 8016539877 | 8016548325 | 530 |
| 848 | iso_pu_bacteria | 8016548790 | 8016553797 | 530 |
| 849 | iso_pu_bacteria | 8016557553 | 8016562174 | 530 |
| 850 | iso_pu_bacteria | 8016566248 | 8016573466 | 530 |
| 851 | iso_pu_bacteria | 8016575299 | 8016577595 | 530 |
| 852 | iso_pu_bacteria | 8016583857 | 8016592080 | 530 |
| 853 | iso_pu_bacteria | 8016595262 | 8016599989 | 530 |
| 854 | iso_pu_bacteria | 8016603502 | 8016610812 | 530 |
| 855 | iso_pu_bacteria | 8016613128 | 8016614151 | 530 |
| 856 | iso_pu_bacteria | 8016622563 | 8016626825 | 530 |
| 857 | iso_pu_bacteria | 8017057580 | 8017062992 | 530 |
| 858 | iso_pu_bacteria | 8019530166 | 8019534876 | 530 |
| 859 | iso_pu_bacteria | 8019555841 | 8019556965 | 530 |
| 860 | iso_pu_bacteria | 8019565922 | 8019568332 | 530 |
| 861 | iso_pu_bacteria | 8019586578 | 8019590034 | 530 |
| 862 | iso_pu_bacteria | 8019597564 | 8019601227 | 530 |
| 863 | iso_pu_bacteria | 8019608314 | 8019617318 | 530 |
| 864 | iso_pu_bacteria | 8019619141 | 8019627805 | 530 |
| 865 | iso_pu_bacteria | 8019629233 | 8019634700 | 530 |
| 866 | iso_pu_bacteria | 8019638758 | 8019645002 | 530 |
| 867 | iso_pu_bacteria | 8019648815 | 8019658162 | 530 |
| 868 | iso_pu_bacteria | 8019668869 | 8019672088 | 530 |
| 869 | iso_pu_bacteria | 8055742211 | 8055746580 | 530 |
| 870 | iso_pu_bacteria | 8056689827 | 8056693691 | 530 |
| 871 | iso_pu_bacteria | 8057132660 | 8057135433 | 530 |
| 872 | 3300003187 | JGI25151J46595_10008365 | JGI25151J46595_100083652 | 531 |
| 873 | 3300003773 | Ga0055537_1000286 | Ga0055537_100028628 | 531 |
| 874 | 3300003784 | Ga0055534_1000413 | Ga0055534_10004133 | 531 |
| 875 | 3300005288 | Ga0065714_10009699 | Ga0065714_100096992 | 531 |
| 876 | 3300005564 | Ga0070664_100028614 | Ga0070664_1000286144 | 531 |
| 877 | 3300006048 | Ga0075363_100006026 | Ga0075363_1000060264 | 531 |
| 878 | 3300006177 | Ga0075362_10005886 | Ga0075362_100058864 | 531 |
| 879 | 3300006353 | Ga0075370_10010108 | Ga0075370_100101082 | 531 |
| 880 | 3300006946 | Ga0079104_1014509 | Ga0079104_10145091 | 531 |
| 881 | 3300017792 | Ga0163161_10001893 | Ga0163161_100018932 | 531 |
| 882 | 3300025263 | Ga0209565_1000020 | Ga0209565_100002037 | 531 |
| 883 | 3300025273 | Ga0209673_1000072 | Ga0209673_1000072163 | 531 |
| 884 | 3300025291 | Ga0209675_1000014 | Ga0209675_100001425 | 531 |
| 885 | 3300025291 | Ga0209675_1006650 | Ga0209675_10066503 | 531 |
| 886 | 3300025294 | Ga0209025_1001471 | Ga0209025_100147112 | 531 |
| 887 | 3300025298 | Ga0209050_1011864 | Ga0209050_10118643 | 531 |
| 888 | 3300025728 | Ga0207655_1012876 | Ga0207655_10128763 | 531 |
| 889 | 3300025935 | Ga0207709_10002053 | Ga0207709_100020534 | 531 |
| 890 | 3300025945 | Ga0207679_10026592 | Ga0207679_100265922 | 531 |
| 891 | 3300027666 | Ga0209282_1004480 | Ga0209282_10044807 | 531 |
| 892 | 3300028379 | Ga0268266_10053608 | Ga0268266_100536083 | 531 |
| 893 | 3300030733 | Ga0314311_1190663 | Ga0314311_11906632 | 531 |
| 894 | 3300031711 | Ga0265314_10009656 | Ga0265314_100096564 | 531 |
| 895 | 3300032005 | Ga0307411_10044025 | Ga0307411_100440253 | 531 |
| 896 | 3300046472 | Ga0495580_0018040 | Ga0495580_0018040_38_1642 | 531 |
| 897 | 3300049577 | Ga0501041_0057305 | Ga0501041_0057305_628_2238 | 531 |
| 898 | 3300050492 | nmdc:mga0yw44_62166_c1 | nmdc:mga0yw44_62166_c1_384_2009 | 531 |
| 899 | 3300050496 | nmdc:mga07m45_6605_c2 | nmdc:mga07m45_6605_c2_3223_4854 | 531 |
| 900 | 3300053158 | Ga0500627_0004513 | Ga0500627_0004513_82_1710 | 531 |
| 901 | iso_pu_bacteria | 2508501125 | 2509130574 | 531 |
| 902 | iso_pu_bacteria | 2509276019 | 2509379399 | 531 |
| 903 | iso_pu_bacteria | 2510065057 | 2510307915 | 531 |
| 904 | iso_pu_bacteria | 2510917020 | 2511124109 | 531 |
| 905 | iso_pu_bacteria | 2510917028 | 2511182930 | 531 |
| 906 | iso_pu_bacteria | 2511231002 | 2511244452 | 531 |
| 907 | iso_pu_bacteria | 2511231052 | 2511498223 | 531 |
| 908 | iso_pu_bacteria | 2512047086 | 2512529379 | 531 |
| 909 | iso_pu_bacteria | 2512875026 | 2512969536 | 531 |
| 910 | iso_pu_bacteria | 2513237086 | 2513586869 | 531 |
| 911 | iso_pu_bacteria | 2513237089 | 2513606240 | 531 |
| 912 | iso_pu_bacteria | 2513237091 | 2513619662 | 531 |
| 913 | iso_pu_bacteria | 2513237140 | 2513885156 | 531 |
| 914 | iso_pu_bacteria | 2513237143 | 2513906255 | 531 |
| 915 | iso_pu_bacteria | 2513237151 | 2513958598 | 531 |
| 916 | iso_pu_bacteria | 2513237156 | 2513985052 | 531 |
| 917 | iso_pu_bacteria | 2513237159 | 2513998998 | 531 |
| 918 | iso_pu_bacteria | 2513237160 | 2514007955 | 531 |
| 919 | iso_pu_bacteria | 2513237351 | 2514591729 | 531 |
| 920 | iso_pu_bacteria | 2515154107 | 2515610796 | 531 |
| 921 | iso_pu_bacteria | 2515154122 | 2515680455 | 531 |
| 922 | iso_pu_bacteria | 2515154123 | 2515692053 | 531 |
| 923 | iso_pu_bacteria | 2516143018 | 2516207542 | 531 |
| 924 | iso_pu_bacteria | 2516653046 | 2516896134 | 531 |
| 925 | iso_pu_bacteria | 2517487022 | 2517565586 | 531 |
| 926 | iso_pu_bacteria | 2519103095 | 2519460403 | 531 |
| 927 | iso_pu_bacteria | 2551306084 | 2551674965 | 531 |
| 928 | iso_pu_bacteria | 2551306085 | 2551687281 | 531 |
| 929 | iso_pu_bacteria | 2551306093 | 2551743238 | 531 |
| 930 | iso_pu_bacteria | 2558860100 | 2558861472 | 531 |
| 931 | iso_pu_bacteria | 2582581280 | 2585155727 | 531 |
| 932 | iso_pu_bacteria | 2582581283 | 2585167054 | 531 |
| 933 | iso_pu_bacteria | 2582581306 | 2585269907 | 531 |
| 934 | iso_pu_bacteria | 2582581311 | 2585292707 | 531 |
| 935 | iso_pu_bacteria | 2582581865 | 2585390695 | 531 |
| 936 | iso_pu_bacteria | 2582581866 | 2585397624 | 531 |
| 937 | iso_pu_bacteria | 2585428057 | 2587725812 | 531 |
| 938 | iso_pu_bacteria | 2585428062 | 2587758332 | 531 |
| 939 | iso_pu_bacteria | 2588253510 | 2588290739 | 531 |
| 940 | iso_pu_bacteria | 2597489875 | 2597815122 | 531 |
| 941 | iso_pu_bacteria | 2599185178 | 2599447271 | 531 |
| 942 | iso_pu_bacteria | 2599185239 | 2599740735 | 531 |
| 943 | iso_pu_bacteria | 2599185240 | 2599748262 | 531 |
| 944 | iso_pu_bacteria | 2599185352 | 2600197251 | 531 |
| 945 | iso_pu_bacteria | 2599185355 | 2600210174 | 531 |
| 946 | iso_pu_bacteria | 2600255067 | 2600814859 | 531 |
| 947 | iso_pu_bacteria | 2643221544 | 2643744069 | 531 |
| 948 | iso_pu_bacteria | 2643221545 | 2643750805 | 531 |
| 949 | iso_pu_bacteria | 2643221552 | 2643779240 | 531 |
| 950 | iso_pu_bacteria | 2643221557 | 2643804853 | 531 |
| 951 | iso_pu_bacteria | 2643221570 | 2643865064 | 531 |
| 952 | iso_pu_bacteria | 2643221583 | 2643925675 | 531 |
| 953 | iso_pu_bacteria | 2643221584 | 2643931416 | 531 |
| 954 | iso_pu_bacteria | 2643221585 | 2643932456 | 531 |
| 955 | iso_pu_bacteria | 2643221595 | 2643985440 | 531 |
| 956 | iso_pu_bacteria | 2643221596 | 2643990786 | 531 |
| 957 | iso_pu_bacteria | 2643221599 | 2644002618 | 531 |
| 958 | iso_pu_bacteria | 2643221607 | 2644047717 | 531 |
| 959 | iso_pu_bacteria | 2643221609 | 2644059094 | 531 |
| 960 | iso_pu_bacteria | 2643221610 | 2644065697 | 531 |
| 961 | iso_pu_bacteria | 2643221611 | 2644075866 | 531 |
| 962 | iso_pu_bacteria | 2643221618 | 2644104287 | 531 |
| 963 | iso_pu_bacteria | 2643221626 | 2644148896 | 531 |
| 964 | iso_pu_bacteria | 2643221627 | 2644152136 | 531 |
| 965 | iso_pu_bacteria | 2643221636 | 2644205865 | 531 |
| 966 | iso_pu_bacteria | 2643221639 | 2644219871 | 531 |
| 967 | iso_pu_bacteria | 2643221644 | 2644246957 | 531 |
| 968 | iso_pu_bacteria | 2643221646 | 2644261012 | 531 |
| 969 | iso_pu_bacteria | 2643221652 | 2644292345 | 531 |
| 970 | iso_pu_bacteria | 2643221655 | 2644313280 | 531 |
| 971 | iso_pu_bacteria | 2643221656 | 2644313707 | 531 |
| 972 | iso_pu_bacteria | 2643221659 | 2644334149 | 531 |
| 973 | iso_pu_bacteria | 2643221660 | 2644338086 | 531 |
| 974 | iso_pu_bacteria | 2643221668 | 2644376803 | 531 |
| 975 | iso_pu_bacteria | 2643221675 | 2644417589 | 531 |
| 976 | iso_pu_bacteria | 2643221680 | 2644453693 | 531 |
| 977 | iso_pu_bacteria | 2643221686 | 2644481879 | 531 |
| 978 | iso_pu_bacteria | 2643221688 | 2644495309 | 531 |
| 979 | iso_pu_bacteria | 2643221689 | 2644497517 | 531 |
| 980 | iso_pu_bacteria | 2643221691 | 2644509879 | 531 |
| 981 | iso_pu_bacteria | 2643221698 | 2644547203 | 531 |
| 982 | iso_pu_bacteria | 2643221712 | 2644612905 | 531 |
| 983 | iso_pu_bacteria | 2643221717 | 2644645457 | 531 |
| 984 | iso_pu_bacteria | 2643221723 | 2644677765 | 531 |
| 985 | iso_pu_bacteria | 2643221726 | 2644688328 | 531 |
| 986 | iso_pu_bacteria | 2657244999 | 2657683367 | 531 |
| 987 | iso_pu_bacteria | 2675903129 | 2676745664 | 531 |
| 988 | iso_pu_bacteria | 2690315857 | 2691331830 | 531 |
| 989 | iso_pu_bacteria | 2690316117 | 2692318413 | 531 |
| 990 | iso_pu_bacteria | 2738541296 | 2738820498 | 531 |
| 991 | iso_pu_bacteria | 2738541298 | 2738832978 | 531 |
| 992 | iso_pu_bacteria | 2738541306 | 2738874505 | 531 |
| 993 | iso_pu_bacteria | 2738541337 | 2739054770 | 531 |
| 994 | iso_pu_bacteria | 2738543002 | 2739186135 | 531 |
| 995 | iso_pu_bacteria | 2738543008 | 2739221103 | 531 |
| 996 | iso_pu_bacteria | 2738543012 | 2739245500 | 531 |
| 997 | iso_pu_bacteria | 2738543020 | 2739285156 | 531 |
| 998 | iso_pu_bacteria | 2738543021 | 2739290470 | 531 |
| 999 | iso_pu_bacteria | 2739367655 | 2739611214 | 531 |
| 1000 | iso_pu_bacteria | 2751185821 | 2753459458 | 531 |
| 1001 | iso_pu_bacteria | 2751185846 | 2753566878 | 531 |
| 1002 | iso_pu_bacteria | 2791355082 | 2792580468 | 531 |
| 1003 | iso_pu_bacteria | 2791355094 | 2792639858 | 531 |
| 1004 | iso_pu_bacteria | 2802428858 | 2802715966 | 531 |
| 1005 | iso_pu_bacteria | 2802428859 | 2802723010 | 531 |
| 1006 | iso_pu_bacteria | 2802428860 | 2802728857 | 531 |
| 1007 | iso_pu_bacteria | 2802428861 | 2802735224 | 531 |
| 1008 | iso_pu_bacteria | 2802428862 | 2802742172 | 531 |
| 1009 | iso_pu_bacteria | 2802428863 | 2802748619 | 531 |
| 1010 | iso_pu_bacteria | 2802429268 | 2804754687 | 531 |
| 1011 | iso_pu_bacteria | 2808606384 | 2808967631 | 531 |
| 1012 | iso_pu_bacteria | 2808606390 | 2809002462 | 531 |
| 1013 | iso_pu_bacteria | 2808606391 | 2809009740 | 531 |
| 1014 | iso_pu_bacteria | 2816332133 | 2816472342 | 531 |
| 1015 | iso_pu_bacteria | 2816332253 | 2817257804 | 531 |
| 1016 | iso_pu_bacteria | 2816332256 | 2817281804 | 531 |
| 1017 | iso_pu_bacteria | 2816332286 | 2817451453 | 531 |
| 1018 | iso_pu_bacteria | 2818991435 | 2819540039 | 531 |
| 1019 | iso_pu_bacteria | 2818991450 | 2819620696 | 531 |
| 1020 | iso_pu_bacteria | 2818991452 | 2819636957 | 531 |
| 1021 | iso_pu_bacteria | 2818991454 | 2819648961 | 531 |
| 1022 | iso_pu_bacteria | 2834641062 | 2834644140 | 531 |
| 1023 | iso_pu_bacteria | 2838016132 | 2838019766 | 531 |
| 1024 | iso_pu_bacteria | 2838074704 | 2838077745 | 531 |
| 1025 | iso_pu_bacteria | 2839138175 | 2839141369 | 531 |
| 1026 | iso_pu_bacteria | 2842428310 | 2842430066 | 531 |
| 1027 | iso_pu_bacteria | 2842441272 | 2842442693 | 531 |
| 1028 | iso_pu_bacteria | 2842462802 | 2842464569 | 531 |
| 1029 | iso_pu_bacteria | 2842469257 | 2842471063 | 531 |
| 1030 | iso_pu_bacteria | 2842521101 | 2842524739 | 531 |
| 1031 | iso_pu_bacteria | 2842805378 | 2842806736 | 531 |
| 1032 | iso_pu_bacteria | 2844163670 | 2844168114 | 531 |
| 1033 | iso_pu_bacteria | 2847417321 | 2847423084 | 531 |
| 1034 | iso_pu_bacteria | 2848992105 | 2848997523 | 531 |
| 1035 | iso_pu_bacteria | 2850079185 | 2850084560 | 531 |
| 1036 | iso_pu_bacteria | 2855730933 | 2855732755 | 531 |
| 1037 | iso_pu_bacteria | 2855767633 | 2855771507 | 531 |
| 1038 | iso_pu_bacteria | 2855825444 | 2855829041 | 531 |
| 1039 | iso_pu_bacteria | 2855839649 | 2855844159 | 531 |
| 1040 | iso_pu_bacteria | 2855872281 | 2855874071 | 531 |
