F496473

General Info

Members Datasets Scaffolds Average Seq Length
2151 637 4298 396

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10197313|Ga0157372_101973132
Length 440
Sequence MGAQGTAQPQLQEGSAAEVGQRALVTFRASILLRAGIDSGMAKAKFDRTKPHVNVGTIGHVDHGKTTTTAALTKVSSDKGWGTKYISYDEVAKASASQGRRDATKILTIATSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAMDGPMPQTREHILLARQVNVPRIVVFLNKCDMVDDPELLDLVELEVRELLSVYGFPGDETPVIRGSATGAISGDPAWIAKIEELYAALDTYIPEPVREKDQPFLMPVEDVFSITGRGTVATGRIDRGVVKVGEEVAVVGFSSDKKTIVTGVEMFRKLLDAGEAGDNVGLLLRGIAKDEIERGMVLAKPGTITPHTRFEAEVYVLTKEEGGRHTPFFKGYRPQFYFRTTDVTGSVELPEGMEMVMPGDNVQMTIELITPIAMEEQLRFAIREGGRTVGAGVVTKILK

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
11 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
12 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
13 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
14 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
15 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
16 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
17 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
157 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
161 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
233 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
235 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
256 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
257 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
258 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
259 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
260 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
261 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
264 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
265 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
266 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
269 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
270 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
271 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
272 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
275 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
276 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
277 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
278 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
282 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
289 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
290 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
291 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
293 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
294 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
299 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
300 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
301 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
302 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
303 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
304 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
305 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
306 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
307 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
308 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
309 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
310 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
312 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
313 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
314 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
315 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
316 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
317 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
318 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
319 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
320 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
321 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
322 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
323 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
324 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
325 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
326 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
327 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
328 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
329 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
330 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
331 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
332 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
333 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
334 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
335 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
336 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
337 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
338 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
339 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
340 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
341 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
342 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
343 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
344 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
345 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
346 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
347 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
348 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
349 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
350 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
351 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
352 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
353 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
354 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
355 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
356 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
357 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
358 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
359 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
360 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
361 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
362 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
363 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
364 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
365 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
366 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
367 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
368 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
369 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
370 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
371 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
372 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
373 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
374 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
375 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
376 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
377 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
378 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
379 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
380 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
381 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
382 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
383 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
384 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
385 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
386 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
387 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
388 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
389 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
390 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
391 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
392 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
393 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
394 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
395 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
396 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
397 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
398 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
399 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
400 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
401 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
402 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
403 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
404 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
405 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
406 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
407 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
408 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
409 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
410 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
411 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
412 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
413 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
414 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
415 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
416 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
417 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
418 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
419 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
420 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
421 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
422 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
423 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
426 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
427 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
428 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
429 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
430 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
431 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
432 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
433 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
434 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
435 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
437 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
438 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
439 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
440 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
441 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
442 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
443 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
444 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
445 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
446 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
447 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
453 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
454 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
455 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
458 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
460 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
461 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
462 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
463 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
464 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
465 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
466 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
467 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
483 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
484 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
485 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
486 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
487 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
488 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
489 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
490 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
491 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
492 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
493 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
494 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
495 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
496 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
497 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
498 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
499 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
500 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
501 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
502 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
503 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
504 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
505 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
506 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
507 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
508 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
509 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
510 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
511 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
512 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
513 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
514 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
515 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
516 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
517 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
518 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
519 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
520 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
521 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
522 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
523 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
524 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
525 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
526 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
527 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
528 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
529 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
530 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
531 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
532 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
533 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
534 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
535 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
536 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
537 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
538 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
539 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
543 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
544 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
545 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
546 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
547 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
548 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
549 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
550 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
551 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
552 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
553 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
554 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
555 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
556 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
557 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
558 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
559 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
560 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
561 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
562 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
563 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
564 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
565 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
566 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
567 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
568 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
569 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
570 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
571 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
572 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
573 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
595 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
596 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
597 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
598 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
599 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
600 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
601 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
602 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
603 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
604 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
605 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
606 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
607 2791355199
608 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
609 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
610 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
611 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
612 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
613 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
614 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
615 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
616 2904699407
617 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
618 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
619 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
620 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
621 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
622 2922425934
623 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
624 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
625 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
626 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
627 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
628 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
629 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
630 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
631 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
632 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
633 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
634 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
635 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
636 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
637 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.25
Metatranscriptomes 2.56
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 1.67
Rhizoplane 4.28
Rhizosphere 90.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10197313 3300013307 Bacteria 2331
2 SwRhRL2b_contig_1298163 2162886007 Bacteria 1893
3 JGI24746J21847_1008028 3300001977 Bacteria 1601
4 JGI24737J22298_10024194 3300001990 Bacteria 1923
5 JGI24750J21931_1000315 3300002070 Bacteria 8295
6 JGI24034J26672_10002296 3300002239 Bacteria 2617
7 JGI24742J22300_10007414 3300002244 Bacteria 1809
8 JGI24742J22300_10010336 3300002244 Bacteria 1545
9 JGI24751J29686_10023018 3300002459 Bacteria 1292
10 JGI25406J46586_10022422 3300003203 Bacteria 2516
11 JGI26128J50194_1001392 3300003347 Bacteria 1531
12 JGI26129J50193_1000031 3300003349 Bacteria 7957
13 JGI26145J50221_1000624 3300003371 Bacteria 2985
14 JGI26134J50242_100275 3300003392 Bacteria 2298
15 JGI26133J50247_100062 3300003397 Bacteria 2219
16 JGI26132J50249_100231 3300003405 Bacteria 1518
17 JGI26143J51219_1000496 3300003502 Bacteria 1534
18 JGI26141J51220_1001165 3300003503 Bacteria 1575
19 JGI25405J52794_10001096 3300003911 Bacteria 4330
20 JGI25405J52794_10018929 3300003911 Bacteria 1377
21 Ga0058863_10074882 3300004799 Bacteria 2266
22 Ga0058863_10078133 3300004799 Bacteria 3576
23 Ga0058863_11936457 3300004799 Bacteria 1902
24 Ga0058861_10030509 3300004800 Bacteria 1791
25 Ga0058861_10159963 3300004800 Bacteria 3320
26 Ga0058861_12046052 3300004800 Bacteria 1357
27 Ga0058862_12356670 3300004803 Bacteria 2894
28 Ga0058862_12636649 3300004803 Bacteria 2075
29 Ga0058862_12778063 3300004803 Bacteria 2673
30 Ga0065704_10085384 3300005289 Bacteria 3228
31 Ga0065704_10117584 3300005289 Bacteria 1831
32 Ga0065715_10121960 3300005293 Bacteria 2213
33 Ga0065707_10002120 3300005295 Bacteria 4994
34 Ga0065707_10013752 3300005295 Bacteria 1669
35 Ga0065707_10084753 3300005295 Bacteria 6807
36 Ga0065707_10087315 3300005295 Bacteria 5079
37 Ga0065707_10136871 3300005295 Bacteria 1827
38 Ga0070658_10003484 3300005327 Bacteria 12924
39 Ga0070658_10005421 3300005327 Bacteria 10350
40 Ga0070658_10090607 3300005327 Bacteria 2519
41 Ga0070676_10000852 3300005328 Bacteria 15089
42 Ga0070676_10000896 3300005328 Bacteria 14732
43 Ga0070676_10029802 3300005328 Bacteria 3106
44 Ga0070676_10116078 3300005328 Bacteria 1674
45 Ga0070676_10136272 3300005328 Bacteria 1558
46 Ga0070683_100014149 3300005329 Bacteria 6970
47 Ga0070683_100019046 3300005329 Bacteria 6090
48 Ga0070683_100111556 3300005329 Bacteria 2580
49 Ga0070683_100196719 3300005329 Bacteria 1914
50 Ga0070690_100013884 3300005330 Bacteria 4774
51 Ga0070690_100078403 3300005330 Bacteria 2158
52 Ga0070690_100150078 3300005330 Bacteria 1589
53 Ga0070670_100003642 3300005331 Bacteria 12830
54 Ga0070670_100016207 3300005331 Bacteria 6398
55 Ga0070670_100046278 3300005331 Bacteria 3741
56 Ga0070670_100046292 3300005331 Bacteria 3740
57 Ga0070670_100062871 3300005331 Bacteria 3186
58 Ga0070670_100202418 3300005331 Bacteria 1725
59 Ga0070677_10003182 3300005333 Bacteria 5282
60 Ga0070677_10031276 3300005333 Bacteria 2033
61 Ga0068869_100006678 3300005334 Bacteria 7327
62 Ga0068869_100017207 3300005334 Bacteria 4895
63 Ga0068869_100128651 3300005334 Bacteria 1944
64 Ga0068869_100176193 3300005334 Bacteria 1674
65 Ga0070666_10032094 3300005335 Bacteria 3469
66 Ga0070680_100003246 3300005336 Bacteria 12104
67 Ga0070680_100003723 3300005336 Bacteria 11390
68 Ga0070680_100004063 3300005336 Bacteria 10956
69 Ga0070680_100013921 3300005336 Bacteria 6276
70 Ga0070680_100023192 3300005336 Bacteria 4947
71 Ga0070680_100027839 3300005336 Bacteria 4529
72 Ga0070680_100076391 3300005336 Bacteria 2757
73 Ga0070682_100017497 3300005337 Bacteria 4180
74 Ga0070682_100030502 3300005337 Bacteria 3255
75 Ga0068868_100001296 3300005338 Bacteria 17217
76 Ga0068868_100029640 3300005338 Bacteria 4192
77 Ga0068868_100206860 3300005338 Bacteria 1638
78 Ga0070660_100037805 3300005339 Bacteria 3660
79 Ga0070660_100075828 3300005339 Bacteria 2633
80 Ga0070660_100102672 3300005339 Bacteria 2267
81 Ga0070660_100139761 3300005339 Bacteria 1942
82 Ga0070660_100166869 3300005339 Bacteria 1777
83 Ga0070689_100006170 3300005340 Bacteria 8266
84 Ga0070689_100009184 3300005340 Bacteria 6999
85 Ga0070689_100032105 3300005340 Bacteria 3993
86 Ga0070689_100042151 3300005340 Bacteria 3504
87 Ga0070689_100051095 3300005340 Bacteria 3195
88 Ga0070689_100067740 3300005340 Bacteria 2783
89 Ga0070689_100096452 3300005340 Bacteria 2337
90 Ga0070689_100172197 3300005340 Bacteria 1754
91 Ga0070689_100219614 3300005340 Bacteria 1558
92 Ga0070691_10003913 3300005341 Bacteria 6736
93 Ga0070691_10020426 3300005341 Bacteria 3060
94 Ga0070691_10089558 3300005341 Bacteria 1515
95 Ga0070687_100004595 3300005343 Bacteria 5516
96 Ga0070687_100008671 3300005343 Bacteria 4316
97 Ga0070687_100014797 3300005343 Bacteria 3513
98 Ga0070687_100051544 3300005343 Bacteria 2131
99 Ga0070687_100060107 3300005343 Bacteria 2003
100 Ga0070661_100016310 3300005344 Bacteria 5251
101 Ga0070661_100042876 3300005344 Bacteria 3304
102 Ga0070661_100055375 3300005344 Bacteria 2904
103 Ga0070692_10013859 3300005345 Bacteria 3768
104 Ga0070692_10016750 3300005345 Bacteria 3491
105 Ga0070692_10027186 3300005345 Bacteria 2833
106 Ga0070668_100008383 3300005347 Bacteria 7675
107 Ga0070668_100017094 3300005347 Bacteria 5428
108 Ga0070668_100021697 3300005347 Bacteria 4851
109 Ga0070668_100035029 3300005347 Bacteria 3826
110 Ga0070668_100047647 3300005347 Bacteria 3295
111 Ga0070668_100246401 3300005347 Bacteria 1482
112 Ga0070669_100001998 3300005353 Bacteria 14758
113 Ga0070669_100013454 3300005353 Bacteria 5816
114 Ga0070669_100062002 3300005353 Bacteria 2748
115 Ga0070669_100066784 3300005353 Bacteria 2652
116 Ga0070675_100006526 3300005354 Bacteria 8963