| 1041 | iso_pu_bacteria | 2857576091 | 2857578921 | 531 |
| 1042 | iso_pu_bacteria | 2858800743 | 2858806591 | 531 |
| 1043 | iso_pu_bacteria | 2863421361 | 2863427135 | 531 |
| 1044 | iso_pu_bacteria | 2870068957 | 2870073665 | 531 |
| 1045 | iso_pu_bacteria | 2881101125 | 2881103265 | 531 |
| 1046 | iso_pu_bacteria | 2881412998 | 2881415551 | 531 |
| 1047 | iso_pu_bacteria | 2881927736 | 2881929956 | 531 |
| 1048 | iso_pu_bacteria | 2883291878 | 2883294790 | 531 |
| 1049 | iso_pu_bacteria | 2883354860 | 2883356723 | 531 |
| 1050 | iso_pu_bacteria | 2885270888 | 2885272792 | 531 |
| 1051 | iso_pu_bacteria | 2886848708 | 2886851567 | 531 |
| 1052 | iso_pu_bacteria | 2887375801 | 2887376333 | 531 |
| 1053 | iso_pu_bacteria | 2889306138 | 2889309814 | 531 |
| 1054 | iso_pu_bacteria | 2894023352 | 2894027440 | 531 |
| 1055 | iso_pu_bacteria | 2894232714 | 2894233713 | 531 |
| 1056 | iso_pu_bacteria | 2896384573 | 2896391859 | 531 |
| 1057 | iso_pu_bacteria | 2898795034 | 2898798283 | 531 |
| 1058 | iso_pu_bacteria | 2900634093 | 2900641740 | 531 |
| 1059 | iso_pu_bacteria | 2902405164 | 2902410593 | 531 |
| 1060 | iso_pu_bacteria | 2902682994 | 2902687801 | 531 |
| 1061 | iso_pu_bacteria | 2904564687 | 2904571116 | 531 |
| 1062 | iso_pu_bacteria | 2904571731 | 2904578172 | 531 |
| 1063 | iso_pu_bacteria | 2909042592 | 2909043825 | 531 |
| 1064 | iso_pu_bacteria | 2913295892 | 2913296771 | 531 |
| 1065 | iso_pu_bacteria | 2915980308 | 2915983631 | 531 |
| 1066 | iso_pu_bacteria | 2915986958 | 2915992207 | 531 |
| 1067 | iso_pu_bacteria | 2915993759 | 2915999281 | 531 |
| 1068 | iso_pu_bacteria | 2916000859 | 2916007499 | 531 |
| 1069 | iso_pu_bacteria | 2916007675 | 2916011610 | 531 |
| 1070 | iso_pu_bacteria | 2916014648 | 2916018857 | 531 |
| 1071 | iso_pu_bacteria | 2916021584 | 2916026064 | 531 |
| 1072 | iso_pu_bacteria | 2916028427 | 2916032109 | 531 |
| 1073 | iso_pu_bacteria | 2916035215 | 2916039055 | 531 |
| 1074 | iso_pu_bacteria | 2916041962 | 2916046154 | 531 |
| 1075 | iso_pu_bacteria | 2916048683 | 2916051889 | 531 |
| 1076 | iso_pu_bacteria | 2916055098 | 2916060878 | 531 |
| 1077 | iso_pu_bacteria | 2916061851 | 2916065329 | 531 |
| 1078 | iso_pu_bacteria | 2916068649 | 2916071964 | 531 |
| 1079 | iso_pu_bacteria | 2916076590 | 2916077361 | 531 |
| 1080 | iso_pu_bacteria | 2919534386 | 2919537123 | 531 |
| 1081 | iso_pu_bacteria | 2919688452 | 2919691481 | 531 |
| 1082 | iso_pu_bacteria | 2919704043 | 2919708417 | 531 |
| 1083 | iso_pu_bacteria | 2920760137 | 2920765001 | 531 |
| 1084 | iso_pu_bacteria | 2920822456 | 2920826793 | 531 |
| 1085 | iso_pu_bacteria | 2921201388 | 2921203586 | 531 |
| 1086 | iso_pu_bacteria | 2921208531 | 2921209478 | 531 |
| 1087 | iso_pu_bacteria | 2921237296 | 2921237929 | 531 |
| 1088 | iso_pu_bacteria | 2921244191 | 2921248291 | 531 |
| 1089 | iso_pu_bacteria | 2921250672 | 2921256870 | 531 |
| 1090 | iso_pu_bacteria | 2921257292 | 2921260982 | 531 |
| 1091 | iso_pu_bacteria | 2921263974 | 2921267897 | 531 |
| 1092 | iso_pu_bacteria | 2921282425 | 2921287069 | 531 |
| 1093 | iso_pu_bacteria | 2921289301 | 2921295700 | 531 |
| 1094 | iso_pu_bacteria | 2924144063 | 2924145714 | 531 |
| 1095 | iso_pu_bacteria | 2924150972 | 2924155844 | 531 |
| 1096 | iso_pu_bacteria | 2924158325 | 2924162445 | 531 |
| 1097 | iso_pu_bacteria | 2924165586 | 2924171310 | 531 |
| 1098 | iso_pu_bacteria | 2924172951 | 2924178396 | 531 |
| 1099 | iso_pu_bacteria | 2924179722 | 2924183398 | 531 |
| 1100 | iso_pu_bacteria | 2924186466 | 2924192003 | 531 |
| 1101 | iso_pu_bacteria | 2924200457 | 2924204591 | 531 |
| 1102 | iso_pu_bacteria | 2924214083 | 2924220846 | 531 |
| 1103 | iso_pu_bacteria | 2924221636 | 2924223527 | 531 |
| 1104 | iso_pu_bacteria | 2924228884 | 2924234614 | 531 |
| 1105 | iso_pu_bacteria | 2928108538 | 2928108702 | 531 |
| 1106 | iso_pu_bacteria | 2928135762 | 2928135926 | 531 |
| 1107 | iso_pu_bacteria | 2928157003 | 2928158267 | 531 |
| 1108 | iso_pu_bacteria | 2928163908 | 2928167514 | 531 |
| 1109 | iso_pu_bacteria | 2928170801 | 2928177834 | 531 |
| 1110 | iso_pu_bacteria | 2928503688 | 2928504307 | 531 |
| 1111 | iso_pu_bacteria | 2928536128 | 2928542898 | 531 |
| 1112 | iso_pu_bacteria | 2932422444 | 2932426297 | 531 |
| 1113 | iso_pu_bacteria | 2936996657 | 2937002235 | 531 |
| 1114 | iso_pu_bacteria | 2937002841 | 2937007227 | 531 |
| 1115 | iso_pu_bacteria | 2937009748 | 2937015203 | 531 |
| 1116 | iso_pu_bacteria | 2937016420 | 2937020748 | 531 |
| 1117 | iso_pu_bacteria | 2937023124 | 2937026948 | 531 |
| 1118 | iso_pu_bacteria | 2937029754 | 2937034983 | 531 |
| 1119 | iso_pu_bacteria | 2937036028 | 2937039214 | 531 |
| 1120 | iso_pu_bacteria | 2937042894 | 2937048060 | 531 |
| 1121 | iso_pu_bacteria | 2937049772 | 2937054127 | 531 |
| 1122 | iso_pu_bacteria | 2937056579 | 2937060582 | 531 |
| 1123 | iso_pu_bacteria | 2937063883 | 2937068016 | 531 |
| 1124 | iso_pu_bacteria | 2937071275 | 2937076986 | 531 |
| 1125 | iso_pu_bacteria | 2937078374 | 2937084373 | 531 |
| 1126 | iso_pu_bacteria | 2937091812 | 2937095333 | 531 |
| 1127 | iso_pu_bacteria | 2937098957 | 2937103598 | 531 |
| 1128 | iso_pu_bacteria | 2937106411 | 2937110303 | 531 |
| 1129 | iso_pu_bacteria | 2937113482 | 2937117190 | 531 |
| 1130 | iso_pu_bacteria | 2937119839 | 2937123589 | 531 |
| 1131 | iso_pu_bacteria | 2937126314 | 2937130524 | 531 |
| 1132 | iso_pu_bacteria | 2939631187 | 2939633815 | 531 |
| 1133 | iso_pu_bacteria | 2945934425 | 2945938721 | 531 |
| 1134 | iso_pu_bacteria | 2957375807 | 2957379102 | 531 |
| 1135 | iso_pu_bacteria | 2957382221 | 2957386364 | 531 |
| 1136 | iso_pu_bacteria | 2957388812 | 2957392785 | 531 |
| 1137 | iso_pu_bacteria | 2957395598 | 2957401477 | 531 |
| 1138 | iso_pu_bacteria | 2957402308 | 2957406648 | 531 |
| 1139 | iso_pu_bacteria | 2957408893 | 2957413649 | 531 |
| 1140 | iso_pu_bacteria | 2957415311 | 2957420937 | 531 |
| 1141 | iso_pu_bacteria | 2957422303 | 2957427384 | 531 |
| 1142 | iso_pu_bacteria | 2957437181 | 2957442992 | 531 |
| 1143 | iso_pu_bacteria | 2957443900 | 2957449181 | 531 |
| 1144 | iso_pu_bacteria | 2957457609 | 2957461445 | 531 |
| 1145 | iso_pu_bacteria | 2957464669 | 2957468583 | 531 |
| 1146 | iso_pu_bacteria | 2957471148 | 2957476796 | 531 |
| 1147 | iso_pu_bacteria | 2957478035 | 2957484268 | 531 |
| 1148 | iso_pu_bacteria | 2957484790 | 2957488635 | 531 |
| 1149 | iso_pu_bacteria | 2957491536 | 2957497248 | 531 |
| 1150 | iso_pu_bacteria | 2957498199 | 2957504217 | 531 |
| 1151 | iso_pu_bacteria | 2957505466 | 2957509662 | 531 |
| 1152 | iso_pu_bacteria | 2960584000 | 2960586858 | 531 |
| 1153 | iso_pu_bacteria | 2960591022 | 2960595261 | 531 |
| 1154 | iso_pu_bacteria | 2960597568 | 2960601081 | 531 |
| 1155 | iso_pu_bacteria | 2960603979 | 2960608843 | 531 |
| 1156 | iso_pu_bacteria | 2960610863 | 2960615808 | 531 |
| 1157 | iso_pu_bacteria | 2960617483 | 2960622058 | 531 |
| 1158 | iso_pu_bacteria | 2960624210 | 2960629915 | 531 |
| 1159 | iso_pu_bacteria | 2960631154 | 2960634350 | 531 |
| 1160 | iso_pu_bacteria | 2960637947 | 2960645331 | 531 |
| 1161 | iso_pu_bacteria | 2960645483 | 2960649755 | 531 |
| 1162 | iso_pu_bacteria | 2960652885 | 2960659014 | 531 |
| 1163 | iso_pu_bacteria | 2960660292 | 2960665639 | 531 |
| 1164 | iso_pu_bacteria | 2960667422 | 2960671612 | 531 |
| 1165 | iso_pu_bacteria | 2960674078 | 2960679895 | 531 |
| 1166 | iso_pu_bacteria | 2960680706 | 2960683421 | 531 |
| 1167 | iso_pu_bacteria | 2960687367 | 2960690040 | 531 |
| 1168 | iso_pu_bacteria | 2960693952 | 2960695273 | 531 |
| 1169 | iso_pu_bacteria | 2964607997 | 2964611937 | 531 |
| 1170 | iso_pu_bacteria | 2964615318 | 2964619656 | 531 |
| 1171 | iso_pu_bacteria | 2964621998 | 2964626938 | 531 |
| 1172 | iso_pu_bacteria | 2964628898 | 2964635020 | 531 |
| 1173 | iso_pu_bacteria | 2964636051 | 2964640079 | 531 |
| 1174 | iso_pu_bacteria | 2964643177 | 2964647458 | 531 |
| 1175 | iso_pu_bacteria | 2964649959 | 2964653787 | 531 |
| 1176 | iso_pu_bacteria | 2964656573 | 2964663411 | 531 |
| 1177 | iso_pu_bacteria | 2964663802 | 2964669197 | 531 |
| 1178 | iso_pu_bacteria | 2964678106 | 2964682796 | 531 |
| 1179 | iso_pu_bacteria | 2964685014 | 2964690182 | 531 |
| 1180 | iso_pu_bacteria | 2964691889 | 2964695611 | 531 |
| 1181 | iso_pu_bacteria | 2964698721 | 2964703749 | 531 |
| 1182 | iso_pu_bacteria | 2964705432 | 2964711576 | 531 |
| 1183 | iso_pu_bacteria | 2964712639 | 2964716253 | 531 |
| 1184 | iso_pu_bacteria | 2964719344 | 2964724924 | 531 |
| 1185 | iso_pu_bacteria | 2967664464 | 2967665346 | 531 |
| 1186 | iso_pu_bacteria | 2967671571 | 2967677194 | 531 |
| 1187 | iso_pu_bacteria | 2967678726 | 2967683353 | 531 |
| 1188 | iso_pu_bacteria | 2967686174 | 2967687994 | 531 |
| 1189 | iso_pu_bacteria | 2967693043 | 2967697008 | 531 |
| 1190 | iso_pu_bacteria | 2967699805 | 2967703956 | 531 |
| 1191 | iso_pu_bacteria | 2967706974 | 2967711159 | 531 |
| 1192 | iso_pu_bacteria | 2967714385 | 2967718404 | 531 |
| 1193 | iso_pu_bacteria | 2967721400 | 2967726993 | 531 |
| 1194 | iso_pu_bacteria | 2967728569 | 2967734042 | 531 |
| 1195 | iso_pu_bacteria | 2967735183 | 2967738799 | 531 |
| 1196 | iso_pu_bacteria | 2967742019 | 2967747964 | 531 |
| 1197 | iso_pu_bacteria | 2967755722 | 2967759404 | 531 |
| 1198 | iso_pu_bacteria | 2967762386 | 2967766263 | 531 |
| 1199 | iso_pu_bacteria | 2967769361 | 2967773542 | 531 |
| 1200 | iso_pu_bacteria | 2967775926 | 2967780783 | 531 |
| 1201 | iso_pu_bacteria | 2970019648 | 2970026605 | 531 |
| 1202 | iso_pu_bacteria | 2970026789 | 2970028916 | 531 |
| 1203 | iso_pu_bacteria | 2970033650 | 2970040095 | 531 |
| 1204 | iso_pu_bacteria | 2970040964 | 2970046414 | 531 |
| 1205 | iso_pu_bacteria | 2970047711 | 2970051658 | 531 |
| 1206 | iso_pu_bacteria | 2970054988 | 2970059175 | 531 |
| 1207 | iso_pu_bacteria | 2970061556 | 2970065420 | 531 |
| 1208 | iso_pu_bacteria | 2970068827 | 2970074103 | 531 |
| 1209 | iso_pu_bacteria | 2970076120 | 2970080746 | 531 |
| 1210 | iso_pu_bacteria | 2970082768 | 2970087084 | 531 |
| 1211 | iso_pu_bacteria | 2970088815 | 2970093152 | 531 |
| 1212 | iso_pu_bacteria | 2970095765 | 2970099652 | 531 |
| 1213 | iso_pu_bacteria | 2970102677 | 2970106493 | 531 |
| 1214 | iso_pu_bacteria | 2970109326 | 2970113712 | 531 |
| 1215 | iso_pu_bacteria | 2970116247 | 2970120080 | 531 |
| 1216 | iso_pu_bacteria | 2970122695 | 2970128495 | 531 |
| 1217 | iso_pu_bacteria | 2970129317 | 2970135723 | 531 |
| 1218 | iso_pu_bacteria | 2970136068 | 2970141904 | 531 |
| 1219 | iso_pu_bacteria | 2970143518 | 2970147826 | 531 |
| 1220 | iso_pu_bacteria | 2970149975 | 2970154072 | 531 |
| 1221 | iso_pu_bacteria | 2970156795 | 2970161902 | 531 |
| 1222 | iso_pu_bacteria | 2970164137 | 2970168087 | 531 |
| 1223 | iso_pu_bacteria | 2970170962 | 2970176153 | 531 |
| 1224 | iso_pu_bacteria | 2970177841 | 2970179152 | 531 |
| 1225 | iso_pu_bacteria | 2970184632 | 2970190218 | 531 |
| 1226 | iso_pu_bacteria | 2970191845 | 2970195949 | 531 |
| 1227 | iso_pu_bacteria | 2977516862 | 2977523669 | 531 |
| 1228 | iso_pu_bacteria | 2977523885 | 2977529772 | 531 |
| 1229 | iso_pu_bacteria | 2977530762 | 2977533919 | 531 |
| 1230 | iso_pu_bacteria | 2977537788 | 2977541610 | 531 |
| 1231 | iso_pu_bacteria | 2977544691 | 2977548007 | 531 |
| 1232 | iso_pu_bacteria | 2977551784 | 2977556282 | 531 |
| 1233 | iso_pu_bacteria | 2977565890 | 2977570203 | 531 |
| 1234 | iso_pu_bacteria | 2977572785 | 2977576942 | 531 |
| 1235 | iso_pu_bacteria | 2977579622 | 2977583443 | 531 |
| 1236 | iso_pu_bacteria | 2981990288 | 2981996660 | 531 |
| 1237 | iso_pu_bacteria | 2989349275 | 2989351566 | 531 |
| 1238 | iso_pu_bacteria | 2990703756 | 2990708720 | 531 |
| 1239 | iso_pu_bacteria | 2990710928 | 2990710957 | 531 |
| 1240 | iso_pu_bacteria | 2996887358 | 2996890405 | 531 |
| 1241 | iso_pu_bacteria | 3003665799 | 3003669567 | 531 |
| 1242 | iso_pu_bacteria | 3004167301 | 3004171018 | 531 |
| 1243 | iso_pu_bacteria | 3005452660 | 3005456110 | 531 |
| 1244 | iso_pu_bacteria | 641736151 | 642420867 | 531 |
| 1245 | iso_pu_bacteria | 641736154 | 642415613 | 531 |
| 1246 | iso_pu_bacteria | 643692032 | 643823019 | 531 |
| 1247 | iso_pu_bacteria | 648276728 | 648738327 | 531 |
| 1248 | iso_pu_bacteria | 8002392321 | 8002392461 | 531 |
| 1249 | iso_pu_bacteria | 8003400568 | 8003404293 | 531 |
| 1250 | iso_pu_bacteria | 8003992118 | 8003996740 | 531 |
| 1251 | iso_pu_bacteria | 8003999396 | 8004004063 | 531 |
| 1252 | iso_pu_bacteria | 8005258706 | 8005262592 | 531 |
| 1253 | iso_pu_bacteria | 8005321885 | 8005324932 | 531 |
| 1254 | iso_pu_bacteria | 8005619151 | 8005625902 | 531 |
| 1255 | iso_pu_bacteria | 8011350971 | 8011356963 | 531 |
| 1256 | iso_pu_bacteria | 8018176218 | 8018180798 | 531 |
| 1257 | iso_pu_bacteria | 8018845410 | 8018850059 | 531 |
| 1258 | iso_pu_bacteria | 8020807995 | 8020810936 | 531 |
| 1259 | iso_pu_bacteria | 8020938398 | 8020942433 | 531 |
| 1260 | iso_pu_bacteria | 8020953355 | 8020954592 | 531 |
| 1261 | iso_pu_bacteria | 8021120328 | 8021123749 | 531 |
| 1262 | iso_pu_bacteria | 8039098773 | 8039104416 | 531 |
| 1263 | iso_pu_bacteria | 8040167225 | 8040172384 | 531 |
| 1264 | iso_pu_bacteria | 8040173305 | 8040177024 | 531 |
| 1265 | iso_pu_bacteria | 8049293176 | 8049298495 | 531 |
| 1266 | iso_pu_bacteria | 8055225921 | 8055228395 | 531 |
| 1267 | iso_pu_bacteria | 8055266321 | 8055269189 | 531 |
| 1268 | 3300003203 | JGI25406J46586_10013287 | JGI25406J46586_100132872 | 532 |
| 1269 | 3300005458 | Ga0070681_10012720 | Ga0070681_100127206 | 532 |
| 1270 | 3300005544 | Ga0070686_100004762 | Ga0070686_1000047623 | 532 |
| 1271 | 3300005617 | Ga0068859_100011261 | Ga0068859_1000112615 | 532 |
| 1272 | 3300005719 | Ga0068861_100118575 | Ga0068861_1001185752 | 532 |
| 1273 | 3300005985 | Ga0081539_10000720 | Ga0081539_1000072068 | 532 |
| 1274 | 3300006931 | Ga0097620_100011261 | Ga0097620_1000112615 | 532 |
| 1275 | 3300007788 | Ga0099795_10000018 | Ga0099795_1000001824 | 532 |
| 1276 | 3300009093 | Ga0105240_10116124 | Ga0105240_101161242 | 532 |
| 1277 | 3300009093 | Ga0105240_10199740 | Ga0105240_101997402 | 532 |
| 1278 | 3300010159 | Ga0099796_10000048 | Ga0099796_100000487 | 532 |
| 1279 | 3300013105 | Ga0157369_10047479 | Ga0157369_100474793 | 532 |
| 1280 | 3300025913 | Ga0207695_10087061 | Ga0207695_100870612 | 532 |
| 1281 | 3300026118 | Ga0207675_100015056 | Ga0207675_1000150563 | 532 |
| 1282 | 3300027512 | Ga0209179_1000007 | Ga0209179_100000787 | 532 |
| 1283 | 3300031649 | Ga0307514_10015637 | Ga0307514_100156374 | 532 |
| 1284 | 3300039437 | Ga0436365_1024917 | Ga0436365_1024917_2273_3880 | 532 |
| 1285 | 3300046615 | Ga0495656_0017331 | Ga0495656_0017331_22_1641 | 532 |
| 1286 | 3300048903 | Ga0496100_0057940 | Ga0496100_0057940_631_2238 | 532 |
| 1287 | 3300048918 | Ga0496115_0050208 | Ga0496115_0050208_727_2334 | 532 |
| 1288 | iso_pu_bacteria | 2894772417 | 2894777341 | 532 |
| 1289 | iso_pu_bacteria | 2906799679 | 2906800416 | 532 |
| 1290 | iso_pu_bacteria | 2977264416 | 2977266426 | 532 |
| 1291 | 3300003578 | Ga0006562J51391_1087736 | Ga0006562J51391_10877362 | 533 |
| 1292 | 3300005338 | Ga0068868_100000761 | Ga0068868_1000007617 | 533 |
| 1293 | 3300005441 | Ga0070700_100010228 | Ga0070700_1000102285 | 533 |
| 1294 | 3300005445 | Ga0070708_100046848 | Ga0070708_1000468482 | 533 |
| 1295 | 3300005467 | Ga0070706_100004243 | Ga0070706_1000042434 | 533 |
| 1296 | 3300005467 | Ga0070706_100004591 | Ga0070706_10000459116 | 533 |
| 1297 | 3300005467 | Ga0070706_100041253 | Ga0070706_1000412533 | 533 |
| 1298 | 3300005468 | Ga0070707_100001417 | Ga0070707_10000141719 | 533 |
| 1299 | 3300005468 | Ga0070707_100005118 | Ga0070707_10000511813 | 533 |
| 1300 | 3300005471 | Ga0070698_100002589 | Ga0070698_1000025895 | 533 |
| 1301 | 3300005471 | Ga0070698_100038577 | Ga0070698_1000385775 | 533 |
| 1302 | 3300005471 | Ga0070698_100053249 | Ga0070698_1000532493 | 533 |
| 1303 | 3300005518 | Ga0070699_100000775 | Ga0070699_10000077522 | 533 |
| 1304 | 3300005518 | Ga0070699_100091366 | Ga0070699_1000913662 | 533 |
| 1305 | 3300005536 | Ga0070697_100051710 | Ga0070697_1000517102 | 533 |
| 1306 | 3300005546 | Ga0070696_100067165 | Ga0070696_1000671652 | 533 |
| 1307 | 3300005564 | Ga0070664_100020858 | Ga0070664_1000208582 | 533 |
| 1308 | 3300005577 | Ga0068857_100145432 | Ga0068857_1001454322 | 533 |
| 1309 | 3300005618 | Ga0068864_100000022 | Ga0068864_100000022210 | 533 |
| 1310 | 3300006028 | Ga0070717_10034110 | Ga0070717_100341103 | 533 |
| 1311 | 3300006881 | Ga0068865_100007151 | Ga0068865_1000071512 | 533 |
| 1312 | 3300009147 | Ga0114129_10142954 | Ga0114129_101429542 | 533 |
| 1313 | 3300013250 | Ga0171462_1003 | Ga0171462_1003586 | 533 |
| 1314 | 3300013296 | Ga0157374_10000012 | Ga0157374_10000012424 | 533 |
| 1315 | 3300013308 | Ga0157375_10000007 | Ga0157375_10000007240 | 533 |
| 1316 | 3300014745 | Ga0157377_10000002 | Ga0157377_1000000217 | 533 |
| 1317 | 3300014969 | Ga0157376_10000020 | Ga0157376_10000020164 | 533 |
| 1318 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002521 | 533 |
| 1319 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001604 | 533 |
| 1320 | 3300021384 | Ga0213876_10000063 | Ga0213876_10000063121 | 533 |
| 1321 | 3300025907 | Ga0207645_10005837 | Ga0207645_100058371 | 533 |
| 1322 | 3300025910 | Ga0207684_10022988 | Ga0207684_100229884 | 533 |
| 1323 | 3300025910 | Ga0207684_10043948 | Ga0207684_100439483 | 533 |
| 1324 | 3300025912 | Ga0207707_10029214 | Ga0207707_100292143 | 533 |
| 1325 | 3300025922 | Ga0207646_10001485 | Ga0207646_1000148512 | 533 |
| 1326 | 3300025922 | Ga0207646_10001492 | Ga0207646_1000149219 | 533 |
| 1327 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000011897 | 533 |
| 1328 | 3300025925 | Ga0207650_10015087 | Ga0207650_100150875 | 533 |
| 1329 | 3300025926 | Ga0207659_10026627 | Ga0207659_100266272 | 533 |
| 1330 | 3300025945 | Ga0207679_10041837 | Ga0207679_100418372 | 533 |
| 1331 | 3300025981 | Ga0207640_10019654 | Ga0207640_100196542 | 533 |
| 1332 | 3300025981 | Ga0207640_10144269 | Ga0207640_101442691 | 533 |
| 1333 | 3300026023 | Ga0207677_10000009 | Ga0207677_1000000959 | 533 |
| 1334 | 3300026023 | Ga0207677_10153420 | Ga0207677_101534201 | 533 |
| 1335 | 3300026067 | Ga0207678_10107168 | Ga0207678_101071682 | 533 |
| 1336 | 3300026075 | Ga0207708_10023705 | Ga0207708_100237053 | 533 |
| 1337 | 3300026095 | Ga0207676_10000029 | Ga0207676_1000002930 | 533 |
| 1338 | 3300026116 | Ga0207674_10018062 | Ga0207674_100180626 | 533 |
| 1339 | 3300027907 | Ga0207428_10002865 | Ga0207428_1000286515 | 533 |
| 1340 | 3300028577 | Ga0265318_10011370 | Ga0265318_100113705 | 533 |
| 1341 | 3300031238 | Ga0265332_10006386 | Ga0265332_100063862 | 533 |
| 1342 | 3300031242 | Ga0265329_10007409 | Ga0265329_100074092 | 533 |
| 1343 | 3300031249 | Ga0265339_10001286 | Ga0265339_1000128620 | 533 |
| 1344 | 3300031250 | Ga0265331_10007279 | Ga0265331_100072796 | 533 |
| 1345 | 3300031344 | Ga0265316_10066938 | Ga0265316_100669383 | 533 |
| 1346 | 3300031344 | Ga0265316_10069887 | Ga0265316_100698872 | 533 |
| 1347 | 3300031665 | Ga0316575_10002135 | Ga0316575_100021358 | 533 |
| 1348 | 3300031711 | Ga0265314_10001416 | Ga0265314_100014167 | 533 |
| 1349 | 3300031711 | Ga0265314_10003480 | Ga0265314_1000348017 | 533 |
| 1350 | 3300031712 | Ga0265342_10050856 | Ga0265342_100508561 | 533 |
| 1351 | 3300035695 | Ga0373927_0002624 | Ga0373927_0002624_9242_10843 | 533 |
| 1352 | 3300037418 | Ga0395900_0124953 | Ga0395900_0124953_86_1687 | 533 |
| 1353 | 3300038443 | Ga0395901_0123138 | Ga0395901_0123138_109_1710 | 533 |
| 1354 | 3300039437 | Ga0436365_0774883 | Ga0436365_0774883_73688_75295 | 533 |
| 1355 | 3300039437 | Ga0436365_0818746 | Ga0436365_0818746_78269_79876 | 533 |
| 1356 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_407986_409593 | 533 |
| 1357 | 3300042131 | Ga0450894_000652 | Ga0450894_000652_3238_4845 | 533 |
| 1358 | 3300042184 | Ga0450908_003056 | Ga0450908_003056_561_2168 | 533 |
| 1359 | 3300044712 | Ga0453684_0000132 | Ga0453684_0000132_26262_27872 | 533 |
| 1360 | 3300049570 | Ga0501033_0028306 | Ga0501033_0028306_1827_3428 | 533 |
| 1361 | 3300049571 | Ga0501034_0011724 | Ga0501034_0011724_4790_6391 | 533 |
| 1362 | 3300049571 | Ga0501034_0027517 | Ga0501034_0027517_3745_5352 | 533 |
| 1363 | 3300049572 | Ga0501036_0001771 | Ga0501036_0001771_12933_14534 | 533 |
| 1364 | 3300049574 | Ga0501038_0000494 | Ga0501038_0000494_17754_19355 | 533 |
| 1365 | 3300049579 | Ga0501043_0001194 | Ga0501043_0001194_2242_3843 | 533 |
| 1366 | 3300049580 | Ga0501046_0013469 | Ga0501046_0013469_3362_4963 | 533 |
| 1367 | 3300049581 | Ga0501047_0008793 | Ga0501047_0008793_4790_6391 | 533 |
| 1368 | 3300049586 | Ga0501070_0000245 | Ga0501070_0000245_12757_14361 | 533 |
| 1369 | 3300049588 | Ga0501072_0160021 | Ga0501072_0160021_73_1728 | 533 |
| 1370 | 3300049822 | Ga0501035_0019919 | Ga0501035_0019919_719_2320 | 533 |
| 1371 | 3300049823 | Ga0501044_0008979 | Ga0501044_0008979_2167_3768 | 533 |
| 1372 | 3300050507 | nmdc:mga05p37_46055_c1 | nmdc:mga05p37_46055_c1_1167_2774 | 533 |
| 1373 | 3300050515 | nmdc:mga0a205_179401_c1 | nmdc:mga0a205_179401_c1_219_1826 | 533 |
| 1374 | 3300054114 | Ga0501084_0115344 | Ga0501084_0115344_231_1886 | 533 |
| 1375 | iso_pu_bacteria | 2582581314 | 2585319764 | 533 |
| 1376 | iso_pu_bacteria | 2643221714 | 2644625593 | 533 |
| 1377 | iso_pu_bacteria | 2808606982 | 2811848414 | 533 |
| 1378 | iso_pu_bacteria | 2821268502 | 2821269842 | 533 |
| 1379 | iso_pu_bacteria | 2912715099 | 2912720678 | 533 |
| 1380 | iso_pu_bacteria | 2919468124 | 2919473531 | 533 |
| 1381 | iso_pu_bacteria | 8056060235 | 8056064235 | 533 |
| 1382 | 3300003203 | JGI25406J46586_10000038 | JGI25406J46586_1000003863 | 534 |
| 1383 | 3300003215 | JGI25153J46596_10004138 | JGI25153J46596_100041388 | 534 |
| 1384 | 3300003794 | Ga0055531_10007154 | Ga0055531_100071545 | 534 |
| 1385 | 3300005262 | Ga0065165_1002138 | Ga0065165_10021386 | 534 |
| 1386 | 3300005339 | Ga0070660_100092472 | Ga0070660_1000924722 | 534 |
| 1387 | 3300005356 | Ga0070674_100127978 | Ga0070674_1001279781 | 534 |
| 1388 | 3300005435 | Ga0070714_100027807 | Ga0070714_1000278072 | 534 |
| 1389 | 3300005436 | Ga0070713_100003848 | Ga0070713_1000038486 | 534 |
| 1390 | 3300005539 | Ga0068853_100095410 | Ga0068853_1000954102 | 534 |
| 1391 | 3300005843 | Ga0068860_100000738 | Ga0068860_10000073828 | 534 |
| 1392 | 3300005937 | Ga0081455_10001075 | Ga0081455_100010753 | 534 |
| 1393 | 3300005983 | Ga0081540_1029910 | Ga0081540_10299103 | 534 |
| 1394 | 3300005985 | Ga0081539_10000080 | Ga0081539_10000080147 | 534 |
| 1395 | 3300006028 | Ga0070717_10013078 | Ga0070717_100130784 | 534 |
| 1396 | 3300006051 | Ga0075364_10039185 | Ga0075364_100391852 | 534 |
| 1397 | 3300006163 | Ga0070715_10004225 | Ga0070715_100042252 | 534 |
| 1398 | 3300006173 | Ga0070716_100021983 | Ga0070716_1000219832 | 534 |
| 1399 | 3300006175 | Ga0070712_100049698 | Ga0070712_1000496982 | 534 |
| 1400 | 3300006881 | Ga0068865_100018710 | Ga0068865_1000187102 | 534 |
| 1401 | 3300009101 | Ga0105247_10049743 | Ga0105247_100497432 | 534 |
| 1402 | 3300009176 | Ga0105242_10000242 | Ga0105242_1000024225 | 534 |
| 1403 | 3300009545 | Ga0105237_10019662 | Ga0105237_100196624 | 534 |
| 1404 | 3300009551 | Ga0105238_10015030 | Ga0105238_100150304 | 534 |