117 Ga0070675_100018790 3300005354 Bacteria 5502
118 Ga0070675_100031007 3300005354 Bacteria 4319
119 Ga0070675_100074752 3300005354 Bacteria 2816
120 Ga0070675_100085083 3300005354 Bacteria 2642
121 Ga0070675_100096991 3300005354 Bacteria 2478
122 Ga0070675_100146178 3300005354 Bacteria 2024
123 Ga0070671_100079316 3300005355 Bacteria 2744
124 Ga0070671_100255325 3300005355 Bacteria 1489
125 Ga0070674_100001606 3300005356 Bacteria 12131
126 Ga0070674_100016846 3300005356 Bacteria 4585
127 Ga0070674_100030757 3300005356 Bacteria 3551
128 Ga0070674_100046250 3300005356 Bacteria 2976
129 Ga0070674_100142411 3300005356 Bacteria 1801
130 Ga0070673_100006677 3300005364 Bacteria 7523
131 Ga0070673_100026334 3300005364 Bacteria 4294
132 Ga0070673_100113997 3300005364 Bacteria 2245
133 Ga0070673_100189528 3300005364 Bacteria 1765
134 Ga0070688_100007379 3300005365 Bacteria 5923
135 Ga0070688_100041679 3300005365 Bacteria 2819
136 Ga0070688_100065254 3300005365 Bacteria 2313
137 Ga0070688_100096758 3300005365 Bacteria 1939
138 Ga0070659_100002785 3300005366 Bacteria 12441
139 Ga0070659_100019303 3300005366 Bacteria 5163
140 Ga0070659_100055980 3300005366 Bacteria 3109
141 Ga0070667_100055123 3300005367 Bacteria 3357
142 Ga0070667_100147072 3300005367 Bacteria 2067
143 Ga0070667_100328861 3300005367 Bacteria 1380
144 Ga0070703_10040799 3300005406 Bacteria 1445
145 Ga0070709_10002316 3300005434 Bacteria 10332
146 Ga0070709_10002621 3300005434 Bacteria 9712
147 Ga0070709_10008272 3300005434 Bacteria 5713
148 Ga0070709_10012009 3300005434 Bacteria 4842
149 Ga0070709_10016990 3300005434 Bacteria 4166
150 Ga0070709_10108541 3300005434 Bacteria 1862
151 Ga0070709_10204897 3300005434 Bacteria 1399
152 Ga0070714_100004755 3300005435 Bacteria 10280
153 Ga0070714_100055490 3300005435 Bacteria 3386
154 Ga0070714_100168597 3300005435 Bacteria 1986
155 Ga0070714_100268807 3300005435 Bacteria 1581
156 Ga0070713_100008004 3300005436 Bacteria 7470
157 Ga0070713_100022673 3300005436 Bacteria 4856
158 Ga0070713_100040073 3300005436 Bacteria 3806
159 Ga0070710_10006065 3300005437 Bacteria 5779
160 Ga0070710_10010819 3300005437 Bacteria 4489
161 Ga0070710_10092907 3300005437 Bacteria 1783
162 Ga0070701_10005417 3300005438 Bacteria 5267
163 Ga0070701_10023488 3300005438 Bacteria 2970
164 Ga0070711_100004283 3300005439 Bacteria 8396
165 Ga0070711_100015384 3300005439 Bacteria 4842
166 Ga0070711_100056462 3300005439 Bacteria 2715
167 Ga0070711_100077038 3300005439 Bacteria 2365
168 Ga0070705_100000175 3300005440 Bacteria 37567
169 Ga0070705_100002479 3300005440 Bacteria 9276
170 Ga0070705_100030070 3300005440 Bacteria 2995
171 Ga0070705_100033592 3300005440 Bacteria 2860
172 Ga0070705_100077350 3300005440 Bacteria 2032
173 Ga0070705_100126283 3300005440 Bacteria 1661
174 Ga0070700_100006909 3300005441 Bacteria 6095
175 Ga0070700_100009943 3300005441 Bacteria 5235
176 Ga0070700_100026867 3300005441 Bacteria 3405
177 Ga0070700_100030535 3300005441 Bacteria 3221
178 Ga0070700_100049208 3300005441 Bacteria 2616
179 Ga0070700_100078943 3300005441 Bacteria 2120
180 Ga0070700_100081059 3300005441 Bacteria 2095
181 Ga0070694_100002980 3300005444 Bacteria 10062
182 Ga0070694_100006648 3300005444 Bacteria 7024
183 Ga0070694_100025235 3300005444 Bacteria 3844
184 Ga0070694_100031890 3300005444 Bacteria 3457
185 Ga0070694_100034838 3300005444 Bacteria 3323
186 Ga0070694_100046376 3300005444 Bacteria 2917
187 Ga0070694_100100295 3300005444 Bacteria 2048
188 Ga0070694_100100423 3300005444 Bacteria 2046
189 Ga0070694_100194307 3300005444 Bacteria 1509
190 Ga0070694_100207796 3300005444 Bacteria 1463
191 Ga0070708_100014393 3300005445 Bacteria 6507
192 Ga0070708_100022190 3300005445 Bacteria 5382
193 Ga0070708_100025481 3300005445 Bacteria 5056
194 Ga0070708_100111985 3300005445 Bacteria 2509
195 Ga0070708_100130593 3300005445 Bacteria 2324
196 Ga0070708_100188023 3300005445 Bacteria 1931
197 Ga0070708_100210303 3300005445 Bacteria 1822
198 Ga0070708_100229002 3300005445 Bacteria 1744
199 Ga0070708_100262798 3300005445 Bacteria 1623
200 Ga0070708_100301947 3300005445 Bacteria 1507
201 Ga0070663_100204481 3300005455 Bacteria 1543
202 Ga0070678_100006525 3300005456 Bacteria 6852
203 Ga0070678_100036552 3300005456 Bacteria 3439
204 Ga0070678_100206605 3300005456 Bacteria 1624
205 Ga0070678_100224962 3300005456 Bacteria 1561
206 Ga0070662_100011148 3300005457 Bacteria 5922
207 Ga0070662_100014975 3300005457 Bacteria 5187
208 Ga0070662_100039023 3300005457 Bacteria 3376
209 Ga0070662_100045356 3300005457 Bacteria 3153
210 Ga0070662_100176892 3300005457 Bacteria 1680
211 Ga0070681_10002397 3300005458 Bacteria 17122
212 Ga0070681_10003472 3300005458 Bacteria 14770
213 Ga0070681_10007223 3300005458 Bacteria 10836
214 Ga0070681_10011126 3300005458 Bacteria 8904
215 Ga0070681_10025568 3300005458 Bacteria 5939
216 Ga0070681_10051196 3300005458 Bacteria 4119
217 Ga0070681_10079820 3300005458 Bacteria 3228
218 Ga0070681_10088539 3300005458 Bacteria 3047
219 Ga0070681_10105124 3300005458 Bacteria 2765
220 Ga0070681_10125946 3300005458 Bacteria 2494
221 Ga0070681_10167382 3300005458 Bacteria 2120
222 Ga0070681_10204011 3300005458 Bacteria 1895
223 Ga0070681_10370452 3300005458 Bacteria 1343
224 Ga0068867_100005066 3300005459 Bacteria 9303
225 Ga0068867_100100295 3300005459 Bacteria 2210
226 Ga0070685_10005310 3300005466 Bacteria 6533
227 Ga0070706_100004157 3300005467 Bacteria 14075
228 Ga0070706_100006592 3300005467 Bacteria 10949
229 Ga0070706_100023324 3300005467 Bacteria 5700
230 Ga0070706_100025041 3300005467 Bacteria 5493
231 Ga0070706_100048078 3300005467 Bacteria 3937
232 Ga0070706_100101171 3300005467 Bacteria 2678
233 Ga0070706_100123427 3300005467 Bacteria 2415
234 Ga0070706_100126482 3300005467 Bacteria 2383
235 Ga0070706_100135765 3300005467 Bacteria 2296
236 Ga0070706_100162922 3300005467 Bacteria 2082
237 Ga0070706_100253012 3300005467 Bacteria 1645
238 Ga0070707_100000111 3300005468 Bacteria 75249
239 Ga0070707_100019949 3300005468 Bacteria 6320
240 Ga0070707_100071190 3300005468 Bacteria 3350
241 Ga0070707_100074279 3300005468 Bacteria 3278
242 Ga0070707_100075299 3300005468 Bacteria 3255
243 Ga0070707_100088344 3300005468 Bacteria 2998
244 Ga0070707_100103404 3300005468 Bacteria 2760
245 Ga0070707_100108107 3300005468 Bacteria 2698
246 Ga0070707_100158149 3300005468 Bacteria 2207
247 Ga0070707_100225531 3300005468 Bacteria 1824
248 Ga0070707_100244470 3300005468 Bacteria 1746
249 Ga0070698_100000732 3300005471 Bacteria 35269
250 Ga0070698_100001954 3300005471 Bacteria 22884
251 Ga0070698_100048367 3300005471 Bacteria 4345
252 Ga0070698_100064792 3300005471 Bacteria 3680
253 Ga0070698_100138610 3300005471 Bacteria 2385
254 Ga0070698_100142564 3300005471 Bacteria 2347
255 Ga0070698_100145856 3300005471 Bacteria 2316
256 Ga0070698_100249357 3300005471 Bacteria 1708
257 Ga0070699_100025317 3300005518 Bacteria 5117
258 Ga0070699_100033808 3300005518 Bacteria 4418
259 Ga0070699_100041434 3300005518 Bacteria 3986
260 Ga0070699_100051744 3300005518 Bacteria 3556
261 Ga0070699_100053750 3300005518 Bacteria 3485
262 Ga0070699_100069767 3300005518 Bacteria 3054
263 Ga0070699_100319853 3300005518 Bacteria 1394
264 Ga0070679_100000601 3300005530 Bacteria 30635
265 Ga0070679_100023697 3300005530 Bacteria 6014
266 Ga0070679_100044346 3300005530 Bacteria 4430
267 Ga0070679_100045790 3300005530 Bacteria 4359
268 Ga0070679_100069873 3300005530 Bacteria 3503
269 Ga0070679_100072402 3300005530 Bacteria 3438
270 Ga0070679_100278807 3300005530 Bacteria 1625
271 Ga0070679_100343498 3300005530 Bacteria 1441
272 Ga0070684_100034431 3300005535 Bacteria 4331
273 Ga0070684_100041680 3300005535 Bacteria 3959
274 Ga0070684_100142679 3300005535 Bacteria 2167
275 Ga0070697_100024423 3300005536 Bacteria 4810
276 Ga0070697_100036389 3300005536 Bacteria 3976
277 Ga0070697_100046677 3300005536 Bacteria 3511
278 Ga0070697_100068800 3300005536 Bacteria 2899
279 Ga0070697_100089953 3300005536 Bacteria 2537
280 Ga0070697_100120873 3300005536 Bacteria 2190
281 Ga0070697_100135504 3300005536 Bacteria 2067
282 Ga0070697_100141679 3300005536 Bacteria 2022
283 Ga0070697_100144992 3300005536 Bacteria 1998
284 Ga0070697_100286344 3300005536 Bacteria 1414
285 Ga0068853_100026550 3300005539 Bacteria 4863
286 Ga0068853_100212483 3300005539 Bacteria 1764
287 Ga0070672_100003949 3300005543 Bacteria 9668
288 Ga0070672_100026322 3300005543 Bacteria 4326
289 Ga0070672_100171558 3300005543 Bacteria 1804
290 Ga0070672_100204838 3300005543 Bacteria 1650
291 Ga0070672_100245379 3300005543 Bacteria 1507
292 Ga0070686_100021163 3300005544 Bacteria 3861
293 Ga0070686_100051285 3300005544 Bacteria 2626
294 Ga0070686_100160151 3300005544 Bacteria 1584
295 Ga0070695_100008312 3300005545 Bacteria 6157
296 Ga0070695_100013344 3300005545 Bacteria 4935
297 Ga0070695_100033166 3300005545 Bacteria 3230
298 Ga0070695_100088152 3300005545 Bacteria 2065
299 Ga0070695_100150576 3300005545 Bacteria 1623
300 Ga0070695_100172301 3300005545 Bacteria 1527
301 Ga0070696_100005231 3300005546 Bacteria 8672
302 Ga0070696_100013998 3300005546 Bacteria 5386
303 Ga0070696_100028628 3300005546 Bacteria 3802
304 Ga0070696_100032388 3300005546 Bacteria 3586
305 Ga0070696_100042413 3300005546 Bacteria 3145
306 Ga0070696_100051895 3300005546 Bacteria 2852
307 Ga0070696_100053018 3300005546 Bacteria 2822
308 Ga0070696_100077257 3300005546 Bacteria 2352
309 Ga0070696_100105886 3300005546 Bacteria 2021
310 Ga0070696_100171415 3300005546 Bacteria 1604
311 Ga0070693_100043429 3300005547 Bacteria 2538
312 Ga0070665_100001142 3300005548 Bacteria 32621
313 Ga0070665_100106126 3300005548 Bacteria 2811
314 Ga0070665_100110500 3300005548 Bacteria 2751
315 Ga0070665_100194758 3300005548 Bacteria 2027
316 Ga0070665_100256810 3300005548 Bacteria 1748
317 Ga0070704_100003747 3300005549 Bacteria 8751
318 Ga0070704_100021663 3300005549 Bacteria 4171
319 Ga0070704_100023271 3300005549 Bacteria 4042
320 Ga0070704_100042785 3300005549 Bacteria 3135
321 Ga0068855_100016427 3300005563 Bacteria 8899
322 Ga0068855_100034201 3300005563 Bacteria 6063
323 Ga0068855_100041438 3300005563 Bacteria 5457
324 Ga0068855_100125252 3300005563 Bacteria 2938
325 Ga0068855_100156517 3300005563 Bacteria 2588
326 Ga0068855_100211199 3300005563 Bacteria 2181
327 Ga0068855_100307246 3300005563 Bacteria 1755
328 Ga0068855_100373693 3300005563 Bacteria 1566
329 Ga0070664_100011074 3300005564 Bacteria 7314
330 Ga0070664_100068537 3300005564 Bacteria 3033
331 Ga0070664_100139427 3300005564 Bacteria 2134
332 Ga0068857_100002740 3300005577 Bacteria 14470
333 Ga0068857_100015888 3300005577 Bacteria 6589
334 Ga0068857_100026578 3300005577 Bacteria 5102
335 Ga0068857_100061458 3300005577 Bacteria 3337
336 Ga0068854_100051569 3300005578 Bacteria 2948
337 Ga0068856_100163441 3300005614 Bacteria 2237
338 Ga0070702_100002572 3300005615 Bacteria 7884
339 Ga0070702_100008493 3300005615 Bacteria 4978
340 Ga0070702_100009357 3300005615 Bacteria 4793
341 Ga0070702_100016820 3300005615 Bacteria 3761
342 Ga0068852_100009981 3300005616 Bacteria 7065
343 Ga0068852_100021426 3300005616 Bacteria 5160
344 Ga0068852_100097256 3300005616 Bacteria 2648
345 Ga0068859_100003294 3300005617 Bacteria 16422
346 Ga0068859_100011939 3300005617 Bacteria 8726
347 Ga0068859_100015547 3300005617 Bacteria 7646
348 Ga0068859_100028177 3300005617 Bacteria 5632
349 Ga0068859_100083516 3300005617 Bacteria 3237
350 Ga0068859_100285147 3300005617 Bacteria 1744
351 Ga0068859_100300736 3300005617 Bacteria 1698
352 Ga0068864_100006580 3300005618 Bacteria 9512
353 Ga0068864_100012293 3300005618 Bacteria 7076
354 Ga0068864_100081652 3300005618 Bacteria 2834
355 Ga0068864_100112489 3300005618 Bacteria 2427
356 Ga0068866_10007241 3300005718 Bacteria 4642
357 Ga0068866_10012598 3300005718 Bacteria 3688
358 Ga0068866_10023782 3300005718 Bacteria 2854
359 Ga0068861_100000975 3300005719 Bacteria 17448
360 Ga0068861_100025036 3300005719 Bacteria 4322
361 Ga0068861_100109023 3300005719 Bacteria 2216
362 Ga0068861_100117879 3300005719 Bacteria 2137
363 Ga0068861_100288270 3300005719 Bacteria 1417
364 Ga0068863_100002641 3300005841 Bacteria 17739
365 Ga0068863_100043145 3300005841 Bacteria 4282
366 Ga0068863_100051547 3300005841 Bacteria 3900
367 Ga0068863_100064103 3300005841 Bacteria 3475
368 Ga0068863_100111800 3300005841 Bacteria 2601
369 Ga0068863_100202272 3300005841 Bacteria 1911
370 Ga0068863_100279109 3300005841 Bacteria 1618
371 Ga0068858_100003549 3300005842 Bacteria 15439
372 Ga0068858_100025878 3300005842 Bacteria 5457
373 Ga0068858_100060745 3300005842 Bacteria 3493
374 Ga0068858_100227052 3300005842 Bacteria 1769
375 Ga0068858_100306229 3300005842 Bacteria 1516
376 Ga0068860_100002169 3300005843 Bacteria 20676
377 Ga0068860_100004188 3300005843 Bacteria 14782
378 Ga0068860_100022141 3300005843 Bacteria 6152
379 Ga0068860_100105193 3300005843 Bacteria 2695
380 Ga0068860_100377495 3300005843 Bacteria 1399
381 Ga0068862_100000764 3300005844 Bacteria 32066
382 Ga0068862_100002926 3300005844 Bacteria 14928
383 Ga0068862_100003483 3300005844 Bacteria 13529
384 Ga0068862_100009767 3300005844 Bacteria 7934
385 Ga0068862_100010512 3300005844 Bacteria 7646
386 Ga0068862_100013561 3300005844 Bacteria 6752
387 Ga0068862_100054158 3300005844 Bacteria 3435
388 Ga0068862_100067739 3300005844 Bacteria 3078
389 Ga0068862_100088084 3300005844 Bacteria 2700
390 Ga0068862_100255669 3300005844 Bacteria 1598
391 Ga0081455_10000048 3300005937 Bacteria 126551
392 Ga0081455_10001008 3300005937 Bacteria 35646
393 Ga0081455_10002584 3300005937 Bacteria 21460
394 Ga0081455_10011198 3300005937 Bacteria 9024
395 Ga0081455_10020498 3300005937 Bacteria 6222
396 Ga0081455_10021909 3300005937 Bacteria 5985
397 Ga0081455_10151707 3300005937 Bacteria 1786
398 Ga0081455_10217200 3300005937 Bacteria 1420
399 Ga0081538_10025683 3300005981 Bacteria 4144
400 Ga0081538_10026012 3300005981 Bacteria 4107
401 Ga0081538_10027178 3300005981 Bacteria 3975
402 Ga0081540_1000039 3300005983 Bacteria 137196
403 Ga0081540_1001954 3300005983 Bacteria 17230
404 Ga0081540_1004248 3300005983 Bacteria 10995
405 Ga0081540_1005100 3300005983 Bacteria 9851
406 Ga0081540_1015691 3300005983 Bacteria 4782
407 Ga0081540_1032077 3300005983 Bacteria 2875
408 Ga0081540_1035908 3300005983 Bacteria 2651
409 Ga0081540_1042197 3300005983 Bacteria 2355
410 Ga0081540_1048547 3300005983 Bacteria 2125
411 Ga0081540_1051845 3300005983 Bacteria 2026
412 Ga0081540_1054086 3300005983 Bacteria 1964
413 Ga0081539_10005565 3300005985 Bacteria 12756
414 Ga0081539_10023434 3300005985 Bacteria 4045
415 Ga0081539_10029077 3300005985 Bacteria 3463
416 Ga0081539_10042213 3300005985 Bacteria 2659
417 Ga0081539_10042683 3300005985 Bacteria 2639
418 Ga0081539_10069342 3300005985 Bacteria 1898
419 Ga0070717_10039765 3300006028 Bacteria 3828
420 Ga0070717_10117638 3300006028 Bacteria 2273
421 Ga0070717_10126952 3300006028 Bacteria 2190
422 Ga0070717_10300996 3300006028 Bacteria 1426
423 Ga0075365_10056321 3300006038 Bacteria 2613
424 Ga0075365_10084311 3300006038 Bacteria 2156
425 Ga0075363_100004519 3300006048 Bacteria 6099
426 Ga0075364_10010958 3300006051 Bacteria 5496
427 Ga0075432_10005809 3300006058 Bacteria 4197
428 Ga0075432_10009022 3300006058 Bacteria 3398
429 Ga0070715_10006350 3300006163 Bacteria 4015
430 Ga0070715_10010428 3300006163 Bacteria 3312
431 Ga0070715_10021362 3300006163 Bacteria 2509
432 Ga0070715_10046249 3300006163 Bacteria 1849
433 Ga0070716_100005648 3300006173 Bacteria 6074
434 Ga0070716_100008042 3300006173 Bacteria 5223
435 Ga0070716_100014776 3300006173 Bacteria 4004
436 Ga0070716_100034413 3300006173 Bacteria 2778
437 Ga0070716_100114378 3300006173 Bacteria 1678
438 Ga0070716_100170288 3300006173 Bacteria 1420
439 Ga0070716_100201717 3300006173 Bacteria 1323
440 Ga0070712_100002022 3300006175 Bacteria 12426
441 Ga0070712_100121632 3300006175 Bacteria 1964
442 Ga0070712_100161335 3300006175 Bacteria 1731
443 Ga0075362_10001094 3300006177 Bacteria 8411
444 Ga0075362_10029472 3300006177 Bacteria 2365
445 Ga0075367_10047918 3300006178 Bacteria 2515
446 Ga0075369_10016456 3300006186 Bacteria 2984
447 Ga0075366_10005041 3300006195 Bacteria 7136
448 Ga0075366_10006363 3300006195 Bacteria 6468
449 Ga0075366_10134608 3300006195 Bacteria 1492
450 Ga0097621_100002102 3300006237 Bacteria 13652
451 Ga0097621_100012152 3300006237 Bacteria 6372
452 Ga0097621_100027490 3300006237 Bacteria 4474
453 Ga0097621_100163010 3300006237 Bacteria 1917
454 Ga0075370_10026686 3300006353 Bacteria 3201
455 Ga0075370_10112241 3300006353 Bacteria 1583
456 Ga0068871_100008543 3300006358 Bacteria 7360
457 Ga0068871_100034414 3300006358 Bacteria 4020
458 Ga0068871_100222917 3300006358 Bacteria 1634
459 Ga0068871_100262605 3300006358 Bacteria 1506
460 Ga0075428_100003062 3300006844 Bacteria 18244
461 Ga0075428_100012165 3300006844 Bacteria 9571
462 Ga0075428_100012701 3300006844 Bacteria 9365
463 Ga0075428_100014750 3300006844 Bacteria 8681
464 Ga0075428_100031483 3300006844 Bacteria 5862
465 Ga0075428_100031769 3300006844 Bacteria 5832
466 Ga0075428_100032084 3300006844 Bacteria 5804
467 Ga0075428_100070970 3300006844 Bacteria 3808
468 Ga0075428_100096246 3300006844 Bacteria 3227
469 Ga0075428_100100956 3300006844 Bacteria 3145
470 Ga0075428_100123298 3300006844 Bacteria 2820
471 Ga0075428_100175030 3300006844 Bacteria 2324
472 Ga0075428_100181164 3300006844 Bacteria 2280
473 Ga0075428_100226820 3300006844 Bacteria 2016
474 Ga0075430_100000196 3300006846 Bacteria 40930
475 Ga0075430_100000588 3300006846 Bacteria 27574
476 Ga0075430_100001414 3300006846 Bacteria 19526
477 Ga0075430_100002137 3300006846 Bacteria 16361
478 Ga0075430_100005309 3300006846 Bacteria 10875
479 Ga0075430_100012839 3300006846 Bacteria 7139
480 Ga0075430_100024234 3300006846 Bacteria 5164
481 Ga0075430_100030156 3300006846 Bacteria 4605
482 Ga0075430_100049042 3300006846 Bacteria 3564
483 Ga0075430_100074672 3300006846 Bacteria 2842
484 Ga0075430_100105672 3300006846 Bacteria 2350
485 Ga0075431_100000285 3300006847 Bacteria 39649
486 Ga0075431_100015841 3300006847 Bacteria 7644
487 Ga0075431_100017225 3300006847 Bacteria 7342
488 Ga0075431_100019032 3300006847 Bacteria 6997
489 Ga0075431_100025863 3300006847 Bacteria 6016
490 Ga0075431_100031481 3300006847 Bacteria 5464
491 Ga0075431_100091921 3300006847 Bacteria 3131
492 Ga0075431_100177690 3300006847 Bacteria 2186
493 Ga0075431_100182184 3300006847 Bacteria 2155
494 Ga0075431_100186865 3300006847 Bacteria 2125
495 Ga0075431_100196910 3300006847 Bacteria 2063
496 Ga0075431_100235873 3300006847 Bacteria 1862
497 Ga0075431_100306437 3300006847 Bacteria 1604
498 Ga0075431_100311671 3300006847 Bacteria 1588
499 Ga0075431_100379713 3300006847 Bacteria 1417
500 Ga0075433_10000728 3300006852 Bacteria 22541
501 Ga0075433_10002316 3300006852 Bacteria 14498
502 Ga0075433_10042950 3300006852 Bacteria 3923
503 Ga0075433_10056647 3300006852 Bacteria 3424
504 Ga0075433_10207815 3300006852 Bacteria 1740
505 Ga0075433_10221288 3300006852 Bacteria 1681
506 Ga0075433_10232108 3300006852 Bacteria 1638
507 Ga0075433_10322591 3300006852 Bacteria 1366
508 Ga0075434_100003094 3300006871 Bacteria 14813
509 Ga0075434_100079053 3300006871 Bacteria 3285
510 Ga0075434_100098077 3300006871 Bacteria 2935
511 Ga0075434_100098215 3300006871 Bacteria 2933
512 Ga0075434_100106220 3300006871 Bacteria 2817
513 Ga0075434_100214139 3300006871 Bacteria 1946
514 Ga0075434_100350883 3300006871 Bacteria 1496
515 Ga0075434_100410412 3300006871 Bacteria 1375
516 Ga0075429_100000573 3300006880 Bacteria 28269
517 Ga0075429_100015763 3300006880 Bacteria 6545
518 Ga0075429_100026560 3300006880 Bacteria 5028
519 Ga0075429_100066007 3300006880 Bacteria 3150
520 Ga0075429_100161147 3300006880 Bacteria 1965
521 Ga0068865_100013360 3300006881 Bacteria 5188
522 Ga0068865_100070394 3300006881 Bacteria 2478
523 Ga0068865_100080162 3300006881 Bacteria 2340
524 Ga0068865_100104200 3300006881 Bacteria 2082
525 Ga0068865_100211460 3300006881 Bacteria 1512
526 Ga0075436_100040622 3300006914 Bacteria 3209
527 Ga0075436_100051066 3300006914 Bacteria 2853
528 Ga0075436_100096253 3300006914 Bacteria 2059
529 Ga0097620_100003294 3300006931 Bacteria 16422
530 Ga0097620_100011939 3300006931 Bacteria 8726
531 Ga0097620_100015546 3300006931 Bacteria 7646
532 Ga0097620_100028177 3300006931 Bacteria 5632
533 Ga0097620_100083510 3300006931 Bacteria 3237
534 Ga0097620_100285152 3300006931 Bacteria 1744
535 Ga0097620_100300703 3300006931 Bacteria 1698
536 Ga0099822_1017947 3300006943 Bacteria 7462
537 Ga0075435_100049503 3300007076 Bacteria 3380
538 Ga0075435_100077177 3300007076 Bacteria 2731
539 Ga0075435_100133447 3300007076 Bacteria 2078
540 Ga0075435_100165794 3300007076 Bacteria 1863
541 Ga0075435_100217013 3300007076 Bacteria 1624
542 Ga0075435_100270475 3300007076 Bacteria 1449
543 Ga0099795_10014852 3300007788 Bacteria 2425
544 Ga0099795_10031443 3300007788 Bacteria 1828
545 Ga0105244_10054642 3300009036 Bacteria 2025
546 Ga0105240_10000041 3300009093 Bacteria 264078
547 Ga0105240_10004245 3300009093 Bacteria 21913
548 Ga0105240_10062946 3300009093 Bacteria 4617
549 Ga0105240_10317079 3300009093 Bacteria 1778
550 Ga0111539_10000254 3300009094 Bacteria 64117
551 Ga0111539_10000683 3300009094 Bacteria 43914
552 Ga0111539_10002526 3300009094 Bacteria 24232
553 Ga0111539_10011739 3300009094 Bacteria 10990
554 Ga0111539_10065953 3300009094 Bacteria 4276
555 Ga0111539_10099479 3300009094 Bacteria 3415
556 Ga0111539_10128818 3300009094 Bacteria 2964
557 Ga0111539_10145820 3300009094 Bacteria 2771
558 Ga0111539_10236594 3300009094 Bacteria 2126
559 Ga0111539_10279893 3300009094 Bacteria 1941
560 Ga0105245_10183915 3300009098 Bacteria 1998
561 Ga0105245_10242990 3300009098 Bacteria 1746
562 Ga0114129_10005890 3300009147 Bacteria 17359
563 Ga0114129_10007918 3300009147 Bacteria 15129
564 Ga0114129_10008352 3300009147 Bacteria 14760
565 Ga0114129_10008584 3300009147 Bacteria 14567
566 Ga0114129_10022594 3300009147 Bacteria 8922
567 Ga0114129_10023982 3300009147 Bacteria 8646
568 Ga0114129_10024415 3300009147 Bacteria 8566
569 Ga0114129_10030751 3300009147 Bacteria 7593
570 Ga0114129_10036192 3300009147 Bacteria 6971
571 Ga0114129_10058827 3300009147 Bacteria 5375
572 Ga0114129_10116757 3300009147 Bacteria 3677
573 Ga0114129_10147439 3300009147 Bacteria 3222
574 Ga0114129_10173993 3300009147 Bacteria 2933
575 Ga0114129_10195878 3300009147 Bacteria 2740
576 Ga0114129_10271585 3300009147 Bacteria 2268
577 Ga0114129_10338416 3300009147 Bacteria 1996
578 Ga0114129_10357525 3300009147 Bacteria 1933
579 Ga0114129_10427049 3300009147 Bacteria 1742
580 Ga0114129_10595964 3300009147 Bacteria 1432
581 Ga0105243_10031684 3300009148 Bacteria 4078
582 Ga0105243_10079528 3300009148 Bacteria 2672
583 Ga0105243_10111592 3300009148 Bacteria 2289
584 Ga0105243_10227041 3300009148 Bacteria 1654
585 Ga0105242_10017209 3300009176 Bacteria 5629
586 Ga0105242_10055724 3300009176 Bacteria 3234
587 Ga0105248_10004070 3300009177 Bacteria 16159
588 Ga0105248_10023633 3300009177 Bacteria 6829
589 Ga0105248_10036522 3300009177 Bacteria 5496
590 Ga0105248_10050272 3300009177 Bacteria 4675
591 Ga0105248_10052133 3300009177 Bacteria 4591
592 Ga0105248_10332211 3300009177 Bacteria 1712
593 Ga0105237_10091369 3300009545 Bacteria 3034
594 Ga0105237_10214518 3300009545 Bacteria 1925
595 Ga0105238_10094918 3300009551 Bacteria 2970
596 Ga0105249_10000580 3300009553 Bacteria 33471
597 Ga0105249_10004567 3300009553 Bacteria 11966
598 Ga0105249_10008223 3300009553 Bacteria 9087
599 Ga0105249_10018979 3300009553 Bacteria 6131
600 Ga0105249_10127689 3300009553 Bacteria 2423
601 Ga0099796_10018211 3300010159 Bacteria 2105
602 Ga0099796_10029177 3300010159 Bacteria 1778
603 Ga0105239_10006094 3300010375 Bacteria 14040
604 Ga0105239_10023806 3300010375 Bacteria 6743
605 Ga0105246_10002307 3300011119 Bacteria 11520
606 Ga0105246_10140884 3300011119 Bacteria 1813
607 Ga0157326_1000019 3300012513 Bacteria 14554
608 Ga0157371_10010154 3300013102 Bacteria 7356
609 Ga0157371_10012727 3300013102 Bacteria 6414
610 Ga0157369_10067134 3300013105 Bacteria 3857
611 Ga0157369_10152920 3300013105 Bacteria 2439
612 Ga0157369_10320029 3300013105 Bacteria 1613
613 Ga0157374_10000059 3300013296 Bacteria 116409
614 Ga0157374_10000420 3300013296 Bacteria 38392
615 Ga0157374_10011042 3300013296 Bacteria 7802
616 Ga0157374_10063069 3300013296 Bacteria 3476
617 Ga0157378_10015692 3300013297 Bacteria 6632
618 Ga0157378_10037718 3300013297 Bacteria 4283
619 Ga0157378_10089479 3300013297 Bacteria 2796
620 Ga0157378_10130357 3300013297 Bacteria 2327
621 Ga0157378_10200348 3300013297 Bacteria 1888
622 Ga0157378_10201694 3300013297 Bacteria 1882
623 Ga0163162_10006136 3300013306 Bacteria 11634
624 Ga0163162_10148135 3300013306 Bacteria 2464
625 Ga0163162_10234444 3300013306 Bacteria 1966
626 Ga0163162_10245555 3300013306 Bacteria 1922
627 Ga0157372_10043257 3300013307 Bacteria 4986
628 Ga0157375_10026125 3300013308 Bacteria 5437