| 1405 | 3300009551 | Ga0105238_10049660 | Ga0105238_100496604 | 534 |
| 1406 | 3300021361 | Ga0213872_10000836 | Ga0213872_1000083618 | 534 |
| 1407 | 3300021388 | Ga0213875_10014263 | Ga0213875_100142633 | 534 |
| 1408 | 3300025253 | Ga0209677_103362 | Ga0209677_1033622 | 534 |
| 1409 | 3300025261 | Ga0209233_1001798 | Ga0209233_10017983 | 534 |
| 1410 | 3300025295 | Ga0209564_1019348 | Ga0209564_10193482 | 534 |
| 1411 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021476 | 534 |
| 1412 | 3300025297 | Ga0209758_1001994 | Ga0209758_100199411 | 534 |
| 1413 | 3300025297 | Ga0209758_1002553 | Ga0209758_100255313 | 534 |
| 1414 | 3300025304 | Ga0209257_1000527 | Ga0209257_100052725 | 534 |
| 1415 | 3300025905 | Ga0207685_10001447 | Ga0207685_100014472 | 534 |
| 1416 | 3300025906 | Ga0207699_10003289 | Ga0207699_100032893 | 534 |
| 1417 | 3300025915 | Ga0207693_10021947 | Ga0207693_100219472 | 534 |
| 1418 | 3300025916 | Ga0207663_10000963 | Ga0207663_100009639 | 534 |
| 1419 | 3300025919 | Ga0207657_10032334 | Ga0207657_100323343 | 534 |
| 1420 | 3300025924 | Ga0207694_10012840 | Ga0207694_100128402 | 534 |
| 1421 | 3300025928 | Ga0207700_10010941 | Ga0207700_100109414 | 534 |
| 1422 | 3300025929 | Ga0207664_10028741 | Ga0207664_100287413 | 534 |
| 1423 | 3300025934 | Ga0207686_10004180 | Ga0207686_100041802 | 534 |
| 1424 | 3300025937 | Ga0207669_10022675 | Ga0207669_100226752 | 534 |
| 1425 | 3300025939 | Ga0207665_10010799 | Ga0207665_100107994 | 534 |
| 1426 | 3300025940 | Ga0207691_10081360 | Ga0207691_100813602 | 534 |
| 1427 | 3300026075 | Ga0207708_10081144 | Ga0207708_100811442 | 534 |
| 1428 | 3300026078 | Ga0207702_10163310 | Ga0207702_101633102 | 534 |
| 1429 | 3300026089 | Ga0207648_10117322 | Ga0207648_101173222 | 534 |
| 1430 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003402 | 534 |
| 1431 | 3300027361 | Ga0209489_100003 | Ga0209489_100003453 | 534 |
| 1432 | 3300027363 | Ga0209700_100003 | Ga0209700_100003453 | 534 |
| 1433 | 3300027512 | Ga0209179_1002568 | Ga0209179_10025682 | 534 |
| 1434 | 3300028379 | Ga0268266_10002300 | Ga0268266_1000230018 | 534 |
| 1435 | 3300028381 | Ga0268264_10000043 | Ga0268264_10000043209 | 534 |
| 1436 | 3300028786 | Ga0307517_10000053 | Ga0307517_1000005363 | 534 |
| 1437 | 3300028794 | Ga0307515_10066126 | Ga0307515_100661264 | 534 |
| 1438 | 3300031235 | Ga0265330_10026724 | Ga0265330_100267242 | 534 |
| 1439 | 3300031241 | Ga0265325_10013593 | Ga0265325_100135932 | 534 |
| 1440 | 3300031616 | Ga0307508_10000001 | Ga0307508_10000001500 | 534 |
| 1441 | 3300031616 | Ga0307508_10013998 | Ga0307508_100139983 | 534 |
| 1442 | 3300031649 | Ga0307514_10010805 | Ga0307514_100108053 | 534 |
| 1443 | 3300031712 | Ga0265342_10015981 | Ga0265342_100159813 | 534 |
| 1444 | 3300031730 | Ga0307516_10007517 | Ga0307516_100075176 | 534 |
| 1445 | 3300035086 | Ga0373934_0000684 | Ga0373934_0000684_4990_6594 | 534 |
| 1446 | 3300035086 | Ga0373934_0026986 | Ga0373934_0026986_276_1880 | 534 |
| 1447 | 3300035117 | Ga0373953_0000768 | Ga0373953_0000768_1193_2797 | 534 |
| 1448 | 3300035118 | Ga0373954_0000045 | Ga0373954_0000045_32166_33770 | 534 |
| 1449 | 3300035119 | Ga0373956_0000635 | Ga0373956_0000635_5348_6952 | 534 |
| 1450 | 3300035172 | Ga0373955_0000519 | Ga0373955_0000519_681_2285 | 534 |
| 1451 | 3300035410 | Ga0373924_0010387 | Ga0373924_0010387_1624_3228 | 534 |
| 1452 | 3300035724 | Ga0373933_0000309 | Ga0373933_0000309_9908_11512 | 534 |
| 1453 | 3300035724 | Ga0373933_0001241 | Ga0373933_0001241_8421_10025 | 534 |
| 1454 | 3300036401 | Ga0373937_0000742 | Ga0373937_0000742_19997_21601 | 534 |
| 1455 | 3300037471 | Ga0395905_0009380 | Ga0395905_0009380_6897_8501 | 534 |
| 1456 | 3300037853 | Ga0436364_0476731 | Ga0436364_0476731_1566_3170 | 534 |
| 1457 | 3300039437 | Ga0436365_0843555 | Ga0436365_0843555_444_2048 | 534 |
| 1458 | 3300039447 | Ga0436361_0307998 | Ga0436361_0307998_506_2113 | 534 |
| 1459 | 3300039447 | Ga0436361_0319598 | Ga0436361_0319598_15399_17006 | 534 |
| 1460 | 3300039447 | Ga0436361_0922325 | Ga0436361_0922325_190_1794 | 534 |
| 1461 | 3300039450 | Ga0436363_1052713 | Ga0436363_1052713_162_1766 | 534 |
| 1462 | 3300042002 | Ga0439442_000327 | Ga0439442_000327_1238_2845 | 534 |
| 1463 | 3300044693 | Ga0466961_0022355 | Ga0466961_0022355_1121_2728 | 534 |
| 1464 | 3300046452 | Ga0495617_025787 | Ga0495617_025787_165_1769 | 534 |
| 1465 | 3300046454 | Ga0495592_0000436 | Ga0495592_0000436_13051_14655 | 534 |
| 1466 | 3300046455 | Ga0495603_0032454 | Ga0495603_0032454_937_2541 | 534 |
| 1467 | 3300046455 | Ga0495603_0048284 | Ga0495603_0048284_624_2291 | 534 |
| 1468 | 3300046459 | Ga0495629_0000257 | Ga0495629_0000257_22958_24562 | 534 |
| 1469 | 3300046462 | Ga0495651_0003296 | Ga0495651_0003296_682_2286 | 534 |
| 1470 | 3300046463 | Ga0495653_0000288 | Ga0495653_0000288_24340_25944 | 534 |
| 1471 | 3300046499 | Ga0495594_0033120 | Ga0495594_0033120_291_1895 | 534 |
| 1472 | 3300046507 | Ga0495606_0086059 | Ga0495606_0086059_210_1814 | 534 |
| 1473 | 3300046511 | Ga0495608_0001126 | Ga0495608_0001126_16634_18238 | 534 |
| 1474 | 3300046511 | Ga0495608_0023176 | Ga0495608_0023176_1541_3145 | 534 |
| 1475 | 3300046519 | Ga0495632_0032470 | Ga0495632_0032470_12_1616 | 534 |
| 1476 | 3300046522 | Ga0495643_0016919 | Ga0495643_0016919_1393_2997 | 534 |
| 1477 | 3300046524 | Ga0495648_0000717 | Ga0495648_0000717_25629_27233 | 534 |
| 1478 | 3300046529 | Ga0495652_0041591 | Ga0495652_0041591_2083_3717 | 534 |
| 1479 | 3300046536 | Ga0495587_0000584 | Ga0495587_0000584_667_2271 | 534 |
| 1480 | 3300046559 | Ga0495667_0000700 | Ga0495667_0000700_14271_15875 | 534 |
| 1481 | 3300046663 | Ga0495635_0000040 | Ga0495635_0000040_68649_70253 | 534 |
| 1482 | 3300046675 | Ga0495657_0001715 | Ga0495657_0001715_16506_18110 | 534 |
| 1483 | 3300046678 | Ga0495599_0000120 | Ga0495599_0000120_15443_17047 | 534 |
| 1484 | 3300046678 | Ga0495599_0016254 | Ga0495599_0016254_839_2473 | 534 |
| 1485 | 3300046679 | Ga0495623_0006814 | Ga0495623_0006814_1703_3307 | 534 |
| 1486 | 3300046809 | Ga0495600_0000074 | Ga0495600_0000074_22832_24436 | 534 |
| 1487 | 3300047317 | Ga0495604_0001303 | Ga0495604_0001303_9120_10724 | 534 |
| 1488 | 3300047322 | Ga0495680_0001054 | Ga0495680_0001054_23197_24801 | 534 |
| 1489 | 3300047444 | Ga0495675_0000382 | Ga0495675_0000382_13207_14811 | 534 |
| 1490 | 3300047444 | Ga0495675_0024379 | Ga0495675_0024379_975_2591 | 534 |
| 1491 | 3300047469 | Ga0495673_0014454 | Ga0495673_0014454_2164_3768 | 534 |
| 1492 | 3300047471 | Ga0495684_0000134 | Ga0495684_0000134_16506_18110 | 534 |
| 1493 | 3300047673 | Ga0495593_0011569 | Ga0495593_0011569_202_1806 | 534 |
| 1494 | 3300048088 | Ga0495602_0002953 | Ga0495602_0002953_2379_3983 | 534 |
| 1495 | 3300048915 | Ga0496112_0012770 | Ga0496112_0012770_1385_2989 | 534 |
| 1496 | 3300048924 | Ga0496121_0068817 | Ga0496121_0068817_101_1705 | 534 |
| 1497 | 3300048927 | Ga0496124_0038597 | Ga0496124_0038597_2452_4059 | 534 |
| 1498 | 3300049569 | Ga0501032_0006523 | Ga0501032_0006523_2229_3836 | 534 |
| 1499 | 3300049570 | Ga0501033_0005255 | Ga0501033_0005255_2310_3962 | 534 |
| 1500 | 3300049570 | Ga0501033_0056476 | Ga0501033_0056476_278_1885 | 534 |
| 1501 | 3300049571 | Ga0501034_0001007 | Ga0501034_0001007_22965_24617 | 534 |
| 1502 | 3300049571 | Ga0501034_0005401 | Ga0501034_0005401_10868_12475 | 534 |
| 1503 | 3300049572 | Ga0501036_0002177 | Ga0501036_0002177_8213_9865 | 534 |
| 1504 | 3300049572 | Ga0501036_0023231 | Ga0501036_0023231_1423_3030 | 534 |
| 1505 | 3300049573 | Ga0501037_0004111 | Ga0501037_0004111_4048_5655 | 534 |
| 1506 | 3300049573 | Ga0501037_0009303 | Ga0501037_0009303_5107_6711 | 534 |
| 1507 | 3300049574 | Ga0501038_0009471 | Ga0501038_0009471_464_2068 | 534 |
| 1508 | 3300049575 | Ga0501039_0002404 | Ga0501039_0002404_5204_6811 | 534 |
| 1509 | 3300049579 | Ga0501043_0002005 | Ga0501043_0002005_13589_15241 | 534 |
| 1510 | 3300049579 | Ga0501043_0043791 | Ga0501043_0043791_278_1885 | 534 |
| 1511 | 3300049580 | Ga0501046_0004738 | Ga0501046_0004738_7197_8804 | 534 |
| 1512 | 3300049581 | Ga0501047_0000341 | Ga0501047_0000341_10084_11688 | 534 |
| 1513 | 3300049581 | Ga0501047_0045621 | Ga0501047_0045621_2185_3789 | 534 |
| 1514 | 3300049581 | Ga0501047_0092569 | Ga0501047_0092569_1017_2624 | 534 |
| 1515 | 3300049582 | Ga0501048_0004373 | Ga0501048_0004373_7767_9374 | 534 |
| 1516 | 3300049585 | Ga0501069_0046880 | Ga0501069_0046880_529_2133 | 534 |
| 1517 | 3300049586 | Ga0501070_0003719 | Ga0501070_0003719_5218_6825 | 534 |
| 1518 | 3300049588 | Ga0501072_0013474 | Ga0501072_0013474_1592_3196 | 534 |
| 1519 | 3300049590 | Ga0501074_0015861 | Ga0501074_0015861_1660_3264 | 534 |
| 1520 | 3300049593 | Ga0501077_0086679 | Ga0501077_0086679_248_1852 | 534 |
| 1521 | 3300049741 | Ga0501079_0103320 | Ga0501079_0103320_519_2123 | 534 |
| 1522 | 3300049744 | Ga0501083_0002138 | Ga0501083_0002138_4524_6128 | 534 |
| 1523 | 3300049822 | Ga0501035_0034003 | Ga0501035_0034003_706_2310 | 534 |
| 1524 | 3300049822 | Ga0501035_0048332 | Ga0501035_0048332_1017_2624 | 534 |
| 1525 | 3300049823 | Ga0501044_0002168 | Ga0501044_0002168_17893_19509 | 534 |
| 1526 | 3300049823 | Ga0501044_0006203 | Ga0501044_0006203_6981_8585 | 534 |
| 1527 | 3300049823 | Ga0501044_0027416 | Ga0501044_0027416_950_2557 | 534 |
| 1528 | 3300049823 | Ga0501044_0107446 | Ga0501044_0107446_1102_2706 | 534 |
| 1529 | 3300049824 | Ga0501045_0008635 | Ga0501045_0008635_3999_5603 | 534 |
| 1530 | 3300049824 | Ga0501045_0020968 | Ga0501045_0020968_311_1918 | 534 |
| 1531 | 3300050516 | nmdc:mga0sz30_33994_c1 | nmdc:mga0sz30_33994_c1_345_1949 | 534 |
| 1532 | 3300053080 | Ga0500635_0000039 | Ga0500635_0000039_38155_39762 | 534 |
| 1533 | 3300053084 | Ga0495595_0000064 | Ga0495595_0000064_29288_30892 | 534 |
| 1534 | 3300053084 | Ga0495595_0011328 | Ga0495595_0011328_1354_2958 | 534 |
| 1535 | 3300053085 | Ga0495619_0000995 | Ga0495619_0000995_16750_18354 | 534 |
| 1536 | 3300053085 | Ga0495619_0021913 | Ga0495619_0021913_1652_3256 | 534 |
| 1537 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_250985_252589 | 534 |
| 1538 | 3300053094 | Ga0500566_0000010 | Ga0500566_0000010_88935_90539 | 534 |
| 1539 | 3300053095 | Ga0500640_031403 | Ga0500640_031403_19_1623 | 534 |
| 1540 | 3300053105 | Ga0500557_000002 | Ga0500557_000002_171495_173099 | 534 |
| 1541 | 3300053111 | Ga0500572_000031 | Ga0500572_000031_29413_31017 | 534 |
| 1542 | 3300053119 | Ga0500595_000914 | Ga0500595_000914_972_2576 | 534 |
| 1543 | 3300053130 | Ga0500642_0000043 | Ga0500642_0000043_30997_32601 | 534 |
| 1544 | 3300053134 | Ga0500658_0027562 | Ga0500658_0027562_403_2007 | 534 |
| 1545 | 3300053136 | Ga0500559_0008850 | Ga0500559_0008850_405_2009 | 534 |
| 1546 | 3300053153 | Ga0500616_0002646 | Ga0500616_0002646_11284_12891 | 534 |
| 1547 | 3300053153 | Ga0500616_0023420 | Ga0500616_0023420_309_1913 | 534 |
| 1548 | 3300053156 | Ga0500622_0028141 | Ga0500622_0028141_979_2583 | 534 |
| 1549 | 3300053163 | Ga0500639_000084 | Ga0500639_000084_2408_4012 | 534 |
| 1550 | iso_pu_bacteria | 2585428094 | 2587864480 | 534 |
| 1551 | iso_pu_bacteria | 2833709550 | 2833710765 | 534 |
| 1552 | iso_pu_bacteria | 8045830549 | 8045830995 | 534 |
| 1553 | 3300001915 | JGI24741J21665_1000834 | JGI24741J21665_10008344 | 535 |
| 1554 | 3300001979 | JGI24740J21852_10002020 | JGI24740J21852_100020206 | 535 |
| 1555 | 3300001979 | JGI24740J21852_10002025 | JGI24740J21852_100020254 | 535 |
| 1556 | 3300001979 | JGI24740J21852_10005408 | JGI24740J21852_100054081 | 535 |
| 1557 | 3300001989 | JGI24739J22299_10002379 | JGI24739J22299_100023793 | 535 |
| 1558 | 3300002067 | JGI24735J21928_10001288 | JGI24735J21928_100012886 | 535 |
| 1559 | 3300002704 | JGI25155J39150_1000064 | JGI25155J39150_100006435 | 535 |
| 1560 | 3300002705 | JGI25156J39149_1000085 | JGI25156J39149_100008535 | 535 |
| 1561 | 3300002705 | JGI25156J39149_1000327 | JGI25156J39149_100032730 | 535 |
| 1562 | 3300002738 | JGI25154J39366_1000112 | JGI25154J39366_100011235 | 535 |
| 1563 | 3300002741 | JGI25157J39369_1000109 | JGI25157J39369_100010935 | 535 |
| 1564 | 3300002773 | JGI25152J39213_1001187 | JGI25152J39213_10011879 | 535 |
| 1565 | 3300002773 | JGI25152J39213_1003929 | JGI25152J39213_10039294 | 535 |
| 1566 | 3300002774 | JGI25150J39212_1002997 | JGI25150J39212_10029974 | 535 |
| 1567 | 3300002987 | JGI25159J45721_1000075 | JGI25159J45721_100007539 | 535 |
| 1568 | 3300002987 | JGI25159J45721_1000246 | JGI25159J45721_100024619 | 535 |
| 1569 | 3300002987 | JGI25159J45721_1000672 | JGI25159J45721_10006727 | 535 |
| 1570 | 3300003187 | JGI25151J46595_10001019 | JGI25151J46595_1000101919 | 535 |
| 1571 | 3300003187 | JGI25151J46595_10004632 | JGI25151J46595_100046323 | 535 |
| 1572 | 3300003215 | JGI25153J46596_10006260 | JGI25153J46596_100062602 | 535 |
| 1573 | 3300003215 | JGI25153J46596_10016966 | JGI25153J46596_100169662 | 535 |
| 1574 | 3300003354 | JGI25160J50197_1000073 | JGI25160J50197_10000739 | 535 |
| 1575 | 3300003354 | JGI25160J50197_1000451 | JGI25160J50197_100045119 | 535 |
| 1576 | 3300003354 | JGI25160J50197_1008868 | JGI25160J50197_10088682 | 535 |
| 1577 | 3300003374 | JGI25161J50226_1000077 | JGI25161J50226_100007741 | 535 |
| 1578 | 3300003374 | JGI25161J50226_1005007 | JGI25161J50226_10050072 | 535 |
| 1579 | 3300003374 | JGI25161J50226_1005903 | JGI25161J50226_10059032 | 535 |
| 1580 | 3300003752 | Ga0055539_1000645 | Ga0055539_10006456 | 535 |
| 1581 | 3300003758 | Ga0055532_1000006 | Ga0055532_1000006397 | 535 |
| 1582 | 3300003759 | Ga0055525_1000004 | Ga0055525_100000482 | 535 |
| 1583 | 3300003759 | Ga0055525_1000837 | Ga0055525_10008376 | 535 |
| 1584 | 3300003761 | Ga0055535_1000004 | Ga0055535_1000004397 | 535 |
| 1585 | 3300003763 | Ga0055529_1000273 | Ga0055529_100027351 | 535 |
| 1586 | 3300003763 | Ga0055529_1000539 | Ga0055529_100053917 | 535 |
| 1587 | 3300003771 | Ga0055526_1001057 | Ga0055526_10010578 | 535 |
| 1588 | 3300003771 | Ga0055526_1001658 | Ga0055526_100165813 | 535 |
| 1589 | 3300003771 | Ga0055526_1010931 | Ga0055526_10109314 | 535 |
| 1590 | 3300003771 | Ga0055526_1016079 | Ga0055526_10160791 | 535 |
| 1591 | 3300003771 | Ga0055526_1026338 | Ga0055526_10263381 | 535 |
| 1592 | 3300003773 | Ga0055537_1000621 | Ga0055537_100062112 | 535 |
| 1593 | 3300003773 | Ga0055537_1003681 | Ga0055537_10036813 | 535 |
| 1594 | 3300003775 | Ga0055524_1000294 | Ga0055524_100029418 | 535 |
| 1595 | 3300003775 | Ga0055524_1000344 | Ga0055524_100034432 | 535 |
| 1596 | 3300003775 | Ga0055524_1001108 | Ga0055524_10011082 | 535 |
| 1597 | 3300003775 | Ga0055524_1003409 | Ga0055524_10034093 | 535 |
| 1598 | 3300003775 | Ga0055524_1004948 | Ga0055524_10049483 | 535 |
| 1599 | 3300003775 | Ga0055524_1013468 | Ga0055524_10134683 | 535 |
| 1600 | 3300003781 | Ga0055536_1000700 | Ga0055536_100070011 | 535 |
| 1601 | 3300003784 | Ga0055534_1005181 | Ga0055534_10051811 | 535 |
| 1602 | 3300003791 | Ga0055530_10000853 | Ga0055530_1000085320 | 535 |
| 1603 | 3300003791 | Ga0055530_10000981 | Ga0055530_100009813 | 535 |
| 1604 | 3300003791 | Ga0055530_10009711 | Ga0055530_100097113 | 535 |
| 1605 | 3300003792 | Ga0055540_1000028 | Ga0055540_100002881 | 535 |
| 1606 | 3300003792 | Ga0055540_1000139 | Ga0055540_100013928 | 535 |
| 1607 | 3300003794 | Ga0055531_10000393 | Ga0055531_100003938 | 535 |
| 1608 | 3300003794 | Ga0055531_10000440 | Ga0055531_1000044014 | 535 |
| 1609 | 3300003794 | Ga0055531_10000717 | Ga0055531_100007175 | 535 |
| 1610 | 3300003794 | Ga0055531_10005930 | Ga0055531_100059305 | 535 |
| 1611 | 3300003794 | Ga0055531_10008527 | Ga0055531_100085274 | 535 |
| 1612 | 3300003794 | Ga0055531_10019798 | Ga0055531_100197982 | 535 |
| 1613 | 3300004625 | Ga0055543_1000629 | Ga0055543_100062915 | 535 |
| 1614 | 3300004625 | Ga0055543_1001603 | Ga0055543_10016038 | 535 |
| 1615 | 3300005262 | Ga0065165_1000081 | Ga0065165_100008178 | 535 |
| 1616 | 3300005262 | Ga0065165_1000198 | Ga0065165_10001989 | 535 |
| 1617 | 3300005262 | Ga0065165_1000289 | Ga0065165_10002897 | 535 |
| 1618 | 3300005262 | Ga0065165_1001190 | Ga0065165_10011907 | 535 |
| 1619 | 3300005262 | Ga0065165_1001706 | Ga0065165_100170619 | 535 |
| 1620 | 3300005262 | Ga0065165_1008159 | Ga0065165_10081593 | 535 |
| 1621 | 3300005327 | Ga0070658_10019632 | Ga0070658_100196324 | 535 |
| 1622 | 3300005329 | Ga0070683_100010112 | Ga0070683_1000101124 | 535 |
| 1623 | 3300005338 | Ga0068868_100001788 | Ga0068868_10000178813 | 535 |
| 1624 | 3300005338 | Ga0068868_100154722 | Ga0068868_1001547222 | 535 |
| 1625 | 3300005339 | Ga0070660_100000277 | Ga0070660_10000027714 | 535 |
| 1626 | 3300005339 | Ga0070660_100003674 | Ga0070660_1000036744 | 535 |
| 1627 | 3300005339 | Ga0070660_100051219 | Ga0070660_1000512192 | 535 |
| 1628 | 3300005339 | Ga0070660_100142088 | Ga0070660_1001420881 | 535 |
| 1629 | 3300005344 | Ga0070661_100004670 | Ga0070661_1000046704 | 535 |
| 1630 | 3300005344 | Ga0070661_100009592 | Ga0070661_1000095922 | 535 |
| 1631 | 3300005347 | Ga0070668_100046300 | Ga0070668_1000463003 | 535 |
| 1632 | 3300005353 | Ga0070669_100036550 | Ga0070669_1000365502 | 535 |
| 1633 | 3300005355 | Ga0070671_100011241 | Ga0070671_1000112411 | 535 |
| 1634 | 3300005355 | Ga0070671_100064802 | Ga0070671_1000648021 | 535 |
| 1635 | 3300005356 | Ga0070674_100036475 | Ga0070674_1000364752 | 535 |
| 1636 | 3300005366 | Ga0070659_100000616 | Ga0070659_10000061620 | 535 |
| 1637 | 3300005366 | Ga0070659_100000738 | Ga0070659_10000073816 | 535 |
| 1638 | 3300005367 | Ga0070667_100002525 | Ga0070667_10000252512 | 535 |
| 1639 | 3300005434 | Ga0070709_10023418 | Ga0070709_100234184 | 535 |
| 1640 | 3300005435 | Ga0070714_100034976 | Ga0070714_1000349764 | 535 |
| 1641 | 3300005436 | Ga0070713_100000093 | Ga0070713_1000000939 | 535 |
| 1642 | 3300005436 | Ga0070713_100073880 | Ga0070713_1000738803 | 535 |
| 1643 | 3300005441 | Ga0070700_100009093 | Ga0070700_1000090933 | 535 |
| 1644 | 3300005455 | Ga0070663_100000239 | Ga0070663_10000023914 | 535 |
| 1645 | 3300005455 | Ga0070663_100003172 | Ga0070663_1000031724 | 535 |
| 1646 | 3300005455 | Ga0070663_100005073 | Ga0070663_1000050737 | 535 |
| 1647 | 3300005455 | Ga0070663_100006029 | Ga0070663_1000060295 | 535 |
| 1648 | 3300005456 | Ga0070678_100022120 | Ga0070678_1000221205 | 535 |
| 1649 | 3300005457 | Ga0070662_100001899 | Ga0070662_1000018997 | 535 |
| 1650 | 3300005458 | Ga0070681_10010220 | Ga0070681_100102203 | 535 |
| 1651 | 3300005458 | Ga0070681_10075162 | Ga0070681_100751622 | 535 |
| 1652 | 3300005459 | Ga0068867_100004111 | Ga0068867_1000041119 | 535 |
| 1653 | 3300005468 | Ga0070707_100106642 | Ga0070707_1001066423 | 535 |
| 1654 | 3300005530 | Ga0070679_100010473 | Ga0070679_1000104739 | 535 |
| 1655 | 3300005530 | Ga0070679_100020760 | Ga0070679_1000207606 | 535 |
| 1656 | 3300005530 | Ga0070679_100055349 | Ga0070679_1000553494 | 535 |
| 1657 | 3300005535 | Ga0070684_100026787 | Ga0070684_1000267875 | 535 |
| 1658 | 3300005539 | Ga0068853_100004240 | Ga0068853_1000042407 | 535 |
| 1659 | 3300005543 | Ga0070672_100014412 | Ga0070672_1000144122 | 535 |
| 1660 | 3300005543 | Ga0070672_100100681 | Ga0070672_1001006812 | 535 |
| 1661 | 3300005544 | Ga0070686_100126171 | Ga0070686_1001261711 | 535 |
| 1662 | 3300005548 | Ga0070665_100021746 | Ga0070665_1000217462 | 535 |
| 1663 | 3300005548 | Ga0070665_100133251 | Ga0070665_1001332513 | 535 |
| 1664 | 3300005563 | Ga0068855_100001097 | Ga0068855_10000109728 | 535 |
| 1665 | 3300005563 | Ga0068855_100023215 | Ga0068855_1000232152 | 535 |
| 1666 | 3300005563 | Ga0068855_100070225 | Ga0068855_1000702253 | 535 |
| 1667 | 3300005564 | Ga0070664_100003001 | Ga0070664_10000300112 | 535 |
| 1668 | 3300005564 | Ga0070664_100006480 | Ga0070664_1000064804 | 535 |
| 1669 | 3300005564 | Ga0070664_100010765 | Ga0070664_1000107654 | 535 |
| 1670 | 3300005578 | Ga0068854_100005268 | Ga0068854_1000052682 | 535 |
| 1671 | 3300005578 | Ga0068854_100016111 | Ga0068854_1000161115 | 535 |
| 1672 | 3300005614 | Ga0068856_100003602 | Ga0068856_1000036025 | 535 |
| 1673 | 3300005614 | Ga0068856_100004835 | Ga0068856_10000483515 | 535 |
| 1674 | 3300005614 | Ga0068856_100005726 | Ga0068856_10000572614 | 535 |
| 1675 | 3300005614 | Ga0068856_100009539 | Ga0068856_1000095394 | 535 |
| 1676 | 3300005614 | Ga0068856_100048274 | Ga0068856_1000482742 | 535 |
| 1677 | 3300005616 | Ga0068852_100022892 | Ga0068852_1000228924 | 535 |
| 1678 | 3300005616 | Ga0068852_100026749 | Ga0068852_1000267494 | 535 |
| 1679 | 3300005617 | Ga0068859_100139880 | Ga0068859_1001398801 | 535 |
| 1680 | 3300005618 | Ga0068864_100052232 | Ga0068864_1000522323 | 535 |
| 1681 | 3300005718 | Ga0068866_10006888 | Ga0068866_100068883 | 535 |
| 1682 | 3300005834 | Ga0068851_10026514 | Ga0068851_100265142 | 535 |
| 1683 | 3300005841 | Ga0068863_100051325 | Ga0068863_1000513252 | 535 |
| 1684 | 3300005842 | Ga0068858_100045219 | Ga0068858_1000452193 | 535 |
| 1685 | 3300005843 | Ga0068860_100017416 | Ga0068860_1000174162 | 535 |
| 1686 | 3300005843 | Ga0068860_100041225 | Ga0068860_1000412253 | 535 |
| 1687 | 3300005843 | Ga0068860_100077969 | Ga0068860_1000779692 | 535 |
| 1688 | 3300005844 | Ga0068862_100140068 | Ga0068862_1001400682 | 535 |
| 1689 | 3300005937 | Ga0081455_10001410 | Ga0081455_1000141024 | 535 |
| 1690 | 3300005983 | Ga0081540_1012947 | Ga0081540_10129472 | 535 |
| 1691 | 3300005985 | Ga0081539_10001055 | Ga0081539_1000105518 | 535 |
| 1692 | 3300006028 | Ga0070717_10002063 | Ga0070717_1000206310 | 535 |
| 1693 | 3300006038 | Ga0075365_10004340 | Ga0075365_100043404 | 535 |
| 1694 | 3300006038 | Ga0075365_10116084 | Ga0075365_101160842 | 535 |
| 1695 | 3300006042 | Ga0075368_10010447 | Ga0075368_100104472 | 535 |
| 1696 | 3300006051 | Ga0075364_10000557 | Ga0075364_1000055711 | 535 |
| 1697 | 3300006051 | Ga0075364_10075295 | Ga0075364_100752952 | 535 |
| 1698 | 3300006178 | Ga0075367_10002592 | Ga0075367_100025924 | 535 |
| 1699 | 3300006195 | Ga0075366_10044974 | Ga0075366_100449742 | 535 |
| 1700 | 3300006353 | Ga0075370_10004866 | Ga0075370_100048662 | 535 |
| 1701 | 3300006353 | Ga0075370_10068181 | Ga0075370_100681811 | 535 |
| 1702 | 3300006353 | Ga0075370_10070139 | Ga0075370_100701391 | 535 |
| 1703 | 3300006358 | Ga0068871_100013192 | Ga0068871_1000131922 | 535 |
| 1704 | 3300006846 | Ga0075430_100045091 | Ga0075430_1000450913 | 535 |
| 1705 | 3300006880 | Ga0075429_100030646 | Ga0075429_1000306462 | 535 |
| 1706 | 3300006880 | Ga0075429_100045029 | Ga0075429_1000450293 | 535 |
| 1707 | 3300006914 | Ga0075436_100058444 | Ga0075436_1000584443 | 535 |
| 1708 | 3300006931 | Ga0097620_100139876 | Ga0097620_1001398762 | 535 |
| 1709 | 3300006944 | Ga0099823_1000051 | Ga0099823_100005130 | 535 |
| 1710 | 3300006946 | Ga0079104_1000058 | Ga0079104_100005822 | 535 |
| 1711 | 3300006946 | Ga0079104_1010357 | Ga0079104_10103572 | 535 |
| 1712 | 3300007265 | Ga0099794_10000111 | Ga0099794_100001113 | 535 |
| 1713 | 3300009092 | Ga0105250_10000418 | Ga0105250_1000041823 | 535 |
| 1714 | 3300009092 | Ga0105250_10002429 | Ga0105250_100024293 | 535 |
| 1715 | 3300009093 | Ga0105240_10001792 | Ga0105240_100017928 | 535 |
| 1716 | 3300009093 | Ga0105240_10183917 | Ga0105240_101839171 | 535 |
| 1717 | 3300009148 | Ga0105243_10002121 | Ga0105243_1000212116 | 535 |