629 Ga0157375_10043876 3300013308 Bacteria 4339
630 Ga0157375_10108740 3300013308 Bacteria 2868
631 Ga0157375_10190591 3300013308 Bacteria 2205
632 Ga0163163_10006954 3300014325 Bacteria 9941
633 Ga0163163_10022770 3300014325 Bacteria 5937
634 Ga0163163_10073351 3300014325 Bacteria 3413
635 Ga0163163_10103076 3300014325 Bacteria 2878
636 Ga0163163_10254024 3300014325 Bacteria 1808
637 Ga0163163_10389447 3300014325 Bacteria 1451
638 Ga0157380_10017794 3300014326 Bacteria 5265
639 Ga0157380_10130825 3300014326 Bacteria 2141
640 Ga0157380_10290076 3300014326 Bacteria 1502
641 Ga0157377_10036391 3300014745 Bacteria 2708
642 Ga0157379_10035446 3300014968 Bacteria 4448
643 Ga0157379_10072718 3300014968 Bacteria 3077
644 Ga0157379_10073976 3300014968 Bacteria 3050
645 Ga0157379_10174229 3300014968 Bacteria 1942
646 Ga0157376_10000366 3300014969 Bacteria 29717
647 Ga0157376_10021266 3300014969 Bacteria 5038
648 Ga0157376_10062627 3300014969 Bacteria 3130
649 Ga0157376_10072830 3300014969 Bacteria 2924
650 Ga0206356_10491331 3300020070 Bacteria 1668
651 Ga0206355_1150548 3300020076 Bacteria 1612
652 Ga0206352_10908026 3300020078 Bacteria 2888
653 Ga0206352_11257230 3300020078 Bacteria 1659
654 Ga0206350_10871634 3300020080 Bacteria 2162
655 Ga0206354_10060344 3300020081 Bacteria 1658
656 Ga0206354_10418299 3300020081 Bacteria 2523
657 Ga0213872_10080721 3300021361 Bacteria 1461
658 Ga0213874_10005086 3300021377 Bacteria 3045
659 Ga0213876_10004873 3300021384 Bacteria 7444
660 Ga0213876_10005191 3300021384 Bacteria 7184
661 Ga0213876_10024479 3300021384 Bacteria 3187
662 Ga0213876_10036554 3300021384 Bacteria 2590
663 Ga0224712_10012105 3300022467 Bacteria 2701
664 Ga0224712_10056701 3300022467 Bacteria 1546
665 Ga0228598_1000842 3300024227 Bacteria 6627
666 Ga0228598_1009546 3300024227 Bacteria 1943
667 Ga0209233_1002757 3300025261 Bacteria 6322
668 Ga0209758_1000294 3300025297 Bacteria 98618
669 Ga0209758_1003798 3300025297 Bacteria 13299
670 Ga0209758_1006193 3300025297 Bacteria 8738
671 Ga0207697_10007256 3300025315 Bacteria 4951
672 Ga0207697_10008426 3300025315 Bacteria 4510
673 Ga0207697_10010465 3300025315 Bacteria 3963
674 Ga0207696_1012954 3300025711 Bacteria 2930
675 Ga0207653_10001008 3300025885 Bacteria 9283
676 Ga0207682_10015238 3300025893 Bacteria 2992
677 Ga0207682_10018511 3300025893 Bacteria 2724
678 Ga0207682_10097011 3300025893 Bacteria 1285
679 Ga0207692_10001850 3300025898 Bacteria 8046
680 Ga0207692_10001861 3300025898 Bacteria 8027
681 Ga0207692_10004350 3300025898 Bacteria 5607
682 Ga0207692_10008328 3300025898 Bacteria 4289
683 Ga0207642_10010483 3300025899 Bacteria 3270
684 Ga0207642_10017186 3300025899 Bacteria 2745
685 Ga0207642_10083695 3300025899 Bacteria 1556
686 Ga0207642_10084880 3300025899 Bacteria 1548
687 Ga0207642_10086501 3300025899 Bacteria 1537
688 Ga0207710_10033867 3300025900 Bacteria 2242
689 Ga0207647_10057140 3300025904 Bacteria 2393
690 Ga0207647_10070290 3300025904 Bacteria 2115
691 Ga0207685_10002961 3300025905 Bacteria 4025
692 Ga0207685_10006264 3300025905 Bacteria 3226
693 Ga0207685_10013698 3300025905 Bacteria 2516
694 Ga0207685_10027209 3300025905 Bacteria 1999
695 Ga0207699_10010108 3300025906 Bacteria 4721
696 Ga0207699_10015690 3300025906 Bacteria 3941
697 Ga0207699_10048407 3300025906 Bacteria 2497
698 Ga0207699_10080717 3300025906 Bacteria 2016
699 Ga0207699_10086124 3300025906 Bacteria 1961
700 Ga0207699_10118915 3300025906 Bacteria 1706
701 Ga0207645_10000909 3300025907 Bacteria 24558
702 Ga0207645_10001246 3300025907 Bacteria 20949
703 Ga0207645_10030019 3300025907 Bacteria 3503
704 Ga0207645_10039141 3300025907 Bacteria 3038
705 Ga0207643_10025597 3300025908 Bacteria 3262
706 Ga0207643_10030502 3300025908 Bacteria 3001
707 Ga0207643_10079555 3300025908 Bacteria 1897
708 Ga0207643_10083433 3300025908 Bacteria 1854
709 Ga0207705_10007506 3300025909 Bacteria 8011
710 Ga0207705_10097755 3300025909 Bacteria 2156
711 Ga0207684_10000334 3300025910 Bacteria 65725
712 Ga0207684_10005045 3300025910 Bacteria 12304
713 Ga0207684_10033102 3300025910 Bacteria 4396
714 Ga0207684_10065816 3300025910 Bacteria 3078
715 Ga0207684_10091560 3300025910 Bacteria 2592
716 Ga0207684_10099628 3300025910 Bacteria 2482
717 Ga0207684_10116816 3300025910 Bacteria 2286
718 Ga0207684_10253520 3300025910 Bacteria 1518
719 Ga0207654_10144844 3300025911 Bacteria 1519
720 Ga0207707_10002337 3300025912 Bacteria 17081
721 Ga0207707_10003270 3300025912 Bacteria 14394
722 Ga0207707_10004335 3300025912 Bacteria 12560
723 Ga0207707_10012860 3300025912 Bacteria 7283
724 Ga0207707_10013953 3300025912 Bacteria 7005
725 Ga0207707_10022768 3300025912 Bacteria 5478
726 Ga0207707_10027678 3300025912 Bacteria 4957
727 Ga0207707_10056109 3300025912 Bacteria 3426
728 Ga0207707_10059354 3300025912 Bacteria 3328
729 Ga0207707_10073265 3300025912 Bacteria 2986
730 Ga0207707_10108444 3300025912 Bacteria 2427
731 Ga0207707_10182832 3300025912 Bacteria 1830
732 Ga0207707_10205128 3300025912 Bacteria 1718
733 Ga0207695_10000093 3300025913 Bacteria 270427
734 Ga0207695_10003067 3300025913 Bacteria 23953
735 Ga0207695_10017539 3300025913 Bacteria 8326
736 Ga0207693_10001366 3300025915 Bacteria 21623
737 Ga0207693_10001926 3300025915 Bacteria 18180
738 Ga0207693_10003338 3300025915 Bacteria 13734
739 Ga0207693_10048951 3300025915 Bacteria 3319
740 Ga0207693_10062321 3300025915 Bacteria 2921
741 Ga0207693_10090627 3300025915 Bacteria 2397
742 Ga0207693_10113671 3300025915 Bacteria 2124
743 Ga0207663_10000218 3300025916 Bacteria 25518
744 Ga0207663_10000533 3300025916 Bacteria 16706
745 Ga0207663_10013116 3300025916 Bacteria 4497
746 Ga0207663_10041305 3300025916 Bacteria 2810
747 Ga0207663_10064474 3300025916 Bacteria 2338
748 Ga0207663_10076841 3300025916 Bacteria 2171
749 Ga0207663_10085049 3300025916 Bacteria 2082
750 Ga0207663_10278742 3300025916 Bacteria 1241
751 Ga0207660_10001269 3300025917 Bacteria 16941
752 Ga0207660_10001710 3300025917 Bacteria 14714
753 Ga0207660_10001861 3300025917 Bacteria 14060
754 Ga0207660_10009536 3300025917 Bacteria 6284
755 Ga0207660_10011255 3300025917 Bacteria 5818
756 Ga0207660_10013609 3300025917 Bacteria 5334
757 Ga0207660_10025700 3300025917 Bacteria 4001
758 Ga0207660_10036064 3300025917 Bacteria 3437
759 Ga0207660_10059416 3300025917 Bacteria 2745
760 Ga0207660_10067521 3300025917 Bacteria 2590
761 Ga0207660_10209597 3300025917 Bacteria 1525
762 Ga0207662_10000695 3300025918 Bacteria 15329
763 Ga0207662_10000745 3300025918 Bacteria 14909
764 Ga0207662_10006823 3300025918 Bacteria 6179
765 Ga0207662_10011914 3300025918 Bacteria 4836
766 Ga0207662_10016037 3300025918 Bacteria 4223
767 Ga0207662_10045667 3300025918 Bacteria 2590
768 Ga0207662_10091381 3300025918 Bacteria 1873
769 Ga0207657_10045238 3300025919 Bacteria 3865
770 Ga0207657_10057829 3300025919 Bacteria 3340
771 Ga0207657_10059343 3300025919 Bacteria 3288
772 Ga0207657_10082571 3300025919 Bacteria 2697
773 Ga0207657_10155717 3300025919 Bacteria 1858
774 Ga0207657_10182426 3300025919 Bacteria 1696
775 Ga0207649_10006102 3300025920 Bacteria 6540
776 Ga0207649_10007666 3300025920 Bacteria 5871
777 Ga0207649_10008227 3300025920 Bacteria 5682
778 Ga0207649_10018776 3300025920 Bacteria 3940
779 Ga0207652_10004826 3300025921 Bacteria 10919
780 Ga0207652_10006486 3300025921 Bacteria 9434
781 Ga0207652_10022531 3300025921 Bacteria 5212
782 Ga0207652_10031244 3300025921 Bacteria 4471
783 Ga0207652_10044290 3300025921 Bacteria 3791
784 Ga0207652_10196571 3300025921 Bacteria 1814
785 Ga0207646_10000163 3300025922 Bacteria 90731
786 Ga0207646_10012943 3300025922 Bacteria 7997
787 Ga0207646_10071440 3300025922 Bacteria 3100
788 Ga0207646_10077354 3300025922 Bacteria 2974
789 Ga0207646_10110092 3300025922 Bacteria 2471
790 Ga0207646_10220554 3300025922 Bacteria 1713
791 Ga0207646_10226890 3300025922 Bacteria 1687
792 Ga0207646_10248979 3300025922 Bacteria 1605
793 Ga0207681_10000921 3300025923 Bacteria 19202
794 Ga0207681_10001456 3300025923 Bacteria 15236
795 Ga0207681_10003904 3300025923 Bacteria 9252
796 Ga0207681_10005449 3300025923 Bacteria 7812
797 Ga0207681_10020067 3300025923 Bacteria 4231
798 Ga0207681_10031873 3300025923 Bacteria 3445
799 Ga0207681_10117087 3300025923 Bacteria 1948
800 Ga0207681_10284402 3300025923 Bacteria 1303
801 Ga0207694_10135749 3300025924 Bacteria 1975
802 Ga0207650_10006954 3300025925 Bacteria 7713
803 Ga0207650_10018698 3300025925 Bacteria 4866
804 Ga0207650_10028886 3300025925 Bacteria 3981
805 Ga0207650_10039543 3300025925 Bacteria 3446
806 Ga0207650_10042551 3300025925 Bacteria 3332
807 Ga0207650_10067277 3300025925 Bacteria 2688
808 Ga0207650_10115619 3300025925 Bacteria 2082
809 Ga0207650_10132476 3300025925 Bacteria 1952
810 Ga0207650_10135504 3300025925 Bacteria 1931
811 Ga0207659_10000959 3300025926 Bacteria 17245
812 Ga0207659_10007653 3300025926 Bacteria 6665
813 Ga0207659_10012855 3300025926 Bacteria 5345
814 Ga0207659_10053718 3300025926 Bacteria 2874
815 Ga0207659_10060754 3300025926 Bacteria 2721
816 Ga0207659_10100538 3300025926 Bacteria 2179
817 Ga0207659_10154739 3300025926 Bacteria 1794
818 Ga0207687_10106619 3300025927 Bacteria 2072
819 Ga0207700_10026269 3300025928 Bacteria 4058
820 Ga0207700_10036414 3300025928 Bacteria 3554
821 Ga0207664_10261591 3300025929 Bacteria 1513
822 Ga0207644_10076837 3300025931 Bacteria 2458
823 Ga0207644_10164498 3300025931 Bacteria 1727
824 Ga0207690_10022305 3300025932 Bacteria 3936
825 Ga0207690_10023620 3300025932 Bacteria 3839
826 Ga0207706_10002035 3300025933 Bacteria 19832
827 Ga0207706_10005841 3300025933 Bacteria 11445
828 Ga0207706_10028938 3300025933 Bacteria 4946
829 Ga0207706_10053166 3300025933 Bacteria 3575
830 Ga0207686_10001079 3300025934 Bacteria 15961
831 Ga0207686_10015176 3300025934 Bacteria 4304
832 Ga0207686_10018632 3300025934 Bacteria 3933
833 Ga0207686_10030722 3300025934 Bacteria 3184
834 Ga0207686_10033926 3300025934 Bacteria 3050
835 Ga0207686_10042605 3300025934 Bacteria 2776
836 Ga0207686_10049385 3300025934 Bacteria 2611
837 Ga0207709_10002980 3300025935 Bacteria 10315
838 Ga0207709_10034936 3300025935 Bacteria 2968
839 Ga0207709_10072298 3300025935 Bacteria 2193
840 Ga0207709_10137952 3300025935 Bacteria 1672
841 Ga0207709_10157252 3300025935 Bacteria 1581
842 Ga0207670_10012034 3300025936 Bacteria 5043
843 Ga0207670_10036246 3300025936 Bacteria 3206
844 Ga0207670_10039944 3300025936 Bacteria 3077
845 Ga0207670_10081319 3300025936 Bacteria 2267
846 Ga0207670_10242798 3300025936 Bacteria 1388
847 Ga0207669_10011707 3300025937 Bacteria 4281
848 Ga0207669_10026425 3300025937 Bacteria 3157
849 Ga0207669_10028160 3300025937 Bacteria 3087
850 Ga0207669_10146520 3300025937 Bacteria 1647
851 Ga0207669_10164508 3300025937 Bacteria 1571
852 Ga0207704_10003676 3300025938 Bacteria 6974
853 Ga0207704_10008696 3300025938 Bacteria 4869
854 Ga0207704_10037526 3300025938 Bacteria 2799
855 Ga0207704_10223226 3300025938 Bacteria 1396
856 Ga0207665_10005278 3300025939 Bacteria 8635
857 Ga0207665_10057769 3300025939 Bacteria 2621
858 Ga0207665_10108523 3300025939 Bacteria 1947
859 Ga0207665_10141623 3300025939 Bacteria 1715
860 Ga0207691_10018044 3300025940 Bacteria 6681
861 Ga0207691_10028811 3300025940 Bacteria 5196
862 Ga0207691_10031365 3300025940 Bacteria 4961
863 Ga0207691_10187260 3300025940 Bacteria 1806
864 Ga0207711_10002753 3300025941 Bacteria 15495
865 Ga0207711_10012732 3300025941 Bacteria 6986
866 Ga0207711_10020060 3300025941 Bacteria 5571
867 Ga0207711_10030222 3300025941 Bacteria 4569
868 Ga0207711_10057259 3300025941 Bacteria 3351
869 Ga0207711_10290926 3300025941 Bacteria 1506
870 Ga0207711_10404715 3300025941 Bacteria 1268
871 Ga0207689_10004653 3300025942 Bacteria 12412
872 Ga0207689_10044042 3300025942 Bacteria 3689
873 Ga0207689_10101234 3300025942 Bacteria 2367
874 Ga0207689_10204162 3300025942 Bacteria 1632
875 Ga0207661_10001853 3300025944 Bacteria 14467
876 Ga0207661_10021271 3300025944 Bacteria 4859
877 Ga0207661_10043353 3300025944 Bacteria 3550
878 Ga0207661_10059157 3300025944 Bacteria 3087
879 Ga0207661_10084492 3300025944 Bacteria 2629
880 Ga0207661_10102602 3300025944 Bacteria 2405
881 Ga0207661_10152829 3300025944 Bacteria 1996
882 Ga0207679_10001341 3300025945 Bacteria 15577
883 Ga0207679_10001347 3300025945 Bacteria 15488
884 Ga0207679_10002943 3300025945 Bacteria 10549
885 Ga0207679_10006574 3300025945 Bacteria 7350
886 Ga0207679_10040166 3300025945 Bacteria 3347
887 Ga0207679_10381630 3300025945 Bacteria 1236
888 Ga0207667_10002033 3300025949 Bacteria 25353
889 Ga0207667_10004001 3300025949 Bacteria 18104
890 Ga0207667_10016094 3300025949 Bacteria 8465
891 Ga0207667_10042200 3300025949 Bacteria 4850
892 Ga0207667_10044959 3300025949 Bacteria 4677
893 Ga0207667_10071599 3300025949 Bacteria 3604
894 Ga0207651_10001504 3300025960 Bacteria 10623
895 Ga0207651_10035925 3300025960 Bacteria 3229
896 Ga0207651_10080597 3300025960 Bacteria 2343
897 Ga0207651_10161489 3300025960 Bacteria 1757
898 Ga0207712_10000596 3300025961 Bacteria 28910
899 Ga0207712_10002234 3300025961 Bacteria 12602
900 Ga0207712_10009138 3300025961 Bacteria 6272
901 Ga0207712_10023580 3300025961 Bacteria 4063
902 Ga0207712_10043142 3300025961 Bacteria 3110
903 Ga0207712_10058166 3300025961 Bacteria 2731
904 Ga0207712_10058973 3300025961 Bacteria 2714
905 Ga0207712_10152678 3300025961 Bacteria 1786
906 Ga0207668_10001639 3300025972 Bacteria 13068
907 Ga0207668_10024669 3300025972 Bacteria 3884
908 Ga0207668_10028177 3300025972 Bacteria 3669
909 Ga0207668_10031247 3300025972 Bacteria 3505
910 Ga0207668_10047791 3300025972 Bacteria 2932
911 Ga0207668_10310721 3300025972 Bacteria 1304
912 Ga0207658_10035012 3300025986 Bacteria 3593
913 Ga0207677_10017448 3300026023 Bacteria 4279
914 Ga0207677_10119516 3300026023 Bacteria 1979
915 Ga0207677_10189306 3300026023 Bacteria 1626
916 Ga0207677_10298127 3300026023 Bacteria 1331
917 Ga0207703_10008320 3300026035 Bacteria 8196
918 Ga0207703_10012297 3300026035 Bacteria 6674
919 Ga0207703_10093383 3300026035 Bacteria 2534
920 Ga0207703_10101060 3300026035 Bacteria 2445
921 Ga0207703_10139787 3300026035 Bacteria 2100
922 Ga0207703_10170199 3300026035 Bacteria 1915
923 Ga0207703_10235862 3300026035 Bacteria 1642
924 Ga0207703_10301979 3300026035 Bacteria 1460
925 Ga0207639_10019041 3300026041 Bacteria 4888
926 Ga0207678_10000118 3300026067 Bacteria 65608
927 Ga0207678_10035455 3300026067 Bacteria 4343
928 Ga0207678_10039362 3300026067 Bacteria 4104
929 Ga0207678_10095005 3300026067 Bacteria 2547
930 Ga0207678_10207924 3300026067 Bacteria 1674
931 Ga0207678_10296505 3300026067 Bacteria 1389
932 Ga0207708_10004898 3300026075 Bacteria 9870
933 Ga0207708_10007880 3300026075 Bacteria 7891
934 Ga0207708_10054897 3300026075 Bacteria 3037
935 Ga0207708_10090622 3300026075 Bacteria 2357
936 Ga0207708_10122644 3300026075 Bacteria 2026
937 Ga0207702_10000678 3300026078 Bacteria 36963
938 Ga0207702_10066250 3300026078 Bacteria 3095
939 Ga0207702_10209393 3300026078 Bacteria 1812
940 Ga0207641_10006730 3300026088 Bacteria 9631
941 Ga0207641_10011831 3300026088 Bacteria 7160
942 Ga0207641_10114560 3300026088 Bacteria 2396
943 Ga0207648_10016323 3300026089 Bacteria 6789
944 Ga0207648_10052941 3300026089 Bacteria 3549
945 Ga0207648_10079224 3300026089 Bacteria 2866
946 Ga0207648_10083752 3300026089 Bacteria 2781
947 Ga0207648_10085952 3300026089 Bacteria 2744
948 Ga0207648_10145976 3300026089 Bacteria 2087
949 Ga0207648_10222012 3300026089 Bacteria 1680
950 Ga0207676_10011825 3300026095 Bacteria 6244
951 Ga0207676_10048181 3300026095 Bacteria 3307
952 Ga0207676_10052602 3300026095 Bacteria 3184
953 Ga0207676_10213603 3300026095 Bacteria 1713
954 Ga0207674_10019696 3300026116 Bacteria 7304
955 Ga0207674_10100148 3300026116 Bacteria 2879
956 Ga0207674_10156626 3300026116 Bacteria 2233
957 Ga0207674_10164710 3300026116 Bacteria 2171
958 Ga0207674_10194383 3300026116 Bacteria 1979
959 Ga0207674_10295767 3300026116 Bacteria 1568
960 Ga0207674_10295768 3300026116 Bacteria 1568
961 Ga0207675_100001482 3300026118 Bacteria 23584
962 Ga0207675_100013949 3300026118 Bacteria 7491
963 Ga0207675_100022225 3300026118 Bacteria 5906
964 Ga0207675_100034087 3300026118 Bacteria 4745
965 Ga0207675_100059999 3300026118 Bacteria 3551
966 Ga0207675_100086719 3300026118 Bacteria 2939
967 Ga0207675_100151309 3300026118 Bacteria 2209
968 Ga0207683_10001846 3300026121 Bacteria 18729
969 Ga0207683_10120249 3300026121 Bacteria 2357
970 Ga0207698_10063499 3300026142 Bacteria 2890
971 Ga0207698_10107570 3300026142 Bacteria 2329
972 Ga0207698_10394090 3300026142 Bacteria 1321
973 Ga0209973_1001352 3300027252 Bacteria 2129
974 Ga0209589_1000009 3300027357 Bacteria 252104
975 Ga0209969_1000998 3300027360 Bacteria 3845
976 Ga0209969_1005374 3300027360 Bacteria 1795
977 Ga0209700_100017 3300027363 Bacteria 252104
978 Ga0209967_1005224 3300027364 Bacteria 1741
979 Ga0209967_1007178 3300027364 Bacteria 1519
980 Ga0209981_1002218 3300027378 Bacteria 2475
981 Ga0209996_1000062 3300027395 Bacteria 14921
982 Ga0209984_1000027 3300027424 Bacteria 15251
983 Ga0209984_1001796 3300027424 Bacteria 2356
984 Ga0210000_1000018 3300027462 Bacteria 28094
985 Ga0210000_1002528 3300027462 Bacteria 2605
986 Ga0209995_1000072 3300027471 Bacteria 16055
987 Ga0209995_1002667 3300027471 Bacteria 2832
988 Ga0209995_1009379 3300027471 Bacteria 1582
989 Ga0209968_1000094 3300027526 Bacteria 16055
990 Ga0209968_1005632 3300027526 Bacteria 1882
991 Ga0209982_1000629 3300027552 Bacteria 4440
992 Ga0209970_1011065 3300027614 Bacteria 1481
993 Ga0210002_1001045 3300027617 Bacteria 3828
994 Ga0209983_1004487 3300027665 Bacteria 2933
995 Ga0209588_1000683 3300027671 Bacteria 8541
996 Ga0209588_1010983 3300027671 Bacteria 2730
997 Ga0209588_1018885 3300027671 Bacteria 2148
998 Ga0209971_1000266 3300027682 Bacteria 14793
999 Ga0209971_1010223 3300027682 Bacteria 2222
1000 Ga0209971_1011157 3300027682 Bacteria 2128
1001 Ga0209971_1011882 3300027682 Bacteria 2061
1002 Ga0209966_1008167 3300027695 Bacteria 1853
1003 Ga0209998_10003141 3300027717 Bacteria 3661
1004 Ga0209974_10011093 3300027876 Bacteria 3034
1005 Ga0207428_10000452 3300027907 Bacteria 49793
1006 Ga0207428_10002442 3300027907 Bacteria 18563
1007 Ga0207428_10002487 3300027907 Bacteria 18400
1008 Ga0207428_10002947 3300027907 Bacteria 16839
1009 Ga0207428_10008077 3300027907 Bacteria 9546
1010 Ga0207428_10019254 3300027907 Bacteria 5820
1011 Ga0207428_10019939 3300027907 Bacteria 5710
1012 Ga0207428_10024590 3300027907 Bacteria 5057
1013 Ga0207428_10087244 3300027907 Bacteria 2428
1014 Ga0207428_10155353 3300027907 Bacteria 1740
1015 Ga0268266_10016375 3300028379 Bacteria 6339
1016 Ga0268266_10038713 3300028379 Bacteria 4059
1017 Ga0268266_10069684 3300028379 Bacteria 3047
1018 Ga0268266_10290198 3300028379 Bacteria 1523
1019 Ga0268265_10000619 3300028380 Bacteria 35414
1020 Ga0268265_10002653 3300028380 Bacteria 13279
1021 Ga0268265_10003125 3300028380 Bacteria 12070
1022 Ga0268265_10004276 3300028380 Bacteria 9964
1023 Ga0268265_10023953 3300028380 Bacteria 4311
1024 Ga0268265_10056115 3300028380 Bacteria 2995
1025 Ga0268265_10148761 3300028380 Bacteria 1972
1026 Ga0268264_10001609 3300028381 Bacteria 20890
1027 Ga0268264_10002890 3300028381 Bacteria 14938
1028 Ga0268264_10028955 3300028381 Bacteria 4534
1029 Ga0268264_10076084 3300028381 Bacteria 2855
1030 Ga0268264_10125894 3300028381 Bacteria 2264
1031 Ga0268264_10142124 3300028381 Bacteria 2141
1032 Ga0265334_10000037 3300028573 Bacteria 102928
1033 Ga0265318_10001354 3300028577 Bacteria 14601
1034 Ga0307517_10023999 3300028786 Bacteria 7543
1035 Ga0265338_10083880 3300028800 Bacteria 2663
1036 Ga0265330_10026535 3300031235 Bacteria 2620
1037 Ga0265330_10040631 3300031235 Bacteria 2065
1038 Ga0265332_10003683 3300031238 Bacteria 7337
1039 Ga0265332_10025986 3300031238 Bacteria 2569
1040 Ga0265320_10006474 3300031240 Bacteria 7383
1041 Ga0265320_10069334 3300031240 Bacteria 1664
1042 Ga0265325_10001769 3300031241 Bacteria 14972
1043 Ga0265325_10042129 3300031241 Bacteria 2389
1044 Ga0265325_10042338 3300031241 Bacteria 2382
1045 Ga0265340_10003857 3300031247 Bacteria 8447
1046 Ga0265340_10008522 3300031247 Bacteria 5533
1047 Ga0265340_10009510 3300031247 Bacteria 5212
1048 Ga0265331_10030089 3300031250 Bacteria 2705
1049 Ga0265331_10033286 3300031250 Bacteria 2549
1050 Ga0265327_10034681 3300031251 Bacteria 2797
1051 Ga0265327_10068129 3300031251 Bacteria 1791
1052 Ga0265316_10018043 3300031344 Bacteria 6080
1053 Ga0307513_10204004 3300031456 Bacteria 1815
1054 Ga0307408_100002257 3300031548 Bacteria 13743
1055 Ga0307408_100002760 3300031548 Bacteria 12197
1056 Ga0307408_100170999 3300031548 Bacteria 1735
1057 Ga0307408_100189027 3300031548 Bacteria 1658
1058 Ga0265313_10001884 3300031595 Bacteria 19075
1059 Ga0265313_10055251 3300031595 Bacteria 1881
1060 Ga0307508_10026303 3300031616 Bacteria 5274
1061 Ga0307508_10047547 3300031616 Bacteria 3826
1062 Ga0316575_10000334 3300031665 Bacteria 13240
1063 Ga0316579_10098817 3300031691 Bacteria 1397
1064 Ga0265314_10004347 3300031711 Bacteria 13204
1065 Ga0265314_10004621 3300031711 Bacteria 12682
1066 Ga0265314_10014975 3300031711 Bacteria 6175
1067 Ga0265314_10031643 3300031711 Bacteria 3902
1068 Ga0265314_10140826 3300031711 Bacteria 1491
1069 Ga0265342_10025101 3300031712 Bacteria 3752
1070 Ga0316576_10015331 3300031727 Bacteria 5141
1071 Ga0316578_10069120 3300031728 Bacteria 2089
1072 Ga0307405_10000834 3300031731 Bacteria 12135
1073 Ga0307405_10051255 3300031731 Bacteria 2560
1074 Ga0307405_10106508 3300031731 Bacteria 1891
1075 Ga0316577_10000808 3300031733 Bacteria 13589
1076 Ga0307413_10001842 3300031824 Bacteria 8343
1077 Ga0307413_10006517 3300031824 Bacteria 5343
1078 Ga0307413_10006826 3300031824 Bacteria 5248
1079 Ga0307413_10029378 3300031824 Bacteria 3074
1080 Ga0307413_10088705 3300031824 Bacteria 2007
1081 Ga0307413_10130446 3300031824 Bacteria 1719
1082 Ga0307410_10001490 3300031852 Bacteria 10610
1083 Ga0307410_10037876 3300031852 Bacteria 3154
1084 Ga0307410_10045318 3300031852 Bacteria 2927
1085 Ga0307410_10046976 3300031852 Bacteria 2883
1086 Ga0307410_10049143 3300031852 Bacteria 2830
1087 Ga0307410_10100632 3300031852 Bacteria 2071
1088 Ga0307406_10001264 3300031901 Bacteria 14150
1089 Ga0307406_10002275 3300031901 Bacteria 10446
1090 Ga0307406_10015689 3300031901 Bacteria 4390
1091 Ga0307406_10025885 3300031901 Bacteria 3516
1092 Ga0307406_10057841 3300031901 Bacteria 2489
1093 Ga0307407_10017582 3300031903 Bacteria 3593
1094 Ga0307407_10038507 3300031903 Bacteria 2650
1095 Ga0307407_10090479 3300031903 Bacteria 1874
1096 Ga0307412_10007821 3300031911 Bacteria 6085
1097 Ga0307412_10009892 3300031911 Bacteria 5483
1098 Ga0307412_10058964 3300031911 Bacteria 2570
1099 Ga0307412_10079641 3300031911 Bacteria 2261
1100 Ga0307412_10163159 3300031911 Bacteria 1658
1101 Ga0307409_100007839 3300031995 Bacteria 6426
1102 Ga0307409_100009070 3300031995 Bacteria 6087
1103 Ga0307409_100019491 3300031995 Bacteria 4595
1104 Ga0307409_100055682 3300031995 Bacteria 3055
1105 Ga0307409_100096366 3300031995 Bacteria 2440
1106 Ga0307409_100178900 3300031995 Bacteria 1875
1107 Ga0307416_100001472 3300032002 Bacteria 12830
1108 Ga0307416_100083952 3300032002 Bacteria 2704
1109 Ga0307416_100096391 3300032002 Bacteria 2558
1110 Ga0307416_100274081 3300032002 Bacteria 1659
1111 Ga0307416_100523430 3300032002 Bacteria 1254
1112 Ga0307414_10004583 3300032004 Bacteria 7521
1113 Ga0307414_10080884 3300032004 Bacteria 2377
1114 Ga0307414_10179904 3300032004 Bacteria 1700
1115 Ga0307411_10007737 3300032005 Bacteria 5504
1116 Ga0307411_10041503 3300032005 Bacteria 2928
1117 Ga0307411_10107058 3300032005 Bacteria 1991
1118 Ga0307411_10153895 3300032005 Bacteria 1713
1119 Ga0307415_100001337 3300032126 Bacteria 11702
1120 Ga0307415_100004471 3300032126 Bacteria 7257
1121 Ga0307415_100017287 3300032126 Bacteria 4322
1122 Ga0307415_100055843 3300032126 Bacteria 2704
1123 Ga0307415_100095105 3300032126 Bacteria 2168
1124 Ga0307415_100340738 3300032126 Bacteria 1258
1125 Ga0316583_10001183 3300032133 Bacteria 8556
1126 Ga0316585_10037261 3300032137 Bacteria 1543
1127 Ga0316593_10051045 3300032168 Bacteria 1397
1128 Ga0307510_10061720 3300033180 Bacteria 3838
1129 Ga0315911_1000009 3300033442 Bacteria 379354
1130 Ga0316592_1003439 3300033524 Bacteria 2851
1131 Ga0316592_1008612 3300033524 Bacteria 2022
1132 Ga0316588_1000228 3300033528 Bacteria 6735
1133 Ga0316588_1006825 3300033528 Bacteria 2297
1134 Ga0316588_1016804 3300033528 Bacteria 1626
1135 Ga0316587_1000001 3300033529 Bacteria 17933
1136 Ga0316587_1000006 3300033529 Bacteria 12250
1137 Ga0316596_1028364 3300033541 Bacteria 1447
1138 Ga0316215_1002072 3300033544 Bacteria 1898
1139 Ga0373930_0008465 3300034816 Bacteria 1800
1140 Ga0373948_0008982 3300034817 Bacteria 1715
1141 Ga0373950_0016909 3300034818 Bacteria 1251
1142 Ga0373959_0004698 3300034820 Bacteria 2214
1143 Ga0373959_0008900 3300034820 Bacteria 1719
1144 Ga0373938_0019036 3300034957 Bacteria 1369