| 1718 | 3300009148 | Ga0105243_10087266 | Ga0105243_100872662 | 535 |
| 1719 | 3300009174 | Ga0105241_10006534 | Ga0105241_100065345 | 535 |
| 1720 | 3300009176 | Ga0105242_10011026 | Ga0105242_100110267 | 535 |
| 1721 | 3300009177 | Ga0105248_10003122 | Ga0105248_100031225 | 535 |
| 1722 | 3300009177 | Ga0105248_10235281 | Ga0105248_102352812 | 535 |
| 1723 | 3300009545 | Ga0105237_10010949 | Ga0105237_100109492 | 535 |
| 1724 | 3300009545 | Ga0105237_10033777 | Ga0105237_100337773 | 535 |
| 1725 | 3300009553 | Ga0105249_10113727 | Ga0105249_101137271 | 535 |
| 1726 | 3300010375 | Ga0105239_10009133 | Ga0105239_100091336 | 535 |
| 1727 | 3300010375 | Ga0105239_10021898 | Ga0105239_100218985 | 535 |
| 1728 | 3300012497 | Ga0157319_1000004 | Ga0157319_100000410 | 535 |
| 1729 | 3300013100 | Ga0157373_10005110 | Ga0157373_100051102 | 535 |
| 1730 | 3300013100 | Ga0157373_10007554 | Ga0157373_100075541 | 535 |
| 1731 | 3300013100 | Ga0157373_10036275 | Ga0157373_100362751 | 535 |
| 1732 | 3300013102 | Ga0157371_10000330 | Ga0157371_1000033038 | 535 |
| 1733 | 3300013102 | Ga0157371_10006672 | Ga0157371_100066726 | 535 |
| 1734 | 3300013104 | Ga0157370_10000031 | Ga0157370_1000003150 | 535 |
| 1735 | 3300013104 | Ga0157370_10005558 | Ga0157370_100055581 | 535 |
| 1736 | 3300013104 | Ga0157370_10118328 | Ga0157370_101183282 | 535 |
| 1737 | 3300013105 | Ga0157369_10000905 | Ga0157369_1000090515 | 535 |
| 1738 | 3300013105 | Ga0157369_10001415 | Ga0157369_1000141524 | 535 |
| 1739 | 3300013105 | Ga0157369_10003573 | Ga0157369_100035732 | 535 |
| 1740 | 3300013249 | Ga0171463_1002 | Ga0171463_10029 | 535 |
| 1741 | 3300013296 | Ga0157374_10000141 | Ga0157374_1000014148 | 535 |
| 1742 | 3300013307 | Ga0157372_10003374 | Ga0157372_1000337413 | 535 |
| 1743 | 3300013307 | Ga0157372_10013312 | Ga0157372_100133124 | 535 |
| 1744 | 3300013307 | Ga0157372_10018145 | Ga0157372_100181455 | 535 |
| 1745 | 3300013308 | Ga0157375_10110400 | Ga0157375_101104002 | 535 |
| 1746 | 3300014325 | Ga0163163_10034114 | Ga0163163_100341142 | 535 |
| 1747 | 3300014326 | Ga0157380_10042129 | Ga0157380_100421293 | 535 |
| 1748 | 3300014745 | Ga0157377_10000069 | Ga0157377_1000006953 | 535 |
| 1749 | 3300014968 | Ga0157379_10137126 | Ga0157379_101371262 | 535 |
| 1750 | 3300015690 | Ga0183363_1304 | Ga0183363_13043 | 535 |
| 1751 | 3300017792 | Ga0163161_10033338 | Ga0163161_100333382 | 535 |
| 1752 | 3300021320 | Ga0214544_1000646 | Ga0214544_100064657 | 535 |
| 1753 | 3300021321 | Ga0214542_1000027 | Ga0214542_100002762 | 535 |
| 1754 | 3300021327 | Ga0214543_1000025 | Ga0214543_1000025129 | 535 |
| 1755 | 3300021327 | Ga0214543_1000047 | Ga0214543_100004736 | 535 |
| 1756 | 3300021361 | Ga0213872_10000031 | Ga0213872_1000003139 | 535 |
| 1757 | 3300021361 | Ga0213872_10000037 | Ga0213872_1000003741 | 535 |
| 1758 | 3300021361 | Ga0213872_10000107 | Ga0213872_1000010745 | 535 |
| 1759 | 3300021361 | Ga0213872_10026117 | Ga0213872_100261174 | 535 |
| 1760 | 3300022739 | Ga0228711_1021534 | Ga0228711_10215344 | 535 |
| 1761 | 3300022740 | Ga0228710_1006811 | Ga0228710_100681112 | 535 |
| 1762 | 3300025206 | Ga0209435_100002 | Ga0209435_100002666 | 535 |
| 1763 | 3300025208 | Ga0209436_100108 | Ga0209436_10010821 | 535 |
| 1764 | 3300025224 | Ga0209784_100006 | Ga0209784_100006658 | 535 |
| 1765 | 3300025224 | Ga0209784_100597 | Ga0209784_10059711 | 535 |
| 1766 | 3300025225 | Ga0209566_100002 | Ga0209566_100002658 | 535 |
| 1767 | 3300025225 | Ga0209566_100700 | Ga0209566_1007007 | 535 |
| 1768 | 3300025225 | Ga0209566_101395 | Ga0209566_1013953 | 535 |
| 1769 | 3300025226 | Ga0209674_100010 | Ga0209674_100010478 | 535 |
| 1770 | 3300025226 | Ga0209674_101858 | Ga0209674_1018583 | 535 |
| 1771 | 3300025226 | Ga0209674_102689 | Ga0209674_1026893 | 535 |
| 1772 | 3300025228 | Ga0209672_100020 | Ga0209672_10002050 | 535 |
| 1773 | 3300025228 | Ga0209672_100145 | Ga0209672_10014531 | 535 |
| 1774 | 3300025228 | Ga0209672_100390 | Ga0209672_1003908 | 535 |
| 1775 | 3300025229 | Ga0209147_100015 | Ga0209147_100015153 | 535 |
| 1776 | 3300025229 | Ga0209147_100024 | Ga0209147_10002450 | 535 |
| 1777 | 3300025229 | Ga0209147_100201 | Ga0209147_10020131 | 535 |
| 1778 | 3300025229 | Ga0209147_100256 | Ga0209147_10025633 | 535 |
| 1779 | 3300025230 | Ga0209563_100004 | Ga0209563_10000469 | 535 |
| 1780 | 3300025230 | Ga0209563_100013 | Ga0209563_10001382 | 535 |
| 1781 | 3300025242 | Ga0209258_100021 | Ga0209258_100021153 | 535 |
| 1782 | 3300025242 | Ga0209258_100084 | Ga0209258_10008450 | 535 |
| 1783 | 3300025242 | Ga0209258_100350 | Ga0209258_10035031 | 535 |
| 1784 | 3300025245 | Ga0207425_1000036 | Ga0207425_1000036103 | 535 |
| 1785 | 3300025245 | Ga0207425_1000238 | Ga0207425_100023841 | 535 |
| 1786 | 3300025245 | Ga0207425_1005562 | Ga0207425_10055622 | 535 |
| 1787 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012809 | 535 |
| 1788 | 3300025250 | Ga0209026_1000121 | Ga0209026_100012135 | 535 |
| 1789 | 3300025253 | Ga0209677_100007 | Ga0209677_100007658 | 535 |
| 1790 | 3300025254 | Ga0209148_1000327 | Ga0209148_100032731 | 535 |
| 1791 | 3300025254 | Ga0209148_1001409 | Ga0209148_10014095 | 535 |
| 1792 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000012440 | 535 |
| 1793 | 3300025256 | Ga0209759_1000052 | Ga0209759_1000052129 | 535 |
| 1794 | 3300025258 | Ga0209129_1000062 | Ga0209129_10000624 | 535 |
| 1795 | 3300025258 | Ga0209129_1001728 | Ga0209129_10017286 | 535 |
| 1796 | 3300025263 | Ga0209565_1000016 | Ga0209565_100001668 | 535 |
| 1797 | 3300025263 | Ga0209565_1003483 | Ga0209565_10034832 | 535 |
| 1798 | 3300025263 | Ga0209565_1004056 | Ga0209565_10040562 | 535 |
| 1799 | 3300025263 | Ga0209565_1004057 | Ga0209565_10040572 | 535 |
| 1800 | 3300025263 | Ga0209565_1012570 | Ga0209565_10125702 | 535 |
| 1801 | 3300025272 | Ga0209455_1000028 | Ga0209455_1000028153 | 535 |
| 1802 | 3300025272 | Ga0209455_1000248 | Ga0209455_100024831 | 535 |
| 1803 | 3300025273 | Ga0209673_1000057 | Ga0209673_1000057160 | 535 |
| 1804 | 3300025273 | Ga0209673_1000073 | Ga0209673_1000073210 | 535 |
| 1805 | 3300025273 | Ga0209673_1003353 | Ga0209673_10033534 | 535 |
| 1806 | 3300025273 | Ga0209673_1003969 | Ga0209673_10039696 | 535 |
| 1807 | 3300025273 | Ga0209673_1005102 | Ga0209673_10051021 | 535 |
| 1808 | 3300025273 | Ga0209673_1005325 | Ga0209673_10053251 | 535 |
| 1809 | 3300025273 | Ga0209673_1016859 | Ga0209673_10168592 | 535 |
| 1810 | 3300025284 | Ga0209130_1000040 | Ga0209130_1000040179 | 535 |
| 1811 | 3300025284 | Ga0209130_1000153 | Ga0209130_10001539 | 535 |
| 1812 | 3300025284 | Ga0209130_1000354 | Ga0209130_100035442 | 535 |
| 1813 | 3300025284 | Ga0209130_1004819 | Ga0209130_10048196 | 535 |
| 1814 | 3300025291 | Ga0209675_1000122 | Ga0209675_100012223 | 535 |
| 1815 | 3300025292 | Ga0209676_1000395 | Ga0209676_100039565 | 535 |
| 1816 | 3300025292 | Ga0209676_1000666 | Ga0209676_100066622 | 535 |
| 1817 | 3300025292 | Ga0209676_1028900 | Ga0209676_10289001 | 535 |
| 1818 | 3300025294 | Ga0209025_1000019 | Ga0209025_100001948 | 535 |
| 1819 | 3300025294 | Ga0209025_1000333 | Ga0209025_10003339 | 535 |
| 1820 | 3300025294 | Ga0209025_1003349 | Ga0209025_10033494 | 535 |
| 1821 | 3300025294 | Ga0209025_1004234 | Ga0209025_100423411 | 535 |
| 1822 | 3300025294 | Ga0209025_1013423 | Ga0209025_10134234 | 535 |
| 1823 | 3300025294 | Ga0209025_1015598 | Ga0209025_10155983 | 535 |
| 1824 | 3300025294 | Ga0209025_1024509 | Ga0209025_10245093 | 535 |
| 1825 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008168 | 535 |
| 1826 | 3300025295 | Ga0209564_1000014 | Ga0209564_100001478 | 535 |
| 1827 | 3300025295 | Ga0209564_1000280 | Ga0209564_10002809 | 535 |
| 1828 | 3300025295 | Ga0209564_1001246 | Ga0209564_10012468 | 535 |
| 1829 | 3300025295 | Ga0209564_1001744 | Ga0209564_100174415 | 535 |
| 1830 | 3300025295 | Ga0209564_1001751 | Ga0209564_100175120 | 535 |
| 1831 | 3300025295 | Ga0209564_1002020 | Ga0209564_100202013 | 535 |
| 1832 | 3300025295 | Ga0209564_1012428 | Ga0209564_10124282 | 535 |
| 1833 | 3300025295 | Ga0209564_1019034 | Ga0209564_10190341 | 535 |
| 1834 | 3300025297 | Ga0209758_1000126 | Ga0209758_100012696 | 535 |
| 1835 | 3300025297 | Ga0209758_1000129 | Ga0209758_1000129165 | 535 |
| 1836 | 3300025297 | Ga0209758_1003114 | Ga0209758_10031148 | 535 |
| 1837 | 3300025297 | Ga0209758_1009132 | Ga0209758_10091325 | 535 |
| 1838 | 3300025298 | Ga0209050_1000084 | Ga0209050_100008465 | 535 |
| 1839 | 3300025298 | Ga0209050_1000282 | Ga0209050_100028219 | 535 |
| 1840 | 3300025298 | Ga0209050_1000502 | Ga0209050_100050227 | 535 |
| 1841 | 3300025298 | Ga0209050_1000852 | Ga0209050_100085235 | 535 |
| 1842 | 3300025298 | Ga0209050_1002252 | Ga0209050_10022526 | 535 |
| 1843 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015109 | 535 |
| 1844 | 3300025299 | Ga0209256_1000064 | Ga0209256_10000649 | 535 |
| 1845 | 3300025299 | Ga0209256_1000313 | Ga0209256_10003139 | 535 |
| 1846 | 3300025299 | Ga0209256_1000811 | Ga0209256_100081121 | 535 |
| 1847 | 3300025299 | Ga0209256_1001123 | Ga0209256_10011239 | 535 |
| 1848 | 3300025299 | Ga0209256_1001124 | Ga0209256_10011245 | 535 |
| 1849 | 3300025299 | Ga0209256_1002149 | Ga0209256_10021493 | 535 |
| 1850 | 3300025299 | Ga0209256_1010626 | Ga0209256_10106261 | 535 |
| 1851 | 3300025302 | Ga0207426_1000280 | Ga0207426_10002809 | 535 |
| 1852 | 3300025302 | Ga0207426_1000359 | Ga0207426_100035910 | 535 |
| 1853 | 3300025302 | Ga0207426_1001223 | Ga0207426_100122316 | 535 |
| 1854 | 3300025302 | Ga0207426_1001336 | Ga0207426_100133624 | 535 |
| 1855 | 3300025303 | Ga0209051_1000022 | Ga0209051_1000022346 | 535 |
| 1856 | 3300025303 | Ga0209051_1000058 | Ga0209051_100005865 | 535 |
| 1857 | 3300025303 | Ga0209051_1000280 | Ga0209051_100028041 | 535 |
| 1858 | 3300025303 | Ga0209051_1002965 | Ga0209051_10029657 | 535 |
| 1859 | 3300025304 | Ga0209257_1000016 | Ga0209257_1000016172 | 535 |
| 1860 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030544 | 535 |
| 1861 | 3300025304 | Ga0209257_1000087 | Ga0209257_100008746 | 535 |
| 1862 | 3300025304 | Ga0209257_1000092 | Ga0209257_100009265 | 535 |
| 1863 | 3300025304 | Ga0209257_1000165 | Ga0209257_100016541 | 535 |
| 1864 | 3300025304 | Ga0209257_1001027 | Ga0209257_10010279 | 535 |
| 1865 | 3300025304 | Ga0209257_1002180 | Ga0209257_10021809 | 535 |
| 1866 | 3300025304 | Ga0209257_1004584 | Ga0209257_10045846 | 535 |
| 1867 | 3300025711 | Ga0207696_1000147 | Ga0207696_100014756 | 535 |
| 1868 | 3300025711 | Ga0207696_1001154 | Ga0207696_10011545 | 535 |
| 1869 | 3300025904 | Ga0207647_10000264 | Ga0207647_1000026412 | 535 |
| 1870 | 3300025907 | Ga0207645_10027593 | Ga0207645_100275932 | 535 |
| 1871 | 3300025908 | Ga0207643_10035227 | Ga0207643_100352272 | 535 |
| 1872 | 3300025909 | Ga0207705_10036568 | Ga0207705_100365683 | 535 |
| 1873 | 3300025911 | Ga0207654_10012461 | Ga0207654_100124614 | 535 |
| 1874 | 3300025912 | Ga0207707_10001948 | Ga0207707_100019482 | 535 |
| 1875 | 3300025912 | Ga0207707_10012301 | Ga0207707_100123012 | 535 |
| 1876 | 3300025913 | Ga0207695_10006723 | Ga0207695_100067235 | 535 |
| 1877 | 3300025913 | Ga0207695_10009029 | Ga0207695_1000902911 | 535 |
| 1878 | 3300025913 | Ga0207695_10050782 | Ga0207695_100507823 | 535 |
| 1879 | 3300025914 | Ga0207671_10009367 | Ga0207671_100093673 | 535 |
| 1880 | 3300025915 | Ga0207693_10055438 | Ga0207693_100554382 | 535 |
| 1881 | 3300025919 | Ga0207657_10000003 | Ga0207657_1000000364 | 535 |
| 1882 | 3300025919 | Ga0207657_10000169 | Ga0207657_1000016959 | 535 |
| 1883 | 3300025919 | Ga0207657_10000745 | Ga0207657_1000074517 | 535 |
| 1884 | 3300025919 | Ga0207657_10000927 | Ga0207657_100009278 | 535 |
| 1885 | 3300025919 | Ga0207657_10022126 | Ga0207657_100221263 | 535 |
| 1886 | 3300025919 | Ga0207657_10041878 | Ga0207657_100418782 | 535 |
| 1887 | 3300025920 | Ga0207649_10002908 | Ga0207649_100029086 | 535 |
| 1888 | 3300025920 | Ga0207649_10061573 | Ga0207649_100615732 | 535 |
| 1889 | 3300025921 | Ga0207652_10007510 | Ga0207652_100075109 | 535 |
| 1890 | 3300025921 | Ga0207652_10013940 | Ga0207652_100139405 | 535 |
| 1891 | 3300025921 | Ga0207652_10039102 | Ga0207652_100391021 | 535 |
| 1892 | 3300025924 | Ga0207694_10016717 | Ga0207694_100167174 | 535 |
| 1893 | 3300025924 | Ga0207694_10165432 | Ga0207694_101654321 | 535 |
| 1894 | 3300025926 | Ga0207659_10058318 | Ga0207659_100583182 | 535 |
| 1895 | 3300025928 | Ga0207700_10000073 | Ga0207700_1000007347 | 535 |
| 1896 | 3300025928 | Ga0207700_10003148 | Ga0207700_100031483 | 535 |
| 1897 | 3300025928 | Ga0207700_10171684 | Ga0207700_101716842 | 535 |
| 1898 | 3300025929 | Ga0207664_10014981 | Ga0207664_100149814 | 535 |
| 1899 | 3300025929 | Ga0207664_10015163 | Ga0207664_100151635 | 535 |
| 1900 | 3300025931 | Ga0207644_10011232 | Ga0207644_100112322 | 535 |
| 1901 | 3300025931 | Ga0207644_10088173 | Ga0207644_100881732 | 535 |
| 1902 | 3300025932 | Ga0207690_10000007 | Ga0207690_1000000765 | 535 |
| 1903 | 3300025932 | Ga0207690_10001061 | Ga0207690_1000106112 | 535 |
| 1904 | 3300025932 | Ga0207690_10008488 | Ga0207690_100084884 | 535 |
| 1905 | 3300025933 | Ga0207706_10000023 | Ga0207706_100000237 | 535 |
| 1906 | 3300025935 | Ga0207709_10000160 | Ga0207709_1000016023 | 535 |
| 1907 | 3300025935 | Ga0207709_10002264 | Ga0207709_100022643 | 535 |
| 1908 | 3300025935 | Ga0207709_10024451 | Ga0207709_100244512 | 535 |
| 1909 | 3300025935 | Ga0207709_10057896 | Ga0207709_100578961 | 535 |
| 1910 | 3300025937 | Ga0207669_10121924 | Ga0207669_101219241 | 535 |
| 1911 | 3300025939 | Ga0207665_10033990 | Ga0207665_100339902 | 535 |
| 1912 | 3300025940 | Ga0207691_10014621 | Ga0207691_100146217 | 535 |
| 1913 | 3300025941 | Ga0207711_10057311 | Ga0207711_100573113 | 535 |
| 1914 | 3300025942 | Ga0207689_10007725 | Ga0207689_100077255 | 535 |
| 1915 | 3300025942 | Ga0207689_10124366 | Ga0207689_101243662 | 535 |
| 1916 | 3300025944 | Ga0207661_10010000 | Ga0207661_100100005 | 535 |
| 1917 | 3300025945 | Ga0207679_10000007 | Ga0207679_10000007291 | 535 |
| 1918 | 3300025945 | Ga0207679_10013781 | Ga0207679_100137814 | 535 |
| 1919 | 3300025949 | Ga0207667_10001383 | Ga0207667_1000138310 | 535 |
| 1920 | 3300025949 | Ga0207667_10008850 | Ga0207667_100088503 | 535 |
| 1921 | 3300025949 | Ga0207667_10016327 | Ga0207667_100163277 | 535 |
| 1922 | 3300025949 | Ga0207667_10019658 | Ga0207667_100196586 | 535 |
| 1923 | 3300025960 | Ga0207651_10039683 | Ga0207651_100396831 | 535 |
| 1924 | 3300025981 | Ga0207640_10000107 | Ga0207640_1000010749 | 535 |
| 1925 | 3300025986 | Ga0207658_10031607 | Ga0207658_100316073 | 535 |
| 1926 | 3300026023 | Ga0207677_10020339 | Ga0207677_100203393 | 535 |
| 1927 | 3300026035 | Ga0207703_10006237 | Ga0207703_100062378 | 535 |
| 1928 | 3300026041 | Ga0207639_10010939 | Ga0207639_100109395 | 535 |
| 1929 | 3300026067 | Ga0207678_10001969 | Ga0207678_100019692 | 535 |
| 1930 | 3300026067 | Ga0207678_10008085 | Ga0207678_100080856 | 535 |
| 1931 | 3300026067 | Ga0207678_10011358 | Ga0207678_100113587 | 535 |
| 1932 | 3300026067 | Ga0207678_10012488 | Ga0207678_100124882 | 535 |
| 1933 | 3300026067 | Ga0207678_10017713 | Ga0207678_100177133 | 535 |
| 1934 | 3300026075 | Ga0207708_10002903 | Ga0207708_1000290310 | 535 |
| 1935 | 3300026078 | Ga0207702_10000260 | Ga0207702_1000026051 | 535 |
| 1936 | 3300026078 | Ga0207702_10004398 | Ga0207702_100043986 | 535 |
| 1937 | 3300026078 | Ga0207702_10005167 | Ga0207702_100051672 | 535 |
| 1938 | 3300026078 | Ga0207702_10020136 | Ga0207702_100201364 | 535 |
| 1939 | 3300026089 | Ga0207648_10008955 | Ga0207648_100089556 | 535 |
| 1940 | 3300026089 | Ga0207648_10015226 | Ga0207648_100152264 | 535 |
| 1941 | 3300026116 | Ga0207674_10000429 | Ga0207674_100004295 | 535 |
| 1942 | 3300026118 | Ga0207675_100005732 | Ga0207675_1000057325 | 535 |
| 1943 | 3300026118 | Ga0207675_100008757 | Ga0207675_1000087575 | 535 |
| 1944 | 3300026118 | Ga0207675_100113155 | Ga0207675_1001131552 | 535 |
| 1945 | 3300026121 | Ga0207683_10023126 | Ga0207683_100231263 | 535 |
| 1946 | 3300026142 | Ga0207698_10009610 | Ga0207698_100096105 | 535 |
| 1947 | 3300026142 | Ga0207698_10011139 | Ga0207698_100111395 | 535 |
| 1948 | 3300026142 | Ga0207698_10027312 | Ga0207698_100273122 | 535 |
| 1949 | 3300026142 | Ga0207698_10032212 | Ga0207698_100322123 | 535 |
| 1950 | 3300027111 | Ga0209281_1000017 | Ga0209281_1000017500 | 535 |
| 1951 | 3300027111 | Ga0209281_1000314 | Ga0209281_100031456 | 535 |
| 1952 | 3300027296 | Ga0209389_1003130 | Ga0209389_10031309 | 535 |
| 1953 | 3300027312 | Ga0209371_1000292 | Ga0209371_100029217 | 535 |
| 1954 | 3300027312 | Ga0209371_1002246 | Ga0209371_10022462 | 535 |
| 1955 | 3300027614 | Ga0209970_1000300 | Ga0209970_10003008 | 535 |
| 1956 | 3300027666 | Ga0209282_1000068 | Ga0209282_100006856 | 535 |
| 1957 | 3300027671 | Ga0209588_1002124 | Ga0209588_10021242 | 535 |
| 1958 | 3300027695 | Ga0209966_1000161 | Ga0209966_100016114 | 535 |
| 1959 | 3300027866 | Ga0209813_10007844 | Ga0209813_100078442 | 535 |
| 1960 | 3300028380 | Ga0268265_10009307 | Ga0268265_100093072 | 535 |
| 1961 | 3300028380 | Ga0268265_10079019 | Ga0268265_100790192 | 535 |
| 1962 | 3300028381 | Ga0268264_10047641 | Ga0268264_100476412 | 535 |
| 1963 | 3300028794 | Ga0307515_10000062 | Ga0307515_10000062140 | 535 |
| 1964 | 3300028794 | Ga0307515_10000346 | Ga0307515_1000034660 | 535 |
| 1965 | 3300028794 | Ga0307515_10000398 | Ga0307515_1000039829 | 535 |
| 1966 | 3300028794 | Ga0307515_10001252 | Ga0307515_100012528 | 535 |
| 1967 | 3300028794 | Ga0307515_10005050 | Ga0307515_1000505024 | 535 |
| 1968 | 3300028794 | Ga0307515_10006111 | Ga0307515_1000611125 | 535 |
| 1969 | 3300028794 | Ga0307515_10024951 | Ga0307515_100249519 | 535 |
| 1970 | 3300028794 | Ga0307515_10113321 | Ga0307515_101133212 | 535 |
| 1971 | 3300030500 | Ga0268256_1000255 | Ga0268256_100025517 | 535 |
| 1972 | 3300030500 | Ga0268256_1003512 | Ga0268256_10035125 | 535 |
| 1973 | 3300031235 | Ga0265330_10000052 | Ga0265330_1000005222 | 535 |
| 1974 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001797 | 535 |
| 1975 | 3300031239 | Ga0265328_10002917 | Ga0265328_100029172 | 535 |
| 1976 | 3300031241 | Ga0265325_10002984 | Ga0265325_100029846 | 535 |
| 1977 | 3300031251 | Ga0265327_10000080 | Ga0265327_10000080151 | 535 |
| 1978 | 3300031251 | Ga0265327_10000622 | Ga0265327_1000062244 | 535 |
| 1979 | 3300031344 | Ga0265316_10019109 | Ga0265316_100191092 | 535 |
| 1980 | 3300031456 | Ga0307513_10000070 | Ga0307513_10000070108 | 535 |
| 1981 | 3300031456 | Ga0307513_10000162 | Ga0307513_1000016253 | 535 |
| 1982 | 3300031456 | Ga0307513_10004918 | Ga0307513_100049184 | 535 |
| 1983 | 3300031456 | Ga0307513_10011662 | Ga0307513_100116627 | 535 |
| 1984 | 3300031507 | Ga0307509_10000032 | Ga0307509_10000032194 | 535 |
| 1985 | 3300031507 | Ga0307509_10008220 | Ga0307509_100082208 | 535 |
| 1986 | 3300031507 | Ga0307509_10075146 | Ga0307509_100751462 | 535 |
| 1987 | 3300031548 | Ga0307408_100000012 | Ga0307408_100000012243 | 535 |
| 1988 | 3300031548 | Ga0307408_100000219 | Ga0307408_10000021921 | 535 |
| 1989 | 3300031548 | Ga0307408_100002474 | Ga0307408_1000024746 | 535 |
| 1990 | 3300031616 | Ga0307508_10000023 | Ga0307508_10000023120 | 535 |
| 1991 | 3300031616 | Ga0307508_10020567 | Ga0307508_100205672 | 535 |
| 1992 | 3300031649 | Ga0307514_10003961 | Ga0307514_100039615 | 535 |
| 1993 | 3300031649 | Ga0307514_10016384 | Ga0307514_100163844 | 535 |
| 1994 | 3300031711 | Ga0265314_10000013 | Ga0265314_1000001320 | 535 |
| 1995 | 3300031727 | Ga0316576_10005251 | Ga0316576_100052513 | 535 |
| 1996 | 3300031727 | Ga0316576_10056466 | Ga0316576_100564661 | 535 |
| 1997 | 3300031730 | Ga0307516_10000045 | Ga0307516_10000045127 | 535 |
| 1998 | 3300031730 | Ga0307516_10003224 | Ga0307516_100032248 | 535 |
| 1999 | 3300031730 | Ga0307516_10010031 | Ga0307516_100100319 | 535 |
| 2000 | 3300031733 | Ga0316577_10016321 | Ga0316577_100163213 | 535 |
| 2001 | 3300031901 | Ga0307406_10000407 | Ga0307406_1000040721 | 535 |
| 2002 | 3300031901 | Ga0307406_10005726 | Ga0307406_100057264 | 535 |
| 2003 | 3300031911 | Ga0307412_10000002 | Ga0307412_10000002204 | 535 |
| 2004 | 3300031967 | Ga0315914_1020806 | Ga0315914_10208064 | 535 |
| 2005 | 3300032002 | Ga0307416_100004227 | Ga0307416_1000042275 | 535 |
| 2006 | 3300032004 | Ga0307414_10029553 | Ga0307414_100295532 | 535 |
| 2007 | 3300032004 | Ga0307414_10039044 | Ga0307414_100390442 | 535 |
| 2008 | 3300032004 | Ga0307414_10063992 | Ga0307414_100639922 | 535 |
| 2009 | 3300032005 | Ga0307411_10126242 | Ga0307411_101262422 | 535 |
| 2010 | 3300033430 | Ga0315913_1002536 | Ga0315913_10025368 | 535 |
| 2011 | 3300033464 | Ga0315915_1000007 | Ga0315915_1000007297 | 535 |
| 2012 | 3300035121 | Ga0373960_0000576 | Ga0373960_0000576_5761_7368 | 535 |
| 2013 | 3300035691 | Ga0373931_0003169 | Ga0373931_0003169_872_2479 | 535 |
| 2014 | 3300036647 | Ga0316582_0076106 | Ga0316582_0076106_489_2096 | 535 |
| 2015 | 3300037068 | Ga0373925_0087351 | Ga0373925_0087351_344_1951 | 535 |
| 2016 | 3300037312 | Ga0395899_0000013 | Ga0395899_0000013_252302_253909 | 535 |
| 2017 | 3300037312 | Ga0395899_0000023 | Ga0395899_0000023_28883_30490 | 535 |
| 2018 | 3300037312 | Ga0395899_0000078 | Ga0395899_0000078_24630_26237 | 535 |
| 2019 | 3300037312 | Ga0395899_0002871 | Ga0395899_0002871_6701_8308 | 535 |
| 2020 | 3300037312 | Ga0395899_0022135 | Ga0395899_0022135_788_2395 | 535 |
| 2021 | 3300037312 | Ga0395899_0027406 | Ga0395899_0027406_1042_2649 | 535 |
| 2022 | 3300037418 | Ga0395900_0000019 | Ga0395900_0000019_336670_338277 | 535 |
| 2023 | 3300037418 | Ga0395900_0000211 | Ga0395900_0000211_29569_31176 | 535 |
| 2024 | 3300037418 | Ga0395900_0019625 | Ga0395900_0019625_4329_5936 | 535 |
| 2025 | 3300037418 | Ga0395900_0035336 | Ga0395900_0035336_3004_4611 | 535 |
| 2026 | 3300037418 | Ga0395900_0105174 | Ga0395900_0105174_941_2548 | 535 |
| 2027 | 3300037418 | Ga0395900_0157547 | Ga0395900_0157547_500_2107 | 535 |
| 2028 | 3300037466 | Ga0395898_0000016 | Ga0395898_0000016_331816_333423 | 535 |
| 2029 | 3300037466 | Ga0395898_0007259 | Ga0395898_0007259_1316_2923 | 535 |
| 2030 | 3300037466 | Ga0395898_0010588 | Ga0395898_0010588_6428_8050 | 535 |
| 2031 | 3300037466 | Ga0395898_0053635 | Ga0395898_0053635_2079_3686 | 535 |
| 2032 | 3300037466 | Ga0395898_0056493 | Ga0395898_0056493_1643_3250 | 535 |
| 2033 | 3300037471 | Ga0395905_0000117 | Ga0395905_0000117_46546_48153 | 535 |
| 2034 | 3300037471 | Ga0395905_0000283 | Ga0395905_0000283_13776_15383 | 535 |
| 2035 | 3300037471 | Ga0395905_0000352 | Ga0395905_0000352_14582_16189 | 535 |
| 2036 | 3300037471 | Ga0395905_0001425 | Ga0395905_0001425_11612_13219 | 535 |
| 2037 | 3300037471 | Ga0395905_0003331 | Ga0395905_0003331_6060_7667 | 535 |
| 2038 | 3300037471 | Ga0395905_0003956 | Ga0395905_0003956_899_2680 | 535 |
| 2039 | 3300037471 | Ga0395905_0011137 | Ga0395905_0011137_4201_5808 | 535 |
| 2040 | 3300037471 | Ga0395905_0017915 | Ga0395905_0017915_3892_5499 | 535 |
| 2041 | 3300037471 | Ga0395905_0018137 | Ga0395905_0018137_801_2408 | 535 |
| 2042 | 3300037471 | Ga0395905_0031988 | Ga0395905_0031988_2253_3860 | 535 |
| 2043 | 3300037471 | Ga0395905_0047994 | Ga0395905_0047994_296_2032 | 535 |
| 2044 | 3300038443 | Ga0395901_0011033 | Ga0395901_0011033_3935_5542 | 535 |