1145 Ga0373926_0002802 3300035083 Bacteria 5566
1146 Ga0373926_0015003 3300035083 Bacteria 2639
1147 Ga0373926_0025049 3300035083 Bacteria 2081
1148 Ga0373928_0001860 3300035084 Bacteria 4119
1149 Ga0373928_0017566 3300035084 Bacteria 1474
1150 Ga0373929_0012636 3300035085 Bacteria 1607
1151 Ga0373934_0000472 3300035086 Bacteria 14068
1152 Ga0373934_0016588 3300035086 Bacteria 2800
1153 Ga0373934_0069427 3300035086 Bacteria 1408
1154 Ga0373934_0071452 3300035086 Bacteria 1388
1155 Ga0373940_0000987 3300035088 Bacteria 4856
1156 Ga0373949_0003354 3300035090 Bacteria 3841
1157 Ga0373949_0010232 3300035090 Bacteria 2055
1158 Ga0373949_0011969 3300035090 Bacteria 1915
1159 Ga0373923_0026151 3300035111 Bacteria 2320
1160 Ga0373923_0032751 3300035111 Bacteria 2101
1161 Ga0373939_0010982 3300035114 Bacteria 2277
1162 Ga0373939_0011969 3300035114 Bacteria 2202
1163 Ga0373939_0016474 3300035114 Bacteria 1949
1164 Ga0373939_0019524 3300035114 Bacteria 1830
1165 Ga0373941_0011416 3300035115 Bacteria 2295
1166 Ga0373941_0029431 3300035115 Bacteria 1620
1167 Ga0373941_0042549 3300035115 Bacteria 1411
1168 Ga0373941_0068417 3300035115 Bacteria 1173
1169 Ga0373945_0085162 3300035116 Bacteria 1216
1170 Ga0373953_0005866 3300035117 Bacteria 4014
1171 Ga0373953_0028142 3300035117 Bacteria 2165
1172 Ga0373954_0031264 3300035118 Bacteria 2457
1173 Ga0373954_0087250 3300035118 Bacteria 1495
1174 Ga0373956_0001329 3300035119 Bacteria 10206
1175 Ga0373956_0038502 3300035119 Bacteria 2115
1176 Ga0373956_0076406 3300035119 Bacteria 1532
1177 Ga0373956_0078110 3300035119 Bacteria 1516
1178 Ga0373957_0025695 3300035120 Bacteria 2125
1179 Ga0373957_0030047 3300035120 Bacteria 1989
1180 Ga0373957_0045634 3300035120 Bacteria 1661
1181 Ga0373960_0009168 3300035121 Bacteria 2389
1182 Ga0373960_0017396 3300035121 Bacteria 1863
1183 Ga0373960_0019913 3300035121 Bacteria 1768
1184 Ga0373943_0014563 3300035170 Bacteria 3563
1185 Ga0373943_0097484 3300035170 Bacteria 1532
1186 Ga0373946_0007151 3300035171 Bacteria 4076
1187 Ga0373946_0018716 3300035171 Bacteria 2662
1188 Ga0373946_0027375 3300035171 Bacteria 2255
1189 Ga0373946_0095766 3300035171 Bacteria 1323
1190 Ga0373955_0000309 3300035172 Bacteria 20251
1191 Ga0373955_0012698 3300035172 Bacteria 4055
1192 Ga0373955_0043063 3300035172 Bacteria 2427
1193 Ga0373942_0008030 3300035207 Bacteria 2454
1194 Ga0373942_0027676 3300035207 Bacteria 1476
1195 Ga0373942_0034045 3300035207 Bacteria 1361
1196 Ga0373942_0035913 3300035207 Bacteria 1332
1197 Ga0373961_0020667 3300035241 Bacteria 1743
1198 Ga0373961_0029361 3300035241 Bacteria 1522
1199 Ga0373961_0034513 3300035241 Bacteria 1430
1200 Ga0373962_0002684 3300035242 Bacteria 4233
1201 Ga0373962_0013863 3300035242 Bacteria 2048
1202 Ga0373962_0016237 3300035242 Bacteria 1918
1203 Ga0373962_0021559 3300035242 Bacteria 1701
1204 Ga0373924_0001445 3300035410 Bacteria 7710
1205 Ga0373924_0011533 3300035410 Bacteria 3285
1206 Ga0373931_0003223 3300035691 Bacteria 7288
1207 Ga0373931_0008373 3300035691 Bacteria 4902
1208 Ga0373931_0020620 3300035691 Bacteria 3299
1209 Ga0373931_0035165 3300035691 Bacteria 2603
1210 Ga0373931_0047139 3300035691 Bacteria 2280
1211 Ga0373931_0072741 3300035691 Bacteria 1880
1212 Ga0373931_0132212 3300035691 Bacteria 1437
1213 Ga0373931_0135530 3300035691 Bacteria 1421
1214 Ga0373935_0001142 3300035692 Bacteria 14517
1215 Ga0373935_0008159 3300035692 Bacteria 6277
1216 Ga0373935_0090314 3300035692 Bacteria 2004
1217 Ga0373927_0029867 3300035695 Bacteria 3555
1218 Ga0373927_0036111 3300035695 Bacteria 3214
1219 Ga0373927_0053681 3300035695 Bacteria 2607
1220 Ga0373927_0095902 3300035695 Bacteria 1928
1221 Ga0373933_0000191 3300035724 Bacteria 40734
1222 Ga0373933_0000226 3300035724 Bacteria 37516
1223 Ga0373933_0002765 3300035724 Bacteria 9786
1224 Ga0373933_0026815 3300035724 Bacteria 3312
1225 Ga0373933_0057615 3300035724 Bacteria 2335
1226 Ga0373933_0070349 3300035724 Bacteria 2128
1227 Ga0373933_0082667 3300035724 Bacteria 1971
1228 Ga0373933_0115338 3300035724 Bacteria 1678
1229 Ga0373947_0012496 3300035725 Bacteria 4869
1230 Ga0373947_0018231 3300035725 Bacteria 4040
1231 Ga0373947_0028579 3300035725 Bacteria 3270
1232 Ga0373947_0075744 3300035725 Bacteria 2072
1233 Ga0373947_0106809 3300035725 Bacteria 1765
1234 Ga0373947_0147968 3300035725 Bacteria 1511
1235 Ga0310104_02351 3300036242 Bacteria 1622
1236 Ga0373937_0000625 3300036401 Bacteria 31052
1237 Ga0373937_0000922 3300036401 Bacteria 24939
1238 Ga0373937_0007608 3300036401 Bacteria 9383
1239 Ga0373937_0011530 3300036401 Bacteria 7759
1240 Ga0373937_0020942 3300036401 Bacteria 5865
1241 Ga0373937_0042587 3300036401 Bacteria 4142
1242 Ga0373937_0057225 3300036401 Bacteria 3581
1243 Ga0373937_0077479 3300036401 Bacteria 3072
1244 Ga0373937_0082050 3300036401 Bacteria 2983
1245 Ga0373937_0087155 3300036401 Bacteria 2889
1246 Ga0373937_0110593 3300036401 Bacteria 2555
1247 Ga0373937_0128072 3300036401 Bacteria 2369
1248 Ga0373937_0144716 3300036401 Bacteria 2224
1249 Ga0373937_0364132 3300036401 Bacteria 1370
1250 Ga0373937_0560283 3300036401 Bacteria 1085
1251 Ga0316582_0010203 3300036647 Bacteria 5134
1252 Ga0316582_0020988 3300036647 Bacteria 3850
1253 Ga0316582_0145583 3300036647 Bacteria 1599
1254 Ga0316582_0159975 3300036647 Bacteria 1525
1255 Ga0316584_0186233 3300036712 Bacteria 1536
1256 Ga0373925_0011980 3300037068 Bacteria 6278
1257 Ga0373925_0015764 3300037068 Bacteria 5468
1258 Ga0373925_0029577 3300037068 Bacteria 4019
1259 Ga0373925_0029981 3300037068 Bacteria 3991
1260 Ga0373925_0042031 3300037068 Bacteria 3390
1261 Ga0373925_0045962 3300037068 Bacteria 3245
1262 Ga0373925_0065943 3300037068 Bacteria 2728
1263 Ga0373925_0087086 3300037068 Bacteria 2384
1264 Ga0373925_0103338 3300037068 Bacteria 2193
1265 Ga0373925_0114848 3300037068 Bacteria 2084
1266 Ga0373925_0116539 3300037068 Bacteria 2069
1267 Ga0373925_0128704 3300037068 Bacteria 1972
1268 Ga0373925_0216071 3300037068 Bacteria 1529
1269 Ga0373925_0219440 3300037068 Bacteria 1517
1270 Ga0395899_0009753 3300037312 Bacteria 7369
1271 Ga0395899_0126969 3300037312 Bacteria 1823
1272 Ga0395900_0001056 3300037418 Bacteria 35315
1273 Ga0395900_0006668 3300037418 Bacteria 11995
1274 Ga0395900_0013202 3300037418 Bacteria 8444
1275 Ga0395900_0037244 3300037418 Bacteria 5017
1276 Ga0395900_0058815 3300037418 Bacteria 3957
1277 Ga0395900_0304856 3300037418 Bacteria 1577
1278 Ga0395898_0004457 3300037466 Bacteria 15305
1279 Ga0395898_0007760 3300037466 Bacteria 11394
1280 Ga0395898_0039516 3300037466 Bacteria 4670
1281 Ga0395898_0047677 3300037466 Bacteria 4203
1282 Ga0395898_0158194 3300037466 Bacteria 2167
1283 Ga0395905_0025260 3300037471 Bacteria 5602
1284 Ga0395905_0038275 3300037471 Bacteria 4500
1285 Ga0395905_0099808 3300037471 Bacteria 2726
1286 Ga0395905_0155091 3300037471 Bacteria 2154
1287 Ga0395905_0163267 3300037471 Bacteria 2093
1288 Ga0395905_0193597 3300037471 Bacteria 1907
1289 Ga0395905_0206228 3300037471 Bacteria 1842
1290 Ga0395905_0383764 3300037471 Bacteria 1299
1291 Ga0436364_0001908 3300037853 Bacteria 3522
1292 Ga0436364_0931532 3300037853 Bacteria 1795
1293 Ga0395901_0001137 3300038443 Bacteria 28208
1294 Ga0395901_0001770 3300038443 Bacteria 22280
1295 Ga0395901_0001933 3300038443 Bacteria 21348
1296 Ga0395901_0010920 3300038443 Bacteria 9204
1297 Ga0395901_0016009 3300038443 Bacteria 7639
1298 Ga0395901_0388912 3300038443 Bacteria 1434
1299 Ga0436365_0274631 3300039437 Bacteria 71187
1300 Ga0436365_0774305 3300039437 Bacteria 92788
1301 Ga0436365_1048027 3300039437 Bacteria 4056
1302 Ga0436365_1305368 3300039437 Bacteria 4101
1303 Ga0436360_0092949 3300039438 Bacteria 1627
1304 Ga0436360_1325874 3300039438 Bacteria 11423
1305 Ga0436361_0047865 3300039447 Bacteria 1797
1306 Ga0436361_0496850 3300039447 Bacteria 5498
1307 Ga0436363_0329569 3300039450 Bacteria 6490
1308 Ga0436363_1374698 3300039450 Bacteria 1679
1309 Ga0436362_0394382 3300039453 Bacteria 1273
1310 Ga0436362_0603905 3300039453 Bacteria 5971
1311 Ga0439447_009570 3300041407 Bacteria 2927
1312 Ga0439453_0001969 3300041408 Bacteria 2756
1313 Ga0439453_0016685 3300041408 Bacteria 1283
1314 Ga0439461_0004017 3300041410 Bacteria 2442
1315 Ga0439466_0025975 3300041411 Bacteria 2040
1316 Ga0439465_0010957 3300041413 Bacteria 2845
1317 Ga0451855_0958738 3300041511 Bacteria 6199
1318 Ga0439437_001583 3300042000 Bacteria 2394
1319 Ga0439441_003681 3300042001 Bacteria 2277
1320 Ga0439442_009336 3300042002 Bacteria 1985
1321 Ga0439448_0025835 3300042005 Bacteria 1844
1322 Ga0439448_0053979 3300042005 Bacteria 1320
1323 Ga0439450_013574 3300042008 Bacteria 1639
1324 Ga0439455_0009644 3300042012 Bacteria 2102
1325 Ga0439455_0018111 3300042012 Bacteria 1649
1326 Ga0439455_0027284 3300042012 Bacteria 1398
1327 Ga0450921_000329 3300042123 Bacteria 2128
1328 Ga0450923_001795 3300042125 Bacteria 2940
1329 Ga0450923_008971 3300042125 Bacteria 1737
1330 Ga0450888_001021 3300042126 Bacteria 2642
1331 Ga0450902_008086 3300042137 Bacteria 1637
1332 Ga0450910_002597 3300042147 Bacteria 2379
1333 Ga0439458_0012925 3300042157 Bacteria 1877
1334 Ga0439458_0017725 3300042157 Bacteria 1627
1335 Ga0439434_0001339 3300042435 Bacteria 7101
1336 Ga0439434_0020661 3300042435 Bacteria 1978
1337 Ga0439444_0021580 3300042437 Bacteria 1141
1338 Ga0439459_0017297 3300042438 Bacteria 1342
1339 Ga0439464_0010092 3300042439 Bacteria 2492
1340 Ga0439464_0013994 3300042439 Bacteria 2154
1341 Ga0439464_0021224 3300042439 Bacteria 1782
1342 Ga0439464_0025031 3300042439 Bacteria 1652
1343 Ga0439460_0016615 3300042461 Bacteria 1962
1344 Ga0439460_0021671 3300042461 Bacteria 1758
1345 Ga0439460_0034043 3300042461 Bacteria 1466
1346 Ga0450893_0012896 3300042532 Bacteria 1390
1347 Ga0451577_0000001 3300042876 Bacteria 2461803
1348 Ga0451577_0000139 3300042876 Bacteria 161883
1349 Ga0451577_0003185 3300042876 Bacteria 18443
1350 Ga0451577_0107174 3300042876 Bacteria 2497
1351 Ga0451577_0134120 3300042876 Bacteria 2222
1352 Ga0451577_0262410 3300042876 Bacteria 1564
1353 Ga0451577_0315405 3300042876 Bacteria 1417
1354 Ga0466969_0008223 3300044656 Bacteria 5534
1355 Ga0453683_0000392 3300044673 Bacteria 52154
1356 Ga0453683_0008242 3300044673 Bacteria 7007
1357 Ga0453683_0018335 3300044673 Bacteria 4493
1358 Ga0466963_0102827 3300044694 Bacteria 1957
1359 Ga0453684_0007134 3300044712 Bacteria 20810
1360 Ga0453684_0011806 3300044712 Bacteria 14554
1361 Ga0453684_0016991 3300044712 Bacteria 11305
1362 Ga0453684_0017055 3300044712 Bacteria 11276
1363 Ga0453684_0023903 3300044712 Bacteria 8967
1364 Ga0453684_0039258 3300044712 Bacteria 6454
1365 Ga0453684_0043642 3300044712 Bacteria 6022
1366 Ga0453684_0180682 3300044712 Bacteria 2477
1367 Ga0453684_0344576 3300044712 Bacteria 1681
1368 Ga0453684_0441992 3300044712 Bacteria 1449
1369 Ga0466957_0172776 3300044842 Bacteria 1408
1370 Ga0466960_0052749 3300044901 Bacteria 1969
1371 Ga0451576_0001666 3300045051 Bacteria 36880
1372 Ga0451576_0004133 3300045051 Bacteria 19143
1373 Ga0451576_0005560 3300045051 Bacteria 15750
1374 Ga0451576_0033892 3300045051 Bacteria 5425
1375 Ga0451576_0067523 3300045051 Bacteria 3722
1376 Ga0451576_0125552 3300045051 Bacteria 2674
1377 Ga0451576_0132335 3300045051 Bacteria 2600
1378 Ga0451576_0145157 3300045051 Bacteria 2474
1379 Ga0451576_0176609 3300045051 Bacteria 2230
1380 Ga0451576_0191597 3300045051 Bacteria 2135
1381 Ga0451576_0302716 3300045051 Bacteria 1672
1382 Ga0451576_0396244 3300045051 Bacteria 1447
1383 Ga0451576_0421819 3300045051 Bacteria 1400
1384 Ga0451576_0509390 3300045051 Bacteria 1264
1385 Ga0466967_0083665 3300045976 Bacteria 2886
1386 Ga0495592_0001172 3300046454 Bacteria 18177
1387 Ga0495592_0057874 3300046454 Bacteria 2860
1388 Ga0495592_0078693 3300046454 Bacteria 2388
1389 Ga0495592_0112240 3300046454 Bacteria 1927
1390 Ga0495592_0187398 3300046454 Bacteria 1404
1391 Ga0495590_0033830 3300046457 Bacteria 1786
1392 Ga0495629_0010959 3300046459 Bacteria 6589
1393 Ga0495629_0013164 3300046459 Bacteria 5973
1394 Ga0495629_0041225 3300046459 Bacteria 3249
1395 Ga0495629_0050570 3300046459 Bacteria 2910
1396 Ga0495629_0153391 3300046459 Bacteria 1601
1397 Ga0495651_0000116 3300046462 Bacteria 59001
1398 Ga0495651_0004583 3300046462 Bacteria 10565
1399 Ga0495651_0012754 3300046462 Bacteria 6488
1400 Ga0495651_0086816 3300046462 Bacteria 2353
1401 Ga0495653_0000992 3300046463 Bacteria 21849
1402 Ga0495653_0043909 3300046463 Bacteria 3472
1403 Ga0495653_0075445 3300046463 Bacteria 2509
1404 Ga0495580_0025129 3300046472 Bacteria 4353
1405 Ga0495580_0070479 3300046472 Bacteria 2442
1406 Ga0495580_0077981 3300046472 Bacteria 2311
1407 Ga0495580_0084214 3300046472 Bacteria 2215
1408 Ga0495580_0122521 3300046472 Bacteria 1805
1409 Ga0495580_0129835 3300046472 Bacteria 1748
1410 Ga0495582_0000533 3300046473 Bacteria 21056
1411 Ga0495582_0003714 3300046473 Bacteria 8595
1412 Ga0495582_0036893 3300046473 Bacteria 2689
1413 Ga0495582_0047252 3300046473 Bacteria 2370
1414 Ga0495582_0102061 3300046473 Bacteria 1606
1415 Ga0495582_0111841 3300046473 Bacteria 1534
1416 Ga0495639_0004359 3300046475 Bacteria 6064
1417 Ga0495639_0004660 3300046475 Bacteria 5889
1418 Ga0495639_0013867 3300046475 Bacteria 3484
1419 Ga0495662_0000285 3300046476 Bacteria 21823
1420 Ga0495662_0023087 3300046476 Bacteria 3003
1421 Ga0495662_0039096 3300046476 Bacteria 2292
1422 Ga0495662_0058686 3300046476 Bacteria 1858
1423 Ga0495662_0137064 3300046476 Bacteria 1204
1424 Ga0495662_0148498 3300046476 Bacteria 1154
1425 Ga0495664_0000961 3300046477 Bacteria 14809
1426 Ga0495584_0014690 3300046491 Bacteria 3990
1427 Ga0495584_0033702 3300046491 Bacteria 2592
1428 Ga0495594_0006984 3300046499 Bacteria 5803
1429 Ga0495594_0026625 3300046499 Bacteria 3112
1430 Ga0495594_0033559 3300046499 Bacteria 2791
1431 Ga0495594_0040646 3300046499 Bacteria 2546
1432 Ga0495594_0054681 3300046499 Bacteria 2200
1433 Ga0495594_0085743 3300046499 Bacteria 1762
1434 Ga0495596_0065051 3300046500 Bacteria 1418
1435 Ga0495607_0105852 3300046501 Bacteria 1499
1436 Ga0495606_0010760 3300046507 Bacteria 7541
1437 Ga0495608_0001013 3300046511 Bacteria 19794
1438 Ga0495608_0059430 3300046511 Bacteria 2518
1439 Ga0495618_0008291 3300046514 Bacteria 6292
1440 Ga0495618_0059266 3300046514 Bacteria 2426
1441 Ga0495618_0096188 3300046514 Bacteria 1894
1442 Ga0495628_0042659 3300046516 Bacteria 3617
1443 Ga0495628_0051410 3300046516 Bacteria 3258
1444 Ga0495628_0112083 3300046516 Bacteria 2097
1445 Ga0495630_0000003 3300046517 Bacteria 524289
1446 Ga0495630_0017202 3300046517 Bacteria 5294
1447 Ga0495630_0034149 3300046517 Bacteria 3796
1448 Ga0495630_0082123 3300046517 Bacteria 2432
1449 Ga0495632_0090958 3300046519 Bacteria 1446
1450 Ga0495643_0000057 3300046522 Bacteria 195145
1451 Ga0495648_0003969 3300046524 Bacteria 12804
1452 Ga0495666_0113004 3300046526 Bacteria 1275
1453 Ga0495652_0001095 3300046529 Bacteria 30639
1454 Ga0495652_0005949 3300046529 Bacteria 11410
1455 Ga0495652_0040514 3300046529 Bacteria 4026
1456 Ga0495652_0101153 3300046529 Bacteria 2337
1457 Ga0495652_0124434 3300046529 Bacteria 2051
1458 Ga0495665_0002814 3300046531 Bacteria 9385
1459 Ga0495665_0007282 3300046531 Bacteria 5973
1460 Ga0495665_0014231 3300046531 Bacteria 4292
1461 Ga0495640_0020543 3300046533 Bacteria 4859
1462 Ga0495640_0031131 3300046533 Bacteria 3811
1463 Ga0495640_0064598 3300046533 Bacteria 2474
1464 Ga0495640_0082221 3300046533 Bacteria 2139
1465 Ga0495586_0030719 3300046535 Bacteria 2875
1466 Ga0495586_0036590 3300046535 Bacteria 2635
1467 Ga0495586_0081706 3300046535 Bacteria 1776
1468 Ga0495586_0119850 3300046535 Bacteria 1469
1469 Ga0495586_0201956 3300046535 Bacteria 1127
1470 Ga0495587_0000143 3300046536 Bacteria 53480
1471 Ga0495587_0000383 3300046536 Bacteria 31535
1472 Ga0495587_0003735 3300046536 Bacteria 10101
1473 Ga0495587_0004112 3300046536 Bacteria 9625
1474 Ga0495598_0039224 3300046537 Bacteria 1376
1475 Ga0495621_0025602 3300046539 Bacteria 1983
1476 Ga0495645_0001091 3300046543 Bacteria 18367
1477 Ga0495645_0001110 3300046543 Bacteria 18204
1478 Ga0495645_0001766 3300046543 Bacteria 14712
1479 Ga0495645_0012119 3300046543 Bacteria 6074
1480 Ga0495633_0058911 3300046558 Bacteria 1802
1481 Ga0495633_0070105 3300046558 Bacteria 1636
1482 Ga0495667_0001636 3300046559 Bacteria 14836
1483 Ga0495667_0011265 3300046559 Bacteria 6052
1484 Ga0495667_0042365 3300046559 Bacteria 3019
1485 Ga0495667_0107565 3300046559 Bacteria 1802
1486 Ga0495634_0001443 3300046642 Bacteria 21148
1487 Ga0495634_0018723 3300046642 Bacteria 4925
1488 Ga0495635_0000158 3300046663 Bacteria 41599
1489 Ga0495635_0007400 3300046663 Bacteria 7663
1490 Ga0495635_0013387 3300046663 Bacteria 5741
1491 Ga0495635_0079904 3300046663 Bacteria 2238
1492 Ga0495659_0002742 3300046664 Bacteria 5664
1493 Ga0495659_0008622 3300046664 Bacteria 3245
1494 Ga0495659_0014552 3300046664 Bacteria 2576
1495 Ga0495659_0021391 3300046664 Bacteria 2179
1496 Ga0495659_0025300 3300046664 Bacteria 2031
1497 Ga0495588_0021926 3300046674 Bacteria 3152
1498 Ga0495657_0000476 3300046675 Bacteria 37717
1499 Ga0495657_0032938 3300046675 Bacteria 3612
1500 Ga0495657_0038867 3300046675 Bacteria 3272
1501 Ga0495599_0000553 3300046678 Bacteria 21358
1502 Ga0495599_0051496 3300046678 Bacteria 2579
1503 Ga0495599_0059863 3300046678 Bacteria 2382
1504 Ga0495623_0000017 3300046679 Bacteria 108556
1505 Ga0495623_0037922 3300046679 Bacteria 3082
1506 Ga0495623_0100595 3300046679 Bacteria 1762
1507 Ga0495646_0002016 3300046680 Bacteria 12293
1508 Ga0495647_0004317 3300046681 Bacteria 4607
1509 Ga0495658_0001433 3300046683 Bacteria 12543
1510 Ga0495658_0002526 3300046683 Bacteria 9205
1511 Ga0495658_0010843 3300046683 Bacteria 4565
1512 Ga0495658_0037637 3300046683 Bacteria 2675
1513 Ga0495658_0071433 3300046683 Bacteria 2016
1514 Ga0495613_0035991 3300046689 Bacteria 3671
1515 Ga0495613_0056944 3300046689 Bacteria 2870
1516 Ga0495613_0088810 3300046689 Bacteria 2239
1517 Ga0495613_0215666 3300046689 Bacteria 1348
1518 Ga0495624_0022926 3300046690 Bacteria 4120
1519 Ga0495624_0033590 3300046690 Bacteria 3322
1520 Ga0495671_0049169 3300046692 Bacteria 2102
1521 Ga0495600_0029410 3300046809 Bacteria 3557
1522 Ga0495600_0067651 3300046809 Bacteria 2334
1523 Ga0495581_0001080 3300047315 Bacteria 14825
1524 Ga0495581_0020101 3300047315 Bacteria 3876
1525 Ga0495581_0020518 3300047315 Bacteria 3834
1526 Ga0495581_0020800 3300047315 Bacteria 3807
1527 Ga0495581_0117388 3300047315 Bacteria 1547
1528 Ga0495604_0000017 3300047317 Bacteria 192029
1529 Ga0495604_0067538 3300047317 Bacteria 2716
1530 Ga0495636_0046182 3300047318 Bacteria 1816
1531 Ga0495674_0003478 3300047319 Bacteria 15305
1532 Ga0495674_0003779 3300047319 Bacteria 14722
1533 Ga0495674_0008269 3300047319 Bacteria 9922
1534 Ga0495674_0014556 3300047319 Bacteria 7360
1535 Ga0495672_0004623 3300047320 Bacteria 11171
1536 Ga0495676_0119184 3300047321 Bacteria 1923
1537 Ga0495676_0192381 3300047321 Bacteria 1422
1538 Ga0495680_0019971 3300047322 Bacteria 5647
1539 Ga0495680_0062098 3300047322 Bacteria 2873
1540 Ga0495680_0071580 3300047322 Bacteria 2639
1541 Ga0495675_0001010 3300047444 Bacteria 17125
1542 Ga0495675_0014092 3300047444 Bacteria 5054
1543 Ga0495675_0199730 3300047444 Bacteria 1218
1544 Ga0495684_0000095 3300047471 Bacteria 62460
1545 Ga0495684_0033602 3300047471 Bacteria 3933
1546 Ga0495593_0013848 3300047673 Bacteria 4594
1547 Ga0495593_0048358 3300047673 Bacteria 2260
1548 Ga0495602_0000485 3300048088 Bacteria 36933
1549 Ga0495602_0000595 3300048088 Bacteria 33887
1550 Ga0495602_0001119 3300048088 Bacteria 26275
1551 Ga0495602_0042877 3300048088 Bacteria 4118
1552 Ga0495614_0042180 3300048089 Bacteria 1956
1553 Ga0495614_0083384 3300048089 Bacteria 1386
1554 Ga0495615_0003581 3300048090 Bacteria 2618
1555 Ga0495615_0017317 3300048090 Bacteria 1568
1556 Ga0496100_0007174 3300048903 Bacteria 6124
1557 Ga0496101_0000949 3300048904 Bacteria 17107
1558 Ga0496101_0009865 3300048904 Bacteria 6290
1559 Ga0496101_0024585 3300048904 Bacteria 4170
1560 Ga0496101_0092511 3300048904 Bacteria 2251
1561 Ga0496101_0129775 3300048904 Bacteria 1913
1562 Ga0496102_0002642 3300048905 Bacteria 15222
1563 Ga0496102_0003666 3300048905 Bacteria 12983
1564 Ga0496102_0029697 3300048905 Bacteria 4892
1565 Ga0496102_0047364 3300048905 Bacteria 3906
1566 Ga0496102_0066985 3300048905 Bacteria 3292
1567 Ga0496102_0068879 3300048905 Bacteria 3247
1568 Ga0496102_0082955 3300048905 Bacteria 2957
1569 Ga0496102_0094489 3300048905 Bacteria 2770
1570 Ga0496102_0151946 3300048905 Bacteria 2176
1571 Ga0496102_0156365 3300048905 Bacteria 2143
1572 Ga0496102_0170502 3300048905 Bacteria 2049
1573 Ga0496102_0296741 3300048905 Bacteria 1523
1574 Ga0496103_0014722 3300048906 Bacteria 4649
1575 Ga0496103_0022205 3300048906 Bacteria 3820
1576 Ga0496103_0042027 3300048906 Bacteria 2811
1577 Ga0496104_0000877 3300048907 Bacteria 25894
1578 Ga0496104_0002308 3300048907 Bacteria 16472
1579 Ga0496104_0015456 3300048907 Bacteria 6912
1580 Ga0496104_0213706 3300048907 Bacteria 1840
1581 Ga0496104_0310826 3300048907 Bacteria 1489
1582 Ga0496105_0004564 3300048908 Bacteria 10430
1583 Ga0496105_0020712 3300048908 Bacteria 5316
1584 Ga0496105_0206979 3300048908 Bacteria 1600
1585 Ga0496105_0221711 3300048908 Bacteria 1539
1586 Ga0496106_0013980 3300048909 Bacteria 5935
1587 Ga0496106_0020151 3300048909 Bacteria 4947
1588 Ga0496106_0031117 3300048909 Bacteria 3976
1589 Ga0496107_0000964 3300048910 Bacteria 17066
1590 Ga0496107_0047674 3300048910 Bacteria 3085
1591 Ga0496107_0073282 3300048910 Bacteria 2490
1592 Ga0496107_0106102 3300048910 Bacteria 2063
1593 Ga0496107_0153008 3300048910 Bacteria 1707
1594 Ga0496108_0002874 3300048911 Bacteria 13813
1595 Ga0496108_0018180 3300048911 Bacteria 5753
1596 Ga0496108_0018765 3300048911 Bacteria 5670
1597 Ga0496108_0039332 3300048911 Bacteria 3942
1598 Ga0496108_0041216 3300048911 Bacteria 3853
1599 Ga0496108_0110108 3300048911 Bacteria 2354
1600 Ga0496108_0181253 3300048911 Bacteria 1824
1601 Ga0496108_0183314 3300048911 Bacteria 1813
1602 Ga0496109_0000518 3300048912 Bacteria 32691
1603 Ga0496109_0009418 3300048912 Bacteria 8324
1604 Ga0496109_0012751 3300048912 Bacteria 7264
1605 Ga0496109_0019059 3300048912 Bacteria 6044
1606 Ga0496109_0024078 3300048912 Bacteria 5409
1607 Ga0496109_0027123 3300048912 Bacteria 5112
1608 Ga0496109_0070950 3300048912 Bacteria 3197
1609 Ga0496109_0116400 3300048912 Bacteria 2488
1610 Ga0496109_0251306 3300048912 Bacteria 1665
1611 Ga0496109_0270655 3300048912 Bacteria 1600
1612 Ga0496109_0346469 3300048912 Bacteria 1403
1613 Ga0496110_0001009 3300048913 Bacteria 19840
1614 Ga0496110_0025610 3300048913 Bacteria 5043
1615 Ga0496110_0040751 3300048913 Bacteria 4048
1616 Ga0496110_0168266 3300048913 Bacteria 1988
1617 Ga0496111_0035018 3300048914 Bacteria 3586
1618 Ga0496111_0119557 3300048914 Bacteria 1946
1619 Ga0496111_0156344 3300048914 Bacteria 1692
1620 Ga0496111_0255744 3300048914 Bacteria 1299
1621 Ga0496112_0000047 3300048915 Bacteria 84877
1622 Ga0496112_0018432 3300048915 Bacteria 6572
1623 Ga0496112_0023223 3300048915 Bacteria 5921
1624 Ga0496112_0049360 3300048915 Bacteria 4125
1625 Ga0496112_0050094 3300048915 Bacteria 4094
1626 Ga0496112_0051573 3300048915 Bacteria 4035
1627 Ga0496112_0061091 3300048915 Bacteria 3714
1628 Ga0496112_0061243 3300048915 Bacteria 3709
1629 Ga0496112_0070213 3300048915 Bacteria 3461
1630 Ga0496112_0302638 3300048915 Bacteria 1544
1631 Ga0496113_0016753 3300048916 Bacteria 5069
1632 Ga0496113_0018957 3300048916 Bacteria 4803
1633 Ga0496113_0065338 3300048916 Bacteria 2753
1634 Ga0496113_0075614 3300048916 Bacteria 2571
1635 Ga0496113_0152959 3300048916 Bacteria 1821
1636 Ga0496113_0160607 3300048916 Bacteria 1776
1637 Ga0496113_0163242 3300048916 Bacteria 1762
1638 Ga0496114_0063260 3300048917 Bacteria 3098
1639 Ga0496114_0119326 3300048917 Bacteria 2267
1640 Ga0496115_0001671 3300048918 Bacteria 15949
1641 Ga0496115_0007121 3300048918 Bacteria 8213
1642 Ga0496115_0037529 3300048918 Bacteria 3840
1643 Ga0496115_0042136 3300048918 Bacteria 3636
1644 Ga0496115_0056597 3300048918 Bacteria 3152
1645 Ga0496115_0148298 3300048918 Bacteria 1936
1646 Ga0496121_0002196 3300048924 Bacteria 30506
1647 Ga0496121_0003067 3300048924 Bacteria 24202
1648 Ga0496126_0040052 3300048929 Bacteria 4345
1649 Ga0501308_001422 3300049128 Bacteria 1906
1650 Ga0501291_009303 3300049514 Bacteria 1375
1651 Ga0501292_000099 3300049515 Bacteria 15440
1652 Ga0501293_000646 3300049516 Bacteria 2614
1653 Ga0501294_000377 3300049517 Bacteria 5422
1654 Ga0501297_006292 3300049520 Bacteria 1264
1655 Ga0501300_001419 3300049523 Bacteria 3586
1656 Ga0501302_000215 3300049525 Bacteria 3024
1657 Ga0501303_000203 3300049526 Bacteria 4981
1658 Ga0501031_0038091 3300049568 Bacteria 3138
1659 Ga0501031_0138467 3300049568 Bacteria 1590
1660 Ga0501032_0001580 3300049569 Bacteria 18155
1661 Ga0501032_0020821 3300049569 Bacteria 4565
1662 Ga0501032_0037464 3300049569 Bacteria 3307
1663 Ga0501032_0056579 3300049569 Bacteria 2636
1664 Ga0501033_0000013 3300049570 Bacteria 232799
1665 Ga0501034_0000208 3300049571 Bacteria 111739
1666 Ga0501034_0002673 3300049571 Bacteria 21040
1667 Ga0501034_0024772 3300049571 Bacteria 6104
1668 Ga0501034_0032099 3300049571 Bacteria 5335
1669 Ga0501034_0035297 3300049571 Bacteria 5070
1670 Ga0501034_0057403 3300049571 Bacteria 3914
1671 Ga0501034_0095353 3300049571 Bacteria 2972
1672 Ga0501034_0351804 3300049571 Bacteria 1401
1673 Ga0501034_0395891 3300049571 Bacteria 1304
1674 Ga0501036_0005563 3300049572 Bacteria 10220
1675 Ga0501036_0060890 3300049572 Bacteria 3197
1676 Ga0501036_0078279 3300049572 Bacteria 2796
1677 Ga0501036_0105762 3300049572 Bacteria 2380
1678 Ga0501036_0144838 3300049572 Bacteria 2004
1679 Ga0501036_0159884 3300049572 Bacteria 1899
1680 Ga0501036_0168217 3300049572 Bacteria 1847
1681 Ga0501037_0077015 3300049573 Bacteria 2420
1682 Ga0501037_0272967 3300049573 Bacteria 1180
1683 Ga0501038_0000212 3300049574 Bacteria 49792
1684 Ga0501038_0038476 3300049574 Bacteria 4188
1685 Ga0501038_0041934 3300049574 Bacteria 3989
1686 Ga0501038_0062611 3300049574 Bacteria 3179
1687 Ga0501038_0108450 3300049574 Bacteria 2302
1688 Ga0501038_0303172 3300049574 Bacteria 1253
1689 Ga0501039_0000072 3300049575 Bacteria 76673
1690 Ga0501039_0001156 3300049575 Bacteria 19441
1691 Ga0501039_0001269 3300049575 Bacteria 18465
1692 Ga0501039_0131020 3300049575 Bacteria 1968
1693 Ga0501039_0164694 3300049575 Bacteria 1743
1694 Ga0501039_0171729 3300049575 Bacteria 1704
1695 Ga0501039_0212676 3300049575 Bacteria 1520
1696 Ga0501039_0222609 3300049575 Bacteria 1483
1697 Ga0501039_0288359 3300049575 Bacteria 1290
1698 Ga0501040_0006079 3300049576 Bacteria 7826
1699 Ga0501040_0018714 3300049576 Bacteria 4600
1700 Ga0501040_0048495 3300049576 Bacteria 2902
1701 Ga0501040_0100972 3300049576 Bacteria 2012
1702 Ga0501040_0139595 3300049576 Bacteria 1706
1703 Ga0501041_0047400 3300049577 Bacteria 2616
1704 Ga0501041_0134161 3300049577 Bacteria 1542
1705 Ga0501042_0003193 3300049578 Bacteria 10236
1706 Ga0501042_0013582 3300049578 Bacteria 5544
1707 Ga0501042_0022117 3300049578 Bacteria 4440
1708 Ga0501042_0102590 3300049578 Bacteria 2058
1709 Ga0501042_0111497 3300049578 Bacteria 1970
1710 Ga0501042_0250921 3300049578 Bacteria 1277
1711 Ga0501043_0047927 3300049579 Bacteria 3359
1712 Ga0501046_0001060 3300049580 Bacteria 26935
1713 Ga0501046_0006019 3300049580 Bacteria 10788
1714 Ga0501046_0014835 3300049580 Bacteria 6560
1715 Ga0501046_0019160 3300049580 Bacteria 5676
1716 Ga0501046_0022425 3300049580 Bacteria 5202
1717 Ga0501046_0078669 3300049580 Bacteria 2551
1718 Ga0501046_0094723 3300049580 Bacteria 2294
1719 Ga0501047_0000235 3300049581 Bacteria 65603
1720 Ga0501047_0001212 3300049581 Bacteria 25586
1721 Ga0501047_0005869 3300049581 Bacteria 11555
1722 Ga0501047_0059552 3300049581 Bacteria 3686
1723 Ga0501047_0068651 3300049581 Bacteria 3414
1724 Ga0501048_0000501 3300049582 Bacteria 27413
1725 Ga0501048_0006738 3300049582 Bacteria 8727
1726 Ga0501048_0016001 3300049582 Bacteria 5532
1727 Ga0501048_0020369 3300049582 Bacteria 4860
1728 Ga0501048_0130259 3300049582 Bacteria 1778
1729 Ga0501048_0155930 3300049582 Bacteria 1615
1730 Ga0501048_0205546 3300049582 Bacteria 1396
1731 Ga0501067_0001590 3300049583 Bacteria 12434
1732 Ga0501067_0012802 3300049583 Bacteria 4646
1733 Ga0501067_0018310 3300049583 Bacteria 3880
1734 Ga0501067_0037014 3300049583 Bacteria 2710
1735 Ga0501067_0054271 3300049583 Bacteria 2220
1736 Ga0501067_0054439 3300049583 Bacteria 2217
1737 Ga0501067_0086970 3300049583 Bacteria 1734
1738 Ga0501068_0003501 3300049584 Bacteria 8471
1739 Ga0501068_0029846 3300049584 Bacteria 3232
1740 Ga0501068_0106078 3300049584 Bacteria 1744
1741 Ga0501069_0026314 3300049585 Bacteria 3185
1742 Ga0501069_0138060 3300049585 Bacteria 1398
1743 Ga0501069_0141669 3300049585 Bacteria 1379
1744 Ga0501069_0155621 3300049585 Bacteria 1315
1745 Ga0501070_0004020 3300049586 Bacteria 12633
1746 Ga0501070_0016965 3300049586 Bacteria 6110
1747 Ga0501070_0060711 3300049586 Bacteria 3133
1748 Ga0501071_0042773 3300049587 Bacteria 3247
1749 Ga0501071_0086964 3300049587 Bacteria 2293
1750 Ga0501071_0193098 3300049587 Bacteria 1528
1751 Ga0501071_0199519 3300049587 Bacteria 1502
1752 Ga0501071_0289925 3300049587 Bacteria 1239
1753 Ga0501072_0005670 3300049588 Bacteria 9507
1754 Ga0501072_0040546 3300049588 Bacteria 3656
1755 Ga0501072_0160162 3300049588 Bacteria 1795
1756 Ga0501072_0161704 3300049588 Bacteria 1786
1757 Ga0501072_0193359 3300049588 Bacteria 1622
1758 Ga0501072_0285120 3300049588 Bacteria 1313
1759 Ga0501073_0028073 3300049589 Bacteria 4020
1760 Ga0501073_0105941 3300049589 Bacteria 1951
1761 Ga0501073_0146428 3300049589 Bacteria 1637
1762 Ga0501074_0010949 3300049590 Bacteria 6583
1763 Ga0501074_0144720 3300049590 Bacteria 1700
1764 Ga0501075_0013901 3300049591 Bacteria 5758
1765 Ga0501075_0065131 3300049591 Bacteria 2749
1766 Ga0501075_0083379 3300049591 Bacteria 2421
1767 Ga0501075_0089183 3300049591 Bacteria 2338
1768 Ga0501075_0137758 3300049591 Bacteria 1860
1769 Ga0501075_0155558 3300049591 Bacteria 1743
1770 Ga0501075_0188194 3300049591 Bacteria 1574
1771 Ga0501076_0023202 3300049592 Bacteria 4780
1772 Ga0501076_0039204 3300049592 Bacteria 3720
1773 Ga0501076_0073626 3300049592 Bacteria 2735
1774 Ga0501076_0079492 3300049592 Bacteria 2631
1775 Ga0501076_0115786 3300049592 Bacteria 2169
1776 Ga0501076_0120432 3300049592 Bacteria 2125
1777 Ga0501076_0121280 3300049592 Bacteria 2117
1778 Ga0501076_0129409 3300049592 Bacteria 2047
1779 Ga0501076_0141391 3300049592 Bacteria 1955
1780 Ga0501076_0251755 3300049592 Bacteria 1445
1781 Ga0501076_0251920 3300049592 Bacteria 1445
1782 Ga0501077_0031283 3300049593 Bacteria 3386
1783 Ga0501077_0057632 3300049593 Bacteria 2466
1784 Ga0501077_0082358 3300049593 Bacteria 2039
1785 Ga0501077_0112695 3300049593 Bacteria 1724
1786 Ga0501077_0118636 3300049593 Bacteria 1676
1787 Ga0501077_0127280 3300049593 Bacteria 1615
1788 Ga0501077_0190947 3300049593 Bacteria 1301
1789 Ga0501077_0199970 3300049593 Bacteria 1269
1790 Ga0501198_000368 3300049649 Bacteria 5651
1791 Ga0501199_001333 3300049650 Bacteria 2222
1792 Ga0501206_000344 3300049653 Bacteria 5506
1793 Ga0501207_001334 3300049654 Bacteria 3067
1794 Ga0501208_000919 3300049655 Bacteria 2563
1795 Ga0501211_001971 3300049658 Bacteria 2191
1796 Ga0501217_027815 3300049661 Bacteria 1374
1797 Ga0501223_010696 3300049663 Bacteria 1843
1798 Ga0501227_002932 3300049665 Bacteria 3731
1799 Ga0501228_000191 3300049666 Bacteria 3553
1800 Ga0501230_000123 3300049667 Bacteria 5948
1801 Ga0501238_002198 3300049671 Bacteria 2310
1802 Ga0501239_000520 3300049672 Bacteria 3020
1803 Ga0501240_007700 3300049673 Bacteria 1362
1804 Ga0501246_001971 3300049676 Bacteria 1605
1805 Ga0501248_000546 3300049678 Bacteria 2091
1806 Ga0501249_022446 3300049679 Bacteria 1382
1807 Ga0501251_000031 3300049681 Bacteria 10430
1808 Ga0501252_005815 3300049682 Bacteria 1353
1809 Ga0501253_000193 3300049683 Bacteria 4570
1810 Ga0501255_004416 3300049684 Bacteria 1359
1811 Ga0501256_000081 3300049685 Bacteria 5018
1812 Ga0501257_013729 3300049686 Bacteria 1858
1813 Ga0501258_000070 3300049687 Bacteria 5267
1814 Ga0501261_000363 3300049690 Bacteria 6080
1815 Ga0501221_000136 3300049704 Bacteria 9511
1816 Ga0501225_0000149 3300049705 Bacteria 21494
1817 Ga0501225_0028573 3300049705 Bacteria 1533
1818 Ga0501229_000082 3300049706 Bacteria 9579
1819 Ga0501245_010629 3300049708 Bacteria 1331
1820 Ga0501079_0074707 3300049741 Bacteria 2620
1821 Ga0501079_0097101 3300049741 Bacteria 2284
1822 Ga0501079_0122450 3300049741 Bacteria 2023
1823 Ga0501079_0148612 3300049741 Bacteria 1827
1824 Ga0501079_0155907 3300049741 Bacteria 1780
1825 Ga0501079_0172008 3300049741 Bacteria 1689
1826 Ga0501079_0195009 3300049741 Bacteria 1581
1827 Ga0501079_0198243 3300049741 Bacteria 1567
1828 Ga0501079_0243130 3300049741 Bacteria 1406
1829 Ga0501079_0255552 3300049741 Bacteria 1369
1830 Ga0501080_0000005 3300049742 Bacteria 176271
1831 Ga0501080_0013007 3300049742 Bacteria 7641
1832 Ga0501080_0045341 3300049742 Bacteria 4093
1833 Ga0501080_0051985 3300049742 Bacteria 3813
1834 Ga0501080_0060529 3300049742 Bacteria 3525
1835 Ga0501080_0081520 3300049742 Bacteria 3006
1836 Ga0501080_0133051 3300049742 Bacteria 2302
1837 Ga0501080_0133128 3300049742 Bacteria 2301
1838 Ga0501080_0138462 3300049742 Bacteria 2251
1839 Ga0501081_0000419 3300049743 Bacteria 23462
1840 Ga0501081_0024655 3300049743 Bacteria 4041
1841 Ga0501081_0032063 3300049743 Bacteria 3563
1842 Ga0501081_0089729 3300049743 Bacteria 2160
1843 Ga0501081_0103607 3300049743 Bacteria 2013
1844 Ga0501081_0270779 3300049743 Bacteria 1242
1845 Ga0501241_003890 3300049758 Bacteria 2813
1846 Ga0501262_002660 3300049759 Bacteria 2019
1847 Ga0501263_003193 3300049760 Bacteria 1732
1848 Ga0501265_000713 3300049762 Bacteria 3634
1849 Ga0501268_002568 3300049765 Bacteria 2400
1850 Ga0501269_004855 3300049766 Bacteria 1617
1851 Ga0501271_000769 3300049768 Bacteria 2716
1852 Ga0501273_003810 3300049770 Bacteria 1626
1853 Ga0501275_000495 3300049772 Bacteria 4427
1854 Ga0501276_001067 3300049773 Bacteria 1797
1855 Ga0501278_000188 3300049774 Bacteria 4814
1856 Ga0501280_000659 3300049776 Bacteria 7698
1857 Ga0501281_00945 3300049777 Bacteria 2440
1858 Ga0501283_006667 3300049779 Bacteria 1624
1859 Ga0501283_008288 3300049779 Bacteria 1495
1860 Ga0501035_0000049 3300049822 Bacteria 145684
1861 Ga0501035_0012246 3300049822 Bacteria 7929
1862 Ga0501035_0019292 3300049822 Bacteria 6275
1863 Ga0501035_0071258 3300049822 Bacteria 3078
1864 Ga0501035_0085598 3300049822 Bacteria 2778
1865 Ga0501035_0109032 3300049822 Bacteria 2427
1866 Ga0501044_0000030 3300049823 Bacteria 173442
1867 Ga0501044_0000222 3300049823 Bacteria 71930
1868 Ga0501044_0038683 3300049823 Bacteria 4980
1869 Ga0501044_0073422 3300049823 Bacteria 3477
1870 Ga0501045_0064837 3300049824 Bacteria 2682
1871 Ga0501045_0070030 3300049824 Bacteria 2580
1872 Ga0501045_0071503 3300049824 Bacteria 2553
1873 Ga0501045_0079394 3300049824 Bacteria 2419
1874 Ga0501045_0079903 3300049824 Bacteria 2411
1875 Ga0501045_0104129 3300049824 Bacteria 2102
1876 Ga0501045_0113403 3300049824 Bacteria 2010
1877 Ga0501045_0148251 3300049824 Bacteria 1745
1878 Ga0501045_0167482 3300049824 Bacteria 1636
1879 Ga0501212_000067 3300049851 Bacteria 7460
1880 Ga0501226_000129 3300049853 Bacteria 14953
1881 nmdc:mga03683_18960_c1 3300050489 Bacteria 1949
1882 nmdc:mga03683_429_c1 3300050489 Bacteria 12155
1883 nmdc:mga03683_52353_c1 3300050489 Bacteria 1706
1884 nmdc:mga00v17_201903_c1 3300050491 Bacteria 1285
1885 nmdc:mga0yw44_93780_c1 3300050492 Bacteria 1902
1886 nmdc:mga0k408_18213_c1 3300050493 Bacteria 3919
1887 nmdc:mga0k408_27225_c1 3300050493 Bacteria 3246
1888 nmdc:mga0k408_4095_c1 3300050493 Bacteria 7742
1889 nmdc:mga0k408_50045_c1 3300050493 Bacteria 2419
1890 nmdc:mga07m45_11904_c1 3300050496 Bacteria 4583
1891 nmdc:mga05p37_119087_c1 3300050507 Bacteria 3244
1892 nmdc:mga05p37_12453_c1 3300050507 Bacteria 10158
1893 nmdc:mga05p37_125066_c1 3300050507 Bacteria 3158
1894 nmdc:mga05p37_129158_c1 3300050507 Bacteria 3102
1895 nmdc:mga05p37_15056_c1 3300050507 Bacteria 9285
1896 nmdc:mga05p37_1773_c1 3300050507 Bacteria 25196
1897 nmdc:mga05p37_180664_c1 3300050507 Bacteria 2567
1898 nmdc:mga05p37_19612_c1 3300050507 Bacteria 8178
1899 nmdc:mga05p37_210322_c1 3300050507 Bacteria 2352
1900 nmdc:mga05p37_213294_c1 3300050507 Bacteria 2333
1901 nmdc:mga05p37_235738_c1 3300050507 Bacteria 2203
1902 nmdc:mga05p37_2437_c1 3300050507 Bacteria 21635
1903 nmdc:mga05p37_2645_c1 3300050507 Bacteria 20857
1904 nmdc:mga05p37_2754_c1 3300050507 Bacteria 20427
1905 nmdc:mga05p37_36180_c1 3300050507 Bacteria 6059
1906 nmdc:mga05p37_38754_c1 3300050507 Bacteria 5848
1907 nmdc:mga05p37_422974_c1 3300050507 Bacteria 1550
1908 nmdc:mga05p37_4273_c1 3300050507 Bacteria 16689
1909 nmdc:mga05p37_459650_c1 3300050507 Bacteria 1471
1910 nmdc:mga05p37_49398_c1 3300050507 Bacteria 5174
1911 nmdc:mga05p37_544344_c1 3300050507 Bacteria 1323
1912 nmdc:mga05p37_548375_c1 3300050507 Bacteria 1317
1913 nmdc:mga05p37_568608_c1 3300050507 Bacteria 1286
1914 nmdc:mga05p37_60272_c1 3300050507 Bacteria 4673
1915 nmdc:mga05p37_64836_c1 3300050507 Bacteria 4495
1916 nmdc:mga05p37_66256_c1 3300050507 Bacteria 4442
1917 nmdc:mga05p37_94703_c1 3300050507 Bacteria 3679
1918 nmdc:mga05p37_96138_c1 3300050507 Bacteria 3649
1919 nmdc:mga09592_129009_c1 3300050508 Bacteria 2175
1920 nmdc:mga09592_1370_c1 3300050508 Bacteria 19524
1921 nmdc:mga09592_170261_c1 3300050508 Bacteria 1883
1922 nmdc:mga09592_177703_c1 3300050508 Bacteria 1841
1923 nmdc:mga09592_192404_c1 3300050508 Bacteria 1766
1924 nmdc:mga09592_2394_c1 3300050508 Bacteria 15146
1925 nmdc:mga09592_252820_c1 3300050508 Bacteria 1528
1926 nmdc:mga09592_40151_c1 3300050508 Bacteria 3931
1927 nmdc:mga09592_46677_c1 3300050508 Bacteria 3649
1928 nmdc:mga09592_65529_c1 3300050508 Bacteria 3078
1929 nmdc:mga09592_7464_c1 3300050508 Bacteria 8886
1930 nmdc:mga0qj67_108914_c1 3300050509 Bacteria 2235
1931 nmdc:mga0qj67_111484_c1 3300050509 Bacteria 2209
1932 nmdc:mga0qj67_15872_c1 3300050509 Bacteria 5703
1933 nmdc:mga0qj67_18360_c1 3300050509 Bacteria 5330
1934 nmdc:mga0qj67_220862_c1 3300050509 Bacteria 1538
1935 nmdc:mga0qj67_22931_c1 3300050509 Bacteria 4797
1936 nmdc:mga0qj67_23583_c1 3300050509 Bacteria 4735
1937 nmdc:mga0qj67_24513_c1 3300050509 Bacteria 4651
1938 nmdc:mga0qj67_2465_c1 3300050509 Bacteria 13183
1939 nmdc:mga0qj67_25617_c1 3300050509 Bacteria 4558
1940 nmdc:mga0qj67_32040_c1 3300050509 Bacteria 4098
1941 nmdc:mga0qj67_42067_c1 3300050509 Bacteria 2048
1942 nmdc:mga0qj67_53256_c1 3300050509 Bacteria 3204
1943 nmdc:mga0qj67_630_c1 3300050509 Bacteria 24211
1944 nmdc:mga0qj67_65307_c1 3300050509 Bacteria 2897
1945 nmdc:mga06r32_102584_c1 3300050510 Bacteria 2808
1946 nmdc:mga06r32_11036_c1 3300050510 Bacteria 8132
1947 nmdc:mga06r32_1300_c1 3300050510 Bacteria 22515
1948 nmdc:mga06r32_145834_c1 3300050510 Bacteria 2344
1949 nmdc:mga06r32_194953_c1 3300050510 Bacteria 2013
1950 nmdc:mga06r32_208220_c1 3300050510 Bacteria 1944
1951 nmdc:mga06r32_212712_c1 3300050510 Bacteria 1921
1952 nmdc:mga06r32_26386_c1 3300050510 Bacteria 5415
1953 nmdc:mga06r32_29260_c1 3300050510 Bacteria 5161
1954 nmdc:mga06r32_36320_c1 3300050510 Bacteria 4655
1955 nmdc:mga06r32_37302_c1 3300050510 Bacteria 4598
1956 nmdc:mga06r32_638_c1 3300050510 Bacteria 30472
1957 nmdc:mga06r32_66201_c1 3300050510 Bacteria 3486
1958 nmdc:mga06r32_8250_c1 3300050510 Bacteria 9379
1959 nmdc:mga06r32_85977_c1 3300050510 Bacteria 3067
1960 nmdc:mga06r32_89288_c1 3300050510 Bacteria 3009
1961 nmdc:mga06r32_89403_c1 3300050510 Bacteria 3007
1962 nmdc:mga06r32_95660_c1 3300050510 Bacteria 2907
1963 nmdc:mga08y16_1022_c1 3300050511 Bacteria 27431
1964 nmdc:mga08y16_1323_c1 3300050511 Bacteria 24650
1965 nmdc:mga08y16_15702_c1 3300050511 Bacteria 7965
1966 nmdc:mga08y16_16100_c1 3300050511 Bacteria 7864
1967 nmdc:mga08y16_292599_c1 3300050511 Bacteria 1679
1968 nmdc:mga08y16_296_c1 3300050511 Bacteria 44778
1969 nmdc:mga08y16_304248_c1 3300050511 Bacteria 1643
1970 nmdc:mga08y16_42140_c1 3300050511 Bacteria 4781
1971 nmdc:mga08y16_549_c1 3300050511 Bacteria 34756
1972 nmdc:mga08y16_75541_c1 3300050511 Bacteria 3513
1973 nmdc:mga08y16_76045_c1 3300050511 Bacteria 3500
1974 nmdc:mga0n895_10725_c1 3300050512 Bacteria 8121
1975 nmdc:mga0n895_14066_c1 3300050512 Bacteria 7253
1976 nmdc:mga0n895_14488_c1 3300050512 Bacteria 7163
1977 nmdc:mga0n895_155153_c1 3300050512 Bacteria 2320
1978 nmdc:mga0n895_24922_c1 3300050512 Bacteria 5644
1979 nmdc:mga0n895_257540_c1 3300050512 Bacteria 1771
1980 nmdc:mga0n895_283_c1 3300050512 Bacteria 33340
1981 nmdc:mga0n895_313932_c1 3300050512 Bacteria 1588
1982 nmdc:mga0n895_402289_c1 3300050512 Bacteria 1385
1983 nmdc:mga0n895_508839_c1 3300050512 Bacteria 1213
1984 nmdc:mga0n895_662409_c1 3300050512 Bacteria 1042
1985 nmdc:mga0n895_8378_c1 3300050512 Bacteria 8949
1986 nmdc:mga0n895_87742_c1 3300050512 Bacteria 3109
1987 nmdc:mga0rr50_101579_c1 3300050513 Bacteria 2261
1988 nmdc:mga0rr50_187395_c1 3300050513 Bacteria 1694
1989 nmdc:mga0rr50_23493_c1 3300050513 Bacteria 4252
1990 nmdc:mga0rr50_263993_c1 3300050513 Bacteria 1433
1991 nmdc:mga0rr50_31921_c1 3300050513 Bacteria 3746
1992 nmdc:mga0rr50_40686_c1 3300050513 Bacteria 3381
1993 nmdc:mga0rr50_48387_c1 3300050513 Bacteria 3143
1994 nmdc:mga0rr50_58209_c1 3300050513 Bacteria 2895
1995 nmdc:mga0rr50_66150_c1 3300050513 Bacteria 2741
1996 nmdc:mga0rr50_70345_c1 3300050513 Bacteria 2666
1997 nmdc:mga0rr50_96239_c1 3300050513 Bacteria 2316
1998 nmdc:mga08x19_115351_c1 3300050514 Bacteria 1795
1999 nmdc:mga08x19_130065_c1 3300050514 Bacteria 1693
2000 nmdc:mga08x19_19796_c1 3300050514 Bacteria 4136
2001 nmdc:mga08x19_239060_c1 3300050514 Bacteria 1251
2002 nmdc:mga08x19_68418_c1 3300050514 Bacteria 2311
2003 nmdc:mga08x19_96494_c1 3300050514 Bacteria 1957
2004 nmdc:mga0a205_135421_c1 3300050515 Bacteria 2364
2005 nmdc:mga0a205_14811_c1 3300050515 Bacteria 7277
2006 nmdc:mga0a205_163229_c1 3300050515 Bacteria 2124
2007 nmdc:mga0a205_194670_c1 3300050515 Bacteria 1918
2008 nmdc:mga0a205_195858_c1 3300050515 Bacteria 1912
2009 nmdc:mga0a205_208182_c1 3300050515 Bacteria 1845
2010 nmdc:mga0a205_23945_c1 3300050515 Bacteria 5796
2011 nmdc:mga0a205_2463_c1 3300050515 Bacteria 16328
2012 nmdc:mga0a205_2479_c1 3300050515 Bacteria 16274
2013 nmdc:mga0a205_312773_c1 3300050515 Bacteria 1442
2014 nmdc:mga0a205_387_c1 3300050515 Bacteria 33459
2015 nmdc:mga0a205_5469_c1 3300050515 Bacteria 11438
2016 nmdc:mga0a205_68067_c1 3300050515 Bacteria 3439
2017 nmdc:mga0a205_8273_c1 3300050515 Bacteria 9459
2018 nmdc:mga0a205_96842_c1 3300050515 Bacteria 2850
2019 Ga0495601_0001193 3300053077 Bacteria 14223
2020 Ga0495601_0002682 3300053077 Bacteria 10083
2021 Ga0495601_0005148 3300053077 Bacteria 7599
2022 Ga0495601_0026408 3300053077 Bacteria 3585
2023 Ga0495601_0051000 3300053077 Bacteria 2611
2024 Ga0495601_0144334 3300053077 Bacteria 1553
2025 Ga0495612_0000272 3300053078 Bacteria 21285
2026 Ga0495612_0001186 3300053078 Bacteria 10745
2027 Ga0495612_0002689 3300053078 Bacteria 7345
2028 Ga0495612_0033867 3300053078 Bacteria 2067
2029 Ga0495595_0001637 3300053084 Bacteria 8760
2030 Ga0495595_0011179 3300053084 Bacteria 3749
2031 Ga0495595_0018090 3300053084 Bacteria 3040
2032 Ga0495619_0002351 3300053085 Bacteria 12447
2033 Ga0495619_0027494 3300053085 Bacteria 3664
2034 Ga0495619_0041602 3300053085 Bacteria 3006
2035 Ga0495619_0046149 3300053085 Bacteria 2864
2036 Ga0495619_0059772 3300053085 Bacteria 2532
2037 Ga0495619_0121031 3300053085 Bacteria 1794
2038 Ga0495619_0163807 3300053085 Bacteria 1536
2039 Ga0495619_0184991 3300053085 Bacteria 1441
2040 Ga0500566_0042381 3300053094 Bacteria 2626
2041 Ga0500641_0069441 3300053096 Bacteria 1481
2042 Ga0500555_000080 3300053103 Bacteria 46241
2043 Ga0500556_0000010 3300053104 Bacteria 258288
2044 Ga0500642_0027843 3300053130 Bacteria 2324
2045 Ga0500616_0008552 3300053153 Bacteria 6340
2046 Ga0500639_000165 3300053163 Bacteria 32213
2047 Ga0500637_0002795 3300053178 Bacteria 7839
2048 Ga0501084_0004756 3300054114 Bacteria 11097
2049 Ga0501084_0058084 3300054114 Bacteria 3237
2050 Ga0501084_0090898 3300054114 Bacteria 2563
2051 Ga0501084_0092931 3300054114 Bacteria 2532
2052 Ga0501084_0122785 3300054114 Bacteria 2184
2053 Ga0501084_0158687 3300054114 Bacteria 1908
2054 Ga0501084_0161711 3300054114 Bacteria 1889
2055 Ga0501084_0163516 3300054114 Bacteria 1878
2056 Ga0501084_0182026 3300054114 Bacteria 1774
2057 Ga0501084_0202926 3300054114 Bacteria 1673
2058 Ga0501084_0360478 3300054114 Bacteria 1228
2059 Ga0590071_017277 3300059421 Bacteria 1694
2060 Ga0590075_004418 3300059424 Bacteria 3328
2061 Ga0587084_002785 3300059477 Bacteria 1856
2062 Ga0587066_006000 3300059490 Bacteria 1581
2063 Ga0587066_010524 3300059490 Bacteria 1336
2064 Ga0587070_006486 3300059491 Bacteria 1581
2065 Ga0587073_0008387 3300059492 Bacteria 1671
2066 Ga0587073_0011099 3300059492 Bacteria 1530
2067 Ga0587077_002191 3300059493 Bacteria 2269
2068 Ga0587080_002077 3300059503 Bacteria 2303
2069 Ga0587082_002150 3300059504 Bacteria 2178
2070 Ga0587082_005840 3300059504 Bacteria 1617
2071 Ga0587083_0009205 3300059505 Bacteria 1569
2072 Ga0587088_005803 3300059508 Bacteria 1640
2073 Ga0587090_001583 3300059510 Bacteria 2340
2074 Ga0587090_005804 3300059510 Bacteria 1563
2075 Ga0587091_001928 3300059511 Bacteria 2358
2076 Ga0587101_005388 3300059623 Bacteria 1418
2077 Ga0587067_007675 3300059640 Bacteria 1551
2078 Ga0587068_002101 3300059641 Bacteria 2377
2079 Ga0587068_007185 3300059641 Bacteria 1581
2080 Ga0587069_001180 3300059642 Bacteria 2315
2081 Ga0587072_007679 3300059643 Bacteria 1686
2082 Ga0587075_004270 3300059644 Bacteria 1649
2083 Ga0587076_006638 3300059645 Bacteria 1551
2084 Ga0587078_003195 3300059646 Bacteria 1644
2085 Ga0587079_007334 3300059647 Bacteria 1646
2086 Ga0587071_008168 3300060344 Bacteria 1690
2087 Ga0501082_0042649 3300060353 Bacteria 3911
2088 Ga0501082_0050059 3300060353 Bacteria 3603
2089 Ga0501082_0057195 3300060353 Bacteria 3360
2090 Ga0501082_0089615 3300060353 Bacteria 2656
2091 Ga0501082_0109383 3300060353 Bacteria 2392
2092 Ga0501082_0196250 3300060353 Bacteria 1756
2093 Ga0501082_0205918 3300060353 Bacteria 1711
2094 Ga0501082_0307130 3300060353 Bacteria 1381
2095 Ga0530510_0015805 3300061734 Bacteria 5336
2096 Ga0530510_0019238 3300061734 Bacteria 4846
2097 Ga0530510_0045499 3300061734 Bacteria 3171
2098 Ga0530510_0111613 3300061734 Bacteria 2003
2099 Ga0530510_0193098 3300061734 Bacteria 1511
2100 2513658386 2513237096 Bacteria 8722461
2101 2513695943 2513237101 Bacteria 7952346
2102 2513857538 2513237137 Bacteria 9558895
2103 2513920122 2513237145 Bacteria 8979722
2104 2517893491 2517572143 Bacteria 9484767
2105 2524537996 2524023228 Bacteria 10118060
2106 2524539164 2524023228 Bacteria 10118060
2107 2601445477 2600255229 Bacteria 1988965
2108 2671118129 2667528175 Bacteria 7532676
2109 2671122206 2667528175 Bacteria 7532676
2110 2723846175 2721755755 Bacteria 8322773
2111 2728747746 2728368998 Bacteria 8720350
2112 2728752494 2728368998 Bacteria 8720350
2113 2793071752 2791355197 Bacteria 8420563
2114 2793076655
2115 2848298226 2848297114 Bacteria 3608511
2116 2874610915 2874604998 Bacteria 7834745
2117 2876810428 2876808645 Bacteria 8824342
2118 2879110528 2879110137 Bacteria 8907982
2119 2883294839 2883291878 Bacteria 5894118
2120 2883294852 2883291878 Bacteria 5894118
2121 2889041124 2889033259 Bacteria 9099371
2122 2903758269 2903748898 Bacteria 9972761
2123 2904696889 2904690495 Bacteria 9412302
2124 2904701652
2125 2906642791 2906635258 Bacteria 8601019
2126 2906665926 2906660503 Bacteria 8595048
2127 2908761465 2908756301 Bacteria 8864324
2128 2922361971 2922361189 Bacteria 7436256
2129 2922392023 2922386360 Bacteria 7017218
2130 2922428985
2131 2935637752 2935630451 Bacteria 8169952
2132 2941514425 2941507105 Bacteria 8166816
2133 2941522321 2941515067 Bacteria 8166720
2134 2941530160 2941523033 Bacteria 8169134
2135 3005479130 3005474847 Bacteria 9259049
2136 8002061395 8002060224 Bacteria 4026565
2137 8002061906 8002060224 Bacteria 4026565
2138 8006934630 8006933436 Bacteria 10410654
2139 8006942218 8006933436 Bacteria 10410654
2140 8006964529 8006964411 Bacteria 8966052
2141 8006974600 8006973647 Bacteria 10679141
2142 8006981952 8006973647 Bacteria 10679141
2143 8006986852 8006984368 Bacteria 9651211
2144 8006996071 8006994254 Bacteria 8309700
2145 8019564041 8019555841 Bacteria 9642137
2146 8019567346 8019565922 Bacteria 9639779
2147 8019574117 8019565922 Bacteria 9639779
2148 8056680461 8056673599 Bacteria 7871253
2149 8056691226 8056689827 Bacteria 6712655
2150 Ga0157372_10197313
2151 SwRhRL2b_contig_1298163
2152 JGI24746J21847_1008028
2153 JGI24737J22298_10024194
2154 JGI24750J21931_1000315
2155 JGI24034J26672_10002296
2156 JGI24742J22300_10007414
2157 JGI24742J22300_10010336
2158 JGI24751J29686_10023018
2159 JGI25406J46586_10022422
2160 JGI26128J50194_1001392
2161 JGI26129J50193_1000031
2162 JGI26145J50221_1000624
2163 JGI26134J50242_100275
2164 JGI26133J50247_100062
2165 JGI26132J50249_100231
2166 JGI26143J51219_1000496
2167 JGI26141J51220_1001165
2168 JGI25405J52794_10001096
2169 JGI25405J52794_10018929
2170 Ga0058863_10074882
2171 Ga0058863_10078133
2172 Ga0058863_11936457
2173 Ga0058861_10030509
2174 Ga0058861_10159963
2175 Ga0058861_12046052
2176 Ga0058862_12356670
2177 Ga0058862_12636649
2178 Ga0058862_12778063
2179 Ga0065704_10085384
2180 Ga0065704_10117584
2181 Ga0065715_10121960
2182 Ga0065707_10002120
2183 Ga0065707_10013752
2184 Ga0065707_10084753
2185 Ga0065707_10087315
2186 Ga0065707_10136871
2187 Ga0070658_10003484
2188 Ga0070658_10005421
2189 Ga0070658_10090607
2190 Ga0070676_10000852
2191 Ga0070676_10000896
2192 Ga0070676_10029802
2193 Ga0070676_10116078
2194 Ga0070676_10136272
2195 Ga0070683_100014149
2196 Ga0070683_100019046
2197 Ga0070683_100111556
2198 Ga0070683_100196719
2199 Ga0070690_100013884
2200 Ga0070690_100078403
2201 Ga0070690_100150078
2202 Ga0070670_100003642
2203 Ga0070670_100016207
2204 Ga0070670_100046278
2205 Ga0070670_100046292
2206 Ga0070670_100062871
2207 Ga0070670_100202418
2208 Ga0070677_10003182
2209 Ga0070677_10031276
2210 Ga0068869_100006678
2211 Ga0068869_100017207
2212 Ga0068869_100128651
2213 Ga0068869_100176193
2214 Ga0070666_10032094
2215 Ga0070680_100003246
2216 Ga0070680_100003723
2217 Ga0070680_100004063
2218 Ga0070680_100013921
2219 Ga0070680_100023192
2220 Ga0070680_100027839
2221 Ga0070680_100076391
2222 Ga0070682_100017497
2223 Ga0070682_100030502
2224 Ga0068868_100001296
2225 Ga0068868_100029640
2226 Ga0068868_100206860
2227 Ga0070660_100037805
2228 Ga0070660_100075828
2229 Ga0070660_100102672
2230 Ga0070660_100139761
2231 Ga0070660_100166869
2232 Ga0070689_100006170
2233 Ga0070689_100009184
2234 Ga0070689_100032105
2235 Ga0070689_100042151
2236 Ga0070689_100051095
2237 Ga0070689_100067740
2238 Ga0070689_100096452
2239 Ga0070689_100172197
2240 Ga0070689_100219614
2241 Ga0070691_10003913
2242 Ga0070691_10020426
2243 Ga0070691_10089558
2244 Ga0070687_100004595
2245 Ga0070687_100008671
2246 Ga0070687_100014797
2247 Ga0070687_100051544
2248 Ga0070687_100060107
2249 Ga0070661_100016310
2250 Ga0070661_100042876
2251 Ga0070661_100055375
2252 Ga0070692_10013859
2253 Ga0070692_10016750
2254 Ga0070692_10027186
2255 Ga0070668_100008383
2256 Ga0070668_100017094
2257 Ga0070668_100021697
2258 Ga0070668_100035029
2259 Ga0070668_100047647
2260 Ga0070668_100246401
2261 Ga0070669_100001998
2262 Ga0070669_100013454
2263 Ga0070669_100062002
2264 Ga0070669_100066784
2265 Ga0070675_100006526
2266 Ga0070675_100018790
2267 Ga0070675_100031007
2268 Ga0070675_100074752
2269 Ga0070675_100085083
2270 Ga0070675_100096991
2271 Ga0070675_100146178
2272 Ga0070671_100079316
2273 Ga0070671_100255325
2274 Ga0070674_100001606
2275 Ga0070674_100016846
2276 Ga0070674_100030757
2277 Ga0070674_100046250
2278 Ga0070674_100142411
2279 Ga0070673_100006677
2280 Ga0070673_100026334
2281 Ga0070673_100113997
2282 Ga0070673_100189528
2283 Ga0070688_100007379
2284 Ga0070688_100041679
2285 Ga0070688_100065254
2286 Ga0070688_100096758
2287 Ga0070659_100002785
2288 Ga0070659_100019303
2289 Ga0070659_100055980
2290 Ga0070667_100055123
2291 Ga0070667_100147072
2292 Ga0070667_100328861
2293 Ga0070703_10040799
2294 Ga0070709_10002316
2295 Ga0070709_10002621
2296 Ga0070709_10008272
2297 Ga0070709_10012009
2298 Ga0070709_10016990
2299 Ga0070709_10108541
2300 Ga0070709_10204897
2301 Ga0070714_100004755
2302 Ga0070714_100055490
2303 Ga0070714_100168597
2304 Ga0070714_100268807
2305 Ga0070713_100008004
2306 Ga0070713_100022673
2307 Ga0070713_100040073
2308 Ga0070710_10006065
2309 Ga0070710_10010819
2310 Ga0070710_10092907
2311 Ga0070701_10005417
2312 Ga0070701_10023488
2313 Ga0070711_100004283
2314 Ga0070711_100015384
2315 Ga0070711_100056462
2316 Ga0070711_100077038
2317 Ga0070705_100000175
2318 Ga0070705_100002479
2319 Ga0070705_100030070
2320 Ga0070705_100033592
2321 Ga0070705_100077350
2322 Ga0070705_100126283
2323 Ga0070700_100006909
2324 Ga0070700_100009943
2325 Ga0070700_100026867
2326 Ga0070700_100030535
2327 Ga0070700_100049208
2328 Ga0070700_100078943
2329 Ga0070700_100081059
2330 Ga0070694_100002980
2331 Ga0070694_100006648
2332 Ga0070694_100025235
2333 Ga0070694_100031890
2334 Ga0070694_100034838
2335 Ga0070694_100046376
2336 Ga0070694_100100295
2337 Ga0070694_100100423
2338 Ga0070694_100194307
2339 Ga0070694_100207796
2340 Ga0070708_100014393
2341 Ga0070708_100022190
2342 Ga0070708_100025481
2343 Ga0070708_100111985
2344 Ga0070708_100130593
2345 Ga0070708_100188023
2346 Ga0070708_100210303
2347 Ga0070708_100229002
2348 Ga0070708_100262798
2349 Ga0070708_100301947
2350 Ga0070663_100204481
2351 Ga0070678_100006525
2352 Ga0070678_100036552
2353 Ga0070678_100206605
2354 Ga0070678_100224962
2355 Ga0070662_100011148
2356 Ga0070662_100014975
2357 Ga0070662_100039023
2358 Ga0070662_100045356
2359 Ga0070662_100176892
2360 Ga0070681_10002397
2361 Ga0070681_10003472
2362 Ga0070681_10007223
2363 Ga0070681_10011126
2364 Ga0070681_10025568
2365 Ga0070681_10051196
2366 Ga0070681_10079820
2367 Ga0070681_10088539
2368 Ga0070681_10105124
2369 Ga0070681_10125946
2370 Ga0070681_10167382
2371 Ga0070681_10204011
2372 Ga0070681_10370452
2373 Ga0068867_100005066
2374 Ga0068867_100100295
2375 Ga0070685_10005310
2376 Ga0070706_100004157
2377 Ga0070706_100006592
2378 Ga0070706_100023324
2379 Ga0070706_100025041
2380 Ga0070706_100048078
2381 Ga0070706_100101171
2382 Ga0070706_100123427
2383 Ga0070706_100126482
2384 Ga0070706_100135765
2385 Ga0070706_100162922
2386 Ga0070706_100253012
2387 Ga0070707_100000111
2388 Ga0070707_100019949
2389 Ga0070707_100071190
2390 Ga0070707_100074279
2391 Ga0070707_100075299
2392 Ga0070707_100088344
2393 Ga0070707_100103404
2394 Ga0070707_100108107
2395 Ga0070707_100158149
2396 Ga0070707_100225531
2397 Ga0070707_100244470
2398 Ga0070698_100000732
2399 Ga0070698_100001954
2400 Ga0070698_100048367
2401 Ga0070698_100064792
2402 Ga0070698_100138610
2403 Ga0070698_100142564
2404 Ga0070698_100145856
2405 Ga0070698_100249357
2406 Ga0070699_100025317
2407 Ga0070699_100033808
2408 Ga0070699_100041434
2409 Ga0070699_100051744
2410 Ga0070699_100053750
2411 Ga0070699_100069767
2412 Ga0070699_100319853
2413 Ga0070679_100000601
2414 Ga0070679_100023697
2415 Ga0070679_100044346
2416 Ga0070679_100045790
2417 Ga0070679_100069873
2418 Ga0070679_100072402
2419 Ga0070679_100278807
2420 Ga0070679_100343498
2421 Ga0070684_100034431
2422 Ga0070684_100041680
2423 Ga0070684_100142679
2424 Ga0070697_100024423
2425 Ga0070697_100036389
2426 Ga0070697_100046677
2427 Ga0070697_100068800
2428 Ga0070697_100089953
2429 Ga0070697_100120873
2430 Ga0070697_100135504
2431 Ga0070697_100141679
2432 Ga0070697_100144992
2433 Ga0070697_100286344
2434 Ga0068853_100026550
2435 Ga0068853_100212483
2436 Ga0070672_100003949
2437 Ga0070672_100026322
2438 Ga0070672_100171558
2439 Ga0070672_100204838
2440 Ga0070672_100245379
2441 Ga0070686_100021163
2442 Ga0070686_100051285
2443 Ga0070686_100160151
2444 Ga0070695_100008312
2445 Ga0070695_100013344
2446 Ga0070695_100033166
2447 Ga0070695_100088152
2448 Ga0070695_100150576
2449 Ga0070695_100172301
2450 Ga0070696_100005231
2451 Ga0070696_100013998
2452 Ga0070696_100028628
2453 Ga0070696_100032388
2454 Ga0070696_100042413
2455 Ga0070696_100051895
2456 Ga0070696_100053018
2457 Ga0070696_100077257
2458 Ga0070696_100105886
2459 Ga0070696_100171415
2460 Ga0070693_100043429
2461 Ga0070665_100001142
2462 Ga0070665_100106126
2463 Ga0070665_100110500
2464 Ga0070665_100194758
2465 Ga0070665_100256810
2466 Ga0070704_100003747
2467 Ga0070704_100021663
2468 Ga0070704_100023271
2469 Ga0070704_100042785
2470 Ga0068855_100016427
2471 Ga0068855_100034201
2472 Ga0068855_100041438
2473 Ga0068855_100125252
2474 Ga0068855_100156517
2475 Ga0068855_100211199
2476 Ga0068855_100307246
2477 Ga0068855_100373693
2478 Ga0070664_100011074
2479 Ga0070664_100068537
2480 Ga0070664_100139427
2481 Ga0068857_100002740
2482 Ga0068857_100015888
2483 Ga0068857_100026578
2484 Ga0068857_100061458
2485 Ga0068854_100051569
2486 Ga0068856_100163441
2487 Ga0070702_100002572
2488 Ga0070702_100008493
2489 Ga0070702_100009357
2490 Ga0070702_100016820
2491 Ga0068852_100009981
2492 Ga0068852_100021426
2493 Ga0068852_100097256
2494 Ga0068859_100003294
2495 Ga0068859_100011939
2496 Ga0068859_100015547
2497 Ga0068859_100028177
2498 Ga0068859_100083516
2499 Ga0068859_100285147
2500 Ga0068859_100300736
2501 Ga0068864_100006580
2502 Ga0068864_100012293
2503 Ga0068864_100081652
2504 Ga0068864_100112489
2505 Ga0068866_10007241
2506 Ga0068866_10012598
2507 Ga0068866_10023782
2508 Ga0068861_100000975
2509 Ga0068861_100025036
2510 Ga0068861_100109023
2511 Ga0068861_100117879
2512 Ga0068861_100288270
2513 Ga0068863_100002641
2514 Ga0068863_100043145
2515 Ga0068863_100051547
2516 Ga0068863_100064103
2517 Ga0068863_100111800
2518 Ga0068863_100202272
2519 Ga0068863_100279109
2520 Ga0068858_100003549
2521 Ga0068858_100025878
2522 Ga0068858_100060745
2523 Ga0068858_100227052
2524 Ga0068858_100306229
2525 Ga0068860_100002169
2526 Ga0068860_100004188
2527 Ga0068860_100022141
2528 Ga0068860_100105193
2529 Ga0068860_100377495
2530 Ga0068862_100000764
2531 Ga0068862_100002926
2532 Ga0068862_100003483
2533 Ga0068862_100009767
2534 Ga0068862_100010512
2535 Ga0068862_100013561
2536 Ga0068862_100054158
2537 Ga0068862_100067739
2538 Ga0068862_100088084
2539 Ga0068862_100255669
2540 Ga0081455_10000048
2541 Ga0081455_10001008
2542 Ga0081455_10002584
2543 Ga0081455_10011198
2544 Ga0081455_10020498
2545 Ga0081455_10021909
2546 Ga0081455_10151707
2547 Ga0081455_10217200
2548 Ga0081538_10025683
2549 Ga0081538_10026012
2550 Ga0081538_10027178
2551 Ga0081540_1000039
2552 Ga0081540_1001954
2553 Ga0081540_1004248
2554 Ga0081540_1005100
2555 Ga0081540_1015691
2556 Ga0081540_1032077
2557 Ga0081540_1035908
2558 Ga0081540_1042197
2559 Ga0081540_1048547
2560 Ga0081540_1051845
2561 Ga0081540_1054086
2562 Ga0081539_10005565
2563 Ga0081539_10023434
2564 Ga0081539_10029077
2565 Ga0081539_10042213
2566 Ga0081539_10042683
2567 Ga0081539_10069342
2568 Ga0070717_10039765
2569 Ga0070717_10117638
2570 Ga0070717_10126952
2571 Ga0070717_10300996
2572 Ga0075365_10056321
2573 Ga0075365_10084311
2574 Ga0075363_100004519
2575 Ga0075364_10010958
2576 Ga0075432_10005809
2577 Ga0075432_10009022
2578 Ga0070715_10006350
2579 Ga0070715_10010428
2580 Ga0070715_10021362
2581 Ga0070715_10046249
2582 Ga0070716_100005648
2583 Ga0070716_100008042
2584 Ga0070716_100014776
2585 Ga0070716_100034413
2586 Ga0070716_100114378
2587 Ga0070716_100170288
2588 Ga0070716_100201717
2589 Ga0070712_100002022
2590 Ga0070712_100121632
2591 Ga0070712_100161335
2592 Ga0075362_10001094
2593 Ga0075362_10029472
2594 Ga0075367_10047918
2595 Ga0075369_10016456
2596 Ga0075366_10005041
2597 Ga0075366_10006363
2598 Ga0075366_10134608
2599 Ga0097621_100002102
2600 Ga0097621_100012152
2601 Ga0097621_100027490
2602 Ga0097621_100163010
2603 Ga0075370_10026686
2604 Ga0075370_10112241
2605 Ga0068871_100008543
2606 Ga0068871_100034414
2607 Ga0068871_100222917
2608 Ga0068871_100262605
2609 Ga0075428_100003062
2610 Ga0075428_100012165
2611 Ga0075428_100012701
2612 Ga0075428_100014750
2613 Ga0075428_100031483
2614 Ga0075428_100031769
2615 Ga0075428_100032084
2616 Ga0075428_100070970
2617 Ga0075428_100096246
2618 Ga0075428_100100956
2619 Ga0075428_100123298
2620 Ga0075428_100175030
2621 Ga0075428_100181164
2622 Ga0075428_100226820
2623 Ga0075430_100000196
2624 Ga0075430_100000588
2625 Ga0075430_100001414
2626 Ga0075430_100002137
2627 Ga0075430_100005309
2628 Ga0075430_100012839
2629 Ga0075430_100024234
2630 Ga0075430_100030156
2631 Ga0075430_100049042
2632 Ga0075430_100074672
2633 Ga0075430_100105672
2634 Ga0075431_100000285
2635 Ga0075431_100015841
2636 Ga0075431_100017225
2637 Ga0075431_100019032
2638 Ga0075431_100025863
2639 Ga0075431_100031481
2640 Ga0075431_100091921
2641 Ga0075431_100177690
2642 Ga0075431_100182184
2643 Ga0075431_100186865
2644 Ga0075431_100196910
2645 Ga0075431_100235873
2646 Ga0075431_100306437
2647 Ga0075431_100311671
2648 Ga0075431_100379713
2649 Ga0075433_10000728
2650 Ga0075433_10002316
2651 Ga0075433_10042950
2652 Ga0075433_10056647
2653 Ga0075433_10207815
2654 Ga0075433_10221288
2655 Ga0075433_10232108
2656 Ga0075433_10322591
2657 Ga0075434_100003094
2658 Ga0075434_100079053
2659 Ga0075434_100098077
2660 Ga0075434_100098215
2661 Ga0075434_100106220
2662 Ga0075434_100214139
2663 Ga0075434_100350883
2664 Ga0075434_100410412
2665 Ga0075429_100000573
2666 Ga0075429_100015763
2667 Ga0075429_100026560
2668 Ga0075429_100066007
2669 Ga0075429_100161147
2670 Ga0068865_100013360
2671 Ga0068865_100070394
2672 Ga0068865_100080162
2673 Ga0068865_100104200
2674 Ga0068865_100211460
2675 Ga0075436_100040622
2676 Ga0075436_100051066
2677 Ga0075436_100096253
2678 Ga0097620_100003294
2679 Ga0097620_100011939
2680 Ga0097620_100015546
2681 Ga0097620_100028177
2682 Ga0097620_100083510
2683 Ga0097620_100285152
2684 Ga0097620_100300703
2685 Ga0099822_1017947
2686 Ga0075435_100049503
2687 Ga0075435_100077177
2688 Ga0075435_100133447
2689 Ga0075435_100165794
2690 Ga0075435_100217013
2691 Ga0075435_100270475
2692 Ga0099795_10014852
2693 Ga0099795_10031443
2694 Ga0105244_10054642
2695 Ga0105240_10000041
2696 Ga0105240_10004245
2697 Ga0105240_10062946
2698 Ga0105240_10317079
2699 Ga0111539_10000254
2700 Ga0111539_10000683
2701 Ga0111539_10002526
2702 Ga0111539_10011739
2703 Ga0111539_10065953
2704 Ga0111539_10099479
2705 Ga0111539_10128818
2706 Ga0111539_10145820
2707 Ga0111539_10236594
2708 Ga0111539_10279893
2709 Ga0105245_10183915
2710 Ga0105245_10242990
2711 Ga0114129_10005890
2712 Ga0114129_10007918
2713 Ga0114129_10008352
2714 Ga0114129_10008584
2715 Ga0114129_10022594
2716 Ga0114129_10023982
2717 Ga0114129_10024415
2718 Ga0114129_10030751
2719 Ga0114129_10036192
2720 Ga0114129_10058827
2721 Ga0114129_10116757
2722 Ga0114129_10147439
2723 Ga0114129_10173993
2724 Ga0114129_10195878
2725 Ga0114129_10271585
2726 Ga0114129_10338416
2727 Ga0114129_10357525
2728 Ga0114129_10427049
2729 Ga0114129_10595964
2730 Ga0105243_10031684
2731 Ga0105243_10079528
2732 Ga0105243_10111592
2733 Ga0105243_10227041
2734 Ga0105242_10017209
2735 Ga0105242_10055724
2736 Ga0105248_10004070
2737 Ga0105248_10023633
2738 Ga0105248_10036522
2739 Ga0105248_10050272
2740 Ga0105248_10052133
2741 Ga0105248_10332211
2742 Ga0105237_10091369
2743 Ga0105237_10214518
2744 Ga0105238_10094918
2745 Ga0105249_10000580
2746 Ga0105249_10004567
2747 Ga0105249_10008223
2748 Ga0105249_10018979
2749 Ga0105249_10127689
2750 Ga0099796_10018211
2751 Ga0099796_10029177
2752 Ga0105239_10006094
2753 Ga0105239_10023806
2754 Ga0105246_10002307
2755 Ga0105246_10140884
2756 Ga0157326_1000019
2757 Ga0157371_10010154
2758 Ga0157371_10012727
2759 Ga0157369_10067134
2760 Ga0157369_10152920
2761 Ga0157369_10320029
2762 Ga0157374_10000059
2763 Ga0157374_10000420
2764 Ga0157374_10011042
2765 Ga0157374_10063069
2766 Ga0157378_10015692
2767 Ga0157378_10037718
2768 Ga0157378_10089479
2769 Ga0157378_10130357
2770 Ga0157378_10200348
2771 Ga0157378_10201694
2772 Ga0163162_10006136
2773 Ga0163162_10148135
2774 Ga0163162_10234444
2775 Ga0163162_10245555
2776 Ga0157372_10043257
2777 Ga0157375_10026125
2778 Ga0157375_10043876
2779 Ga0157375_10108740
2780 Ga0157375_10190591
2781 Ga0163163_10006954
2782 Ga0163163_10022770
2783 Ga0163163_10073351
2784 Ga0163163_10103076
2785 Ga0163163_10254024
2786 Ga0163163_10389447
2787 Ga0157380_10017794
2788 Ga0157380_10130825
2789 Ga0157380_10290076
2790 Ga0157377_10036391
2791 Ga0157379_10035446
2792 Ga0157379_10072718
2793 Ga0157379_10073976
2794 Ga0157379_10174229
2795 Ga0157376_10000366
2796 Ga0157376_10021266
2797 Ga0157376_10062627
2798 Ga0157376_10072830
2799 Ga0206356_10491331
2800 Ga0206355_1150548
2801 Ga0206352_10908026
2802 Ga0206352_11257230
2803 Ga0206350_10871634
2804 Ga0206354_10060344
2805 Ga0206354_10418299
2806 Ga0213872_10080721
2807 Ga0213874_10005086
2808 Ga0213876_10004873
2809 Ga0213876_10005191
2810 Ga0213876_10024479
2811 Ga0213876_10036554
2812 Ga0224712_10012105
2813 Ga0224712_10056701
2814 Ga0228598_1000842
2815 Ga0228598_1009546
2816 Ga0209233_1002757
2817 Ga0209758_1000294
2818 Ga0209758_1003798
2819 Ga0209758_1006193
2820 Ga0207697_10007256
2821 Ga0207697_10008426
2822 Ga0207697_10010465
2823 Ga0207696_1012954
2824 Ga0207653_10001008
2825 Ga0207682_10015238
2826 Ga0207682_10018511
2827 Ga0207682_10097011
2828 Ga0207692_10001850
2829 Ga0207692_10001861
2830 Ga0207692_10004350
2831 Ga0207692_10008328
2832 Ga0207642_10010483
2833 Ga0207642_10017186
2834 Ga0207642_10083695
2835 Ga0207642_10084880
2836 Ga0207642_10086501
2837 Ga0207710_10033867
2838 Ga0207647_10057140
2839 Ga0207647_10070290
2840 Ga0207685_10002961
2841 Ga0207685_10006264
2842 Ga0207685_10013698
2843 Ga0207685_10027209
2844 Ga0207699_10010108
2845 Ga0207699_10015690
2846 Ga0207699_10048407
2847 Ga0207699_10080717
2848 Ga0207699_10086124
2849 Ga0207699_10118915
2850 Ga0207645_10000909
2851 Ga0207645_10001246
2852 Ga0207645_10030019
2853 Ga0207645_10039141
2854 Ga0207643_10025597
2855 Ga0207643_10030502
2856 Ga0207643_10079555
2857 Ga0207643_10083433
2858 Ga0207705_10007506
2859 Ga0207705_10097755
2860 Ga0207684_10000334
2861 Ga0207684_10005045
2862 Ga0207684_10033102
2863 Ga0207684_10065816
2864 Ga0207684_10091560
2865 Ga0207684_10099628
2866 Ga0207684_10116816
2867 Ga0207684_10253520
2868 Ga0207654_10144844
2869 Ga0207707_10002337
2870 Ga0207707_10003270
2871 Ga0207707_10004335
2872 Ga0207707_10012860
2873 Ga0207707_10013953
2874 Ga0207707_10022768
2875 Ga0207707_10027678
2876 Ga0207707_10056109
2877 Ga0207707_10059354
2878 Ga0207707_10073265
2879 Ga0207707_10108444
2880 Ga0207707_10182832
2881 Ga0207707_10205128
2882 Ga0207695_10000093
2883 Ga0207695_10003067
2884 Ga0207695_10017539
2885 Ga0207693_10001366
2886 Ga0207693_10001926
2887 Ga0207693_10003338
2888 Ga0207693_10048951
2889 Ga0207693_10062321
2890 Ga0207693_10090627
2891 Ga0207693_10113671
2892 Ga0207663_10000218
2893 Ga0207663_10000533
2894 Ga0207663_10013116
2895 Ga0207663_10041305
2896 Ga0207663_10064474
2897 Ga0207663_10076841
2898 Ga0207663_10085049
2899 Ga0207663_10278742
2900 Ga0207660_10001269
2901 Ga0207660_10001710
2902 Ga0207660_10001861
2903 Ga0207660_10009536
2904 Ga0207660_10011255
2905 Ga0207660_10013609
2906 Ga0207660_10025700
2907 Ga0207660_10036064
2908 Ga0207660_10059416
2909 Ga0207660_10067521
2910 Ga0207660_10209597
2911 Ga0207662_10000695
2912 Ga0207662_10000745
2913 Ga0207662_10006823
2914 Ga0207662_10011914
2915 Ga0207662_10016037
2916 Ga0207662_10045667
2917 Ga0207662_10091381
2918 Ga0207657_10045238
2919 Ga0207657_10057829
2920 Ga0207657_10059343
2921 Ga0207657_10082571
2922 Ga0207657_10155717
2923 Ga0207657_10182426
2924 Ga0207649_10006102
2925 Ga0207649_10007666
2926 Ga0207649_10008227
2927 Ga0207649_10018776
2928 Ga0207652_10004826
2929 Ga0207652_10006486
2930 Ga0207652_10022531
2931 Ga0207652_10031244
2932 Ga0207652_10044290
2933 Ga0207652_10196571
2934 Ga0207646_10000163
2935 Ga0207646_10012943
2936 Ga0207646_10071440
2937 Ga0207646_10077354
2938 Ga0207646_10110092
2939 Ga0207646_10220554
2940 Ga0207646_10226890
2941 Ga0207646_10248979
2942 Ga0207681_10000921
2943 Ga0207681_10001456
2944 Ga0207681_10003904
2945 Ga0207681_10005449
2946 Ga0207681_10020067
2947 Ga0207681_10031873
2948 Ga0207681_10117087
2949 Ga0207681_10284402
2950 Ga0207694_10135749
2951 Ga0207650_10006954
2952 Ga0207650_10018698
2953 Ga0207650_10028886
2954 Ga0207650_10039543
2955 Ga0207650_10042551
2956 Ga0207650_10067277
2957 Ga0207650_10115619
2958 Ga0207650_10132476
2959 Ga0207650_10135504
2960 Ga0207659_10000959
2961 Ga0207659_10007653
2962 Ga0207659_10012855
2963 Ga0207659_10053718
2964 Ga0207659_10060754
2965 Ga0207659_10100538
2966 Ga0207659_10154739
2967 Ga0207687_10106619
2968 Ga0207700_10026269
2969 Ga0207700_10036414
2970 Ga0207664_10261591
2971 Ga0207644_10076837
2972 Ga0207644_10164498
2973 Ga0207690_10022305
2974 Ga0207690_10023620
2975 Ga0207706_10002035
2976 Ga0207706_10005841
2977 Ga0207706_10028938
2978 Ga0207706_10053166
2979 Ga0207686_10001079
2980 Ga0207686_10015176
2981 Ga0207686_10018632
2982 Ga0207686_10030722
2983 Ga0207686_10033926
2984 Ga0207686_10042605
2985 Ga0207686_10049385
2986 Ga0207709_10002980
2987 Ga0207709_10034936
2988 Ga0207709_10072298
2989 Ga0207709_10137952
2990 Ga0207709_10157252
2991 Ga0207670_10012034
2992 Ga0207670_10036246
2993 Ga0207670_10039944
2994 Ga0207670_10081319
2995 Ga0207670_10242798
2996 Ga0207669_10011707
2997 Ga0207669_10026425
2998 Ga0207669_10028160
2999 Ga0207669_10146520
3000 Ga0207669_10164508
3001 Ga0207704_10003676
3002 Ga0207704_10008696
3003 Ga0207704_10037526
3004 Ga0207704_10223226
3005 Ga0207665_10005278
3006 Ga0207665_10057769
3007 Ga0207665_10108523
3008 Ga0207665_10141623
3009 Ga0207691_10018044
3010 Ga0207691_10028811
3011 Ga0207691_10031365
3012 Ga0207691_10187260
3013 Ga0207711_10002753
3014 Ga0207711_10012732
3015 Ga0207711_10020060
3016 Ga0207711_10030222
3017 Ga0207711_10057259
3018 Ga0207711_10290926
3019 Ga0207711_10404715
3020 Ga0207689_10004653
3021 Ga0207689_10044042
3022 Ga0207689_10101234
3023 Ga0207689_10204162
3024 Ga0207661_10001853
3025 Ga0207661_10021271
3026 Ga0207661_10043353
3027 Ga0207661_10059157
3028 Ga0207661_10084492
3029 Ga0207661_10102602
3030 Ga0207661_10152829
3031 Ga0207679_10001341
3032 Ga0207679_10001347
3033 Ga0207679_10002943
3034 Ga0207679_10006574
3035 Ga0207679_10040166
3036 Ga0207679_10381630
3037 Ga0207667_10002033
3038 Ga0207667_10004001
3039 Ga0207667_10016094
3040 Ga0207667_10042200
3041 Ga0207667_10044959
3042 Ga0207667_10071599
3043 Ga0207651_10001504
3044 Ga0207651_10035925
3045 Ga0207651_10080597
3046 Ga0207651_10161489
3047 Ga0207712_10000596
3048 Ga0207712_10002234
3049 Ga0207712_10009138
3050 Ga0207712_10023580
3051 Ga0207712_10043142
3052 Ga0207712_10058166
3053 Ga0207712_10058973
3054 Ga0207712_10152678
3055 Ga0207668_10001639
3056 Ga0207668_10024669
3057 Ga0207668_10028177
3058 Ga0207668_10031247
3059 Ga0207668_10047791
3060 Ga0207668_10310721
3061 Ga0207658_10035012
3062 Ga0207677_10017448
3063 Ga0207677_10119516
3064 Ga0207677_10189306
3065 Ga0207677_10298127
3066 Ga0207703_10008320
3067 Ga0207703_10012297
3068 Ga0207703_10093383
3069 Ga0207703_10101060
3070 Ga0207703_10139787
3071 Ga0207703_10170199
3072 Ga0207703_10235862
3073 Ga0207703_10301979
3074 Ga0207639_10019041
3075 Ga0207678_10000118
3076 Ga0207678_10035455
3077 Ga0207678_10039362
3078 Ga0207678_10095005
3079 Ga0207678_10207924
3080 Ga0207678_10296505
3081 Ga0207708_10004898
3082 Ga0207708_10007880
3083 Ga0207708_10054897
3084 Ga0207708_10090622
3085 Ga0207708_10122644
3086 Ga0207702_10000678
3087 Ga0207702_10066250
3088 Ga0207702_10209393
3089 Ga0207641_10006730
3090 Ga0207641_10011831
3091 Ga0207641_10114560
3092 Ga0207648_10016323
3093 Ga0207648_10052941
3094 Ga0207648_10079224
3095 Ga0207648_10083752
3096 Ga0207648_10085952
3097 Ga0207648_10145976
3098 Ga0207648_10222012
3099 Ga0207676_10011825
3100 Ga0207676_10048181
3101 Ga0207676_10052602
3102 Ga0207676_10213603
3103 Ga0207674_10019696
3104 Ga0207674_10100148
3105 Ga0207674_10156626
3106 Ga0207674_10164710
3107 Ga0207674_10194383
3108 Ga0207674_10295767
3109 Ga0207674_10295768
3110 Ga0207675_100001482
3111 Ga0207675_100013949
3112 Ga0207675_100022225
3113 Ga0207675_100034087
3114 Ga0207675_100059999
3115 Ga0207675_100086719
3116 Ga0207675_100151309
3117 Ga0207683_10001846
3118 Ga0207683_10120249
3119 Ga0207698_10063499
3120 Ga0207698_10107570
3121 Ga0207698_10394090
3122 Ga0209973_1001352
3123 Ga0209589_1000009
3124 Ga0209969_1000998
3125 Ga0209969_1005374
3126 Ga0209700_100017
3127 Ga0209967_1005224
3128 Ga0209967_1007178
3129 Ga0209981_1002218
3130 Ga0209996_1000062
3131 Ga0209984_1000027
3132 Ga0209984_1001796
3133 Ga0210000_1000018
3134 Ga0210000_1002528
3135 Ga0209995_1000072
3136 Ga0209995_1002667
3137 Ga0209995_1009379
3138 Ga0209968_1000094
3139 Ga0209968_1005632
3140 Ga0209982_1000629
3141 Ga0209970_1011065
3142 Ga0210002_1001045
3143 Ga0209983_1004487
3144 Ga0209588_1000683
3145 Ga0209588_1010983
3146 Ga0209588_1018885
3147 Ga0209971_1000266
3148 Ga0209971_1010223
3149 Ga0209971_1011157
3150 Ga0209971_1011882
3151 Ga0209966_1008167
3152 Ga0209998_10003141
3153 Ga0209974_10011093
3154 Ga0207428_10000452
3155 Ga0207428_10002442
3156 Ga0207428_10002487
3157 Ga0207428_10002947
3158 Ga0207428_10008077
3159 Ga0207428_10019254
3160 Ga0207428_10019939
3161 Ga0207428_10024590
3162 Ga0207428_10087244
3163 Ga0207428_10155353
3164 Ga0268266_10016375
3165 Ga0268266_10038713
3166 Ga0268266_10069684
3167 Ga0268266_10290198
3168 Ga0268265_10000619
3169 Ga0268265_10002653
3170 Ga0268265_10003125
3171 Ga0268265_10004276
3172 Ga0268265_10023953
3173 Ga0268265_10056115
3174 Ga0268265_10148761
3175 Ga0268264_10001609
3176 Ga0268264_10002890
3177 Ga0268264_10028955
3178 Ga0268264_10076084
3179 Ga0268264_10125894
3180 Ga0268264_10142124
3181 Ga0265334_10000037
3182 Ga0265318_10001354
3183 Ga0307517_10023999
3184 Ga0265338_10083880
3185 Ga0265330_10026535
3186 Ga0265330_10040631
3187 Ga0265332_10003683
3188 Ga0265332_10025986
3189 Ga0265320_10006474
3190 Ga0265320_10069334
3191 Ga0265325_10001769
3192 Ga0265325_10042129
3193 Ga0265325_10042338
3194 Ga0265340_10003857
3195 Ga0265340_10008522
3196 Ga0265340_10009510
3197 Ga0265331_10030089
3198 Ga0265331_10033286
3199 Ga0265327_10034681
3200 Ga0265327_10068129
3201 Ga0265316_10018043
3202 Ga0307513_10204004
3203 Ga0307408_100002257
3204 Ga0307408_100002760
3205 Ga0307408_100170999
3206 Ga0307408_100189027
3207 Ga0265313_10001884
3208 Ga0265313_10055251
3209 Ga0307508_10026303
3210 Ga0307508_10047547
3211 Ga0316575_10000334
3212 Ga0316579_10098817
3213 Ga0265314_10004347
3214 Ga0265314_10004621
3215 Ga0265314_10014975
3216 Ga0265314_10031643
3217 Ga0265314_10140826
3218 Ga0265342_10025101
3219 Ga0316576_10015331
3220 Ga0316578_10069120
3221 Ga0307405_10000834
3222 Ga0307405_10051255
3223 Ga0307405_10106508
3224 Ga0316577_10000808
3225 Ga0307413_10001842
3226 Ga0307413_10006517
3227 Ga0307413_10006826
3228 Ga0307413_10029378
3229 Ga0307413_10088705
3230 Ga0307413_10130446
3231 Ga0307410_10001490
3232 Ga0307410_10037876
3233 Ga0307410_10045318
3234 Ga0307410_10046976
3235 Ga0307410_10049143
3236 Ga0307410_10100632
3237 Ga0307406_10001264
3238 Ga0307406_10002275
3239 Ga0307406_10015689
3240 Ga0307406_10025885
3241 Ga0307406_10057841
3242 Ga0307407_10017582
3243 Ga0307407_10038507
3244 Ga0307407_10090479
3245 Ga0307412_10007821
3246 Ga0307412_10009892
3247 Ga0307412_10058964
3248 Ga0307412_10079641
3249 Ga0307412_10163159
3250 Ga0307409_100007839
3251 Ga0307409_100009070
3252 Ga0307409_100019491
3253 Ga0307409_100055682
3254 Ga0307409_100096366
3255 Ga0307409_100178900
3256 Ga0307416_100001472
3257 Ga0307416_100083952
3258 Ga0307416_100096391
3259 Ga0307416_100274081
3260 Ga0307416_100523430
3261 Ga0307414_10004583
3262 Ga0307414_10080884
3263 Ga0307414_10179904
3264 Ga0307411_10007737
3265 Ga0307411_10041503
3266 Ga0307411_10107058
3267 Ga0307411_10153895
3268 Ga0307415_100001337
3269 Ga0307415_100004471
3270 Ga0307415_100017287
3271 Ga0307415_100055843
3272 Ga0307415_100095105
3273 Ga0307415_100340738
3274 Ga0316583_10001183
3275 Ga0316585_10037261
3276 Ga0316593_10051045
3277 Ga0307510_10061720
3278 Ga0315911_1000009
3279 Ga0316592_1003439
3280 Ga0316592_1008612
3281 Ga0316588_1000228
3282 Ga0316588_1006825
3283 Ga0316588_1016804
3284 Ga0316587_1000001
3285 Ga0316587_1000006
3286 Ga0316596_1028364
3287 Ga0316215_1002072
3288 Ga0373930_0008465
3289 Ga0373948_0008982
3290 Ga0373950_0016909
3291 Ga0373959_0004698
3292 Ga0373959_0008900
3293 Ga0373938_0019036
3294 Ga0373926_0002802
3295 Ga0373926_0015003
3296 Ga0373926_0025049
3297 Ga0373928_0001860
3298 Ga0373928_0017566
3299 Ga0373929_0012636
3300 Ga0373934_0000472
3301 Ga0373934_0016588
3302 Ga0373934_0069427
3303 Ga0373934_0071452
3304 Ga0373940_0000987
3305 Ga0373949_0003354
3306 Ga0373949_0010232
3307 Ga0373949_0011969
3308 Ga0373923_0026151
3309 Ga0373923_0032751
3310 Ga0373939_0010982
3311 Ga0373939_0011969
3312 Ga0373939_0016474
3313 Ga0373939_0019524
3314 Ga0373941_0011416
3315 Ga0373941_0029431
3316 Ga0373941_0042549
3317 Ga0373941_0068417
3318 Ga0373945_0085162
3319 Ga0373953_0005866
3320 Ga0373953_0028142
3321 Ga0373954_0031264
3322 Ga0373954_0087250
3323 Ga0373956_0001329
3324 Ga0373956_0038502
3325 Ga0373956_0076406
3326 Ga0373956_0078110
3327 Ga0373957_0025695
3328 Ga0373957_0030047
3329 Ga0373957_0045634
3330 Ga0373960_0009168
3331 Ga0373960_0017396
3332 Ga0373960_0019913
3333 Ga0373943_0014563
3334 Ga0373943_0097484
3335 Ga0373946_0007151
3336 Ga0373946_0018716
3337 Ga0373946_0027375
3338 Ga0373946_0095766
3339 Ga0373955_0000309
3340 Ga0373955_0012698
3341 Ga0373955_0043063
3342 Ga0373942_0008030
3343 Ga0373942_0027676
3344 Ga0373942_0034045
3345 Ga0373942_0035913
3346 Ga0373961_0020667
3347 Ga0373961_0029361
3348 Ga0373961_0034513
3349 Ga0373962_0002684
3350 Ga0373962_0013863
3351 Ga0373962_0016237
3352 Ga0373962_0021559
3353 Ga0373924_0001445
3354 Ga0373924_0011533
3355 Ga0373931_0003223
3356 Ga0373931_0008373
3357 Ga0373931_0020620
3358 Ga0373931_0035165
3359 Ga0373931_0047139
3360 Ga0373931_0072741
3361 Ga0373931_0132212
3362 Ga0373931_0135530
3363 Ga0373935_0001142
3364 Ga0373935_0008159
3365 Ga0373935_0090314
3366 Ga0373927_0029867
3367 Ga0373927_0036111
3368 Ga0373927_0053681
3369 Ga0373927_0095902
3370 Ga0373933_0000191
3371 Ga0373933_0000226
3372 Ga0373933_0002765
3373 Ga0373933_0026815
3374 Ga0373933_0057615
3375 Ga0373933_0070349
3376 Ga0373933_0082667
3377 Ga0373933_0115338
3378 Ga0373947_0012496
3379 Ga0373947_0018231
3380 Ga0373947_0028579
3381 Ga0373947_0075744
3382 Ga0373947_0106809
3383 Ga0373947_0147968
3384 Ga0310104_02351
3385 Ga0373937_0000625
3386 Ga0373937_0000922
3387 Ga0373937_0007608
3388 Ga0373937_0011530
3389 Ga0373937_0020942
3390 Ga0373937_0042587
3391 Ga0373937_0057225
3392 Ga0373937_0077479
3393 Ga0373937_0082050
3394 Ga0373937_0087155
3395 Ga0373937_0110593
3396 Ga0373937_0128072
3397 Ga0373937_0144716
3398 Ga0373937_0364132
3399 Ga0373937_0560283
3400 Ga0316582_0010203
3401 Ga0316582_0020988
3402 Ga0316582_0145583
3403 Ga0316582_0159975
3404 Ga0316584_0186233
3405 Ga0373925_0011980
3406 Ga0373925_0015764
3407 Ga0373925_0029577
3408 Ga0373925_0029981
3409 Ga0373925_0042031
3410 Ga0373925_0045962
3411 Ga0373925_0065943
3412 Ga0373925_0087086
3413 Ga0373925_0103338
3414 Ga0373925_0114848
3415 Ga0373925_0116539
3416 Ga0373925_0128704
3417 Ga0373925_0216071
3418 Ga0373925_0219440
3419 Ga0395899_0009753
3420 Ga0395899_0126969
3421 Ga0395900_0001056
3422 Ga0395900_0006668
3423 Ga0395900_0013202
3424 Ga0395900_0037244
3425 Ga0395900_0058815
3426 Ga0395900_0304856
3427 Ga0395898_0004457
3428 Ga0395898_0007760
3429 Ga0395898_0039516
3430 Ga0395898_0047677
3431 Ga0395898_0158194
3432 Ga0395905_0025260
3433 Ga0395905_0038275
3434 Ga0395905_0099808
3435 Ga0395905_0155091
3436 Ga0395905_0163267
3437 Ga0395905_0193597
3438 Ga0395905_0206228
3439 Ga0395905_0383764
3440 Ga0436364_0001908
3441 Ga0436364_0931532
3442 Ga0395901_0001137
3443 Ga0395901_0001770
3444 Ga0395901_0001933
3445 Ga0395901_0010920
3446 Ga0395901_0016009
3447 Ga0395901_0388912
3448 Ga0436365_0274631
3449 Ga0436365_0774305
3450 Ga0436365_1048027
3451 Ga0436365_1305368
3452 Ga0436360_0092949
3453 Ga0436360_1325874
3454 Ga0436361_0047865
3455 Ga0436361_0496850
3456 Ga0436363_0329569
3457 Ga0436363_1374698
3458 Ga0436362_0394382
3459 Ga0436362_0603905
3460 Ga0439447_009570
3461 Ga0439453_0001969
3462 Ga0439453_0016685
3463 Ga0439461_0004017
3464 Ga0439466_0025975
3465 Ga0439465_0010957
3466 Ga0451855_0958738
3467 Ga0439437_001583
3468 Ga0439441_003681
3469 Ga0439442_009336
3470 Ga0439448_0025835
3471 Ga0439448_0053979
3472 Ga0439450_013574
3473 Ga0439455_0009644
3474 Ga0439455_0018111
3475 Ga0439455_0027284
3476 Ga0450921_000329
3477 Ga0450923_001795
3478 Ga0450923_008971
3479 Ga0450888_001021
3480 Ga0450902_008086
3481 Ga0450910_002597
3482 Ga0439458_0012925
3483 Ga0439458_0017725
3484 Ga0439434_0001339
3485 Ga0439434_0020661
3486 Ga0439444_0021580
3487 Ga0439459_0017297
3488 Ga0439464_0010092
3489 Ga0439464_0013994
3490 Ga0439464_0021224
3491 Ga0439464_0025031
3492 Ga0439460_0016615
3493 Ga0439460_0021671
3494 Ga0439460_0034043
3495 Ga0450893_0012896
3496 Ga0451577_0000001
3497 Ga0451577_0000139
3498 Ga0451577_0003185
3499 Ga0451577_0107174
3500 Ga0451577_0134120
3501 Ga0451577_0262410
3502 Ga0451577_0315405
3503 Ga0466969_0008223
3504 Ga0453683_0000392
3505 Ga0453683_0008242
3506 Ga0453683_0018335
3507 Ga0466963_0102827
3508 Ga0453684_0007134
3509 Ga0453684_0011806
3510 Ga0453684_0016991
3511 Ga0453684_0017055
3512 Ga0453684_0023903
3513 Ga0453684_0039258
3514 Ga0453684_0043642
3515 Ga0453684_0180682
3516 Ga0453684_0344576
3517 Ga0453684_0441992
3518 Ga0466957_0172776
3519 Ga0466960_0052749
3520 Ga0451576_0001666
3521 Ga0451576_0004133
3522 Ga0451576_0005560
3523 Ga0451576_0033892
3524 Ga0451576_0067523
3525 Ga0451576_0125552
3526 Ga0451576_0132335
3527 Ga0451576_0145157
3528 Ga0451576_0176609
3529 Ga0451576_0191597
3530 Ga0451576_0302716
3531 Ga0451576_0396244
3532 Ga0451576_0421819
3533 Ga0451576_0509390
3534 Ga0466967_0083665
3535 Ga0495592_0001172
3536 Ga0495592_0057874
3537 Ga0495592_0078693
3538 Ga0495592_0112240
3539 Ga0495592_0187398
3540 Ga0495590_0033830
3541 Ga0495629_0010959
3542 Ga0495629_0013164
3543 Ga0495629_0041225
3544 Ga0495629_0050570
3545 Ga0495629_0153391
3546 Ga0495651_0000116
3547 Ga0495651_0004583
3548 Ga0495651_0012754
3549 Ga0495651_0086816
3550 Ga0495653_0000992
3551 Ga0495653_0043909
3552 Ga0495653_0075445
3553 Ga0495580_0025129
3554 Ga0495580_0070479
3555 Ga0495580_0077981
3556 Ga0495580_0084214
3557 Ga0495580_0122521
3558 Ga0495580_0129835
3559 Ga0495582_0000533
3560 Ga0495582_0003714
3561 Ga0495582_0036893
3562 Ga0495582_0047252
3563 Ga0495582_0102061
3564 Ga0495582_0111841
3565 Ga0495639_0004359
3566 Ga0495639_0004660
3567 Ga0495639_0013867
3568 Ga0495662_0000285
3569 Ga0495662_0023087
3570 Ga0495662_0039096
3571 Ga0495662_0058686
3572 Ga0495662_0137064
3573 Ga0495662_0148498
3574 Ga0495664_0000961
3575 Ga0495584_0014690
3576 Ga0495584_0033702
3577 Ga0495594_0006984
3578 Ga0495594_0026625
3579 Ga0495594_0033559
3580 Ga0495594_0040646
3581 Ga0495594_0054681
3582 Ga0495594_0085743
3583 Ga0495596_0065051
3584 Ga0495607_0105852
3585 Ga0495606_0010760
3586 Ga0495608_0001013
3587 Ga0495608_0059430
3588 Ga0495618_0008291
3589 Ga0495618_0059266
3590 Ga0495618_0096188
3591 Ga0495628_0042659
3592 Ga0495628_0051410
3593 Ga0495628_0112083
3594 Ga0495630_0000003
3595 Ga0495630_0017202
3596 Ga0495630_0034149
3597 Ga0495630_0082123
3598 Ga0495632_0090958
3599 Ga0495643_0000057
3600 Ga0495648_0003969
3601 Ga0495666_0113004
3602 Ga0495652_0001095
3603 Ga0495652_0005949
3604 Ga0495652_0040514
3605 Ga0495652_0101153
3606 Ga0495652_0124434
3607 Ga0495665_0002814
3608 Ga0495665_0007282
3609 Ga0495665_0014231
3610 Ga0495640_0020543
3611 Ga0495640_0031131
3612 Ga0495640_0064598
3613 Ga0495640_0082221
3614 Ga0495586_0030719
3615 Ga0495586_0036590
3616 Ga0495586_0081706
3617 Ga0495586_0119850
3618 Ga0495586_0201956
3619 Ga0495587_0000143
3620 Ga0495587_0000383
3621 Ga0495587_0003735
3622 Ga0495587_0004112
3623 Ga0495598_0039224
3624 Ga0495621_0025602
3625 Ga0495645_0001091
3626 Ga0495645_0001110
3627 Ga0495645_0001766
3628 Ga0495645_0012119
3629 Ga0495633_0058911
3630 Ga0495633_0070105
3631 Ga0495667_0001636
3632 Ga0495667_0011265
3633 Ga0495667_0042365
3634 Ga0495667_0107565
3635 Ga0495634_0001443
3636 Ga0495634_0018723
3637 Ga0495635_0000158
3638 Ga0495635_0007400
3639 Ga0495635_0013387
3640 Ga0495635_0079904
3641 Ga0495659_0002742
3642 Ga0495659_0008622
3643 Ga0495659_0014552
3644 Ga0495659_0021391
3645 Ga0495659_0025300
3646 Ga0495588_0021926
3647 Ga0495657_0000476
3648 Ga0495657_0032938
3649 Ga0495657_0038867
3650 Ga0495599_0000553
3651 Ga0495599_0051496
3652 Ga0495599_0059863
3653 Ga0495623_0000017
3654 Ga0495623_0037922
3655 Ga0495623_0100595
3656 Ga0495646_0002016
3657 Ga0495647_0004317
3658 Ga0495658_0001433
3659 Ga0495658_0002526
3660 Ga0495658_0010843
3661 Ga0495658_0037637
3662 Ga0495658_0071433
3663 Ga0495613_0035991
3664 Ga0495613_0056944
3665 Ga0495613_0088810
3666 Ga0495613_0215666
3667 Ga0495624_0022926
3668 Ga0495624_0033590
3669 Ga0495671_0049169
3670 Ga0495600_0029410
3671 Ga0495600_0067651
3672 Ga0495581_0001080
3673 Ga0495581_0020101
3674 Ga0495581_0020518
3675 Ga0495581_0020800
3676 Ga0495581_0117388
3677 Ga0495604_0000017
3678 Ga0495604_0067538
3679 Ga0495636_0046182
3680 Ga0495674_0003478
3681 Ga0495674_0003779
3682 Ga0495674_0008269
3683 Ga0495674_0014556
3684 Ga0495672_0004623
3685 Ga0495676_0119184
3686 Ga0495676_0192381
3687 Ga0495680_0019971
3688 Ga0495680_0062098
3689 Ga0495680_0071580
3690 Ga0495675_0001010
3691 Ga0495675_0014092
3692 Ga0495675_0199730
3693 Ga0495684_0000095
3694 Ga0495684_0033602
3695 Ga0495593_0013848
3696 Ga0495593_0048358
3697 Ga0495602_0000485
3698 Ga0495602_0000595
3699 Ga0495602_0001119
3700 Ga0495602_0042877
3701 Ga0495614_0042180
3702 Ga0495614_0083384
3703 Ga0495615_0003581
3704 Ga0495615_0017317
3705 Ga0496100_0007174
3706 Ga0496101_0000949
3707 Ga0496101_0009865
3708 Ga0496101_0024585
3709 Ga0496101_0092511
3710 Ga0496101_0129775
3711 Ga0496102_0002642
3712 Ga0496102_0003666
3713 Ga0496102_0029697
3714 Ga0496102_0047364
3715 Ga0496102_0066985
3716 Ga0496102_0068879
3717 Ga0496102_0082955
3718 Ga0496102_0094489
3719 Ga0496102_0151946
3720 Ga0496102_0156365
3721 Ga0496102_0170502
3722 Ga0496102_0296741
3723 Ga0496103_0014722
3724 Ga0496103_0022205
3725 Ga0496103_0042027
3726 Ga0496104_0000877
3727 Ga0496104_0002308
3728 Ga0496104_0015456
3729 Ga0496104_0213706
3730 Ga0496104_0310826
3731 Ga0496105_0004564
3732 Ga0496105_0020712
3733 Ga0496105_0206979
3734 Ga0496105_0221711
3735 Ga0496106_0013980
3736 Ga0496106_0020151
3737 Ga0496106_0031117
3738 Ga0496107_0000964
3739 Ga0496107_0047674
3740 Ga0496107_0073282
3741 Ga0496107_0106102
3742 Ga0496107_0153008
3743 Ga0496108_0002874
3744 Ga0496108_0018180
3745 Ga0496108_0018765
3746 Ga0496108_0039332
3747 Ga0496108_0041216
3748 Ga0496108_0110108
3749 Ga0496108_0181253
3750 Ga0496108_0183314
3751 Ga0496109_0000518
3752 Ga0496109_0009418
3753 Ga0496109_0012751
3754 Ga0496109_0019059
3755 Ga0496109_0024078
3756 Ga0496109_0027123
3757 Ga0496109_0070950
3758 Ga0496109_0116400
3759 Ga0496109_0251306
3760 Ga0496109_0270655
3761 Ga0496109_0346469
3762 Ga0496110_0001009
3763 Ga0496110_0025610
3764 Ga0496110_0040751
3765 Ga0496110_0168266
3766 Ga0496111_0035018
3767 Ga0496111_0119557
3768 Ga0496111_0156344
3769 Ga0496111_0255744
3770 Ga0496112_0000047
3771 Ga0496112_0018432
3772 Ga0496112_0023223
3773 Ga0496112_0049360
3774 Ga0496112_0050094
3775 Ga0496112_0051573
3776 Ga0496112_0061091
3777 Ga0496112_0061243
3778 Ga0496112_0070213
3779 Ga0496112_0302638
3780 Ga0496113_0016753
3781 Ga0496113_0018957
3782 Ga0496113_0065338
3783 Ga0496113_0075614
3784 Ga0496113_0152959
3785 Ga0496113_0160607
3786 Ga0496113_0163242
3787 Ga0496114_0063260
3788 Ga0496114_0119326
3789 Ga0496115_0001671
3790 Ga0496115_0007121
3791 Ga0496115_0037529
3792 Ga0496115_0042136
3793 Ga0496115_0056597
3794 Ga0496115_0148298
3795 Ga0496121_0002196
3796 Ga0496121_0003067
3797 Ga0496126_0040052
3798 Ga0501308_001422
3799 Ga0501291_009303
3800 Ga0501292_000099
3801 Ga0501293_000646
3802 Ga0501294_000377
3803 Ga0501297_006292
3804 Ga0501300_001419
3805 Ga0501302_000215
3806 Ga0501303_000203
3807 Ga0501031_0038091
3808 Ga0501031_0138467
3809 Ga0501032_0001580
3810 Ga0501032_0020821
3811 Ga0501032_0037464
3812 Ga0501032_0056579
3813 Ga0501033_0000013
3814 Ga0501034_0000208
3815 Ga0501034_0002673
3816 Ga0501034_0024772
3817 Ga0501034_0032099
3818 Ga0501034_0035297
3819 Ga0501034_0057403
3820 Ga0501034_0095353
3821 Ga0501034_0351804
3822 Ga0501034_0395891
3823 Ga0501036_0005563
3824 Ga0501036_0060890
3825 Ga0501036_0078279
3826 Ga0501036_0105762
3827 Ga0501036_0144838
3828 Ga0501036_0159884
3829 Ga0501036_0168217
3830 Ga0501037_0077015
3831 Ga0501037_0272967
3832 Ga0501038_0000212
3833 Ga0501038_0038476
3834 Ga0501038_0041934
3835 Ga0501038_0062611
3836 Ga0501038_0108450
3837 Ga0501038_0303172
3838 Ga0501039_0000072
3839 Ga0501039_0001156
3840 Ga0501039_0001269
3841 Ga0501039_0131020
3842 Ga0501039_0164694
3843 Ga0501039_0171729
3844 Ga0501039_0212676
3845 Ga0501039_0222609
3846 Ga0501039_0288359
3847 Ga0501040_0006079
3848 Ga0501040_0018714
3849 Ga0501040_0048495
3850 Ga0501040_0100972
3851 Ga0501040_0139595
3852 Ga0501041_0047400
3853 Ga0501041_0134161
3854 Ga0501042_0003193
3855 Ga0501042_0013582
3856 Ga0501042_0022117
3857 Ga0501042_0102590
3858 Ga0501042_0111497
3859 Ga0501042_0250921
3860 Ga0501043_0047927
3861 Ga0501046_0001060
3862 Ga0501046_0006019
3863 Ga0501046_0014835
3864 Ga0501046_0019160
3865 Ga0501046_0022425
3866 Ga0501046_0078669
3867 Ga0501046_0094723
3868 Ga0501047_0000235
3869 Ga0501047_0001212
3870 Ga0501047_0005869
3871 Ga0501047_0059552
3872 Ga0501047_0068651
3873 Ga0501048_0000501
3874 Ga0501048_0006738
3875 Ga0501048_0016001
3876 Ga0501048_0020369
3877 Ga0501048_0130259
3878 Ga0501048_0155930
3879 Ga0501048_0205546
3880 Ga0501067_0001590
3881 Ga0501067_0012802
3882 Ga0501067_0018310
3883 Ga0501067_0037014
3884 Ga0501067_0054271
3885 Ga0501067_0054439
3886 Ga0501067_0086970
3887 Ga0501068_0003501
3888 Ga0501068_0029846
3889 Ga0501068_0106078
3890 Ga0501069_0026314
3891 Ga0501069_0138060
3892 Ga0501069_0141669
3893 Ga0501069_0155621
3894 Ga0501070_0004020
3895 Ga0501070_0016965
3896 Ga0501070_0060711
3897 Ga0501071_0042773
3898 Ga0501071_0086964
3899 Ga0501071_0193098
3900 Ga0501071_0199519
3901 Ga0501071_0289925
3902 Ga0501072_0005670
3903 Ga0501072_0040546
3904 Ga0501072_0160162
3905 Ga0501072_0161704
3906 Ga0501072_0193359
3907 Ga0501072_0285120
3908 Ga0501073_0028073
3909 Ga0501073_0105941
3910 Ga0501073_0146428
3911 Ga0501074_0010949
3912 Ga0501074_0144720
3913 Ga0501075_0013901
3914 Ga0501075_0065131
3915 Ga0501075_0083379
3916 Ga0501075_0089183
3917 Ga0501075_0137758
3918 Ga0501075_0155558
3919 Ga0501075_0188194
3920 Ga0501076_0023202
3921 Ga0501076_0039204
3922 Ga0501076_0073626
3923 Ga0501076_0079492
3924 Ga0501076_0115786
3925 Ga0501076_0120432
3926 Ga0501076_0121280
3927 Ga0501076_0129409
3928 Ga0501076_0141391
3929 Ga0501076_0251755
3930 Ga0501076_0251920
3931 Ga0501077_0031283
3932 Ga0501077_0057632
3933 Ga0501077_0082358
3934 Ga0501077_0112695
3935 Ga0501077_0118636
3936 Ga0501077_0127280
3937 Ga0501077_0190947
3938 Ga0501077_0199970
3939 Ga0501198_000368
3940 Ga0501199_001333
3941 Ga0501206_000344
3942 Ga0501207_001334
3943 Ga0501208_000919
3944 Ga0501211_001971
3945 Ga0501217_027815
3946 Ga0501223_010696
3947 Ga0501227_002932
3948 Ga0501228_000191
3949 Ga0501230_000123
3950 Ga0501238_002198
3951 Ga0501239_000520
3952 Ga0501240_007700
3953 Ga0501246_001971
3954 Ga0501248_000546
3955 Ga0501249_022446
3956 Ga0501251_000031
3957 Ga0501252_005815
3958 Ga0501253_000193
3959 Ga0501255_004416
3960 Ga0501256_000081
3961 Ga0501257_013729
3962 Ga0501258_000070
3963 Ga0501261_000363
3964 Ga0501221_000136
3965 Ga0501225_0000149
3966 Ga0501225_0028573
3967 Ga0501229_000082
3968 Ga0501245_010629
3969 Ga0501079_0074707
3970 Ga0501079_0097101
3971 Ga0501079_0122450
3972 Ga0501079_0148612
3973 Ga0501079_0155907
3974 Ga0501079_0172008
3975 Ga0501079_0195009
3976 Ga0501079_0198243
3977 Ga0501079_0243130
3978 Ga0501079_0255552
3979 Ga0501080_0000005
3980 Ga0501080_0013007
3981 Ga0501080_0045341
3982 Ga0501080_0051985
3983 Ga0501080_0060529
3984 Ga0501080_0081520
3985 Ga0501080_0133051
3986 Ga0501080_0133128
3987 Ga0501080_0138462
3988 Ga0501081_0000419
3989 Ga0501081_0024655
3990 Ga0501081_0032063
3991 Ga0501081_0089729
3992 Ga0501081_0103607
3993 Ga0501081_0270779
3994 Ga0501241_003890
3995 Ga0501262_002660
3996 Ga0501263_003193
3997 Ga0501265_000713
3998 Ga0501268_002568
3999 Ga0501269_004855
4000 Ga0501271_000769
4001 Ga0501273_003810
4002 Ga0501275_000495
4003 Ga0501276_001067
4004 Ga0501278_000188
4005 Ga0501280_000659
4006 Ga0501281_00945
4007 Ga0501283_006667
4008 Ga0501283_008288
4009 Ga0501035_0000049
4010 Ga0501035_0012246
4011 Ga0501035_0019292
4012 Ga0501035_0071258
4013 Ga0501035_0085598
4014 Ga0501035_0109032
4015 Ga0501044_0000030
4016 Ga0501044_0000222
4017 Ga0501044_0038683
4018 Ga0501044_0073422
4019 Ga0501045_0064837
4020 Ga0501045_0070030
4021 Ga0501045_0071503
4022 Ga0501045_0079394
4023 Ga0501045_0079903
4024 Ga0501045_0104129
4025 Ga0501045_0113403
4026 Ga0501045_0148251
4027 Ga0501045_0167482
4028 Ga0501212_000067
4029 Ga0501226_000129
4030 nmdc:mga03683_18960_c1
4031 nmdc:mga03683_429_c1
4032 nmdc:mga03683_52353_c1
4033 nmdc:mga00v17_201903_c1
4034 nmdc:mga0yw44_93780_c1
4035 nmdc:mga0k408_18213_c1
4036 nmdc:mga0k408_27225_c1
4037 nmdc:mga0k408_4095_c1
4038 nmdc:mga0k408_50045_c1
4039 nmdc:mga07m45_11904_c1
4040 nmdc:mga05p37_119087_c1
4041 nmdc:mga05p37_12453_c1
4042 nmdc:mga05p37_125066_c1
4043 nmdc:mga05p37_129158_c1
4044 nmdc:mga05p37_15056_c1
4045 nmdc:mga05p37_1773_c1
4046 nmdc:mga05p37_180664_c1
4047 nmdc:mga05p37_19612_c1
4048 nmdc:mga05p37_210322_c1
4049 nmdc:mga05p37_213294_c1
4050 nmdc:mga05p37_235738_c1
4051 nmdc:mga05p37_2437_c1
4052 nmdc:mga05p37_2645_c1
4053 nmdc:mga05p37_2754_c1
4054 nmdc:mga05p37_36180_c1
4055 nmdc:mga05p37_38754_c1
4056 nmdc:mga05p37_422974_c1
4057 nmdc:mga05p37_4273_c1
4058 nmdc:mga05p37_459650_c1
4059 nmdc:mga05p37_49398_c1
4060 nmdc:mga05p37_544344_c1
4061 nmdc:mga05p37_548375_c1
4062 nmdc:mga05p37_568608_c1
4063 nmdc:mga05p37_60272_c1
4064 nmdc:mga05p37_64836_c1
4065 nmdc:mga05p37_66256_c1
4066 nmdc:mga05p37_94703_c1
4067 nmdc:mga05p37_96138_c1
4068 nmdc:mga09592_129009_c1
4069 nmdc:mga09592_1370_c1
4070 nmdc:mga09592_170261_c1
4071 nmdc:mga09592_177703_c1
4072 nmdc:mga09592_192404_c1
4073 nmdc:mga09592_2394_c1
4074 nmdc:mga09592_252820_c1
4075 nmdc:mga09592_40151_c1
4076 nmdc:mga09592_46677_c1
4077 nmdc:mga09592_65529_c1
4078 nmdc:mga09592_7464_c1
4079 nmdc:mga0qj67_108914_c1
4080 nmdc:mga0qj67_111484_c1
4081 nmdc:mga0qj67_15872_c1
4082 nmdc:mga0qj67_18360_c1
4083 nmdc:mga0qj67_220862_c1
4084 nmdc:mga0qj67_22931_c1
4085 nmdc:mga0qj67_23583_c1
4086 nmdc:mga0qj67_24513_c1
4087 nmdc:mga0qj67_2465_c1
4088 nmdc:mga0qj67_25617_c1
4089 nmdc:mga0qj67_32040_c1
4090 nmdc:mga0qj67_42067_c1
4091 nmdc:mga0qj67_53256_c1
4092 nmdc:mga0qj67_630_c1
4093 nmdc:mga0qj67_65307_c1
4094 nmdc:mga06r32_102584_c1
4095 nmdc:mga06r32_11036_c1
4096 nmdc:mga06r32_1300_c1
4097 nmdc:mga06r32_145834_c1
4098 nmdc:mga06r32_194953_c1
4099 nmdc:mga06r32_208220_c1
4100 nmdc:mga06r32_212712_c1
4101 nmdc:mga06r32_26386_c1
4102 nmdc:mga06r32_29260_c1
4103 nmdc:mga06r32_36320_c1
4104 nmdc:mga06r32_37302_c1
4105 nmdc:mga06r32_638_c1
4106 nmdc:mga06r32_66201_c1
4107 nmdc:mga06r32_8250_c1
4108 nmdc:mga06r32_85977_c1
4109 nmdc:mga06r32_89288_c1
4110 nmdc:mga06r32_89403_c1
4111 nmdc:mga06r32_95660_c1
4112 nmdc:mga08y16_1022_c1
4113 nmdc:mga08y16_1323_c1
4114 nmdc:mga08y16_15702_c1
4115 nmdc:mga08y16_16100_c1
4116 nmdc:mga08y16_292599_c1
4117 nmdc:mga08y16_296_c1
4118 nmdc:mga08y16_304248_c1
4119 nmdc:mga08y16_42140_c1
4120 nmdc:mga08y16_549_c1
4121 nmdc:mga08y16_75541_c1
4122 nmdc:mga08y16_76045_c1
4123 nmdc:mga0n895_10725_c1
4124 nmdc:mga0n895_14066_c1
4125 nmdc:mga0n895_14488_c1
4126 nmdc:mga0n895_155153_c1
4127 nmdc:mga0n895_24922_c1
4128 nmdc:mga0n895_257540_c1
4129 nmdc:mga0n895_283_c1
4130 nmdc:mga0n895_313932_c1
4131 nmdc:mga0n895_402289_c1
4132 nmdc:mga0n895_508839_c1
4133 nmdc:mga0n895_662409_c1
4134 nmdc:mga0n895_8378_c1
4135 nmdc:mga0n895_87742_c1
4136 nmdc:mga0rr50_101579_c1
4137 nmdc:mga0rr50_187395_c1
4138 nmdc:mga0rr50_23493_c1
4139 nmdc:mga0rr50_263993_c1
4140 nmdc:mga0rr50_31921_c1
4141 nmdc:mga0rr50_40686_c1
4142 nmdc:mga0rr50_48387_c1
4143 nmdc:mga0rr50_58209_c1
4144 nmdc:mga0rr50_66150_c1
4145 nmdc:mga0rr50_70345_c1
4146 nmdc:mga0rr50_96239_c1
4147 nmdc:mga08x19_115351_c1
4148 nmdc:mga08x19_130065_c1
4149 nmdc:mga08x19_19796_c1
4150 nmdc:mga08x19_239060_c1
4151 nmdc:mga08x19_68418_c1
4152 nmdc:mga08x19_96494_c1
4153 nmdc:mga0a205_135421_c1
4154 nmdc:mga0a205_14811_c1
4155 nmdc:mga0a205_163229_c1
4156 nmdc:mga0a205_194670_c1
4157 nmdc:mga0a205_195858_c1
4158 nmdc:mga0a205_208182_c1
4159 nmdc:mga0a205_23945_c1
4160 nmdc:mga0a205_2463_c1
4161 nmdc:mga0a205_2479_c1
4162 nmdc:mga0a205_312773_c1
4163 nmdc:mga0a205_387_c1
4164 nmdc:mga0a205_5469_c1
4165 nmdc:mga0a205_68067_c1
4166 nmdc:mga0a205_8273_c1
4167 nmdc:mga0a205_96842_c1
4168 Ga0495601_0001193
4169 Ga0495601_0002682
4170 Ga0495601_0005148
4171 Ga0495601_0026408
4172 Ga0495601_0051000
4173 Ga0495601_0144334
4174 Ga0495612_0000272
4175 Ga0495612_0001186
4176 Ga0495612_0002689
4177 Ga0495612_0033867
4178 Ga0495595_0001637
4179 Ga0495595_0011179
4180 Ga0495595_0018090
4181 Ga0495619_0002351
4182 Ga0495619_0027494
4183 Ga0495619_0041602
4184 Ga0495619_0046149
4185 Ga0495619_0059772
4186 Ga0495619_0121031
4187 Ga0495619_0163807
4188 Ga0495619_0184991
4189 Ga0500566_0042381
4190 Ga0500641_0069441
4191 Ga0500555_000080
4192 Ga0500556_0000010
4193 Ga0500642_0027843
4194 Ga0500616_0008552
4195 Ga0500639_000165
4196 Ga0500637_0002795
4197 Ga0501084_0004756
4198 Ga0501084_0058084
4199 Ga0501084_0090898
4200 Ga0501084_0092931
4201 Ga0501084_0122785
4202 Ga0501084_0158687
4203 Ga0501084_0161711
4204 Ga0501084_0163516
4205 Ga0501084_0182026
4206 Ga0501084_0202926
4207 Ga0501084_0360478
4208 Ga0590071_017277
4209 Ga0590075_004418
4210 Ga0587084_002785
4211 Ga0587066_006000
4212 Ga0587066_010524
4213 Ga0587070_006486
4214 Ga0587073_0008387
4215 Ga0587073_0011099
4216 Ga0587077_002191
4217 Ga0587080_002077
4218 Ga0587082_002150
4219 Ga0587082_005840
4220 Ga0587083_0009205
4221 Ga0587088_005803
4222 Ga0587090_001583
4223 Ga0587090_005804
4224 Ga0587091_001928
4225 Ga0587101_005388
4226 Ga0587067_007675
4227 Ga0587068_002101
4228 Ga0587068_007185
4229 Ga0587069_001180
4230 Ga0587072_007679
4231 Ga0587075_004270
4232 Ga0587076_006638
4233 Ga0587078_003195
4234 Ga0587079_007334
4235 Ga0587071_008168
4236 Ga0501082_0042649
4237 Ga0501082_0050059
4238 Ga0501082_0057195
4239 Ga0501082_0089615
4240 Ga0501082_0109383
4241 Ga0501082_0196250
4242 Ga0501082_0205918
4243 Ga0501082_0307130
4244 Ga0530510_0015805
4245 Ga0530510_0019238
4246 Ga0530510_0045499
4247 Ga0530510_0111613
4248 Ga0530510_0193098
4249 2513658386
4250 2513695943
4251 2513857538
4252 2513920122
4253 2517893491
4254 2524537996
4255 2524539164
4256 2601445477
4257 2671118129
4258 2671122206
4259 2723846175
4260 2728747746
4261 2728752494
4262 2793071752
4263 2793076655
4264 2848298226
4265 2874610915
4266 2876810428
4267 2879110528
4268 2883294839
4269 2883294852
4270 2889041124
4271 2903758269
4272 2904696889
4273 2904701652
4274 2906642791
4275 2906665926
4276 2908761465
4277 2922361971
4278 2922392023
4279 2922428985
4280 2935637752
4281 2941514425
4282 2941522321
4283 2941530160
4284 3005479130
4285 8002061395
4286 8002061906
4287 8006934630
4288 8006942218
4289 8006964529
4290 8006974600
4291 8006981952
4292 8006986852
4293 8006996071
4294 8019564041
4295 8019567346
4296 8019574117
4297 8056680461
4298 8056691226

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03143

GTP_EFTU_D3

Elongation factor Tu C-terminal domain

344

439

0.98

PF03144

GTP_EFTU_D2

Elongation factor Tu domain 2

271

340

0.97

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

50

248

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i4q-assembly1.cif.gz_C-2 contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.9737 201 386
5i4q-assembly1.cif.gz_C-2 contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.9686 201 386
2bvn-assembly2.cif.gz_B e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia 0.9199 7 386
6wd7-assembly1.cif.gz_8 cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure ii-d) 0.9193 291 385
6wd9-assembly1.cif.gz_8 cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) 0.9189 10 385
ID Description Score Start End Superfamily
2y12Z02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9842 199 288 2.40.30.10
5w7qA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9821 199 292 2.40.30.10
af_G5ECM6_248_343_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9808 199 289 2.40.30.10
4h9gA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9789 292 385 2.40.30.10
af_Q7K3V6_252_380_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9786 199 319 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A2P7P1A2-F1-model_v4 deleted 1.006 206 288
AF-A0A3S0V9N4-F1-model_v4 Elongation factor Tu 1.002 280 386 GO:0003746
GO:0005525
AF-A0A352F424-F1-model_v4 Elongation factor Tu (EC 3.6.5.3) 1.001 294 386 GO:0003746
GO:0005525
GO:0005829
GO:0016787
AF-A0A3D0F3T6-F1-model_v4 Elongation factor Tu (EC 3.6.5.3) 1.001 294 386 GO:0003746
GO:0005525
GO:0005829
GO:0016787
AF-A0A1V5ZE31-F1-model_v4 Elongation factor Tu 1.001 304 386 GO:0003746
GO:0005525

Map