| 2045 | 3300038443 | Ga0395901_0047204 | Ga0395901_0047204_1908_3515 | 535 |
| 2046 | 3300039447 | Ga0436361_0067858 | Ga0436361_0067858_1107_2714 | 535 |
| 2047 | 3300039447 | Ga0436361_0192229 | Ga0436361_0192229_564_2171 | 535 |
| 2048 | 3300039447 | Ga0436361_0208418 | Ga0436361_0208418_6622_8229 | 535 |
| 2049 | 3300039447 | Ga0436361_0224368 | Ga0436361_0224368_5140_6780 | 535 |
| 2050 | 3300039447 | Ga0436361_0424891 | Ga0436361_0424891_1756_3363 | 535 |
| 2051 | 3300039447 | Ga0436361_0437880 | Ga0436361_0437880_5692_7299 | 535 |
| 2052 | 3300039447 | Ga0436361_0807409 | Ga0436361_0807409_8029_9636 | 535 |
| 2053 | 3300039447 | Ga0436361_0913791 | Ga0436361_0913791_2611_4218 | 535 |
| 2054 | 3300039447 | Ga0436361_0937617 | Ga0436361_0937617_1294_2901 | 535 |
| 2055 | 3300039447 | Ga0436361_0941839 | Ga0436361_0941839_119321_120928 | 535 |
| 2056 | 3300039447 | Ga0436361_1034384 | Ga0436361_1034384_3783_5390 | 535 |
| 2057 | 3300039450 | Ga0436363_0794016 | Ga0436363_0794016_1610_3217 | 535 |
| 2058 | 3300042007 | Ga0439449_0016081 | Ga0439449_0016081_570_2177 | 535 |
| 2059 | 3300042438 | Ga0439459_0000205 | Ga0439459_0000205_2981_4588 | 535 |
| 2060 | 3300042876 | Ga0451577_0000014 | Ga0451577_0000014_303520_305127 | 535 |
| 2061 | 3300042876 | Ga0451577_0000388 | Ga0451577_0000388_24086_25720 | 535 |
| 2062 | 3300042876 | Ga0451577_0006997 | Ga0451577_0006997_7321_8928 | 535 |
| 2063 | 3300042876 | Ga0451577_0013489 | Ga0451577_0013489_3956_5563 | 535 |
| 2064 | 3300044656 | Ga0466969_0054442 | Ga0466969_0054442_291_1898 | 535 |
| 2065 | 3300044673 | Ga0453683_0002610 | Ga0453683_0002610_8384_9991 | 535 |
| 2066 | 3300044673 | Ga0453683_0003826 | Ga0453683_0003826_9138_10745 | 535 |
| 2067 | 3300044684 | Ga0466966_0000009 | Ga0466966_0000009_112434_114041 | 535 |
| 2068 | 3300044684 | Ga0466966_0033613 | Ga0466966_0033613_1189_2796 | 535 |
| 2069 | 3300044693 | Ga0466961_0000353 | Ga0466961_0000353_16125_17732 | 535 |
| 2070 | 3300044693 | Ga0466961_0006262 | Ga0466961_0006262_751_2358 | 535 |
| 2071 | 3300044694 | Ga0466963_0040009 | Ga0466963_0040009_1198_2805 | 535 |
| 2072 | 3300044712 | Ga0453684_0000082 | Ga0453684_0000082_304846_306453 | 535 |
| 2073 | 3300044712 | Ga0453684_0000187 | Ga0453684_0000187_24988_26622 | 535 |
| 2074 | 3300044712 | Ga0453684_0000204 | Ga0453684_0000204_39217_40824 | 535 |
| 2075 | 3300044712 | Ga0453684_0001066 | Ga0453684_0001066_41797_43404 | 535 |
| 2076 | 3300044712 | Ga0453684_0002858 | Ga0453684_0002858_3556_5163 | 535 |
| 2077 | 3300044712 | Ga0453684_0007830 | Ga0453684_0007830_11674_13281 | 535 |
| 2078 | 3300044712 | Ga0453684_0031157 | Ga0453684_0031157_3933_5540 | 535 |
| 2079 | 3300044712 | Ga0453684_0048661 | Ga0453684_0048661_860_2467 | 535 |
| 2080 | 3300044712 | Ga0453684_0239155 | Ga0453684_0239155_238_1845 | 535 |
| 2081 | 3300044719 | Ga0466971_0022622 | Ga0466971_0022622_562_2169 | 535 |
| 2082 | 3300044735 | Ga0466968_0017610 | Ga0466968_0017610_508_2115 | 535 |
| 2083 | 3300045049 | Ga0466959_0000938 | Ga0466959_0000938_3179_4786 | 535 |
| 2084 | 3300045049 | Ga0466959_0005843 | Ga0466959_0005843_1700_3307 | 535 |
| 2085 | 3300045051 | Ga0451576_0000096 | Ga0451576_0000096_59369_60976 | 535 |
| 2086 | 3300045051 | Ga0451576_0005438 | Ga0451576_0005438_9014_10621 | 535 |
| 2087 | 3300045051 | Ga0451576_0028947 | Ga0451576_0028947_1111_2718 | 535 |
| 2088 | 3300045051 | Ga0451576_0055246 | Ga0451576_0055246_1594_3201 | 535 |
| 2089 | 3300045836 | Ga0466958_0008156 | Ga0466958_0008156_937_2544 | 535 |
| 2090 | 3300045836 | Ga0466958_0027790 | Ga0466958_0027790_608_2215 | 535 |
| 2091 | 3300046471 | Ga0495650_0007201 | Ga0495650_0007201_3440_5047 | 535 |
| 2092 | 3300046507 | Ga0495606_0000873 | Ga0495606_0000873_8363_9970 | 535 |
| 2093 | 3300046507 | Ga0495606_0019756 | Ga0495606_0019756_2887_4494 | 535 |
| 2094 | 3300046507 | Ga0495606_0037209 | Ga0495606_0037209_525_2132 | 535 |
| 2095 | 3300046512 | Ga0495610_0000092 | Ga0495610_0000092_83773_85443 | 535 |
| 2096 | 3300046513 | Ga0495616_0002407 | Ga0495616_0002407_7532_9202 | 535 |
| 2097 | 3300046522 | Ga0495643_0050007 | Ga0495643_0050007_54_1661 | 535 |
| 2098 | 3300046530 | Ga0495654_0000010 | Ga0495654_0000010_149736_151406 | 535 |
| 2099 | 3300046542 | Ga0495597_0002137 | Ga0495597_0002137_9415_11022 | 535 |
| 2100 | 3300046557 | Ga0495622_0000692 | Ga0495622_0000692_3288_4895 | 535 |
| 2101 | 3300046558 | Ga0495633_0007327 | Ga0495633_0007327_2461_4068 | 535 |
| 2102 | 3300046616 | Ga0495668_0005568 | Ga0495668_0005568_2202_3872 | 535 |
| 2103 | 3300046660 | Ga0495625_0000295 | Ga0495625_0000295_23118_24725 | 535 |
| 2104 | 3300047320 | Ga0495672_0003177 | Ga0495672_0003177_11111_12718 | 535 |
| 2105 | 3300047472 | Ga0495686_0000090 | Ga0495686_0000090_41071_42678 | 535 |
| 2106 | 3300048903 | Ga0496100_0025105 | Ga0496100_0025105_1731_3341 | 535 |
| 2107 | 3300048904 | Ga0496101_0068987 | Ga0496101_0068987_91_1698 | 535 |
| 2108 | 3300048905 | Ga0496102_0044851 | Ga0496102_0044851_2031_3641 | 535 |
| 2109 | 3300048908 | Ga0496105_0038978 | Ga0496105_0038978_195_1805 | 535 |
| 2110 | 3300048909 | Ga0496106_0000852 | Ga0496106_0000852_14783_16390 | 535 |
| 2111 | 3300048909 | Ga0496106_0013667 | Ga0496106_0013667_1832_3442 | 535 |
| 2112 | 3300048909 | Ga0496106_0025589 | Ga0496106_0025589_1540_3147 | 535 |
| 2113 | 3300048909 | Ga0496106_0052408 | Ga0496106_0052408_137_1744 | 535 |
| 2114 | 3300048911 | Ga0496108_0009068 | Ga0496108_0009068_2707_4317 | 535 |
| 2115 | 3300048912 | Ga0496109_0025721 | Ga0496109_0025721_1987_3597 | 535 |
| 2116 | 3300048913 | Ga0496110_0034208 | Ga0496110_0034208_1846_3456 | 535 |
| 2117 | 3300048914 | Ga0496111_0014357 | Ga0496111_0014357_1914_3524 | 535 |
| 2118 | 3300048915 | Ga0496112_0089671 | Ga0496112_0089671_10_1617 | 535 |
| 2119 | 3300048916 | Ga0496113_0005533 | Ga0496113_0005533_181_1791 | 535 |
| 2120 | 3300048917 | Ga0496114_0013825 | Ga0496114_0013825_2739_4349 | 535 |
| 2121 | 3300048918 | Ga0496115_0025731 | Ga0496115_0025731_2207_3877 | 535 |
| 2122 | 3300048924 | Ga0496121_0000303 | Ga0496121_0000303_444_2051 | 535 |
| 2123 | 3300048924 | Ga0496121_0029495 | Ga0496121_0029495_2164_3834 | 535 |
| 2124 | 3300048925 | Ga0496122_0011264 | Ga0496122_0011264_2319_3926 | 535 |
| 2125 | 3300048925 | Ga0496122_0037915 | Ga0496122_0037915_1074_2681 | 535 |
| 2126 | 3300048927 | Ga0496124_0002789 | Ga0496124_0002789_2284_3891 | 535 |
| 2127 | 3300048928 | Ga0496125_0001159 | Ga0496125_0001159_12451_14058 | 535 |
| 2128 | 3300048928 | Ga0496125_0013587 | Ga0496125_0013587_2186_3817 | 535 |
| 2129 | 3300048928 | Ga0496125_0038602 | Ga0496125_0038602_1223_2830 | 535 |
| 2130 | 3300048929 | Ga0496126_0000315 | Ga0496126_0000315_65599_67206 | 535 |
| 2131 | 3300048929 | Ga0496126_0038837 | Ga0496126_0038837_1679_3286 | 535 |
| 2132 | 3300049459 | Ga0495678_013497 | Ga0495678_013497_213_1820 | 535 |
| 2133 | 3300049570 | Ga0501033_0016641 | Ga0501033_0016641_506_2113 | 535 |
| 2134 | 3300049576 | Ga0501040_0006452 | Ga0501040_0006452_4650_6257 | 535 |
| 2135 | 3300049581 | Ga0501047_0005327 | Ga0501047_0005327_695_2302 | 535 |
| 2136 | 3300049586 | Ga0501070_0061236 | Ga0501070_0061236_515_2122 | 535 |
| 2137 | 3300049588 | Ga0501072_0008620 | Ga0501072_0008620_1434_3041 | 535 |
| 2138 | 3300049589 | Ga0501073_0007988 | Ga0501073_0007988_2694_4301 | 535 |
| 2139 | 3300049589 | Ga0501073_0017803 | Ga0501073_0017803_62_1669 | 535 |
| 2140 | 3300049592 | Ga0501076_0000337 | Ga0501076_0000337_16441_18048 | 535 |
| 2141 | 3300049742 | Ga0501080_0000476 | Ga0501080_0000476_23355_24962 | 535 |
| 2142 | 3300049742 | Ga0501080_0126781 | Ga0501080_0126781_58_1665 | 535 |
| 2143 | 3300049775 | Ga0501279_001251 | Ga0501279_001251_661_2268 | 535 |
| 2144 | 3300049822 | Ga0501035_0012407 | Ga0501035_0012407_4591_6198 | 535 |
| 2145 | 3300049822 | Ga0501035_0158625 | Ga0501035_0158625_99_1706 | 535 |
| 2146 | 3300049824 | Ga0501045_0003147 | Ga0501045_0003147_6025_7632 | 535 |
| 2147 | 3300050492 | nmdc:mga0yw44_14167_c1 | nmdc:mga0yw44_14167_c1_2406_4016 | 535 |
| 2148 | 3300050496 | nmdc:mga07m45_503_c1 | nmdc:mga07m45_503_c1_635_2299 | 535 |
| 2149 | 3300050496 | nmdc:mga07m45_7110_c1 | nmdc:mga07m45_7110_c1_2077_3687 | 535 |
| 2150 | 3300050508 | nmdc:mga09592_30307_c1 | nmdc:mga09592_30307_c1_1350_2957 | 535 |
| 2151 | 3300050512 | nmdc:mga0n895_90066_c1 | nmdc:mga0n895_90066_c1_678_2285 | 535 |
| 2152 | 3300053080 | Ga0500635_0004585 | Ga0500635_0004585_1740_3347 | 535 |
| 2153 | 3300053086 | Ga0500578_0000040 | Ga0500578_0000040_48938_50545 | 535 |
| 2154 | 3300053098 | Ga0500650_0000121 | Ga0500650_0000121_4449_6056 | 535 |
| 2155 | 3300053104 | Ga0500556_0000611 | Ga0500556_0000611_3349_5019 | 535 |
| 2156 | 3300053117 | Ga0500593_000387 | Ga0500593_000387_2181_3788 | 535 |
| 2157 | 3300053117 | Ga0500593_000627 | Ga0500593_000627_7634_9256 | 535 |
| 2158 | 3300053122 | Ga0500608_000321 | Ga0500608_000321_6386_7993 | 535 |
| 2159 | 3300053122 | Ga0500608_064059 | Ga0500608_064059_48_1655 | 535 |
| 2160 | 3300053131 | Ga0500652_000133 | Ga0500652_000133_2441_4048 | 535 |
| 2161 | 3300053156 | Ga0500622_0001741 | Ga0500622_0001741_5003_6610 | 535 |
| 2162 | 3300053730 | Ga0500645_001733 | Ga0500645_001733_535_2157 | 535 |
| 2163 | 3300054114 | Ga0501084_0000907 | Ga0501084_0000907_4825_6432 | 535 |
| 2164 | 3300060353 | Ga0501082_0009535 | Ga0501082_0009535_1241_2848 | 535 |
| 2165 | 3300061719 | Ga0466962_0003462 | Ga0466962_0003462_5467_7074 | 535 |
| 2166 | 3300061719 | Ga0466962_0017705 | Ga0466962_0017705_291_1898 | 535 |
| 2167 | 3300061734 | Ga0530510_0001617 | Ga0530510_0001617_6558_8165 | 535 |
| 2168 | iso_pu_bacteria | 2791355091 | 2792619474 | 535 |
| 2169 | iso_pu_bacteria | 2791355092 | 2792627245 | 535 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q0g-assembly1.cif.gz_C | crystal structure of beta subunit of acyl-coa carboxylase accd1 from mycobacterium tuberculosis | 0.9914 | 18 | 535 |
| 4q0g-assembly1.cif.gz_C | crystal structure of beta subunit of acyl-coa carboxylase accd1 from mycobacterium tuberculosis | 0.9858 | 18 | 535 |
| 3u9t-assembly1.cif.gz_B | crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme | 0.9843 | 2 | 535 |
| 4q0g-assembly1.cif.gz_B-2 | crystal structure of beta subunit of acyl-coa carboxylase accd1 from mycobacterium tuberculosis | 0.9825 | 18 | 535 |
| 3u9t-assembly1.cif.gz_B | crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme | 0.9821 | 2 | 535 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O86318_1_265_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9844 | 4 | 272 | 3.90.226.10 |
| af_A4HUX0_21_275_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9785 | 42 | 267 | 3.90.226.10 |
| af_O86318_1_265_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.977 | 4 | 272 | 3.90.226.10 |
| af_O86318_267_524_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9729 | 276 | 525 | 3.90.226.10 |
| 3u9tB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9652 | 39 | 269 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9BPN7-F1-model_v4 | Methylcrotonoyl-CoA carboxylase | 1 | 36 | 138 |
GO:0004485
GO:0006552 GO:1905202 |
| AF-A0A2W5PZL7-F1-model_v4 | deleted | 0.9985 | 1 | 139 |
|
| AF-A0A022FPE0-F1-model_v4 | Methylmalonyl-CoA carboxyltransferase | 0.9979 | 48 | 245 |
GO:0004485
GO:0006552 GO:0016740 GO:1905202 |
| AF-A0A520DUF9-F1-model_v4 | Methylcrotonoyl-CoA carboxylase | 0.9975 | 348 | 535 |
GO:0004485
GO:0006552 GO:1905202 |
| AF-A0A3B9PQF5-F1-model_v4 | Methylcrotonoyl-CoA carboxylase | 0.9958 | 1 | 397 |
GO:0004485
GO:0006552 GO:1905202 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar