F496473
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2151 | 637 | 4298 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10197313|Ga0157372_101973132 |
| Length | 440 |
| Sequence | MGAQGTAQPQLQEGSAAEVGQRALVTFRASILLRAGIDSGMAKAKFDRTKPHVNVGTIGHVDHGKTTTTAALTKVSSDKGWGTKYISYDEVAKASASQGRRDATKILTIATSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAMDGPMPQTREHILLARQVNVPRIVVFLNKCDMVDDPELLDLVELEVRELLSVYGFPGDETPVIRGSATGAISGDPAWIAKIEELYAALDTYIPEPVREKDQPFLMPVEDVFSITGRGTVATGRIDRGVVKVGEEVAVVGFSSDKKTIVTGVEMFRKLLDAGEAGDNVGLLLRGIAKDEIERGMVLAKPGTITPHTRFEAEVYVLTKEEGGRHTPFFKGYRPQFYFRTTDVTGSVELPEGMEMVMPGDNVQMTIELITPIAMEEQLRFAIREGGRTVGAGVVTKILK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 11 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 12 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 13 | 3300003392 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM | Metagenome | Rhizosphere |
| 14 | 3300003397 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM | Metagenome | Rhizosphere |
| 15 | 3300003405 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM | Metagenome | Rhizosphere |
| 16 | 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Metagenome | Rhizosphere |
| 17 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 157 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 161 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 165 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 257 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 258 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 263 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 264 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 266 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 267 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 268 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 269 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 271 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 272 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 276 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 279 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 280 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 281 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 282 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 283 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 285 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 286 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 287 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 288 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 289 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 290 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 291 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 293 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 294 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 299 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 300 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 301 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 302 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 303 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 304 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 305 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 306 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 307 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 308 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 312 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 314 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 315 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 316 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 318 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 319 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 320 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 322 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 323 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 325 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 326 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 327 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 328 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 329 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 330 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 331 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 332 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 333 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 334 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 335 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 336 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 337 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 338 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 339 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 340 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 341 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 342 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 343 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 344 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 345 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 346 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 347 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 348 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 349 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 350 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 351 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 352 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 353 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 354 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 355 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 356 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 357 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 358 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 359 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 360 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 361 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 362 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 363 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 364 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 365 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 366 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 367 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 368 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 369 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 370 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 371 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 372 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 373 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 374 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 375 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 376 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 377 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 378 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 379 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 380 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 443 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 444 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 445 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 446 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 447 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 448 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 451 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 452 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 453 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 454 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 455 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 456 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 457 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 458 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 460 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 461 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 462 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 463 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 464 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 465 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 466 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 467 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 494 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 495 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 496 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 497 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 498 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 499 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 500 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 501 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 502 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 503 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 504 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 505 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 506 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 507 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 508 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 509 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 510 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 511 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 512 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 513 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 514 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 515 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 516 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 517 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 518 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 519 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 520 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 521 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 522 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 526 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 527 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 528 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 529 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 530 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 531 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 532 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 533 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 534 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 535 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 536 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 537 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 538 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 539 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 543 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 544 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 545 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 546 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 547 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 548 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 549 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 563 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 564 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 565 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 566 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 567 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 568 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 569 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 570 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 571 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 572 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 573 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 579 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 580 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 596 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 597 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 598 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 599 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 600 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 601 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 602 | 2600255229 | Lactobacillus acidophilus A 16 | Isolate | Rhizosphere |
| 603 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 604 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 605 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 606 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 607 | 2791355199 | |||
| 608 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 609 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 610 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 611 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 612 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 613 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 614 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 615 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 616 | 2904699407 | |||
| 617 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 618 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 619 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 620 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 621 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 622 | 2922425934 | |||
| 623 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 624 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 625 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 626 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 627 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 628 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 629 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 630 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 631 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 632 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 633 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 634 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 635 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 636 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 637 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.25 |
| Metatranscriptomes | 2.56 |
| Isolates | 2.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.63 |
| Nodule | 1.67 |
| Rhizoplane | 4.28 |
| Rhizosphere | 90.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10197313 | 3300013307 | Bacteria | 2331 |
| 2 | SwRhRL2b_contig_1298163 | 2162886007 | Bacteria | 1893 |
| 3 | JGI24746J21847_1008028 | 3300001977 | Bacteria | 1601 |
| 4 | JGI24737J22298_10024194 | 3300001990 | Bacteria | 1923 |
| 5 | JGI24750J21931_1000315 | 3300002070 | Bacteria | 8295 |
| 6 | JGI24034J26672_10002296 | 3300002239 | Bacteria | 2617 |
| 7 | JGI24742J22300_10007414 | 3300002244 | Bacteria | 1809 |
| 8 | JGI24742J22300_10010336 | 3300002244 | Bacteria | 1545 |
| 9 | JGI24751J29686_10023018 | 3300002459 | Bacteria | 1292 |
| 10 | JGI25406J46586_10022422 | 3300003203 | Bacteria | 2516 |
| 11 | JGI26128J50194_1001392 | 3300003347 | Bacteria | 1531 |
| 12 | JGI26129J50193_1000031 | 3300003349 | Bacteria | 7957 |
| 13 | JGI26145J50221_1000624 | 3300003371 | Bacteria | 2985 |
| 14 | JGI26134J50242_100275 | 3300003392 | Bacteria | 2298 |
| 15 | JGI26133J50247_100062 | 3300003397 | Bacteria | 2219 |
| 16 | JGI26132J50249_100231 | 3300003405 | Bacteria | 1518 |
| 17 | JGI26143J51219_1000496 | 3300003502 | Bacteria | 1534 |
| 18 | JGI26141J51220_1001165 | 3300003503 | Bacteria | 1575 |
| 19 | JGI25405J52794_10001096 | 3300003911 | Bacteria | 4330 |
| 20 | JGI25405J52794_10018929 | 3300003911 | Bacteria | 1377 |
| 21 | Ga0058863_10074882 | 3300004799 | Bacteria | 2266 |
| 22 | Ga0058863_10078133 | 3300004799 | Bacteria | 3576 |
| 23 | Ga0058863_11936457 | 3300004799 | Bacteria | 1902 |
| 24 | Ga0058861_10030509 | 3300004800 | Bacteria | 1791 |
| 25 | Ga0058861_10159963 | 3300004800 | Bacteria | 3320 |
| 26 | Ga0058861_12046052 | 3300004800 | Bacteria | 1357 |
| 27 | Ga0058862_12356670 | 3300004803 | Bacteria | 2894 |
| 28 | Ga0058862_12636649 | 3300004803 | Bacteria | 2075 |
| 29 | Ga0058862_12778063 | 3300004803 | Bacteria | 2673 |
| 30 | Ga0065704_10085384 | 3300005289 | Bacteria | 3228 |
| 31 | Ga0065704_10117584 | 3300005289 | Bacteria | 1831 |
| 32 | Ga0065715_10121960 | 3300005293 | Bacteria | 2213 |
| 33 | Ga0065707_10002120 | 3300005295 | Bacteria | 4994 |
| 34 | Ga0065707_10013752 | 3300005295 | Bacteria | 1669 |
| 35 | Ga0065707_10084753 | 3300005295 | Bacteria | 6807 |
| 36 | Ga0065707_10087315 | 3300005295 | Bacteria | 5079 |
| 37 | Ga0065707_10136871 | 3300005295 | Bacteria | 1827 |
| 38 | Ga0070658_10003484 | 3300005327 | Bacteria | 12924 |
| 39 | Ga0070658_10005421 | 3300005327 | Bacteria | 10350 |
| 40 | Ga0070658_10090607 | 3300005327 | Bacteria | 2519 |
| 41 | Ga0070676_10000852 | 3300005328 | Bacteria | 15089 |
| 42 | Ga0070676_10000896 | 3300005328 | Bacteria | 14732 |
| 43 | Ga0070676_10029802 | 3300005328 | Bacteria | 3106 |
| 44 | Ga0070676_10116078 | 3300005328 | Bacteria | 1674 |
| 45 | Ga0070676_10136272 | 3300005328 | Bacteria | 1558 |
| 46 | Ga0070683_100014149 | 3300005329 | Bacteria | 6970 |
| 47 | Ga0070683_100019046 | 3300005329 | Bacteria | 6090 |
| 48 | Ga0070683_100111556 | 3300005329 | Bacteria | 2580 |
| 49 | Ga0070683_100196719 | 3300005329 | Bacteria | 1914 |
| 50 | Ga0070690_100013884 | 3300005330 | Bacteria | 4774 |
| 51 | Ga0070690_100078403 | 3300005330 | Bacteria | 2158 |
| 52 | Ga0070690_100150078 | 3300005330 | Bacteria | 1589 |
| 53 | Ga0070670_100003642 | 3300005331 | Bacteria | 12830 |
| 54 | Ga0070670_100016207 | 3300005331 | Bacteria | 6398 |
| 55 | Ga0070670_100046278 | 3300005331 | Bacteria | 3741 |
| 56 | Ga0070670_100046292 | 3300005331 | Bacteria | 3740 |
| 57 | Ga0070670_100062871 | 3300005331 | Bacteria | 3186 |
| 58 | Ga0070670_100202418 | 3300005331 | Bacteria | 1725 |
| 59 | Ga0070677_10003182 | 3300005333 | Bacteria | 5282 |
| 60 | Ga0070677_10031276 | 3300005333 | Bacteria | 2033 |
| 61 | Ga0068869_100006678 | 3300005334 | Bacteria | 7327 |
| 62 | Ga0068869_100017207 | 3300005334 | Bacteria | 4895 |
| 63 | Ga0068869_100128651 | 3300005334 | Bacteria | 1944 |
| 64 | Ga0068869_100176193 | 3300005334 | Bacteria | 1674 |
| 65 | Ga0070666_10032094 | 3300005335 | Bacteria | 3469 |
| 66 | Ga0070680_100003246 | 3300005336 | Bacteria | 12104 |
| 67 | Ga0070680_100003723 | 3300005336 | Bacteria | 11390 |
| 68 | Ga0070680_100004063 | 3300005336 | Bacteria | 10956 |
| 69 | Ga0070680_100013921 | 3300005336 | Bacteria | 6276 |
| 70 | Ga0070680_100023192 | 3300005336 | Bacteria | 4947 |
| 71 | Ga0070680_100027839 | 3300005336 | Bacteria | 4529 |
| 72 | Ga0070680_100076391 | 3300005336 | Bacteria | 2757 |
| 73 | Ga0070682_100017497 | 3300005337 | Bacteria | 4180 |
| 74 | Ga0070682_100030502 | 3300005337 | Bacteria | 3255 |
| 75 | Ga0068868_100001296 | 3300005338 | Bacteria | 17217 |
| 76 | Ga0068868_100029640 | 3300005338 | Bacteria | 4192 |
| 77 | Ga0068868_100206860 | 3300005338 | Bacteria | 1638 |
| 78 | Ga0070660_100037805 | 3300005339 | Bacteria | 3660 |
| 79 | Ga0070660_100075828 | 3300005339 | Bacteria | 2633 |
| 80 | Ga0070660_100102672 | 3300005339 | Bacteria | 2267 |
| 81 | Ga0070660_100139761 | 3300005339 | Bacteria | 1942 |
| 82 | Ga0070660_100166869 | 3300005339 | Bacteria | 1777 |
| 83 | Ga0070689_100006170 | 3300005340 | Bacteria | 8266 |
| 84 | Ga0070689_100009184 | 3300005340 | Bacteria | 6999 |
| 85 | Ga0070689_100032105 | 3300005340 | Bacteria | 3993 |
| 86 | Ga0070689_100042151 | 3300005340 | Bacteria | 3504 |
| 87 | Ga0070689_100051095 | 3300005340 | Bacteria | 3195 |
| 88 | Ga0070689_100067740 | 3300005340 | Bacteria | 2783 |
| 89 | Ga0070689_100096452 | 3300005340 | Bacteria | 2337 |
| 90 | Ga0070689_100172197 | 3300005340 | Bacteria | 1754 |
| 91 | Ga0070689_100219614 | 3300005340 | Bacteria | 1558 |
| 92 | Ga0070691_10003913 | 3300005341 | Bacteria | 6736 |
| 93 | Ga0070691_10020426 | 3300005341 | Bacteria | 3060 |
| 94 | Ga0070691_10089558 | 3300005341 | Bacteria | 1515 |
| 95 | Ga0070687_100004595 | 3300005343 | Bacteria | 5516 |
| 96 | Ga0070687_100008671 | 3300005343 | Bacteria | 4316 |
| 97 | Ga0070687_100014797 | 3300005343 | Bacteria | 3513 |
| 98 | Ga0070687_100051544 | 3300005343 | Bacteria | 2131 |
| 99 | Ga0070687_100060107 | 3300005343 | Bacteria | 2003 |
| 100 | Ga0070661_100016310 | 3300005344 | Bacteria | 5251 |
| 101 | Ga0070661_100042876 | 3300005344 | Bacteria | 3304 |
| 102 | Ga0070661_100055375 | 3300005344 | Bacteria | 2904 |
| 103 | Ga0070692_10013859 | 3300005345 | Bacteria | 3768 |
| 104 | Ga0070692_10016750 | 3300005345 | Bacteria | 3491 |
| 105 | Ga0070692_10027186 | 3300005345 | Bacteria | 2833 |
| 106 | Ga0070668_100008383 | 3300005347 | Bacteria | 7675 |
| 107 | Ga0070668_100017094 | 3300005347 | Bacteria | 5428 |
| 108 | Ga0070668_100021697 | 3300005347 | Bacteria | 4851 |
| 109 | Ga0070668_100035029 | 3300005347 | Bacteria | 3826 |
| 110 | Ga0070668_100047647 | 3300005347 | Bacteria | 3295 |
| 111 | Ga0070668_100246401 | 3300005347 | Bacteria | 1482 |
| 112 | Ga0070669_100001998 | 3300005353 | Bacteria | 14758 |
| 113 | Ga0070669_100013454 | 3300005353 | Bacteria | 5816 |
| 114 | Ga0070669_100062002 | 3300005353 | Bacteria | 2748 |
| 115 | Ga0070669_100066784 | 3300005353 | Bacteria | 2652 |
| 116 | Ga0070675_100006526 | 3300005354 | Bacteria | 8963 |
| 117 | Ga0070675_100018790 | 3300005354 | Bacteria | 5502 |
| 118 | Ga0070675_100031007 | 3300005354 | Bacteria | 4319 |
| 119 | Ga0070675_100074752 | 3300005354 | Bacteria | 2816 |
| 120 | Ga0070675_100085083 | 3300005354 | Bacteria | 2642 |
| 121 | Ga0070675_100096991 | 3300005354 | Bacteria | 2478 |
| 122 | Ga0070675_100146178 | 3300005354 | Bacteria | 2024 |
| 123 | Ga0070671_100079316 | 3300005355 | Bacteria | 2744 |
| 124 | Ga0070671_100255325 | 3300005355 | Bacteria | 1489 |
| 125 | Ga0070674_100001606 | 3300005356 | Bacteria | 12131 |
| 126 | Ga0070674_100016846 | 3300005356 | Bacteria | 4585 |
| 127 | Ga0070674_100030757 | 3300005356 | Bacteria | 3551 |
| 128 | Ga0070674_100046250 | 3300005356 | Bacteria | 2976 |
| 129 | Ga0070674_100142411 | 3300005356 | Bacteria | 1801 |
| 130 | Ga0070673_100006677 | 3300005364 | Bacteria | 7523 |
| 131 | Ga0070673_100026334 | 3300005364 | Bacteria | 4294 |
| 132 | Ga0070673_100113997 | 3300005364 | Bacteria | 2245 |
| 133 | Ga0070673_100189528 | 3300005364 | Bacteria | 1765 |
| 134 | Ga0070688_100007379 | 3300005365 | Bacteria | 5923 |
| 135 | Ga0070688_100041679 | 3300005365 | Bacteria | 2819 |
| 136 | Ga0070688_100065254 | 3300005365 | Bacteria | 2313 |
| 137 | Ga0070688_100096758 | 3300005365 | Bacteria | 1939 |
| 138 | Ga0070659_100002785 | 3300005366 | Bacteria | 12441 |
| 139 | Ga0070659_100019303 | 3300005366 | Bacteria | 5163 |
| 140 | Ga0070659_100055980 | 3300005366 | Bacteria | 3109 |
| 141 | Ga0070667_100055123 | 3300005367 | Bacteria | 3357 |
| 142 | Ga0070667_100147072 | 3300005367 | Bacteria | 2067 |
| 143 | Ga0070667_100328861 | 3300005367 | Bacteria | 1380 |
| 144 | Ga0070703_10040799 | 3300005406 | Bacteria | 1445 |
| 145 | Ga0070709_10002316 | 3300005434 | Bacteria | 10332 |
| 146 | Ga0070709_10002621 | 3300005434 | Bacteria | 9712 |
| 147 | Ga0070709_10008272 | 3300005434 | Bacteria | 5713 |
| 148 | Ga0070709_10012009 | 3300005434 | Bacteria | 4842 |
| 149 | Ga0070709_10016990 | 3300005434 | Bacteria | 4166 |
| 150 | Ga0070709_10108541 | 3300005434 | Bacteria | 1862 |
| 151 | Ga0070709_10204897 | 3300005434 | Bacteria | 1399 |
| 152 | Ga0070714_100004755 | 3300005435 | Bacteria | 10280 |
| 153 | Ga0070714_100055490 | 3300005435 | Bacteria | 3386 |
| 154 | Ga0070714_100168597 | 3300005435 | Bacteria | 1986 |
| 155 | Ga0070714_100268807 | 3300005435 | Bacteria | 1581 |
| 156 | Ga0070713_100008004 | 3300005436 | Bacteria | 7470 |
| 157 | Ga0070713_100022673 | 3300005436 | Bacteria | 4856 |
| 158 | Ga0070713_100040073 | 3300005436 | Bacteria | 3806 |
| 159 | Ga0070710_10006065 | 3300005437 | Bacteria | 5779 |
| 160 | Ga0070710_10010819 | 3300005437 | Bacteria | 4489 |
| 161 | Ga0070710_10092907 | 3300005437 | Bacteria | 1783 |
| 162 | Ga0070701_10005417 | 3300005438 | Bacteria | 5267 |
| 163 | Ga0070701_10023488 | 3300005438 | Bacteria | 2970 |
| 164 | Ga0070711_100004283 | 3300005439 | Bacteria | 8396 |
| 165 | Ga0070711_100015384 | 3300005439 | Bacteria | 4842 |
| 166 | Ga0070711_100056462 | 3300005439 | Bacteria | 2715 |
| 167 | Ga0070711_100077038 | 3300005439 | Bacteria | 2365 |
| 168 | Ga0070705_100000175 | 3300005440 | Bacteria | 37567 |
| 169 | Ga0070705_100002479 | 3300005440 | Bacteria | 9276 |
| 170 | Ga0070705_100030070 | 3300005440 | Bacteria | 2995 |
| 171 | Ga0070705_100033592 | 3300005440 | Bacteria | 2860 |
| 172 | Ga0070705_100077350 | 3300005440 | Bacteria | 2032 |
| 173 | Ga0070705_100126283 | 3300005440 | Bacteria | 1661 |
| 174 | Ga0070700_100006909 | 3300005441 | Bacteria | 6095 |
| 175 | Ga0070700_100009943 | 3300005441 | Bacteria | 5235 |
| 176 | Ga0070700_100026867 | 3300005441 | Bacteria | 3405 |
| 177 | Ga0070700_100030535 | 3300005441 | Bacteria | 3221 |
| 178 | Ga0070700_100049208 | 3300005441 | Bacteria | 2616 |
| 179 | Ga0070700_100078943 | 3300005441 | Bacteria | 2120 |
| 180 | Ga0070700_100081059 | 3300005441 | Bacteria | 2095 |
| 181 | Ga0070694_100002980 | 3300005444 | Bacteria | 10062 |
| 182 | Ga0070694_100006648 | 3300005444 | Bacteria | 7024 |
| 183 | Ga0070694_100025235 | 3300005444 | Bacteria | 3844 |
| 184 | Ga0070694_100031890 | 3300005444 | Bacteria | 3457 |
| 185 | Ga0070694_100034838 | 3300005444 | Bacteria | 3323 |
| 186 | Ga0070694_100046376 | 3300005444 | Bacteria | 2917 |
| 187 | Ga0070694_100100295 | 3300005444 | Bacteria | 2048 |
| 188 | Ga0070694_100100423 | 3300005444 | Bacteria | 2046 |
| 189 | Ga0070694_100194307 | 3300005444 | Bacteria | 1509 |
| 190 | Ga0070694_100207796 | 3300005444 | Bacteria | 1463 |
| 191 | Ga0070708_100014393 | 3300005445 | Bacteria | 6507 |
| 192 | Ga0070708_100022190 | 3300005445 | Bacteria | 5382 |
| 193 | Ga0070708_100025481 | 3300005445 | Bacteria | 5056 |
| 194 | Ga0070708_100111985 | 3300005445 | Bacteria | 2509 |
| 195 | Ga0070708_100130593 | 3300005445 | Bacteria | 2324 |
| 196 | Ga0070708_100188023 | 3300005445 | Bacteria | 1931 |
| 197 | Ga0070708_100210303 | 3300005445 | Bacteria | 1822 |
| 198 | Ga0070708_100229002 | 3300005445 | Bacteria | 1744 |
| 199 | Ga0070708_100262798 | 3300005445 | Bacteria | 1623 |
| 200 | Ga0070708_100301947 | 3300005445 | Bacteria | 1507 |
| 201 | Ga0070663_100204481 | 3300005455 | Bacteria | 1543 |
| 202 | Ga0070678_100006525 | 3300005456 | Bacteria | 6852 |
| 203 | Ga0070678_100036552 | 3300005456 | Bacteria | 3439 |
| 204 | Ga0070678_100206605 | 3300005456 | Bacteria | 1624 |
| 205 | Ga0070678_100224962 | 3300005456 | Bacteria | 1561 |
| 206 | Ga0070662_100011148 | 3300005457 | Bacteria | 5922 |
| 207 | Ga0070662_100014975 | 3300005457 | Bacteria | 5187 |
| 208 | Ga0070662_100039023 | 3300005457 | Bacteria | 3376 |
| 209 | Ga0070662_100045356 | 3300005457 | Bacteria | 3153 |
| 210 | Ga0070662_100176892 | 3300005457 | Bacteria | 1680 |
| 211 | Ga0070681_10002397 | 3300005458 | Bacteria | 17122 |
| 212 | Ga0070681_10003472 | 3300005458 | Bacteria | 14770 |
| 213 | Ga0070681_10007223 | 3300005458 | Bacteria | 10836 |
| 214 | Ga0070681_10011126 | 3300005458 | Bacteria | 8904 |
| 215 | Ga0070681_10025568 | 3300005458 | Bacteria | 5939 |
| 216 | Ga0070681_10051196 | 3300005458 | Bacteria | 4119 |
| 217 | Ga0070681_10079820 | 3300005458 | Bacteria | 3228 |
| 218 | Ga0070681_10088539 | 3300005458 | Bacteria | 3047 |
| 219 | Ga0070681_10105124 | 3300005458 | Bacteria | 2765 |
| 220 | Ga0070681_10125946 | 3300005458 | Bacteria | 2494 |
| 221 | Ga0070681_10167382 | 3300005458 | Bacteria | 2120 |
| 222 | Ga0070681_10204011 | 3300005458 | Bacteria | 1895 |
| 223 | Ga0070681_10370452 | 3300005458 | Bacteria | 1343 |
| 224 | Ga0068867_100005066 | 3300005459 | Bacteria | 9303 |
| 225 | Ga0068867_100100295 | 3300005459 | Bacteria | 2210 |
| 226 | Ga0070685_10005310 | 3300005466 | Bacteria | 6533 |
| 227 | Ga0070706_100004157 | 3300005467 | Bacteria | 14075 |
| 228 | Ga0070706_100006592 | 3300005467 | Bacteria | 10949 |
| 229 | Ga0070706_100023324 | 3300005467 | Bacteria | 5700 |
| 230 | Ga0070706_100025041 | 3300005467 | Bacteria | 5493 |
| 231 | Ga0070706_100048078 | 3300005467 | Bacteria | 3937 |
| 232 | Ga0070706_100101171 | 3300005467 | Bacteria | 2678 |
| 233 | Ga0070706_100123427 | 3300005467 | Bacteria | 2415 |
| 234 | Ga0070706_100126482 | 3300005467 | Bacteria | 2383 |
| 235 | Ga0070706_100135765 | 3300005467 | Bacteria | 2296 |
| 236 | Ga0070706_100162922 | 3300005467 | Bacteria | 2082 |
| 237 | Ga0070706_100253012 | 3300005467 | Bacteria | 1645 |
| 238 | Ga0070707_100000111 | 3300005468 | Bacteria | 75249 |
| 239 | Ga0070707_100019949 | 3300005468 | Bacteria | 6320 |
| 240 | Ga0070707_100071190 | 3300005468 | Bacteria | 3350 |
| 241 | Ga0070707_100074279 | 3300005468 | Bacteria | 3278 |
| 242 | Ga0070707_100075299 | 3300005468 | Bacteria | 3255 |
| 243 | Ga0070707_100088344 | 3300005468 | Bacteria | 2998 |
| 244 | Ga0070707_100103404 | 3300005468 | Bacteria | 2760 |
| 245 | Ga0070707_100108107 | 3300005468 | Bacteria | 2698 |
| 246 | Ga0070707_100158149 | 3300005468 | Bacteria | 2207 |
| 247 | Ga0070707_100225531 | 3300005468 | Bacteria | 1824 |
| 248 | Ga0070707_100244470 | 3300005468 | Bacteria | 1746 |
| 249 | Ga0070698_100000732 | 3300005471 | Bacteria | 35269 |
| 250 | Ga0070698_100001954 | 3300005471 | Bacteria | 22884 |
| 251 | Ga0070698_100048367 | 3300005471 | Bacteria | 4345 |
| 252 | Ga0070698_100064792 | 3300005471 | Bacteria | 3680 |
| 253 | Ga0070698_100138610 | 3300005471 | Bacteria | 2385 |
| 254 | Ga0070698_100142564 | 3300005471 | Bacteria | 2347 |
| 255 | Ga0070698_100145856 | 3300005471 | Bacteria | 2316 |
| 256 | Ga0070698_100249357 | 3300005471 | Bacteria | 1708 |
| 257 | Ga0070699_100025317 | 3300005518 | Bacteria | 5117 |
| 258 | Ga0070699_100033808 | 3300005518 | Bacteria | 4418 |
| 259 | Ga0070699_100041434 | 3300005518 | Bacteria | 3986 |
| 260 | Ga0070699_100051744 | 3300005518 | Bacteria | 3556 |
| 261 | Ga0070699_100053750 | 3300005518 | Bacteria | 3485 |
| 262 | Ga0070699_100069767 | 3300005518 | Bacteria | 3054 |
| 263 | Ga0070699_100319853 | 3300005518 | Bacteria | 1394 |
| 264 | Ga0070679_100000601 | 3300005530 | Bacteria | 30635 |
| 265 | Ga0070679_100023697 | 3300005530 | Bacteria | 6014 |
| 266 | Ga0070679_100044346 | 3300005530 | Bacteria | 4430 |
| 267 | Ga0070679_100045790 | 3300005530 | Bacteria | 4359 |
| 268 | Ga0070679_100069873 | 3300005530 | Bacteria | 3503 |
| 269 | Ga0070679_100072402 | 3300005530 | Bacteria | 3438 |
| 270 | Ga0070679_100278807 | 3300005530 | Bacteria | 1625 |
| 271 | Ga0070679_100343498 | 3300005530 | Bacteria | 1441 |
| 272 | Ga0070684_100034431 | 3300005535 | Bacteria | 4331 |
| 273 | Ga0070684_100041680 | 3300005535 | Bacteria | 3959 |
| 274 | Ga0070684_100142679 | 3300005535 | Bacteria | 2167 |
| 275 | Ga0070697_100024423 | 3300005536 | Bacteria | 4810 |
| 276 | Ga0070697_100036389 | 3300005536 | Bacteria | 3976 |
| 277 | Ga0070697_100046677 | 3300005536 | Bacteria | 3511 |
| 278 | Ga0070697_100068800 | 3300005536 | Bacteria | 2899 |
| 279 | Ga0070697_100089953 | 3300005536 | Bacteria | 2537 |
| 280 | Ga0070697_100120873 | 3300005536 | Bacteria | 2190 |
| 281 | Ga0070697_100135504 | 3300005536 | Bacteria | 2067 |
| 282 | Ga0070697_100141679 | 3300005536 | Bacteria | 2022 |
| 283 | Ga0070697_100144992 | 3300005536 | Bacteria | 1998 |
| 284 | Ga0070697_100286344 | 3300005536 | Bacteria | 1414 |
| 285 | Ga0068853_100026550 | 3300005539 | Bacteria | 4863 |
| 286 | Ga0068853_100212483 | 3300005539 | Bacteria | 1764 |
| 287 | Ga0070672_100003949 | 3300005543 | Bacteria | 9668 |
| 288 | Ga0070672_100026322 | 3300005543 | Bacteria | 4326 |
| 289 | Ga0070672_100171558 | 3300005543 | Bacteria | 1804 |
| 290 | Ga0070672_100204838 | 3300005543 | Bacteria | 1650 |
| 291 | Ga0070672_100245379 | 3300005543 | Bacteria | 1507 |
| 292 | Ga0070686_100021163 | 3300005544 | Bacteria | 3861 |
| 293 | Ga0070686_100051285 | 3300005544 | Bacteria | 2626 |
| 294 | Ga0070686_100160151 | 3300005544 | Bacteria | 1584 |
| 295 | Ga0070695_100008312 | 3300005545 | Bacteria | 6157 |
| 296 | Ga0070695_100013344 | 3300005545 | Bacteria | 4935 |
| 297 | Ga0070695_100033166 | 3300005545 | Bacteria | 3230 |
| 298 | Ga0070695_100088152 | 3300005545 | Bacteria | 2065 |
| 299 | Ga0070695_100150576 | 3300005545 | Bacteria | 1623 |
| 300 | Ga0070695_100172301 | 3300005545 | Bacteria | 1527 |
| 301 | Ga0070696_100005231 | 3300005546 | Bacteria | 8672 |
| 302 | Ga0070696_100013998 | 3300005546 | Bacteria | 5386 |
| 303 | Ga0070696_100028628 | 3300005546 | Bacteria | 3802 |
| 304 | Ga0070696_100032388 | 3300005546 | Bacteria | 3586 |
| 305 | Ga0070696_100042413 | 3300005546 | Bacteria | 3145 |
| 306 | Ga0070696_100051895 | 3300005546 | Bacteria | 2852 |
| 307 | Ga0070696_100053018 | 3300005546 | Bacteria | 2822 |
| 308 | Ga0070696_100077257 | 3300005546 | Bacteria | 2352 |
| 309 | Ga0070696_100105886 | 3300005546 | Bacteria | 2021 |
| 310 | Ga0070696_100171415 | 3300005546 | Bacteria | 1604 |
| 311 | Ga0070693_100043429 | 3300005547 | Bacteria | 2538 |
| 312 | Ga0070665_100001142 | 3300005548 | Bacteria | 32621 |
| 313 | Ga0070665_100106126 | 3300005548 | Bacteria | 2811 |
| 314 | Ga0070665_100110500 | 3300005548 | Bacteria | 2751 |
| 315 | Ga0070665_100194758 | 3300005548 | Bacteria | 2027 |
| 316 | Ga0070665_100256810 | 3300005548 | Bacteria | 1748 |
| 317 | Ga0070704_100003747 | 3300005549 | Bacteria | 8751 |
| 318 | Ga0070704_100021663 | 3300005549 | Bacteria | 4171 |
| 319 | Ga0070704_100023271 | 3300005549 | Bacteria | 4042 |
| 320 | Ga0070704_100042785 | 3300005549 | Bacteria | 3135 |
| 321 | Ga0068855_100016427 | 3300005563 | Bacteria | 8899 |
| 322 | Ga0068855_100034201 | 3300005563 | Bacteria | 6063 |
| 323 | Ga0068855_100041438 | 3300005563 | Bacteria | 5457 |
| 324 | Ga0068855_100125252 | 3300005563 | Bacteria | 2938 |
| 325 | Ga0068855_100156517 | 3300005563 | Bacteria | 2588 |
| 326 | Ga0068855_100211199 | 3300005563 | Bacteria | 2181 |
| 327 | Ga0068855_100307246 | 3300005563 | Bacteria | 1755 |
| 328 | Ga0068855_100373693 | 3300005563 | Bacteria | 1566 |
| 329 | Ga0070664_100011074 | 3300005564 | Bacteria | 7314 |
| 330 | Ga0070664_100068537 | 3300005564 | Bacteria | 3033 |
| 331 | Ga0070664_100139427 | 3300005564 | Bacteria | 2134 |
| 332 | Ga0068857_100002740 | 3300005577 | Bacteria | 14470 |
| 333 | Ga0068857_100015888 | 3300005577 | Bacteria | 6589 |
| 334 | Ga0068857_100026578 | 3300005577 | Bacteria | 5102 |
| 335 | Ga0068857_100061458 | 3300005577 | Bacteria | 3337 |
| 336 | Ga0068854_100051569 | 3300005578 | Bacteria | 2948 |
| 337 | Ga0068856_100163441 | 3300005614 | Bacteria | 2237 |
| 338 | Ga0070702_100002572 | 3300005615 | Bacteria | 7884 |
| 339 | Ga0070702_100008493 | 3300005615 | Bacteria | 4978 |
| 340 | Ga0070702_100009357 | 3300005615 | Bacteria | 4793 |
| 341 | Ga0070702_100016820 | 3300005615 | Bacteria | 3761 |
| 342 | Ga0068852_100009981 | 3300005616 | Bacteria | 7065 |
| 343 | Ga0068852_100021426 | 3300005616 | Bacteria | 5160 |
| 344 | Ga0068852_100097256 | 3300005616 | Bacteria | 2648 |
| 345 | Ga0068859_100003294 | 3300005617 | Bacteria | 16422 |
| 346 | Ga0068859_100011939 | 3300005617 | Bacteria | 8726 |
| 347 | Ga0068859_100015547 | 3300005617 | Bacteria | 7646 |
| 348 | Ga0068859_100028177 | 3300005617 | Bacteria | 5632 |
| 349 | Ga0068859_100083516 | 3300005617 | Bacteria | 3237 |
| 350 | Ga0068859_100285147 | 3300005617 | Bacteria | 1744 |
| 351 | Ga0068859_100300736 | 3300005617 | Bacteria | 1698 |
| 352 | Ga0068864_100006580 | 3300005618 | Bacteria | 9512 |
| 353 | Ga0068864_100012293 | 3300005618 | Bacteria | 7076 |
| 354 | Ga0068864_100081652 | 3300005618 | Bacteria | 2834 |
| 355 | Ga0068864_100112489 | 3300005618 | Bacteria | 2427 |
| 356 | Ga0068866_10007241 | 3300005718 | Bacteria | 4642 |
| 357 | Ga0068866_10012598 | 3300005718 | Bacteria | 3688 |
| 358 | Ga0068866_10023782 | 3300005718 | Bacteria | 2854 |
| 359 | Ga0068861_100000975 | 3300005719 | Bacteria | 17448 |
| 360 | Ga0068861_100025036 | 3300005719 | Bacteria | 4322 |
| 361 | Ga0068861_100109023 | 3300005719 | Bacteria | 2216 |
| 362 | Ga0068861_100117879 | 3300005719 | Bacteria | 2137 |
| 363 | Ga0068861_100288270 | 3300005719 | Bacteria | 1417 |
| 364 | Ga0068863_100002641 | 3300005841 | Bacteria | 17739 |
| 365 | Ga0068863_100043145 | 3300005841 | Bacteria | 4282 |
| 366 | Ga0068863_100051547 | 3300005841 | Bacteria | 3900 |
| 367 | Ga0068863_100064103 | 3300005841 | Bacteria | 3475 |
| 368 | Ga0068863_100111800 | 3300005841 | Bacteria | 2601 |
| 369 | Ga0068863_100202272 | 3300005841 | Bacteria | 1911 |
| 370 | Ga0068863_100279109 | 3300005841 | Bacteria | 1618 |
| 371 | Ga0068858_100003549 | 3300005842 | Bacteria | 15439 |
| 372 | Ga0068858_100025878 | 3300005842 | Bacteria | 5457 |
| 373 | Ga0068858_100060745 | 3300005842 | Bacteria | 3493 |
| 374 | Ga0068858_100227052 | 3300005842 | Bacteria | 1769 |
| 375 | Ga0068858_100306229 | 3300005842 | Bacteria | 1516 |
| 376 | Ga0068860_100002169 | 3300005843 | Bacteria | 20676 |
| 377 | Ga0068860_100004188 | 3300005843 | Bacteria | 14782 |
| 378 | Ga0068860_100022141 | 3300005843 | Bacteria | 6152 |
| 379 | Ga0068860_100105193 | 3300005843 | Bacteria | 2695 |
| 380 | Ga0068860_100377495 | 3300005843 | Bacteria | 1399 |
| 381 | Ga0068862_100000764 | 3300005844 | Bacteria | 32066 |
| 382 | Ga0068862_100002926 | 3300005844 | Bacteria | 14928 |
| 383 | Ga0068862_100003483 | 3300005844 | Bacteria | 13529 |
| 384 | Ga0068862_100009767 | 3300005844 | Bacteria | 7934 |
| 385 | Ga0068862_100010512 | 3300005844 | Bacteria | 7646 |
| 386 | Ga0068862_100013561 | 3300005844 | Bacteria | 6752 |
| 387 | Ga0068862_100054158 | 3300005844 | Bacteria | 3435 |
| 388 | Ga0068862_100067739 | 3300005844 | Bacteria | 3078 |
| 389 | Ga0068862_100088084 | 3300005844 | Bacteria | 2700 |
| 390 | Ga0068862_100255669 | 3300005844 | Bacteria | 1598 |
| 391 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 392 | Ga0081455_10001008 | 3300005937 | Bacteria | 35646 |
| 393 | Ga0081455_10002584 | 3300005937 | Bacteria | 21460 |
| 394 | Ga0081455_10011198 | 3300005937 | Bacteria | 9024 |
| 395 | Ga0081455_10020498 | 3300005937 | Bacteria | 6222 |
| 396 | Ga0081455_10021909 | 3300005937 | Bacteria | 5985 |
| 397 | Ga0081455_10151707 | 3300005937 | Bacteria | 1786 |
| 398 | Ga0081455_10217200 | 3300005937 | Bacteria | 1420 |
| 399 | Ga0081538_10025683 | 3300005981 | Bacteria | 4144 |
| 400 | Ga0081538_10026012 | 3300005981 | Bacteria | 4107 |
| 401 | Ga0081538_10027178 | 3300005981 | Bacteria | 3975 |
| 402 | Ga0081540_1000039 | 3300005983 | Bacteria | 137196 |
| 403 | Ga0081540_1001954 | 3300005983 | Bacteria | 17230 |
| 404 | Ga0081540_1004248 | 3300005983 | Bacteria | 10995 |
| 405 | Ga0081540_1005100 | 3300005983 | Bacteria | 9851 |
| 406 | Ga0081540_1015691 | 3300005983 | Bacteria | 4782 |
| 407 | Ga0081540_1032077 | 3300005983 | Bacteria | 2875 |
| 408 | Ga0081540_1035908 | 3300005983 | Bacteria | 2651 |
| 409 | Ga0081540_1042197 | 3300005983 | Bacteria | 2355 |
| 410 | Ga0081540_1048547 | 3300005983 | Bacteria | 2125 |
| 411 | Ga0081540_1051845 | 3300005983 | Bacteria | 2026 |
| 412 | Ga0081540_1054086 | 3300005983 | Bacteria | 1964 |
| 413 | Ga0081539_10005565 | 3300005985 | Bacteria | 12756 |
| 414 | Ga0081539_10023434 | 3300005985 | Bacteria | 4045 |
| 415 | Ga0081539_10029077 | 3300005985 | Bacteria | 3463 |
| 416 | Ga0081539_10042213 | 3300005985 | Bacteria | 2659 |
| 417 | Ga0081539_10042683 | 3300005985 | Bacteria | 2639 |
| 418 | Ga0081539_10069342 | 3300005985 | Bacteria | 1898 |
| 419 | Ga0070717_10039765 | 3300006028 | Bacteria | 3828 |
| 420 | Ga0070717_10117638 | 3300006028 | Bacteria | 2273 |
| 421 | Ga0070717_10126952 | 3300006028 | Bacteria | 2190 |
| 422 | Ga0070717_10300996 | 3300006028 | Bacteria | 1426 |
| 423 | Ga0075365_10056321 | 3300006038 | Bacteria | 2613 |
| 424 | Ga0075365_10084311 | 3300006038 | Bacteria | 2156 |
| 425 | Ga0075363_100004519 | 3300006048 | Bacteria | 6099 |
| 426 | Ga0075364_10010958 | 3300006051 | Bacteria | 5496 |
| 427 | Ga0075432_10005809 | 3300006058 | Bacteria | 4197 |
| 428 | Ga0075432_10009022 | 3300006058 | Bacteria | 3398 |
| 429 | Ga0070715_10006350 | 3300006163 | Bacteria | 4015 |
| 430 | Ga0070715_10010428 | 3300006163 | Bacteria | 3312 |
| 431 | Ga0070715_10021362 | 3300006163 | Bacteria | 2509 |
| 432 | Ga0070715_10046249 | 3300006163 | Bacteria | 1849 |
| 433 | Ga0070716_100005648 | 3300006173 | Bacteria | 6074 |
| 434 | Ga0070716_100008042 | 3300006173 | Bacteria | 5223 |
| 435 | Ga0070716_100014776 | 3300006173 | Bacteria | 4004 |
| 436 | Ga0070716_100034413 | 3300006173 | Bacteria | 2778 |
| 437 | Ga0070716_100114378 | 3300006173 | Bacteria | 1678 |
| 438 | Ga0070716_100170288 | 3300006173 | Bacteria | 1420 |
| 439 | Ga0070716_100201717 | 3300006173 | Bacteria | 1323 |
| 440 | Ga0070712_100002022 | 3300006175 | Bacteria | 12426 |
| 441 | Ga0070712_100121632 | 3300006175 | Bacteria | 1964 |
| 442 | Ga0070712_100161335 | 3300006175 | Bacteria | 1731 |
| 443 | Ga0075362_10001094 | 3300006177 | Bacteria | 8411 |
| 444 | Ga0075362_10029472 | 3300006177 | Bacteria | 2365 |
| 445 | Ga0075367_10047918 | 3300006178 | Bacteria | 2515 |
| 446 | Ga0075369_10016456 | 3300006186 | Bacteria | 2984 |
| 447 | Ga0075366_10005041 | 3300006195 | Bacteria | 7136 |
| 448 | Ga0075366_10006363 | 3300006195 | Bacteria | 6468 |
| 449 | Ga0075366_10134608 | 3300006195 | Bacteria | 1492 |
| 450 | Ga0097621_100002102 | 3300006237 | Bacteria | 13652 |
| 451 | Ga0097621_100012152 | 3300006237 | Bacteria | 6372 |
| 452 | Ga0097621_100027490 | 3300006237 | Bacteria | 4474 |
| 453 | Ga0097621_100163010 | 3300006237 | Bacteria | 1917 |
| 454 | Ga0075370_10026686 | 3300006353 | Bacteria | 3201 |
| 455 | Ga0075370_10112241 | 3300006353 | Bacteria | 1583 |
| 456 | Ga0068871_100008543 | 3300006358 | Bacteria | 7360 |
| 457 | Ga0068871_100034414 | 3300006358 | Bacteria | 4020 |
| 458 | Ga0068871_100222917 | 3300006358 | Bacteria | 1634 |
| 459 | Ga0068871_100262605 | 3300006358 | Bacteria | 1506 |
| 460 | Ga0075428_100003062 | 3300006844 | Bacteria | 18244 |
| 461 | Ga0075428_100012165 | 3300006844 | Bacteria | 9571 |
| 462 | Ga0075428_100012701 | 3300006844 | Bacteria | 9365 |
| 463 | Ga0075428_100014750 | 3300006844 | Bacteria | 8681 |
| 464 | Ga0075428_100031483 | 3300006844 | Bacteria | 5862 |
| 465 | Ga0075428_100031769 | 3300006844 | Bacteria | 5832 |
| 466 | Ga0075428_100032084 | 3300006844 | Bacteria | 5804 |
| 467 | Ga0075428_100070970 | 3300006844 | Bacteria | 3808 |
| 468 | Ga0075428_100096246 | 3300006844 | Bacteria | 3227 |
| 469 | Ga0075428_100100956 | 3300006844 | Bacteria | 3145 |
| 470 | Ga0075428_100123298 | 3300006844 | Bacteria | 2820 |
| 471 | Ga0075428_100175030 | 3300006844 | Bacteria | 2324 |
| 472 | Ga0075428_100181164 | 3300006844 | Bacteria | 2280 |
| 473 | Ga0075428_100226820 | 3300006844 | Bacteria | 2016 |
| 474 | Ga0075430_100000196 | 3300006846 | Bacteria | 40930 |
| 475 | Ga0075430_100000588 | 3300006846 | Bacteria | 27574 |
| 476 | Ga0075430_100001414 | 3300006846 | Bacteria | 19526 |
| 477 | Ga0075430_100002137 | 3300006846 | Bacteria | 16361 |
| 478 | Ga0075430_100005309 | 3300006846 | Bacteria | 10875 |
| 479 | Ga0075430_100012839 | 3300006846 | Bacteria | 7139 |
| 480 | Ga0075430_100024234 | 3300006846 | Bacteria | 5164 |
| 481 | Ga0075430_100030156 | 3300006846 | Bacteria | 4605 |
| 482 | Ga0075430_100049042 | 3300006846 | Bacteria | 3564 |
| 483 | Ga0075430_100074672 | 3300006846 | Bacteria | 2842 |
| 484 | Ga0075430_100105672 | 3300006846 | Bacteria | 2350 |
| 485 | Ga0075431_100000285 | 3300006847 | Bacteria | 39649 |
| 486 | Ga0075431_100015841 | 3300006847 | Bacteria | 7644 |
| 487 | Ga0075431_100017225 | 3300006847 | Bacteria | 7342 |
| 488 | Ga0075431_100019032 | 3300006847 | Bacteria | 6997 |
| 489 | Ga0075431_100025863 | 3300006847 | Bacteria | 6016 |
| 490 | Ga0075431_100031481 | 3300006847 | Bacteria | 5464 |
| 491 | Ga0075431_100091921 | 3300006847 | Bacteria | 3131 |
| 492 | Ga0075431_100177690 | 3300006847 | Bacteria | 2186 |
| 493 | Ga0075431_100182184 | 3300006847 | Bacteria | 2155 |
| 494 | Ga0075431_100186865 | 3300006847 | Bacteria | 2125 |
| 495 | Ga0075431_100196910 | 3300006847 | Bacteria | 2063 |
| 496 | Ga0075431_100235873 | 3300006847 | Bacteria | 1862 |
| 497 | Ga0075431_100306437 | 3300006847 | Bacteria | 1604 |
| 498 | Ga0075431_100311671 | 3300006847 | Bacteria | 1588 |
| 499 | Ga0075431_100379713 | 3300006847 | Bacteria | 1417 |
| 500 | Ga0075433_10000728 | 3300006852 | Bacteria | 22541 |
| 501 | Ga0075433_10002316 | 3300006852 | Bacteria | 14498 |
| 502 | Ga0075433_10042950 | 3300006852 | Bacteria | 3923 |
| 503 | Ga0075433_10056647 | 3300006852 | Bacteria | 3424 |
| 504 | Ga0075433_10207815 | 3300006852 | Bacteria | 1740 |
| 505 | Ga0075433_10221288 | 3300006852 | Bacteria | 1681 |
| 506 | Ga0075433_10232108 | 3300006852 | Bacteria | 1638 |
| 507 | Ga0075433_10322591 | 3300006852 | Bacteria | 1366 |
| 508 | Ga0075434_100003094 | 3300006871 | Bacteria | 14813 |
| 509 | Ga0075434_100079053 | 3300006871 | Bacteria | 3285 |
| 510 | Ga0075434_100098077 | 3300006871 | Bacteria | 2935 |
| 511 | Ga0075434_100098215 | 3300006871 | Bacteria | 2933 |
| 512 | Ga0075434_100106220 | 3300006871 | Bacteria | 2817 |
| 513 | Ga0075434_100214139 | 3300006871 | Bacteria | 1946 |
| 514 | Ga0075434_100350883 | 3300006871 | Bacteria | 1496 |
| 515 | Ga0075434_100410412 | 3300006871 | Bacteria | 1375 |
| 516 | Ga0075429_100000573 | 3300006880 | Bacteria | 28269 |
| 517 | Ga0075429_100015763 | 3300006880 | Bacteria | 6545 |
| 518 | Ga0075429_100026560 | 3300006880 | Bacteria | 5028 |
| 519 | Ga0075429_100066007 | 3300006880 | Bacteria | 3150 |
| 520 | Ga0075429_100161147 | 3300006880 | Bacteria | 1965 |
| 521 | Ga0068865_100013360 | 3300006881 | Bacteria | 5188 |
| 522 | Ga0068865_100070394 | 3300006881 | Bacteria | 2478 |
| 523 | Ga0068865_100080162 | 3300006881 | Bacteria | 2340 |
| 524 | Ga0068865_100104200 | 3300006881 | Bacteria | 2082 |
| 525 | Ga0068865_100211460 | 3300006881 | Bacteria | 1512 |
| 526 | Ga0075436_100040622 | 3300006914 | Bacteria | 3209 |
| 527 | Ga0075436_100051066 | 3300006914 | Bacteria | 2853 |
| 528 | Ga0075436_100096253 | 3300006914 | Bacteria | 2059 |
| 529 | Ga0097620_100003294 | 3300006931 | Bacteria | 16422 |
| 530 | Ga0097620_100011939 | 3300006931 | Bacteria | 8726 |
| 531 | Ga0097620_100015546 | 3300006931 | Bacteria | 7646 |
| 532 | Ga0097620_100028177 | 3300006931 | Bacteria | 5632 |
| 533 | Ga0097620_100083510 | 3300006931 | Bacteria | 3237 |
| 534 | Ga0097620_100285152 | 3300006931 | Bacteria | 1744 |
| 535 | Ga0097620_100300703 | 3300006931 | Bacteria | 1698 |
| 536 | Ga0099822_1017947 | 3300006943 | Bacteria | 7462 |
| 537 | Ga0075435_100049503 | 3300007076 | Bacteria | 3380 |
| 538 | Ga0075435_100077177 | 3300007076 | Bacteria | 2731 |
| 539 | Ga0075435_100133447 | 3300007076 | Bacteria | 2078 |
| 540 | Ga0075435_100165794 | 3300007076 | Bacteria | 1863 |
| 541 | Ga0075435_100217013 | 3300007076 | Bacteria | 1624 |
| 542 | Ga0075435_100270475 | 3300007076 | Bacteria | 1449 |
| 543 | Ga0099795_10014852 | 3300007788 | Bacteria | 2425 |
| 544 | Ga0099795_10031443 | 3300007788 | Bacteria | 1828 |
| 545 | Ga0105244_10054642 | 3300009036 | Bacteria | 2025 |
| 546 | Ga0105240_10000041 | 3300009093 | Bacteria | 264078 |
| 547 | Ga0105240_10004245 | 3300009093 | Bacteria | 21913 |
| 548 | Ga0105240_10062946 | 3300009093 | Bacteria | 4617 |
| 549 | Ga0105240_10317079 | 3300009093 | Bacteria | 1778 |
| 550 | Ga0111539_10000254 | 3300009094 | Bacteria | 64117 |
| 551 | Ga0111539_10000683 | 3300009094 | Bacteria | 43914 |
| 552 | Ga0111539_10002526 | 3300009094 | Bacteria | 24232 |
| 553 | Ga0111539_10011739 | 3300009094 | Bacteria | 10990 |
| 554 | Ga0111539_10065953 | 3300009094 | Bacteria | 4276 |
| 555 | Ga0111539_10099479 | 3300009094 | Bacteria | 3415 |
| 556 | Ga0111539_10128818 | 3300009094 | Bacteria | 2964 |
| 557 | Ga0111539_10145820 | 3300009094 | Bacteria | 2771 |
| 558 | Ga0111539_10236594 | 3300009094 | Bacteria | 2126 |
| 559 | Ga0111539_10279893 | 3300009094 | Bacteria | 1941 |
| 560 | Ga0105245_10183915 | 3300009098 | Bacteria | 1998 |
| 561 | Ga0105245_10242990 | 3300009098 | Bacteria | 1746 |
| 562 | Ga0114129_10005890 | 3300009147 | Bacteria | 17359 |
| 563 | Ga0114129_10007918 | 3300009147 | Bacteria | 15129 |
| 564 | Ga0114129_10008352 | 3300009147 | Bacteria | 14760 |
| 565 | Ga0114129_10008584 | 3300009147 | Bacteria | 14567 |
| 566 | Ga0114129_10022594 | 3300009147 | Bacteria | 8922 |
| 567 | Ga0114129_10023982 | 3300009147 | Bacteria | 8646 |
| 568 | Ga0114129_10024415 | 3300009147 | Bacteria | 8566 |
| 569 | Ga0114129_10030751 | 3300009147 | Bacteria | 7593 |
| 570 | Ga0114129_10036192 | 3300009147 | Bacteria | 6971 |
| 571 | Ga0114129_10058827 | 3300009147 | Bacteria | 5375 |
| 572 | Ga0114129_10116757 | 3300009147 | Bacteria | 3677 |
| 573 | Ga0114129_10147439 | 3300009147 | Bacteria | 3222 |
| 574 | Ga0114129_10173993 | 3300009147 | Bacteria | 2933 |
| 575 | Ga0114129_10195878 | 3300009147 | Bacteria | 2740 |
| 576 | Ga0114129_10271585 | 3300009147 | Bacteria | 2268 |
| 577 | Ga0114129_10338416 | 3300009147 | Bacteria | 1996 |
| 578 | Ga0114129_10357525 | 3300009147 | Bacteria | 1933 |
| 579 | Ga0114129_10427049 | 3300009147 | Bacteria | 1742 |
| 580 | Ga0114129_10595964 | 3300009147 | Bacteria | 1432 |
| 581 | Ga0105243_10031684 | 3300009148 | Bacteria | 4078 |
| 582 | Ga0105243_10079528 | 3300009148 | Bacteria | 2672 |
| 583 | Ga0105243_10111592 | 3300009148 | Bacteria | 2289 |
| 584 | Ga0105243_10227041 | 3300009148 | Bacteria | 1654 |
| 585 | Ga0105242_10017209 | 3300009176 | Bacteria | 5629 |
| 586 | Ga0105242_10055724 | 3300009176 | Bacteria | 3234 |
| 587 | Ga0105248_10004070 | 3300009177 | Bacteria | 16159 |
| 588 | Ga0105248_10023633 | 3300009177 | Bacteria | 6829 |
| 589 | Ga0105248_10036522 | 3300009177 | Bacteria | 5496 |
| 590 | Ga0105248_10050272 | 3300009177 | Bacteria | 4675 |
| 591 | Ga0105248_10052133 | 3300009177 | Bacteria | 4591 |
| 592 | Ga0105248_10332211 | 3300009177 | Bacteria | 1712 |
| 593 | Ga0105237_10091369 | 3300009545 | Bacteria | 3034 |
| 594 | Ga0105237_10214518 | 3300009545 | Bacteria | 1925 |
| 595 | Ga0105238_10094918 | 3300009551 | Bacteria | 2970 |
| 596 | Ga0105249_10000580 | 3300009553 | Bacteria | 33471 |
| 597 | Ga0105249_10004567 | 3300009553 | Bacteria | 11966 |
| 598 | Ga0105249_10008223 | 3300009553 | Bacteria | 9087 |
| 599 | Ga0105249_10018979 | 3300009553 | Bacteria | 6131 |
| 600 | Ga0105249_10127689 | 3300009553 | Bacteria | 2423 |
| 601 | Ga0099796_10018211 | 3300010159 | Bacteria | 2105 |
| 602 | Ga0099796_10029177 | 3300010159 | Bacteria | 1778 |
| 603 | Ga0105239_10006094 | 3300010375 | Bacteria | 14040 |
| 604 | Ga0105239_10023806 | 3300010375 | Bacteria | 6743 |
| 605 | Ga0105246_10002307 | 3300011119 | Bacteria | 11520 |
| 606 | Ga0105246_10140884 | 3300011119 | Bacteria | 1813 |
| 607 | Ga0157326_1000019 | 3300012513 | Bacteria | 14554 |
| 608 | Ga0157371_10010154 | 3300013102 | Bacteria | 7356 |
| 609 | Ga0157371_10012727 | 3300013102 | Bacteria | 6414 |
| 610 | Ga0157369_10067134 | 3300013105 | Bacteria | 3857 |
| 611 | Ga0157369_10152920 | 3300013105 | Bacteria | 2439 |
| 612 | Ga0157369_10320029 | 3300013105 | Bacteria | 1613 |
| 613 | Ga0157374_10000059 | 3300013296 | Bacteria | 116409 |
| 614 | Ga0157374_10000420 | 3300013296 | Bacteria | 38392 |
| 615 | Ga0157374_10011042 | 3300013296 | Bacteria | 7802 |
| 616 | Ga0157374_10063069 | 3300013296 | Bacteria | 3476 |
| 617 | Ga0157378_10015692 | 3300013297 | Bacteria | 6632 |
| 618 | Ga0157378_10037718 | 3300013297 | Bacteria | 4283 |
| 619 | Ga0157378_10089479 | 3300013297 | Bacteria | 2796 |
| 620 | Ga0157378_10130357 | 3300013297 | Bacteria | 2327 |
| 621 | Ga0157378_10200348 | 3300013297 | Bacteria | 1888 |
| 622 | Ga0157378_10201694 | 3300013297 | Bacteria | 1882 |
| 623 | Ga0163162_10006136 | 3300013306 | Bacteria | 11634 |
| 624 | Ga0163162_10148135 | 3300013306 | Bacteria | 2464 |
| 625 | Ga0163162_10234444 | 3300013306 | Bacteria | 1966 |
| 626 | Ga0163162_10245555 | 3300013306 | Bacteria | 1922 |
| 627 | Ga0157372_10043257 | 3300013307 | Bacteria | 4986 |
| 628 | Ga0157375_10026125 | 3300013308 | Bacteria | 5437 |
| 629 | Ga0157375_10043876 | 3300013308 | Bacteria | 4339 |
| 630 | Ga0157375_10108740 | 3300013308 | Bacteria | 2868 |
| 631 | Ga0157375_10190591 | 3300013308 | Bacteria | 2205 |
| 632 | Ga0163163_10006954 | 3300014325 | Bacteria | 9941 |
| 633 | Ga0163163_10022770 | 3300014325 | Bacteria | 5937 |
| 634 | Ga0163163_10073351 | 3300014325 | Bacteria | 3413 |
| 635 | Ga0163163_10103076 | 3300014325 | Bacteria | 2878 |
| 636 | Ga0163163_10254024 | 3300014325 | Bacteria | 1808 |
| 637 | Ga0163163_10389447 | 3300014325 | Bacteria | 1451 |
| 638 | Ga0157380_10017794 | 3300014326 | Bacteria | 5265 |
| 639 | Ga0157380_10130825 | 3300014326 | Bacteria | 2141 |
| 640 | Ga0157380_10290076 | 3300014326 | Bacteria | 1502 |
| 641 | Ga0157377_10036391 | 3300014745 | Bacteria | 2708 |
| 642 | Ga0157379_10035446 | 3300014968 | Bacteria | 4448 |
| 643 | Ga0157379_10072718 | 3300014968 | Bacteria | 3077 |
| 644 | Ga0157379_10073976 | 3300014968 | Bacteria | 3050 |
| 645 | Ga0157379_10174229 | 3300014968 | Bacteria | 1942 |
| 646 | Ga0157376_10000366 | 3300014969 | Bacteria | 29717 |
| 647 | Ga0157376_10021266 | 3300014969 | Bacteria | 5038 |
| 648 | Ga0157376_10062627 | 3300014969 | Bacteria | 3130 |
| 649 | Ga0157376_10072830 | 3300014969 | Bacteria | 2924 |
| 650 | Ga0206356_10491331 | 3300020070 | Bacteria | 1668 |
| 651 | Ga0206355_1150548 | 3300020076 | Bacteria | 1612 |
| 652 | Ga0206352_10908026 | 3300020078 | Bacteria | 2888 |
| 653 | Ga0206352_11257230 | 3300020078 | Bacteria | 1659 |
| 654 | Ga0206350_10871634 | 3300020080 | Bacteria | 2162 |
| 655 | Ga0206354_10060344 | 3300020081 | Bacteria | 1658 |
| 656 | Ga0206354_10418299 | 3300020081 | Bacteria | 2523 |
| 657 | Ga0213872_10080721 | 3300021361 | Bacteria | 1461 |
| 658 | Ga0213874_10005086 | 3300021377 | Bacteria | 3045 |
| 659 | Ga0213876_10004873 | 3300021384 | Bacteria | 7444 |
| 660 | Ga0213876_10005191 | 3300021384 | Bacteria | 7184 |
| 661 | Ga0213876_10024479 | 3300021384 | Bacteria | 3187 |
| 662 | Ga0213876_10036554 | 3300021384 | Bacteria | 2590 |
| 663 | Ga0224712_10012105 | 3300022467 | Bacteria | 2701 |
| 664 | Ga0224712_10056701 | 3300022467 | Bacteria | 1546 |
| 665 | Ga0228598_1000842 | 3300024227 | Bacteria | 6627 |
| 666 | Ga0228598_1009546 | 3300024227 | Bacteria | 1943 |
| 667 | Ga0209233_1002757 | 3300025261 | Bacteria | 6322 |
| 668 | Ga0209758_1000294 | 3300025297 | Bacteria | 98618 |
| 669 | Ga0209758_1003798 | 3300025297 | Bacteria | 13299 |
| 670 | Ga0209758_1006193 | 3300025297 | Bacteria | 8738 |
| 671 | Ga0207697_10007256 | 3300025315 | Bacteria | 4951 |
| 672 | Ga0207697_10008426 | 3300025315 | Bacteria | 4510 |
| 673 | Ga0207697_10010465 | 3300025315 | Bacteria | 3963 |
| 674 | Ga0207696_1012954 | 3300025711 | Bacteria | 2930 |
| 675 | Ga0207653_10001008 | 3300025885 | Bacteria | 9283 |
| 676 | Ga0207682_10015238 | 3300025893 | Bacteria | 2992 |
| 677 | Ga0207682_10018511 | 3300025893 | Bacteria | 2724 |
| 678 | Ga0207682_10097011 | 3300025893 | Bacteria | 1285 |
| 679 | Ga0207692_10001850 | 3300025898 | Bacteria | 8046 |
| 680 | Ga0207692_10001861 | 3300025898 | Bacteria | 8027 |
| 681 | Ga0207692_10004350 | 3300025898 | Bacteria | 5607 |
| 682 | Ga0207692_10008328 | 3300025898 | Bacteria | 4289 |
| 683 | Ga0207642_10010483 | 3300025899 | Bacteria | 3270 |
| 684 | Ga0207642_10017186 | 3300025899 | Bacteria | 2745 |
| 685 | Ga0207642_10083695 | 3300025899 | Bacteria | 1556 |
| 686 | Ga0207642_10084880 | 3300025899 | Bacteria | 1548 |
| 687 | Ga0207642_10086501 | 3300025899 | Bacteria | 1537 |
| 688 | Ga0207710_10033867 | 3300025900 | Bacteria | 2242 |
| 689 | Ga0207647_10057140 | 3300025904 | Bacteria | 2393 |
| 690 | Ga0207647_10070290 | 3300025904 | Bacteria | 2115 |
| 691 | Ga0207685_10002961 | 3300025905 | Bacteria | 4025 |
| 692 | Ga0207685_10006264 | 3300025905 | Bacteria | 3226 |
| 693 | Ga0207685_10013698 | 3300025905 | Bacteria | 2516 |
| 694 | Ga0207685_10027209 | 3300025905 | Bacteria | 1999 |
| 695 | Ga0207699_10010108 | 3300025906 | Bacteria | 4721 |
| 696 | Ga0207699_10015690 | 3300025906 | Bacteria | 3941 |
| 697 | Ga0207699_10048407 | 3300025906 | Bacteria | 2497 |
| 698 | Ga0207699_10080717 | 3300025906 | Bacteria | 2016 |
| 699 | Ga0207699_10086124 | 3300025906 | Bacteria | 1961 |
| 700 | Ga0207699_10118915 | 3300025906 | Bacteria | 1706 |
| 701 | Ga0207645_10000909 | 3300025907 | Bacteria | 24558 |
| 702 | Ga0207645_10001246 | 3300025907 | Bacteria | 20949 |
| 703 | Ga0207645_10030019 | 3300025907 | Bacteria | 3503 |
| 704 | Ga0207645_10039141 | 3300025907 | Bacteria | 3038 |
| 705 | Ga0207643_10025597 | 3300025908 | Bacteria | 3262 |
| 706 | Ga0207643_10030502 | 3300025908 | Bacteria | 3001 |
| 707 | Ga0207643_10079555 | 3300025908 | Bacteria | 1897 |
| 708 | Ga0207643_10083433 | 3300025908 | Bacteria | 1854 |
| 709 | Ga0207705_10007506 | 3300025909 | Bacteria | 8011 |
| 710 | Ga0207705_10097755 | 3300025909 | Bacteria | 2156 |
| 711 | Ga0207684_10000334 | 3300025910 | Bacteria | 65725 |
| 712 | Ga0207684_10005045 | 3300025910 | Bacteria | 12304 |
| 713 | Ga0207684_10033102 | 3300025910 | Bacteria | 4396 |
| 714 | Ga0207684_10065816 | 3300025910 | Bacteria | 3078 |
| 715 | Ga0207684_10091560 | 3300025910 | Bacteria | 2592 |
| 716 | Ga0207684_10099628 | 3300025910 | Bacteria | 2482 |
| 717 | Ga0207684_10116816 | 3300025910 | Bacteria | 2286 |
| 718 | Ga0207684_10253520 | 3300025910 | Bacteria | 1518 |
| 719 | Ga0207654_10144844 | 3300025911 | Bacteria | 1519 |
| 720 | Ga0207707_10002337 | 3300025912 | Bacteria | 17081 |
| 721 | Ga0207707_10003270 | 3300025912 | Bacteria | 14394 |
| 722 | Ga0207707_10004335 | 3300025912 | Bacteria | 12560 |
| 723 | Ga0207707_10012860 | 3300025912 | Bacteria | 7283 |
| 724 | Ga0207707_10013953 | 3300025912 | Bacteria | 7005 |
| 725 | Ga0207707_10022768 | 3300025912 | Bacteria | 5478 |
| 726 | Ga0207707_10027678 | 3300025912 | Bacteria | 4957 |
| 727 | Ga0207707_10056109 | 3300025912 | Bacteria | 3426 |
| 728 | Ga0207707_10059354 | 3300025912 | Bacteria | 3328 |
| 729 | Ga0207707_10073265 | 3300025912 | Bacteria | 2986 |
| 730 | Ga0207707_10108444 | 3300025912 | Bacteria | 2427 |
| 731 | Ga0207707_10182832 | 3300025912 | Bacteria | 1830 |
| 732 | Ga0207707_10205128 | 3300025912 | Bacteria | 1718 |
| 733 | Ga0207695_10000093 | 3300025913 | Bacteria | 270427 |
| 734 | Ga0207695_10003067 | 3300025913 | Bacteria | 23953 |
| 735 | Ga0207695_10017539 | 3300025913 | Bacteria | 8326 |
| 736 | Ga0207693_10001366 | 3300025915 | Bacteria | 21623 |
| 737 | Ga0207693_10001926 | 3300025915 | Bacteria | 18180 |
| 738 | Ga0207693_10003338 | 3300025915 | Bacteria | 13734 |
| 739 | Ga0207693_10048951 | 3300025915 | Bacteria | 3319 |
| 740 | Ga0207693_10062321 | 3300025915 | Bacteria | 2921 |
| 741 | Ga0207693_10090627 | 3300025915 | Bacteria | 2397 |
| 742 | Ga0207693_10113671 | 3300025915 | Bacteria | 2124 |
| 743 | Ga0207663_10000218 | 3300025916 | Bacteria | 25518 |
| 744 | Ga0207663_10000533 | 3300025916 | Bacteria | 16706 |
| 745 | Ga0207663_10013116 | 3300025916 | Bacteria | 4497 |
| 746 | Ga0207663_10041305 | 3300025916 | Bacteria | 2810 |
| 747 | Ga0207663_10064474 | 3300025916 | Bacteria | 2338 |
| 748 | Ga0207663_10076841 | 3300025916 | Bacteria | 2171 |
| 749 | Ga0207663_10085049 | 3300025916 | Bacteria | 2082 |
| 750 | Ga0207663_10278742 | 3300025916 | Bacteria | 1241 |
| 751 | Ga0207660_10001269 | 3300025917 | Bacteria | 16941 |
| 752 | Ga0207660_10001710 | 3300025917 | Bacteria | 14714 |
| 753 | Ga0207660_10001861 | 3300025917 | Bacteria | 14060 |
| 754 | Ga0207660_10009536 | 3300025917 | Bacteria | 6284 |
| 755 | Ga0207660_10011255 | 3300025917 | Bacteria | 5818 |
| 756 | Ga0207660_10013609 | 3300025917 | Bacteria | 5334 |
| 757 | Ga0207660_10025700 | 3300025917 | Bacteria | 4001 |
| 758 | Ga0207660_10036064 | 3300025917 | Bacteria | 3437 |
| 759 | Ga0207660_10059416 | 3300025917 | Bacteria | 2745 |
| 760 | Ga0207660_10067521 | 3300025917 | Bacteria | 2590 |
| 761 | Ga0207660_10209597 | 3300025917 | Bacteria | 1525 |
| 762 | Ga0207662_10000695 | 3300025918 | Bacteria | 15329 |
| 763 | Ga0207662_10000745 | 3300025918 | Bacteria | 14909 |
| 764 | Ga0207662_10006823 | 3300025918 | Bacteria | 6179 |
| 765 | Ga0207662_10011914 | 3300025918 | Bacteria | 4836 |
| 766 | Ga0207662_10016037 | 3300025918 | Bacteria | 4223 |
| 767 | Ga0207662_10045667 | 3300025918 | Bacteria | 2590 |
| 768 | Ga0207662_10091381 | 3300025918 | Bacteria | 1873 |
| 769 | Ga0207657_10045238 | 3300025919 | Bacteria | 3865 |
| 770 | Ga0207657_10057829 | 3300025919 | Bacteria | 3340 |
| 771 | Ga0207657_10059343 | 3300025919 | Bacteria | 3288 |
| 772 | Ga0207657_10082571 | 3300025919 | Bacteria | 2697 |
| 773 | Ga0207657_10155717 | 3300025919 | Bacteria | 1858 |
| 774 | Ga0207657_10182426 | 3300025919 | Bacteria | 1696 |
| 775 | Ga0207649_10006102 | 3300025920 | Bacteria | 6540 |
| 776 | Ga0207649_10007666 | 3300025920 | Bacteria | 5871 |
| 777 | Ga0207649_10008227 | 3300025920 | Bacteria | 5682 |
| 778 | Ga0207649_10018776 | 3300025920 | Bacteria | 3940 |
| 779 | Ga0207652_10004826 | 3300025921 | Bacteria | 10919 |
| 780 | Ga0207652_10006486 | 3300025921 | Bacteria | 9434 |
| 781 | Ga0207652_10022531 | 3300025921 | Bacteria | 5212 |
| 782 | Ga0207652_10031244 | 3300025921 | Bacteria | 4471 |
| 783 | Ga0207652_10044290 | 3300025921 | Bacteria | 3791 |
| 784 | Ga0207652_10196571 | 3300025921 | Bacteria | 1814 |
| 785 | Ga0207646_10000163 | 3300025922 | Bacteria | 90731 |
| 786 | Ga0207646_10012943 | 3300025922 | Bacteria | 7997 |
| 787 | Ga0207646_10071440 | 3300025922 | Bacteria | 3100 |
| 788 | Ga0207646_10077354 | 3300025922 | Bacteria | 2974 |
| 789 | Ga0207646_10110092 | 3300025922 | Bacteria | 2471 |
| 790 | Ga0207646_10220554 | 3300025922 | Bacteria | 1713 |
| 791 | Ga0207646_10226890 | 3300025922 | Bacteria | 1687 |
| 792 | Ga0207646_10248979 | 3300025922 | Bacteria | 1605 |
| 793 | Ga0207681_10000921 | 3300025923 | Bacteria | 19202 |
| 794 | Ga0207681_10001456 | 3300025923 | Bacteria | 15236 |
| 795 | Ga0207681_10003904 | 3300025923 | Bacteria | 9252 |
| 796 | Ga0207681_10005449 | 3300025923 | Bacteria | 7812 |
| 797 | Ga0207681_10020067 | 3300025923 | Bacteria | 4231 |
| 798 | Ga0207681_10031873 | 3300025923 | Bacteria | 3445 |
| 799 | Ga0207681_10117087 | 3300025923 | Bacteria | 1948 |
| 800 | Ga0207681_10284402 | 3300025923 | Bacteria | 1303 |
| 801 | Ga0207694_10135749 | 3300025924 | Bacteria | 1975 |
| 802 | Ga0207650_10006954 | 3300025925 | Bacteria | 7713 |
| 803 | Ga0207650_10018698 | 3300025925 | Bacteria | 4866 |
| 804 | Ga0207650_10028886 | 3300025925 | Bacteria | 3981 |
| 805 | Ga0207650_10039543 | 3300025925 | Bacteria | 3446 |
| 806 | Ga0207650_10042551 | 3300025925 | Bacteria | 3332 |
| 807 | Ga0207650_10067277 | 3300025925 | Bacteria | 2688 |
| 808 | Ga0207650_10115619 | 3300025925 | Bacteria | 2082 |
| 809 | Ga0207650_10132476 | 3300025925 | Bacteria | 1952 |
| 810 | Ga0207650_10135504 | 3300025925 | Bacteria | 1931 |
| 811 | Ga0207659_10000959 | 3300025926 | Bacteria | 17245 |
| 812 | Ga0207659_10007653 | 3300025926 | Bacteria | 6665 |
| 813 | Ga0207659_10012855 | 3300025926 | Bacteria | 5345 |
| 814 | Ga0207659_10053718 | 3300025926 | Bacteria | 2874 |
| 815 | Ga0207659_10060754 | 3300025926 | Bacteria | 2721 |
| 816 | Ga0207659_10100538 | 3300025926 | Bacteria | 2179 |
| 817 | Ga0207659_10154739 | 3300025926 | Bacteria | 1794 |
| 818 | Ga0207687_10106619 | 3300025927 | Bacteria | 2072 |
| 819 | Ga0207700_10026269 | 3300025928 | Bacteria | 4058 |
| 820 | Ga0207700_10036414 | 3300025928 | Bacteria | 3554 |
| 821 | Ga0207664_10261591 | 3300025929 | Bacteria | 1513 |
| 822 | Ga0207644_10076837 | 3300025931 | Bacteria | 2458 |
| 823 | Ga0207644_10164498 | 3300025931 | Bacteria | 1727 |
| 824 | Ga0207690_10022305 | 3300025932 | Bacteria | 3936 |
| 825 | Ga0207690_10023620 | 3300025932 | Bacteria | 3839 |
| 826 | Ga0207706_10002035 | 3300025933 | Bacteria | 19832 |
| 827 | Ga0207706_10005841 | 3300025933 | Bacteria | 11445 |
| 828 | Ga0207706_10028938 | 3300025933 | Bacteria | 4946 |
| 829 | Ga0207706_10053166 | 3300025933 | Bacteria | 3575 |
| 830 | Ga0207686_10001079 | 3300025934 | Bacteria | 15961 |
| 831 | Ga0207686_10015176 | 3300025934 | Bacteria | 4304 |
| 832 | Ga0207686_10018632 | 3300025934 | Bacteria | 3933 |
| 833 | Ga0207686_10030722 | 3300025934 | Bacteria | 3184 |
| 834 | Ga0207686_10033926 | 3300025934 | Bacteria | 3050 |
| 835 | Ga0207686_10042605 | 3300025934 | Bacteria | 2776 |
| 836 | Ga0207686_10049385 | 3300025934 | Bacteria | 2611 |
| 837 | Ga0207709_10002980 | 3300025935 | Bacteria | 10315 |
| 838 | Ga0207709_10034936 | 3300025935 | Bacteria | 2968 |
| 839 | Ga0207709_10072298 | 3300025935 | Bacteria | 2193 |
| 840 | Ga0207709_10137952 | 3300025935 | Bacteria | 1672 |
| 841 | Ga0207709_10157252 | 3300025935 | Bacteria | 1581 |
| 842 | Ga0207670_10012034 | 3300025936 | Bacteria | 5043 |
| 843 | Ga0207670_10036246 | 3300025936 | Bacteria | 3206 |
| 844 | Ga0207670_10039944 | 3300025936 | Bacteria | 3077 |
| 845 | Ga0207670_10081319 | 3300025936 | Bacteria | 2267 |
| 846 | Ga0207670_10242798 | 3300025936 | Bacteria | 1388 |
| 847 | Ga0207669_10011707 | 3300025937 | Bacteria | 4281 |
| 848 | Ga0207669_10026425 | 3300025937 | Bacteria | 3157 |
| 849 | Ga0207669_10028160 | 3300025937 | Bacteria | 3087 |
| 850 | Ga0207669_10146520 | 3300025937 | Bacteria | 1647 |
| 851 | Ga0207669_10164508 | 3300025937 | Bacteria | 1571 |
| 852 | Ga0207704_10003676 | 3300025938 | Bacteria | 6974 |
| 853 | Ga0207704_10008696 | 3300025938 | Bacteria | 4869 |
| 854 | Ga0207704_10037526 | 3300025938 | Bacteria | 2799 |
| 855 | Ga0207704_10223226 | 3300025938 | Bacteria | 1396 |
| 856 | Ga0207665_10005278 | 3300025939 | Bacteria | 8635 |
| 857 | Ga0207665_10057769 | 3300025939 | Bacteria | 2621 |
| 858 | Ga0207665_10108523 | 3300025939 | Bacteria | 1947 |
| 859 | Ga0207665_10141623 | 3300025939 | Bacteria | 1715 |
| 860 | Ga0207691_10018044 | 3300025940 | Bacteria | 6681 |
| 861 | Ga0207691_10028811 | 3300025940 | Bacteria | 5196 |
| 862 | Ga0207691_10031365 | 3300025940 | Bacteria | 4961 |
| 863 | Ga0207691_10187260 | 3300025940 | Bacteria | 1806 |
| 864 | Ga0207711_10002753 | 3300025941 | Bacteria | 15495 |
| 865 | Ga0207711_10012732 | 3300025941 | Bacteria | 6986 |
| 866 | Ga0207711_10020060 | 3300025941 | Bacteria | 5571 |
| 867 | Ga0207711_10030222 | 3300025941 | Bacteria | 4569 |
| 868 | Ga0207711_10057259 | 3300025941 | Bacteria | 3351 |
| 869 | Ga0207711_10290926 | 3300025941 | Bacteria | 1506 |
| 870 | Ga0207711_10404715 | 3300025941 | Bacteria | 1268 |
| 871 | Ga0207689_10004653 | 3300025942 | Bacteria | 12412 |
| 872 | Ga0207689_10044042 | 3300025942 | Bacteria | 3689 |
| 873 | Ga0207689_10101234 | 3300025942 | Bacteria | 2367 |
| 874 | Ga0207689_10204162 | 3300025942 | Bacteria | 1632 |
| 875 | Ga0207661_10001853 | 3300025944 | Bacteria | 14467 |
| 876 | Ga0207661_10021271 | 3300025944 | Bacteria | 4859 |
| 877 | Ga0207661_10043353 | 3300025944 | Bacteria | 3550 |
| 878 | Ga0207661_10059157 | 3300025944 | Bacteria | 3087 |
| 879 | Ga0207661_10084492 | 3300025944 | Bacteria | 2629 |
| 880 | Ga0207661_10102602 | 3300025944 | Bacteria | 2405 |
| 881 | Ga0207661_10152829 | 3300025944 | Bacteria | 1996 |
| 882 | Ga0207679_10001341 | 3300025945 | Bacteria | 15577 |
| 883 | Ga0207679_10001347 | 3300025945 | Bacteria | 15488 |
| 884 | Ga0207679_10002943 | 3300025945 | Bacteria | 10549 |
| 885 | Ga0207679_10006574 | 3300025945 | Bacteria | 7350 |
| 886 | Ga0207679_10040166 | 3300025945 | Bacteria | 3347 |
| 887 | Ga0207679_10381630 | 3300025945 | Bacteria | 1236 |
| 888 | Ga0207667_10002033 | 3300025949 | Bacteria | 25353 |
| 889 | Ga0207667_10004001 | 3300025949 | Bacteria | 18104 |
| 890 | Ga0207667_10016094 | 3300025949 | Bacteria | 8465 |
| 891 | Ga0207667_10042200 | 3300025949 | Bacteria | 4850 |
| 892 | Ga0207667_10044959 | 3300025949 | Bacteria | 4677 |
| 893 | Ga0207667_10071599 | 3300025949 | Bacteria | 3604 |
| 894 | Ga0207651_10001504 | 3300025960 | Bacteria | 10623 |
| 895 | Ga0207651_10035925 | 3300025960 | Bacteria | 3229 |
| 896 | Ga0207651_10080597 | 3300025960 | Bacteria | 2343 |
| 897 | Ga0207651_10161489 | 3300025960 | Bacteria | 1757 |
| 898 | Ga0207712_10000596 | 3300025961 | Bacteria | 28910 |
| 899 | Ga0207712_10002234 | 3300025961 | Bacteria | 12602 |
| 900 | Ga0207712_10009138 | 3300025961 | Bacteria | 6272 |
| 901 | Ga0207712_10023580 | 3300025961 | Bacteria | 4063 |
| 902 | Ga0207712_10043142 | 3300025961 | Bacteria | 3110 |
| 903 | Ga0207712_10058166 | 3300025961 | Bacteria | 2731 |
| 904 | Ga0207712_10058973 | 3300025961 | Bacteria | 2714 |
| 905 | Ga0207712_10152678 | 3300025961 | Bacteria | 1786 |
| 906 | Ga0207668_10001639 | 3300025972 | Bacteria | 13068 |
| 907 | Ga0207668_10024669 | 3300025972 | Bacteria | 3884 |
| 908 | Ga0207668_10028177 | 3300025972 | Bacteria | 3669 |
| 909 | Ga0207668_10031247 | 3300025972 | Bacteria | 3505 |
| 910 | Ga0207668_10047791 | 3300025972 | Bacteria | 2932 |
| 911 | Ga0207668_10310721 | 3300025972 | Bacteria | 1304 |
| 912 | Ga0207658_10035012 | 3300025986 | Bacteria | 3593 |
| 913 | Ga0207677_10017448 | 3300026023 | Bacteria | 4279 |
| 914 | Ga0207677_10119516 | 3300026023 | Bacteria | 1979 |
| 915 | Ga0207677_10189306 | 3300026023 | Bacteria | 1626 |
| 916 | Ga0207677_10298127 | 3300026023 | Bacteria | 1331 |
| 917 | Ga0207703_10008320 | 3300026035 | Bacteria | 8196 |
| 918 | Ga0207703_10012297 | 3300026035 | Bacteria | 6674 |
| 919 | Ga0207703_10093383 | 3300026035 | Bacteria | 2534 |
| 920 | Ga0207703_10101060 | 3300026035 | Bacteria | 2445 |
| 921 | Ga0207703_10139787 | 3300026035 | Bacteria | 2100 |
| 922 | Ga0207703_10170199 | 3300026035 | Bacteria | 1915 |
| 923 | Ga0207703_10235862 | 3300026035 | Bacteria | 1642 |
| 924 | Ga0207703_10301979 | 3300026035 | Bacteria | 1460 |
| 925 | Ga0207639_10019041 | 3300026041 | Bacteria | 4888 |
| 926 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 927 | Ga0207678_10035455 | 3300026067 | Bacteria | 4343 |
| 928 | Ga0207678_10039362 | 3300026067 | Bacteria | 4104 |
| 929 | Ga0207678_10095005 | 3300026067 | Bacteria | 2547 |
| 930 | Ga0207678_10207924 | 3300026067 | Bacteria | 1674 |
| 931 | Ga0207678_10296505 | 3300026067 | Bacteria | 1389 |
| 932 | Ga0207708_10004898 | 3300026075 | Bacteria | 9870 |
| 933 | Ga0207708_10007880 | 3300026075 | Bacteria | 7891 |
| 934 | Ga0207708_10054897 | 3300026075 | Bacteria | 3037 |
| 935 | Ga0207708_10090622 | 3300026075 | Bacteria | 2357 |
| 936 | Ga0207708_10122644 | 3300026075 | Bacteria | 2026 |
| 937 | Ga0207702_10000678 | 3300026078 | Bacteria | 36963 |
| 938 | Ga0207702_10066250 | 3300026078 | Bacteria | 3095 |
| 939 | Ga0207702_10209393 | 3300026078 | Bacteria | 1812 |
| 940 | Ga0207641_10006730 | 3300026088 | Bacteria | 9631 |
| 941 | Ga0207641_10011831 | 3300026088 | Bacteria | 7160 |
| 942 | Ga0207641_10114560 | 3300026088 | Bacteria | 2396 |
| 943 | Ga0207648_10016323 | 3300026089 | Bacteria | 6789 |
| 944 | Ga0207648_10052941 | 3300026089 | Bacteria | 3549 |
| 945 | Ga0207648_10079224 | 3300026089 | Bacteria | 2866 |
| 946 | Ga0207648_10083752 | 3300026089 | Bacteria | 2781 |
| 947 | Ga0207648_10085952 | 3300026089 | Bacteria | 2744 |
| 948 | Ga0207648_10145976 | 3300026089 | Bacteria | 2087 |
| 949 | Ga0207648_10222012 | 3300026089 | Bacteria | 1680 |
| 950 | Ga0207676_10011825 | 3300026095 | Bacteria | 6244 |
| 951 | Ga0207676_10048181 | 3300026095 | Bacteria | 3307 |
| 952 | Ga0207676_10052602 | 3300026095 | Bacteria | 3184 |
| 953 | Ga0207676_10213603 | 3300026095 | Bacteria | 1713 |
| 954 | Ga0207674_10019696 | 3300026116 | Bacteria | 7304 |
| 955 | Ga0207674_10100148 | 3300026116 | Bacteria | 2879 |
| 956 | Ga0207674_10156626 | 3300026116 | Bacteria | 2233 |
| 957 | Ga0207674_10164710 | 3300026116 | Bacteria | 2171 |
| 958 | Ga0207674_10194383 | 3300026116 | Bacteria | 1979 |
| 959 | Ga0207674_10295767 | 3300026116 | Bacteria | 1568 |
| 960 | Ga0207674_10295768 | 3300026116 | Bacteria | 1568 |
| 961 | Ga0207675_100001482 | 3300026118 | Bacteria | 23584 |
| 962 | Ga0207675_100013949 | 3300026118 | Bacteria | 7491 |
| 963 | Ga0207675_100022225 | 3300026118 | Bacteria | 5906 |
| 964 | Ga0207675_100034087 | 3300026118 | Bacteria | 4745 |
| 965 | Ga0207675_100059999 | 3300026118 | Bacteria | 3551 |
| 966 | Ga0207675_100086719 | 3300026118 | Bacteria | 2939 |
| 967 | Ga0207675_100151309 | 3300026118 | Bacteria | 2209 |
| 968 | Ga0207683_10001846 | 3300026121 | Bacteria | 18729 |
| 969 | Ga0207683_10120249 | 3300026121 | Bacteria | 2357 |
| 970 | Ga0207698_10063499 | 3300026142 | Bacteria | 2890 |
| 971 | Ga0207698_10107570 | 3300026142 | Bacteria | 2329 |
| 972 | Ga0207698_10394090 | 3300026142 | Bacteria | 1321 |
| 973 | Ga0209973_1001352 | 3300027252 | Bacteria | 2129 |
| 974 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 975 | Ga0209969_1000998 | 3300027360 | Bacteria | 3845 |
| 976 | Ga0209969_1005374 | 3300027360 | Bacteria | 1795 |
| 977 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 978 | Ga0209967_1005224 | 3300027364 | Bacteria | 1741 |
| 979 | Ga0209967_1007178 | 3300027364 | Bacteria | 1519 |
| 980 | Ga0209981_1002218 | 3300027378 | Bacteria | 2475 |
| 981 | Ga0209996_1000062 | 3300027395 | Bacteria | 14921 |
| 982 | Ga0209984_1000027 | 3300027424 | Bacteria | 15251 |
| 983 | Ga0209984_1001796 | 3300027424 | Bacteria | 2356 |
| 984 | Ga0210000_1000018 | 3300027462 | Bacteria | 28094 |
| 985 | Ga0210000_1002528 | 3300027462 | Bacteria | 2605 |
| 986 | Ga0209995_1000072 | 3300027471 | Bacteria | 16055 |
| 987 | Ga0209995_1002667 | 3300027471 | Bacteria | 2832 |
| 988 | Ga0209995_1009379 | 3300027471 | Bacteria | 1582 |
| 989 | Ga0209968_1000094 | 3300027526 | Bacteria | 16055 |
| 990 | Ga0209968_1005632 | 3300027526 | Bacteria | 1882 |
| 991 | Ga0209982_1000629 | 3300027552 | Bacteria | 4440 |
| 992 | Ga0209970_1011065 | 3300027614 | Bacteria | 1481 |
| 993 | Ga0210002_1001045 | 3300027617 | Bacteria | 3828 |
| 994 | Ga0209983_1004487 | 3300027665 | Bacteria | 2933 |
| 995 | Ga0209588_1000683 | 3300027671 | Bacteria | 8541 |
| 996 | Ga0209588_1010983 | 3300027671 | Bacteria | 2730 |
| 997 | Ga0209588_1018885 | 3300027671 | Bacteria | 2148 |
| 998 | Ga0209971_1000266 | 3300027682 | Bacteria | 14793 |
| 999 | Ga0209971_1010223 | 3300027682 | Bacteria | 2222 |
| 1000 | Ga0209971_1011157 | 3300027682 | Bacteria | 2128 |
| 1001 | Ga0209971_1011882 | 3300027682 | Bacteria | 2061 |
| 1002 | Ga0209966_1008167 | 3300027695 | Bacteria | 1853 |
| 1003 | Ga0209998_10003141 | 3300027717 | Bacteria | 3661 |
| 1004 | Ga0209974_10011093 | 3300027876 | Bacteria | 3034 |
| 1005 | Ga0207428_10000452 | 3300027907 | Bacteria | 49793 |
| 1006 | Ga0207428_10002442 | 3300027907 | Bacteria | 18563 |
| 1007 | Ga0207428_10002487 | 3300027907 | Bacteria | 18400 |
| 1008 | Ga0207428_10002947 | 3300027907 | Bacteria | 16839 |
| 1009 | Ga0207428_10008077 | 3300027907 | Bacteria | 9546 |
| 1010 | Ga0207428_10019254 | 3300027907 | Bacteria | 5820 |
| 1011 | Ga0207428_10019939 | 3300027907 | Bacteria | 5710 |
| 1012 | Ga0207428_10024590 | 3300027907 | Bacteria | 5057 |
| 1013 | Ga0207428_10087244 | 3300027907 | Bacteria | 2428 |
| 1014 | Ga0207428_10155353 | 3300027907 | Bacteria | 1740 |
| 1015 | Ga0268266_10016375 | 3300028379 | Bacteria | 6339 |
| 1016 | Ga0268266_10038713 | 3300028379 | Bacteria | 4059 |
| 1017 | Ga0268266_10069684 | 3300028379 | Bacteria | 3047 |
| 1018 | Ga0268266_10290198 | 3300028379 | Bacteria | 1523 |
| 1019 | Ga0268265_10000619 | 3300028380 | Bacteria | 35414 |
| 1020 | Ga0268265_10002653 | 3300028380 | Bacteria | 13279 |
| 1021 | Ga0268265_10003125 | 3300028380 | Bacteria | 12070 |
| 1022 | Ga0268265_10004276 | 3300028380 | Bacteria | 9964 |
| 1023 | Ga0268265_10023953 | 3300028380 | Bacteria | 4311 |
| 1024 | Ga0268265_10056115 | 3300028380 | Bacteria | 2995 |
| 1025 | Ga0268265_10148761 | 3300028380 | Bacteria | 1972 |
| 1026 | Ga0268264_10001609 | 3300028381 | Bacteria | 20890 |
| 1027 | Ga0268264_10002890 | 3300028381 | Bacteria | 14938 |
| 1028 | Ga0268264_10028955 | 3300028381 | Bacteria | 4534 |
| 1029 | Ga0268264_10076084 | 3300028381 | Bacteria | 2855 |
| 1030 | Ga0268264_10125894 | 3300028381 | Bacteria | 2264 |
| 1031 | Ga0268264_10142124 | 3300028381 | Bacteria | 2141 |
| 1032 | Ga0265334_10000037 | 3300028573 | Bacteria | 102928 |
| 1033 | Ga0265318_10001354 | 3300028577 | Bacteria | 14601 |
| 1034 | Ga0307517_10023999 | 3300028786 | Bacteria | 7543 |
| 1035 | Ga0265338_10083880 | 3300028800 | Bacteria | 2663 |
| 1036 | Ga0265330_10026535 | 3300031235 | Bacteria | 2620 |
| 1037 | Ga0265330_10040631 | 3300031235 | Bacteria | 2065 |
| 1038 | Ga0265332_10003683 | 3300031238 | Bacteria | 7337 |
| 1039 | Ga0265332_10025986 | 3300031238 | Bacteria | 2569 |
| 1040 | Ga0265320_10006474 | 3300031240 | Bacteria | 7383 |
| 1041 | Ga0265320_10069334 | 3300031240 | Bacteria | 1664 |
| 1042 | Ga0265325_10001769 | 3300031241 | Bacteria | 14972 |
| 1043 | Ga0265325_10042129 | 3300031241 | Bacteria | 2389 |
| 1044 | Ga0265325_10042338 | 3300031241 | Bacteria | 2382 |
| 1045 | Ga0265340_10003857 | 3300031247 | Bacteria | 8447 |
| 1046 | Ga0265340_10008522 | 3300031247 | Bacteria | 5533 |
| 1047 | Ga0265340_10009510 | 3300031247 | Bacteria | 5212 |
| 1048 | Ga0265331_10030089 | 3300031250 | Bacteria | 2705 |
| 1049 | Ga0265331_10033286 | 3300031250 | Bacteria | 2549 |
| 1050 | Ga0265327_10034681 | 3300031251 | Bacteria | 2797 |
| 1051 | Ga0265327_10068129 | 3300031251 | Bacteria | 1791 |
| 1052 | Ga0265316_10018043 | 3300031344 | Bacteria | 6080 |
| 1053 | Ga0307513_10204004 | 3300031456 | Bacteria | 1815 |
| 1054 | Ga0307408_100002257 | 3300031548 | Bacteria | 13743 |
| 1055 | Ga0307408_100002760 | 3300031548 | Bacteria | 12197 |
| 1056 | Ga0307408_100170999 | 3300031548 | Bacteria | 1735 |
| 1057 | Ga0307408_100189027 | 3300031548 | Bacteria | 1658 |
| 1058 | Ga0265313_10001884 | 3300031595 | Bacteria | 19075 |
| 1059 | Ga0265313_10055251 | 3300031595 | Bacteria | 1881 |
| 1060 | Ga0307508_10026303 | 3300031616 | Bacteria | 5274 |
| 1061 | Ga0307508_10047547 | 3300031616 | Bacteria | 3826 |
| 1062 | Ga0316575_10000334 | 3300031665 | Bacteria | 13240 |
| 1063 | Ga0316579_10098817 | 3300031691 | Bacteria | 1397 |
| 1064 | Ga0265314_10004347 | 3300031711 | Bacteria | 13204 |
| 1065 | Ga0265314_10004621 | 3300031711 | Bacteria | 12682 |
| 1066 | Ga0265314_10014975 | 3300031711 | Bacteria | 6175 |
| 1067 | Ga0265314_10031643 | 3300031711 | Bacteria | 3902 |
| 1068 | Ga0265314_10140826 | 3300031711 | Bacteria | 1491 |
| 1069 | Ga0265342_10025101 | 3300031712 | Bacteria | 3752 |
| 1070 | Ga0316576_10015331 | 3300031727 | Bacteria | 5141 |
| 1071 | Ga0316578_10069120 | 3300031728 | Bacteria | 2089 |
| 1072 | Ga0307405_10000834 | 3300031731 | Bacteria | 12135 |
| 1073 | Ga0307405_10051255 | 3300031731 | Bacteria | 2560 |
| 1074 | Ga0307405_10106508 | 3300031731 | Bacteria | 1891 |
| 1075 | Ga0316577_10000808 | 3300031733 | Bacteria | 13589 |
| 1076 | Ga0307413_10001842 | 3300031824 | Bacteria | 8343 |
| 1077 | Ga0307413_10006517 | 3300031824 | Bacteria | 5343 |
| 1078 | Ga0307413_10006826 | 3300031824 | Bacteria | 5248 |
| 1079 | Ga0307413_10029378 | 3300031824 | Bacteria | 3074 |
| 1080 | Ga0307413_10088705 | 3300031824 | Bacteria | 2007 |
| 1081 | Ga0307413_10130446 | 3300031824 | Bacteria | 1719 |
| 1082 | Ga0307410_10001490 | 3300031852 | Bacteria | 10610 |
| 1083 | Ga0307410_10037876 | 3300031852 | Bacteria | 3154 |
| 1084 | Ga0307410_10045318 | 3300031852 | Bacteria | 2927 |
| 1085 | Ga0307410_10046976 | 3300031852 | Bacteria | 2883 |
| 1086 | Ga0307410_10049143 | 3300031852 | Bacteria | 2830 |
| 1087 | Ga0307410_10100632 | 3300031852 | Bacteria | 2071 |
| 1088 | Ga0307406_10001264 | 3300031901 | Bacteria | 14150 |
| 1089 | Ga0307406_10002275 | 3300031901 | Bacteria | 10446 |
| 1090 | Ga0307406_10015689 | 3300031901 | Bacteria | 4390 |
| 1091 | Ga0307406_10025885 | 3300031901 | Bacteria | 3516 |
| 1092 | Ga0307406_10057841 | 3300031901 | Bacteria | 2489 |
| 1093 | Ga0307407_10017582 | 3300031903 | Bacteria | 3593 |
| 1094 | Ga0307407_10038507 | 3300031903 | Bacteria | 2650 |
| 1095 | Ga0307407_10090479 | 3300031903 | Bacteria | 1874 |
| 1096 | Ga0307412_10007821 | 3300031911 | Bacteria | 6085 |
| 1097 | Ga0307412_10009892 | 3300031911 | Bacteria | 5483 |
| 1098 | Ga0307412_10058964 | 3300031911 | Bacteria | 2570 |
| 1099 | Ga0307412_10079641 | 3300031911 | Bacteria | 2261 |
| 1100 | Ga0307412_10163159 | 3300031911 | Bacteria | 1658 |
| 1101 | Ga0307409_100007839 | 3300031995 | Bacteria | 6426 |
| 1102 | Ga0307409_100009070 | 3300031995 | Bacteria | 6087 |
| 1103 | Ga0307409_100019491 | 3300031995 | Bacteria | 4595 |
| 1104 | Ga0307409_100055682 | 3300031995 | Bacteria | 3055 |
| 1105 | Ga0307409_100096366 | 3300031995 | Bacteria | 2440 |
| 1106 | Ga0307409_100178900 | 3300031995 | Bacteria | 1875 |
| 1107 | Ga0307416_100001472 | 3300032002 | Bacteria | 12830 |
| 1108 | Ga0307416_100083952 | 3300032002 | Bacteria | 2704 |
| 1109 | Ga0307416_100096391 | 3300032002 | Bacteria | 2558 |
| 1110 | Ga0307416_100274081 | 3300032002 | Bacteria | 1659 |
| 1111 | Ga0307416_100523430 | 3300032002 | Bacteria | 1254 |
| 1112 | Ga0307414_10004583 | 3300032004 | Bacteria | 7521 |
| 1113 | Ga0307414_10080884 | 3300032004 | Bacteria | 2377 |
| 1114 | Ga0307414_10179904 | 3300032004 | Bacteria | 1700 |
| 1115 | Ga0307411_10007737 | 3300032005 | Bacteria | 5504 |
| 1116 | Ga0307411_10041503 | 3300032005 | Bacteria | 2928 |
| 1117 | Ga0307411_10107058 | 3300032005 | Bacteria | 1991 |
| 1118 | Ga0307411_10153895 | 3300032005 | Bacteria | 1713 |
| 1119 | Ga0307415_100001337 | 3300032126 | Bacteria | 11702 |
| 1120 | Ga0307415_100004471 | 3300032126 | Bacteria | 7257 |
| 1121 | Ga0307415_100017287 | 3300032126 | Bacteria | 4322 |
| 1122 | Ga0307415_100055843 | 3300032126 | Bacteria | 2704 |
| 1123 | Ga0307415_100095105 | 3300032126 | Bacteria | 2168 |
| 1124 | Ga0307415_100340738 | 3300032126 | Bacteria | 1258 |
| 1125 | Ga0316583_10001183 | 3300032133 | Bacteria | 8556 |
| 1126 | Ga0316585_10037261 | 3300032137 | Bacteria | 1543 |
| 1127 | Ga0316593_10051045 | 3300032168 | Bacteria | 1397 |
| 1128 | Ga0307510_10061720 | 3300033180 | Bacteria | 3838 |
| 1129 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 1130 | Ga0316592_1003439 | 3300033524 | Bacteria | 2851 |
| 1131 | Ga0316592_1008612 | 3300033524 | Bacteria | 2022 |
| 1132 | Ga0316588_1000228 | 3300033528 | Bacteria | 6735 |
| 1133 | Ga0316588_1006825 | 3300033528 | Bacteria | 2297 |
| 1134 | Ga0316588_1016804 | 3300033528 | Bacteria | 1626 |
| 1135 | Ga0316587_1000001 | 3300033529 | Bacteria | 17933 |
| 1136 | Ga0316587_1000006 | 3300033529 | Bacteria | 12250 |
| 1137 | Ga0316596_1028364 | 3300033541 | Bacteria | 1447 |
| 1138 | Ga0316215_1002072 | 3300033544 | Bacteria | 1898 |
| 1139 | Ga0373930_0008465 | 3300034816 | Bacteria | 1800 |
| 1140 | Ga0373948_0008982 | 3300034817 | Bacteria | 1715 |
| 1141 | Ga0373950_0016909 | 3300034818 | Bacteria | 1251 |
| 1142 | Ga0373959_0004698 | 3300034820 | Bacteria | 2214 |
| 1143 | Ga0373959_0008900 | 3300034820 | Bacteria | 1719 |
| 1144 | Ga0373938_0019036 | 3300034957 | Bacteria | 1369 |
| 1145 | Ga0373926_0002802 | 3300035083 | Bacteria | 5566 |
| 1146 | Ga0373926_0015003 | 3300035083 | Bacteria | 2639 |
| 1147 | Ga0373926_0025049 | 3300035083 | Bacteria | 2081 |
| 1148 | Ga0373928_0001860 | 3300035084 | Bacteria | 4119 |
| 1149 | Ga0373928_0017566 | 3300035084 | Bacteria | 1474 |
| 1150 | Ga0373929_0012636 | 3300035085 | Bacteria | 1607 |
| 1151 | Ga0373934_0000472 | 3300035086 | Bacteria | 14068 |
| 1152 | Ga0373934_0016588 | 3300035086 | Bacteria | 2800 |
| 1153 | Ga0373934_0069427 | 3300035086 | Bacteria | 1408 |
| 1154 | Ga0373934_0071452 | 3300035086 | Bacteria | 1388 |
| 1155 | Ga0373940_0000987 | 3300035088 | Bacteria | 4856 |
| 1156 | Ga0373949_0003354 | 3300035090 | Bacteria | 3841 |
| 1157 | Ga0373949_0010232 | 3300035090 | Bacteria | 2055 |
| 1158 | Ga0373949_0011969 | 3300035090 | Bacteria | 1915 |
| 1159 | Ga0373923_0026151 | 3300035111 | Bacteria | 2320 |
| 1160 | Ga0373923_0032751 | 3300035111 | Bacteria | 2101 |
| 1161 | Ga0373939_0010982 | 3300035114 | Bacteria | 2277 |
| 1162 | Ga0373939_0011969 | 3300035114 | Bacteria | 2202 |
| 1163 | Ga0373939_0016474 | 3300035114 | Bacteria | 1949 |
| 1164 | Ga0373939_0019524 | 3300035114 | Bacteria | 1830 |
| 1165 | Ga0373941_0011416 | 3300035115 | Bacteria | 2295 |
| 1166 | Ga0373941_0029431 | 3300035115 | Bacteria | 1620 |
| 1167 | Ga0373941_0042549 | 3300035115 | Bacteria | 1411 |
| 1168 | Ga0373941_0068417 | 3300035115 | Bacteria | 1173 |
| 1169 | Ga0373945_0085162 | 3300035116 | Bacteria | 1216 |
| 1170 | Ga0373953_0005866 | 3300035117 | Bacteria | 4014 |
| 1171 | Ga0373953_0028142 | 3300035117 | Bacteria | 2165 |
| 1172 | Ga0373954_0031264 | 3300035118 | Bacteria | 2457 |
| 1173 | Ga0373954_0087250 | 3300035118 | Bacteria | 1495 |
| 1174 | Ga0373956_0001329 | 3300035119 | Bacteria | 10206 |
| 1175 | Ga0373956_0038502 | 3300035119 | Bacteria | 2115 |
| 1176 | Ga0373956_0076406 | 3300035119 | Bacteria | 1532 |
| 1177 | Ga0373956_0078110 | 3300035119 | Bacteria | 1516 |
| 1178 | Ga0373957_0025695 | 3300035120 | Bacteria | 2125 |
| 1179 | Ga0373957_0030047 | 3300035120 | Bacteria | 1989 |
| 1180 | Ga0373957_0045634 | 3300035120 | Bacteria | 1661 |
| 1181 | Ga0373960_0009168 | 3300035121 | Bacteria | 2389 |
| 1182 | Ga0373960_0017396 | 3300035121 | Bacteria | 1863 |
| 1183 | Ga0373960_0019913 | 3300035121 | Bacteria | 1768 |
| 1184 | Ga0373943_0014563 | 3300035170 | Bacteria | 3563 |
| 1185 | Ga0373943_0097484 | 3300035170 | Bacteria | 1532 |
| 1186 | Ga0373946_0007151 | 3300035171 | Bacteria | 4076 |
| 1187 | Ga0373946_0018716 | 3300035171 | Bacteria | 2662 |
| 1188 | Ga0373946_0027375 | 3300035171 | Bacteria | 2255 |
| 1189 | Ga0373946_0095766 | 3300035171 | Bacteria | 1323 |
| 1190 | Ga0373955_0000309 | 3300035172 | Bacteria | 20251 |
| 1191 | Ga0373955_0012698 | 3300035172 | Bacteria | 4055 |
| 1192 | Ga0373955_0043063 | 3300035172 | Bacteria | 2427 |
| 1193 | Ga0373942_0008030 | 3300035207 | Bacteria | 2454 |
| 1194 | Ga0373942_0027676 | 3300035207 | Bacteria | 1476 |
| 1195 | Ga0373942_0034045 | 3300035207 | Bacteria | 1361 |
| 1196 | Ga0373942_0035913 | 3300035207 | Bacteria | 1332 |
| 1197 | Ga0373961_0020667 | 3300035241 | Bacteria | 1743 |
| 1198 | Ga0373961_0029361 | 3300035241 | Bacteria | 1522 |
| 1199 | Ga0373961_0034513 | 3300035241 | Bacteria | 1430 |
| 1200 | Ga0373962_0002684 | 3300035242 | Bacteria | 4233 |
| 1201 | Ga0373962_0013863 | 3300035242 | Bacteria | 2048 |
| 1202 | Ga0373962_0016237 | 3300035242 | Bacteria | 1918 |
| 1203 | Ga0373962_0021559 | 3300035242 | Bacteria | 1701 |
| 1204 | Ga0373924_0001445 | 3300035410 | Bacteria | 7710 |
| 1205 | Ga0373924_0011533 | 3300035410 | Bacteria | 3285 |
| 1206 | Ga0373931_0003223 | 3300035691 | Bacteria | 7288 |
| 1207 | Ga0373931_0008373 | 3300035691 | Bacteria | 4902 |
| 1208 | Ga0373931_0020620 | 3300035691 | Bacteria | 3299 |
| 1209 | Ga0373931_0035165 | 3300035691 | Bacteria | 2603 |
| 1210 | Ga0373931_0047139 | 3300035691 | Bacteria | 2280 |
| 1211 | Ga0373931_0072741 | 3300035691 | Bacteria | 1880 |
| 1212 | Ga0373931_0132212 | 3300035691 | Bacteria | 1437 |
| 1213 | Ga0373931_0135530 | 3300035691 | Bacteria | 1421 |
| 1214 | Ga0373935_0001142 | 3300035692 | Bacteria | 14517 |
| 1215 | Ga0373935_0008159 | 3300035692 | Bacteria | 6277 |
| 1216 | Ga0373935_0090314 | 3300035692 | Bacteria | 2004 |
| 1217 | Ga0373927_0029867 | 3300035695 | Bacteria | 3555 |
| 1218 | Ga0373927_0036111 | 3300035695 | Bacteria | 3214 |
| 1219 | Ga0373927_0053681 | 3300035695 | Bacteria | 2607 |
| 1220 | Ga0373927_0095902 | 3300035695 | Bacteria | 1928 |
| 1221 | Ga0373933_0000191 | 3300035724 | Bacteria | 40734 |
| 1222 | Ga0373933_0000226 | 3300035724 | Bacteria | 37516 |
| 1223 | Ga0373933_0002765 | 3300035724 | Bacteria | 9786 |
| 1224 | Ga0373933_0026815 | 3300035724 | Bacteria | 3312 |
| 1225 | Ga0373933_0057615 | 3300035724 | Bacteria | 2335 |
| 1226 | Ga0373933_0070349 | 3300035724 | Bacteria | 2128 |
| 1227 | Ga0373933_0082667 | 3300035724 | Bacteria | 1971 |
| 1228 | Ga0373933_0115338 | 3300035724 | Bacteria | 1678 |
| 1229 | Ga0373947_0012496 | 3300035725 | Bacteria | 4869 |
| 1230 | Ga0373947_0018231 | 3300035725 | Bacteria | 4040 |
| 1231 | Ga0373947_0028579 | 3300035725 | Bacteria | 3270 |
| 1232 | Ga0373947_0075744 | 3300035725 | Bacteria | 2072 |
| 1233 | Ga0373947_0106809 | 3300035725 | Bacteria | 1765 |
| 1234 | Ga0373947_0147968 | 3300035725 | Bacteria | 1511 |
| 1235 | Ga0310104_02351 | 3300036242 | Bacteria | 1622 |
| 1236 | Ga0373937_0000625 | 3300036401 | Bacteria | 31052 |
| 1237 | Ga0373937_0000922 | 3300036401 | Bacteria | 24939 |
| 1238 | Ga0373937_0007608 | 3300036401 | Bacteria | 9383 |
| 1239 | Ga0373937_0011530 | 3300036401 | Bacteria | 7759 |
| 1240 | Ga0373937_0020942 | 3300036401 | Bacteria | 5865 |
| 1241 | Ga0373937_0042587 | 3300036401 | Bacteria | 4142 |
| 1242 | Ga0373937_0057225 | 3300036401 | Bacteria | 3581 |
| 1243 | Ga0373937_0077479 | 3300036401 | Bacteria | 3072 |
| 1244 | Ga0373937_0082050 | 3300036401 | Bacteria | 2983 |
| 1245 | Ga0373937_0087155 | 3300036401 | Bacteria | 2889 |
| 1246 | Ga0373937_0110593 | 3300036401 | Bacteria | 2555 |
| 1247 | Ga0373937_0128072 | 3300036401 | Bacteria | 2369 |
| 1248 | Ga0373937_0144716 | 3300036401 | Bacteria | 2224 |
| 1249 | Ga0373937_0364132 | 3300036401 | Bacteria | 1370 |
| 1250 | Ga0373937_0560283 | 3300036401 | Bacteria | 1085 |
| 1251 | Ga0316582_0010203 | 3300036647 | Bacteria | 5134 |
| 1252 | Ga0316582_0020988 | 3300036647 | Bacteria | 3850 |
| 1253 | Ga0316582_0145583 | 3300036647 | Bacteria | 1599 |
| 1254 | Ga0316582_0159975 | 3300036647 | Bacteria | 1525 |
| 1255 | Ga0316584_0186233 | 3300036712 | Bacteria | 1536 |
| 1256 | Ga0373925_0011980 | 3300037068 | Bacteria | 6278 |
| 1257 | Ga0373925_0015764 | 3300037068 | Bacteria | 5468 |
| 1258 | Ga0373925_0029577 | 3300037068 | Bacteria | 4019 |
| 1259 | Ga0373925_0029981 | 3300037068 | Bacteria | 3991 |
| 1260 | Ga0373925_0042031 | 3300037068 | Bacteria | 3390 |
| 1261 | Ga0373925_0045962 | 3300037068 | Bacteria | 3245 |
| 1262 | Ga0373925_0065943 | 3300037068 | Bacteria | 2728 |
| 1263 | Ga0373925_0087086 | 3300037068 | Bacteria | 2384 |
| 1264 | Ga0373925_0103338 | 3300037068 | Bacteria | 2193 |
| 1265 | Ga0373925_0114848 | 3300037068 | Bacteria | 2084 |
| 1266 | Ga0373925_0116539 | 3300037068 | Bacteria | 2069 |
| 1267 | Ga0373925_0128704 | 3300037068 | Bacteria | 1972 |
| 1268 | Ga0373925_0216071 | 3300037068 | Bacteria | 1529 |
| 1269 | Ga0373925_0219440 | 3300037068 | Bacteria | 1517 |
| 1270 | Ga0395899_0009753 | 3300037312 | Bacteria | 7369 |
| 1271 | Ga0395899_0126969 | 3300037312 | Bacteria | 1823 |
| 1272 | Ga0395900_0001056 | 3300037418 | Bacteria | 35315 |
| 1273 | Ga0395900_0006668 | 3300037418 | Bacteria | 11995 |
| 1274 | Ga0395900_0013202 | 3300037418 | Bacteria | 8444 |
| 1275 | Ga0395900_0037244 | 3300037418 | Bacteria | 5017 |
| 1276 | Ga0395900_0058815 | 3300037418 | Bacteria | 3957 |
| 1277 | Ga0395900_0304856 | 3300037418 | Bacteria | 1577 |
| 1278 | Ga0395898_0004457 | 3300037466 | Bacteria | 15305 |
| 1279 | Ga0395898_0007760 | 3300037466 | Bacteria | 11394 |
| 1280 | Ga0395898_0039516 | 3300037466 | Bacteria | 4670 |
| 1281 | Ga0395898_0047677 | 3300037466 | Bacteria | 4203 |
| 1282 | Ga0395898_0158194 | 3300037466 | Bacteria | 2167 |
| 1283 | Ga0395905_0025260 | 3300037471 | Bacteria | 5602 |
| 1284 | Ga0395905_0038275 | 3300037471 | Bacteria | 4500 |
| 1285 | Ga0395905_0099808 | 3300037471 | Bacteria | 2726 |
| 1286 | Ga0395905_0155091 | 3300037471 | Bacteria | 2154 |
| 1287 | Ga0395905_0163267 | 3300037471 | Bacteria | 2093 |
| 1288 | Ga0395905_0193597 | 3300037471 | Bacteria | 1907 |
| 1289 | Ga0395905_0206228 | 3300037471 | Bacteria | 1842 |
| 1290 | Ga0395905_0383764 | 3300037471 | Bacteria | 1299 |
| 1291 | Ga0436364_0001908 | 3300037853 | Bacteria | 3522 |
| 1292 | Ga0436364_0931532 | 3300037853 | Bacteria | 1795 |
| 1293 | Ga0395901_0001137 | 3300038443 | Bacteria | 28208 |
| 1294 | Ga0395901_0001770 | 3300038443 | Bacteria | 22280 |
| 1295 | Ga0395901_0001933 | 3300038443 | Bacteria | 21348 |
| 1296 | Ga0395901_0010920 | 3300038443 | Bacteria | 9204 |
| 1297 | Ga0395901_0016009 | 3300038443 | Bacteria | 7639 |
| 1298 | Ga0395901_0388912 | 3300038443 | Bacteria | 1434 |
| 1299 | Ga0436365_0274631 | 3300039437 | Bacteria | 71187 |
| 1300 | Ga0436365_0774305 | 3300039437 | Bacteria | 92788 |
| 1301 | Ga0436365_1048027 | 3300039437 | Bacteria | 4056 |
| 1302 | Ga0436365_1305368 | 3300039437 | Bacteria | 4101 |
| 1303 | Ga0436360_0092949 | 3300039438 | Bacteria | 1627 |
| 1304 | Ga0436360_1325874 | 3300039438 | Bacteria | 11423 |
| 1305 | Ga0436361_0047865 | 3300039447 | Bacteria | 1797 |
| 1306 | Ga0436361_0496850 | 3300039447 | Bacteria | 5498 |
| 1307 | Ga0436363_0329569 | 3300039450 | Bacteria | 6490 |
| 1308 | Ga0436363_1374698 | 3300039450 | Bacteria | 1679 |
| 1309 | Ga0436362_0394382 | 3300039453 | Bacteria | 1273 |
| 1310 | Ga0436362_0603905 | 3300039453 | Bacteria | 5971 |
| 1311 | Ga0439447_009570 | 3300041407 | Bacteria | 2927 |
| 1312 | Ga0439453_0001969 | 3300041408 | Bacteria | 2756 |
| 1313 | Ga0439453_0016685 | 3300041408 | Bacteria | 1283 |
| 1314 | Ga0439461_0004017 | 3300041410 | Bacteria | 2442 |
| 1315 | Ga0439466_0025975 | 3300041411 | Bacteria | 2040 |
| 1316 | Ga0439465_0010957 | 3300041413 | Bacteria | 2845 |
| 1317 | Ga0451855_0958738 | 3300041511 | Bacteria | 6199 |
| 1318 | Ga0439437_001583 | 3300042000 | Bacteria | 2394 |
| 1319 | Ga0439441_003681 | 3300042001 | Bacteria | 2277 |
| 1320 | Ga0439442_009336 | 3300042002 | Bacteria | 1985 |
| 1321 | Ga0439448_0025835 | 3300042005 | Bacteria | 1844 |
| 1322 | Ga0439448_0053979 | 3300042005 | Bacteria | 1320 |
| 1323 | Ga0439450_013574 | 3300042008 | Bacteria | 1639 |
| 1324 | Ga0439455_0009644 | 3300042012 | Bacteria | 2102 |
| 1325 | Ga0439455_0018111 | 3300042012 | Bacteria | 1649 |
| 1326 | Ga0439455_0027284 | 3300042012 | Bacteria | 1398 |
| 1327 | Ga0450921_000329 | 3300042123 | Bacteria | 2128 |
| 1328 | Ga0450923_001795 | 3300042125 | Bacteria | 2940 |
| 1329 | Ga0450923_008971 | 3300042125 | Bacteria | 1737 |
| 1330 | Ga0450888_001021 | 3300042126 | Bacteria | 2642 |
| 1331 | Ga0450902_008086 | 3300042137 | Bacteria | 1637 |
| 1332 | Ga0450910_002597 | 3300042147 | Bacteria | 2379 |
| 1333 | Ga0439458_0012925 | 3300042157 | Bacteria | 1877 |
| 1334 | Ga0439458_0017725 | 3300042157 | Bacteria | 1627 |
| 1335 | Ga0439434_0001339 | 3300042435 | Bacteria | 7101 |
| 1336 | Ga0439434_0020661 | 3300042435 | Bacteria | 1978 |
| 1337 | Ga0439444_0021580 | 3300042437 | Bacteria | 1141 |
| 1338 | Ga0439459_0017297 | 3300042438 | Bacteria | 1342 |
| 1339 | Ga0439464_0010092 | 3300042439 | Bacteria | 2492 |
| 1340 | Ga0439464_0013994 | 3300042439 | Bacteria | 2154 |
| 1341 | Ga0439464_0021224 | 3300042439 | Bacteria | 1782 |
| 1342 | Ga0439464_0025031 | 3300042439 | Bacteria | 1652 |
| 1343 | Ga0439460_0016615 | 3300042461 | Bacteria | 1962 |
| 1344 | Ga0439460_0021671 | 3300042461 | Bacteria | 1758 |
| 1345 | Ga0439460_0034043 | 3300042461 | Bacteria | 1466 |
| 1346 | Ga0450893_0012896 | 3300042532 | Bacteria | 1390 |
| 1347 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 1348 | Ga0451577_0000139 | 3300042876 | Bacteria | 161883 |
| 1349 | Ga0451577_0003185 | 3300042876 | Bacteria | 18443 |
| 1350 | Ga0451577_0107174 | 3300042876 | Bacteria | 2497 |
| 1351 | Ga0451577_0134120 | 3300042876 | Bacteria | 2222 |
| 1352 | Ga0451577_0262410 | 3300042876 | Bacteria | 1564 |
| 1353 | Ga0451577_0315405 | 3300042876 | Bacteria | 1417 |
| 1354 | Ga0466969_0008223 | 3300044656 | Bacteria | 5534 |
| 1355 | Ga0453683_0000392 | 3300044673 | Bacteria | 52154 |
| 1356 | Ga0453683_0008242 | 3300044673 | Bacteria | 7007 |
| 1357 | Ga0453683_0018335 | 3300044673 | Bacteria | 4493 |
| 1358 | Ga0466963_0102827 | 3300044694 | Bacteria | 1957 |
| 1359 | Ga0453684_0007134 | 3300044712 | Bacteria | 20810 |
| 1360 | Ga0453684_0011806 | 3300044712 | Bacteria | 14554 |
| 1361 | Ga0453684_0016991 | 3300044712 | Bacteria | 11305 |
| 1362 | Ga0453684_0017055 | 3300044712 | Bacteria | 11276 |
| 1363 | Ga0453684_0023903 | 3300044712 | Bacteria | 8967 |
| 1364 | Ga0453684_0039258 | 3300044712 | Bacteria | 6454 |
| 1365 | Ga0453684_0043642 | 3300044712 | Bacteria | 6022 |
| 1366 | Ga0453684_0180682 | 3300044712 | Bacteria | 2477 |
| 1367 | Ga0453684_0344576 | 3300044712 | Bacteria | 1681 |
| 1368 | Ga0453684_0441992 | 3300044712 | Bacteria | 1449 |
| 1369 | Ga0466957_0172776 | 3300044842 | Bacteria | 1408 |
| 1370 | Ga0466960_0052749 | 3300044901 | Bacteria | 1969 |
| 1371 | Ga0451576_0001666 | 3300045051 | Bacteria | 36880 |
| 1372 | Ga0451576_0004133 | 3300045051 | Bacteria | 19143 |
| 1373 | Ga0451576_0005560 | 3300045051 | Bacteria | 15750 |
| 1374 | Ga0451576_0033892 | 3300045051 | Bacteria | 5425 |
| 1375 | Ga0451576_0067523 | 3300045051 | Bacteria | 3722 |
| 1376 | Ga0451576_0125552 | 3300045051 | Bacteria | 2674 |
| 1377 | Ga0451576_0132335 | 3300045051 | Bacteria | 2600 |
| 1378 | Ga0451576_0145157 | 3300045051 | Bacteria | 2474 |
| 1379 | Ga0451576_0176609 | 3300045051 | Bacteria | 2230 |
| 1380 | Ga0451576_0191597 | 3300045051 | Bacteria | 2135 |
| 1381 | Ga0451576_0302716 | 3300045051 | Bacteria | 1672 |
| 1382 | Ga0451576_0396244 | 3300045051 | Bacteria | 1447 |
| 1383 | Ga0451576_0421819 | 3300045051 | Bacteria | 1400 |
| 1384 | Ga0451576_0509390 | 3300045051 | Bacteria | 1264 |
| 1385 | Ga0466967_0083665 | 3300045976 | Bacteria | 2886 |
| 1386 | Ga0495592_0001172 | 3300046454 | Bacteria | 18177 |
| 1387 | Ga0495592_0057874 | 3300046454 | Bacteria | 2860 |
| 1388 | Ga0495592_0078693 | 3300046454 | Bacteria | 2388 |
| 1389 | Ga0495592_0112240 | 3300046454 | Bacteria | 1927 |
| 1390 | Ga0495592_0187398 | 3300046454 | Bacteria | 1404 |
| 1391 | Ga0495590_0033830 | 3300046457 | Bacteria | 1786 |
| 1392 | Ga0495629_0010959 | 3300046459 | Bacteria | 6589 |
| 1393 | Ga0495629_0013164 | 3300046459 | Bacteria | 5973 |
| 1394 | Ga0495629_0041225 | 3300046459 | Bacteria | 3249 |
| 1395 | Ga0495629_0050570 | 3300046459 | Bacteria | 2910 |
| 1396 | Ga0495629_0153391 | 3300046459 | Bacteria | 1601 |
| 1397 | Ga0495651_0000116 | 3300046462 | Bacteria | 59001 |
| 1398 | Ga0495651_0004583 | 3300046462 | Bacteria | 10565 |
| 1399 | Ga0495651_0012754 | 3300046462 | Bacteria | 6488 |
| 1400 | Ga0495651_0086816 | 3300046462 | Bacteria | 2353 |
| 1401 | Ga0495653_0000992 | 3300046463 | Bacteria | 21849 |
| 1402 | Ga0495653_0043909 | 3300046463 | Bacteria | 3472 |
| 1403 | Ga0495653_0075445 | 3300046463 | Bacteria | 2509 |
| 1404 | Ga0495580_0025129 | 3300046472 | Bacteria | 4353 |
| 1405 | Ga0495580_0070479 | 3300046472 | Bacteria | 2442 |
| 1406 | Ga0495580_0077981 | 3300046472 | Bacteria | 2311 |
| 1407 | Ga0495580_0084214 | 3300046472 | Bacteria | 2215 |
| 1408 | Ga0495580_0122521 | 3300046472 | Bacteria | 1805 |
| 1409 | Ga0495580_0129835 | 3300046472 | Bacteria | 1748 |
| 1410 | Ga0495582_0000533 | 3300046473 | Bacteria | 21056 |
| 1411 | Ga0495582_0003714 | 3300046473 | Bacteria | 8595 |
| 1412 | Ga0495582_0036893 | 3300046473 | Bacteria | 2689 |
| 1413 | Ga0495582_0047252 | 3300046473 | Bacteria | 2370 |
| 1414 | Ga0495582_0102061 | 3300046473 | Bacteria | 1606 |
| 1415 | Ga0495582_0111841 | 3300046473 | Bacteria | 1534 |
| 1416 | Ga0495639_0004359 | 3300046475 | Bacteria | 6064 |
| 1417 | Ga0495639_0004660 | 3300046475 | Bacteria | 5889 |
| 1418 | Ga0495639_0013867 | 3300046475 | Bacteria | 3484 |
| 1419 | Ga0495662_0000285 | 3300046476 | Bacteria | 21823 |
| 1420 | Ga0495662_0023087 | 3300046476 | Bacteria | 3003 |
| 1421 | Ga0495662_0039096 | 3300046476 | Bacteria | 2292 |
| 1422 | Ga0495662_0058686 | 3300046476 | Bacteria | 1858 |
| 1423 | Ga0495662_0137064 | 3300046476 | Bacteria | 1204 |
| 1424 | Ga0495662_0148498 | 3300046476 | Bacteria | 1154 |
| 1425 | Ga0495664_0000961 | 3300046477 | Bacteria | 14809 |
| 1426 | Ga0495584_0014690 | 3300046491 | Bacteria | 3990 |
| 1427 | Ga0495584_0033702 | 3300046491 | Bacteria | 2592 |
| 1428 | Ga0495594_0006984 | 3300046499 | Bacteria | 5803 |
| 1429 | Ga0495594_0026625 | 3300046499 | Bacteria | 3112 |
| 1430 | Ga0495594_0033559 | 3300046499 | Bacteria | 2791 |
| 1431 | Ga0495594_0040646 | 3300046499 | Bacteria | 2546 |
| 1432 | Ga0495594_0054681 | 3300046499 | Bacteria | 2200 |
| 1433 | Ga0495594_0085743 | 3300046499 | Bacteria | 1762 |
| 1434 | Ga0495596_0065051 | 3300046500 | Bacteria | 1418 |
| 1435 | Ga0495607_0105852 | 3300046501 | Bacteria | 1499 |
| 1436 | Ga0495606_0010760 | 3300046507 | Bacteria | 7541 |
| 1437 | Ga0495608_0001013 | 3300046511 | Bacteria | 19794 |
| 1438 | Ga0495608_0059430 | 3300046511 | Bacteria | 2518 |
| 1439 | Ga0495618_0008291 | 3300046514 | Bacteria | 6292 |
| 1440 | Ga0495618_0059266 | 3300046514 | Bacteria | 2426 |
| 1441 | Ga0495618_0096188 | 3300046514 | Bacteria | 1894 |
| 1442 | Ga0495628_0042659 | 3300046516 | Bacteria | 3617 |
| 1443 | Ga0495628_0051410 | 3300046516 | Bacteria | 3258 |
| 1444 | Ga0495628_0112083 | 3300046516 | Bacteria | 2097 |
| 1445 | Ga0495630_0000003 | 3300046517 | Bacteria | 524289 |
| 1446 | Ga0495630_0017202 | 3300046517 | Bacteria | 5294 |
| 1447 | Ga0495630_0034149 | 3300046517 | Bacteria | 3796 |
| 1448 | Ga0495630_0082123 | 3300046517 | Bacteria | 2432 |
| 1449 | Ga0495632_0090958 | 3300046519 | Bacteria | 1446 |
| 1450 | Ga0495643_0000057 | 3300046522 | Bacteria | 195145 |
| 1451 | Ga0495648_0003969 | 3300046524 | Bacteria | 12804 |
| 1452 | Ga0495666_0113004 | 3300046526 | Bacteria | 1275 |
| 1453 | Ga0495652_0001095 | 3300046529 | Bacteria | 30639 |
| 1454 | Ga0495652_0005949 | 3300046529 | Bacteria | 11410 |
| 1455 | Ga0495652_0040514 | 3300046529 | Bacteria | 4026 |
| 1456 | Ga0495652_0101153 | 3300046529 | Bacteria | 2337 |
| 1457 | Ga0495652_0124434 | 3300046529 | Bacteria | 2051 |
| 1458 | Ga0495665_0002814 | 3300046531 | Bacteria | 9385 |
| 1459 | Ga0495665_0007282 | 3300046531 | Bacteria | 5973 |
| 1460 | Ga0495665_0014231 | 3300046531 | Bacteria | 4292 |
| 1461 | Ga0495640_0020543 | 3300046533 | Bacteria | 4859 |
| 1462 | Ga0495640_0031131 | 3300046533 | Bacteria | 3811 |
| 1463 | Ga0495640_0064598 | 3300046533 | Bacteria | 2474 |
| 1464 | Ga0495640_0082221 | 3300046533 | Bacteria | 2139 |
| 1465 | Ga0495586_0030719 | 3300046535 | Bacteria | 2875 |
| 1466 | Ga0495586_0036590 | 3300046535 | Bacteria | 2635 |
| 1467 | Ga0495586_0081706 | 3300046535 | Bacteria | 1776 |
| 1468 | Ga0495586_0119850 | 3300046535 | Bacteria | 1469 |
| 1469 | Ga0495586_0201956 | 3300046535 | Bacteria | 1127 |
| 1470 | Ga0495587_0000143 | 3300046536 | Bacteria | 53480 |
| 1471 | Ga0495587_0000383 | 3300046536 | Bacteria | 31535 |
| 1472 | Ga0495587_0003735 | 3300046536 | Bacteria | 10101 |
| 1473 | Ga0495587_0004112 | 3300046536 | Bacteria | 9625 |
| 1474 | Ga0495598_0039224 | 3300046537 | Bacteria | 1376 |
| 1475 | Ga0495621_0025602 | 3300046539 | Bacteria | 1983 |
| 1476 | Ga0495645_0001091 | 3300046543 | Bacteria | 18367 |
| 1477 | Ga0495645_0001110 | 3300046543 | Bacteria | 18204 |
| 1478 | Ga0495645_0001766 | 3300046543 | Bacteria | 14712 |
| 1479 | Ga0495645_0012119 | 3300046543 | Bacteria | 6074 |
| 1480 | Ga0495633_0058911 | 3300046558 | Bacteria | 1802 |
| 1481 | Ga0495633_0070105 | 3300046558 | Bacteria | 1636 |
| 1482 | Ga0495667_0001636 | 3300046559 | Bacteria | 14836 |
| 1483 | Ga0495667_0011265 | 3300046559 | Bacteria | 6052 |
| 1484 | Ga0495667_0042365 | 3300046559 | Bacteria | 3019 |
| 1485 | Ga0495667_0107565 | 3300046559 | Bacteria | 1802 |
| 1486 | Ga0495634_0001443 | 3300046642 | Bacteria | 21148 |
| 1487 | Ga0495634_0018723 | 3300046642 | Bacteria | 4925 |
| 1488 | Ga0495635_0000158 | 3300046663 | Bacteria | 41599 |
| 1489 | Ga0495635_0007400 | 3300046663 | Bacteria | 7663 |
| 1490 | Ga0495635_0013387 | 3300046663 | Bacteria | 5741 |
| 1491 | Ga0495635_0079904 | 3300046663 | Bacteria | 2238 |
| 1492 | Ga0495659_0002742 | 3300046664 | Bacteria | 5664 |
| 1493 | Ga0495659_0008622 | 3300046664 | Bacteria | 3245 |
| 1494 | Ga0495659_0014552 | 3300046664 | Bacteria | 2576 |
| 1495 | Ga0495659_0021391 | 3300046664 | Bacteria | 2179 |
| 1496 | Ga0495659_0025300 | 3300046664 | Bacteria | 2031 |
| 1497 | Ga0495588_0021926 | 3300046674 | Bacteria | 3152 |
| 1498 | Ga0495657_0000476 | 3300046675 | Bacteria | 37717 |
| 1499 | Ga0495657_0032938 | 3300046675 | Bacteria | 3612 |
| 1500 | Ga0495657_0038867 | 3300046675 | Bacteria | 3272 |
| 1501 | Ga0495599_0000553 | 3300046678 | Bacteria | 21358 |
| 1502 | Ga0495599_0051496 | 3300046678 | Bacteria | 2579 |
| 1503 | Ga0495599_0059863 | 3300046678 | Bacteria | 2382 |
| 1504 | Ga0495623_0000017 | 3300046679 | Bacteria | 108556 |
| 1505 | Ga0495623_0037922 | 3300046679 | Bacteria | 3082 |
| 1506 | Ga0495623_0100595 | 3300046679 | Bacteria | 1762 |
| 1507 | Ga0495646_0002016 | 3300046680 | Bacteria | 12293 |
| 1508 | Ga0495647_0004317 | 3300046681 | Bacteria | 4607 |
| 1509 | Ga0495658_0001433 | 3300046683 | Bacteria | 12543 |
| 1510 | Ga0495658_0002526 | 3300046683 | Bacteria | 9205 |
| 1511 | Ga0495658_0010843 | 3300046683 | Bacteria | 4565 |
| 1512 | Ga0495658_0037637 | 3300046683 | Bacteria | 2675 |
| 1513 | Ga0495658_0071433 | 3300046683 | Bacteria | 2016 |
| 1514 | Ga0495613_0035991 | 3300046689 | Bacteria | 3671 |
| 1515 | Ga0495613_0056944 | 3300046689 | Bacteria | 2870 |
| 1516 | Ga0495613_0088810 | 3300046689 | Bacteria | 2239 |
| 1517 | Ga0495613_0215666 | 3300046689 | Bacteria | 1348 |
| 1518 | Ga0495624_0022926 | 3300046690 | Bacteria | 4120 |
| 1519 | Ga0495624_0033590 | 3300046690 | Bacteria | 3322 |
| 1520 | Ga0495671_0049169 | 3300046692 | Bacteria | 2102 |
| 1521 | Ga0495600_0029410 | 3300046809 | Bacteria | 3557 |
| 1522 | Ga0495600_0067651 | 3300046809 | Bacteria | 2334 |
| 1523 | Ga0495581_0001080 | 3300047315 | Bacteria | 14825 |
| 1524 | Ga0495581_0020101 | 3300047315 | Bacteria | 3876 |
| 1525 | Ga0495581_0020518 | 3300047315 | Bacteria | 3834 |
| 1526 | Ga0495581_0020800 | 3300047315 | Bacteria | 3807 |
| 1527 | Ga0495581_0117388 | 3300047315 | Bacteria | 1547 |
| 1528 | Ga0495604_0000017 | 3300047317 | Bacteria | 192029 |
| 1529 | Ga0495604_0067538 | 3300047317 | Bacteria | 2716 |
| 1530 | Ga0495636_0046182 | 3300047318 | Bacteria | 1816 |
| 1531 | Ga0495674_0003478 | 3300047319 | Bacteria | 15305 |
| 1532 | Ga0495674_0003779 | 3300047319 | Bacteria | 14722 |
| 1533 | Ga0495674_0008269 | 3300047319 | Bacteria | 9922 |
| 1534 | Ga0495674_0014556 | 3300047319 | Bacteria | 7360 |
| 1535 | Ga0495672_0004623 | 3300047320 | Bacteria | 11171 |
| 1536 | Ga0495676_0119184 | 3300047321 | Bacteria | 1923 |
| 1537 | Ga0495676_0192381 | 3300047321 | Bacteria | 1422 |
| 1538 | Ga0495680_0019971 | 3300047322 | Bacteria | 5647 |
| 1539 | Ga0495680_0062098 | 3300047322 | Bacteria | 2873 |
| 1540 | Ga0495680_0071580 | 3300047322 | Bacteria | 2639 |
| 1541 | Ga0495675_0001010 | 3300047444 | Bacteria | 17125 |
| 1542 | Ga0495675_0014092 | 3300047444 | Bacteria | 5054 |
| 1543 | Ga0495675_0199730 | 3300047444 | Bacteria | 1218 |
| 1544 | Ga0495684_0000095 | 3300047471 | Bacteria | 62460 |
| 1545 | Ga0495684_0033602 | 3300047471 | Bacteria | 3933 |
| 1546 | Ga0495593_0013848 | 3300047673 | Bacteria | 4594 |
| 1547 | Ga0495593_0048358 | 3300047673 | Bacteria | 2260 |
| 1548 | Ga0495602_0000485 | 3300048088 | Bacteria | 36933 |
| 1549 | Ga0495602_0000595 | 3300048088 | Bacteria | 33887 |
| 1550 | Ga0495602_0001119 | 3300048088 | Bacteria | 26275 |
| 1551 | Ga0495602_0042877 | 3300048088 | Bacteria | 4118 |
| 1552 | Ga0495614_0042180 | 3300048089 | Bacteria | 1956 |
| 1553 | Ga0495614_0083384 | 3300048089 | Bacteria | 1386 |
| 1554 | Ga0495615_0003581 | 3300048090 | Bacteria | 2618 |
| 1555 | Ga0495615_0017317 | 3300048090 | Bacteria | 1568 |
| 1556 | Ga0496100_0007174 | 3300048903 | Bacteria | 6124 |
| 1557 | Ga0496101_0000949 | 3300048904 | Bacteria | 17107 |
| 1558 | Ga0496101_0009865 | 3300048904 | Bacteria | 6290 |
| 1559 | Ga0496101_0024585 | 3300048904 | Bacteria | 4170 |
| 1560 | Ga0496101_0092511 | 3300048904 | Bacteria | 2251 |
| 1561 | Ga0496101_0129775 | 3300048904 | Bacteria | 1913 |
| 1562 | Ga0496102_0002642 | 3300048905 | Bacteria | 15222 |
| 1563 | Ga0496102_0003666 | 3300048905 | Bacteria | 12983 |
| 1564 | Ga0496102_0029697 | 3300048905 | Bacteria | 4892 |
| 1565 | Ga0496102_0047364 | 3300048905 | Bacteria | 3906 |
| 1566 | Ga0496102_0066985 | 3300048905 | Bacteria | 3292 |
| 1567 | Ga0496102_0068879 | 3300048905 | Bacteria | 3247 |
| 1568 | Ga0496102_0082955 | 3300048905 | Bacteria | 2957 |
| 1569 | Ga0496102_0094489 | 3300048905 | Bacteria | 2770 |
| 1570 | Ga0496102_0151946 | 3300048905 | Bacteria | 2176 |
| 1571 | Ga0496102_0156365 | 3300048905 | Bacteria | 2143 |
| 1572 | Ga0496102_0170502 | 3300048905 | Bacteria | 2049 |
| 1573 | Ga0496102_0296741 | 3300048905 | Bacteria | 1523 |
| 1574 | Ga0496103_0014722 | 3300048906 | Bacteria | 4649 |
| 1575 | Ga0496103_0022205 | 3300048906 | Bacteria | 3820 |
| 1576 | Ga0496103_0042027 | 3300048906 | Bacteria | 2811 |
| 1577 | Ga0496104_0000877 | 3300048907 | Bacteria | 25894 |
| 1578 | Ga0496104_0002308 | 3300048907 | Bacteria | 16472 |
| 1579 | Ga0496104_0015456 | 3300048907 | Bacteria | 6912 |
| 1580 | Ga0496104_0213706 | 3300048907 | Bacteria | 1840 |
| 1581 | Ga0496104_0310826 | 3300048907 | Bacteria | 1489 |
| 1582 | Ga0496105_0004564 | 3300048908 | Bacteria | 10430 |
| 1583 | Ga0496105_0020712 | 3300048908 | Bacteria | 5316 |
| 1584 | Ga0496105_0206979 | 3300048908 | Bacteria | 1600 |
| 1585 | Ga0496105_0221711 | 3300048908 | Bacteria | 1539 |
| 1586 | Ga0496106_0013980 | 3300048909 | Bacteria | 5935 |
| 1587 | Ga0496106_0020151 | 3300048909 | Bacteria | 4947 |
| 1588 | Ga0496106_0031117 | 3300048909 | Bacteria | 3976 |
| 1589 | Ga0496107_0000964 | 3300048910 | Bacteria | 17066 |
| 1590 | Ga0496107_0047674 | 3300048910 | Bacteria | 3085 |
| 1591 | Ga0496107_0073282 | 3300048910 | Bacteria | 2490 |
| 1592 | Ga0496107_0106102 | 3300048910 | Bacteria | 2063 |
| 1593 | Ga0496107_0153008 | 3300048910 | Bacteria | 1707 |
| 1594 | Ga0496108_0002874 | 3300048911 | Bacteria | 13813 |
| 1595 | Ga0496108_0018180 | 3300048911 | Bacteria | 5753 |
| 1596 | Ga0496108_0018765 | 3300048911 | Bacteria | 5670 |
| 1597 | Ga0496108_0039332 | 3300048911 | Bacteria | 3942 |
| 1598 | Ga0496108_0041216 | 3300048911 | Bacteria | 3853 |
| 1599 | Ga0496108_0110108 | 3300048911 | Bacteria | 2354 |
| 1600 | Ga0496108_0181253 | 3300048911 | Bacteria | 1824 |
| 1601 | Ga0496108_0183314 | 3300048911 | Bacteria | 1813 |
| 1602 | Ga0496109_0000518 | 3300048912 | Bacteria | 32691 |
| 1603 | Ga0496109_0009418 | 3300048912 | Bacteria | 8324 |
| 1604 | Ga0496109_0012751 | 3300048912 | Bacteria | 7264 |
| 1605 | Ga0496109_0019059 | 3300048912 | Bacteria | 6044 |
| 1606 | Ga0496109_0024078 | 3300048912 | Bacteria | 5409 |
| 1607 | Ga0496109_0027123 | 3300048912 | Bacteria | 5112 |
| 1608 | Ga0496109_0070950 | 3300048912 | Bacteria | 3197 |
| 1609 | Ga0496109_0116400 | 3300048912 | Bacteria | 2488 |
| 1610 | Ga0496109_0251306 | 3300048912 | Bacteria | 1665 |
| 1611 | Ga0496109_0270655 | 3300048912 | Bacteria | 1600 |
| 1612 | Ga0496109_0346469 | 3300048912 | Bacteria | 1403 |
| 1613 | Ga0496110_0001009 | 3300048913 | Bacteria | 19840 |
| 1614 | Ga0496110_0025610 | 3300048913 | Bacteria | 5043 |
| 1615 | Ga0496110_0040751 | 3300048913 | Bacteria | 4048 |
| 1616 | Ga0496110_0168266 | 3300048913 | Bacteria | 1988 |
| 1617 | Ga0496111_0035018 | 3300048914 | Bacteria | 3586 |
| 1618 | Ga0496111_0119557 | 3300048914 | Bacteria | 1946 |
| 1619 | Ga0496111_0156344 | 3300048914 | Bacteria | 1692 |
| 1620 | Ga0496111_0255744 | 3300048914 | Bacteria | 1299 |
| 1621 | Ga0496112_0000047 | 3300048915 | Bacteria | 84877 |
| 1622 | Ga0496112_0018432 | 3300048915 | Bacteria | 6572 |
| 1623 | Ga0496112_0023223 | 3300048915 | Bacteria | 5921 |
| 1624 | Ga0496112_0049360 | 3300048915 | Bacteria | 4125 |
| 1625 | Ga0496112_0050094 | 3300048915 | Bacteria | 4094 |
| 1626 | Ga0496112_0051573 | 3300048915 | Bacteria | 4035 |
| 1627 | Ga0496112_0061091 | 3300048915 | Bacteria | 3714 |
| 1628 | Ga0496112_0061243 | 3300048915 | Bacteria | 3709 |
| 1629 | Ga0496112_0070213 | 3300048915 | Bacteria | 3461 |
| 1630 | Ga0496112_0302638 | 3300048915 | Bacteria | 1544 |
| 1631 | Ga0496113_0016753 | 3300048916 | Bacteria | 5069 |
| 1632 | Ga0496113_0018957 | 3300048916 | Bacteria | 4803 |
| 1633 | Ga0496113_0065338 | 3300048916 | Bacteria | 2753 |
| 1634 | Ga0496113_0075614 | 3300048916 | Bacteria | 2571 |
| 1635 | Ga0496113_0152959 | 3300048916 | Bacteria | 1821 |
| 1636 | Ga0496113_0160607 | 3300048916 | Bacteria | 1776 |
| 1637 | Ga0496113_0163242 | 3300048916 | Bacteria | 1762 |
| 1638 | Ga0496114_0063260 | 3300048917 | Bacteria | 3098 |
| 1639 | Ga0496114_0119326 | 3300048917 | Bacteria | 2267 |
| 1640 | Ga0496115_0001671 | 3300048918 | Bacteria | 15949 |
| 1641 | Ga0496115_0007121 | 3300048918 | Bacteria | 8213 |
| 1642 | Ga0496115_0037529 | 3300048918 | Bacteria | 3840 |
| 1643 | Ga0496115_0042136 | 3300048918 | Bacteria | 3636 |
| 1644 | Ga0496115_0056597 | 3300048918 | Bacteria | 3152 |
| 1645 | Ga0496115_0148298 | 3300048918 | Bacteria | 1936 |
| 1646 | Ga0496121_0002196 | 3300048924 | Bacteria | 30506 |
| 1647 | Ga0496121_0003067 | 3300048924 | Bacteria | 24202 |
| 1648 | Ga0496126_0040052 | 3300048929 | Bacteria | 4345 |
| 1649 | Ga0501308_001422 | 3300049128 | Bacteria | 1906 |
| 1650 | Ga0501291_009303 | 3300049514 | Bacteria | 1375 |
| 1651 | Ga0501292_000099 | 3300049515 | Bacteria | 15440 |
| 1652 | Ga0501293_000646 | 3300049516 | Bacteria | 2614 |
| 1653 | Ga0501294_000377 | 3300049517 | Bacteria | 5422 |
| 1654 | Ga0501297_006292 | 3300049520 | Bacteria | 1264 |
| 1655 | Ga0501300_001419 | 3300049523 | Bacteria | 3586 |
| 1656 | Ga0501302_000215 | 3300049525 | Bacteria | 3024 |
| 1657 | Ga0501303_000203 | 3300049526 | Bacteria | 4981 |
| 1658 | Ga0501031_0038091 | 3300049568 | Bacteria | 3138 |
| 1659 | Ga0501031_0138467 | 3300049568 | Bacteria | 1590 |
| 1660 | Ga0501032_0001580 | 3300049569 | Bacteria | 18155 |
| 1661 | Ga0501032_0020821 | 3300049569 | Bacteria | 4565 |
| 1662 | Ga0501032_0037464 | 3300049569 | Bacteria | 3307 |
| 1663 | Ga0501032_0056579 | 3300049569 | Bacteria | 2636 |
| 1664 | Ga0501033_0000013 | 3300049570 | Bacteria | 232799 |
| 1665 | Ga0501034_0000208 | 3300049571 | Bacteria | 111739 |
| 1666 | Ga0501034_0002673 | 3300049571 | Bacteria | 21040 |
| 1667 | Ga0501034_0024772 | 3300049571 | Bacteria | 6104 |
| 1668 | Ga0501034_0032099 | 3300049571 | Bacteria | 5335 |
| 1669 | Ga0501034_0035297 | 3300049571 | Bacteria | 5070 |
| 1670 | Ga0501034_0057403 | 3300049571 | Bacteria | 3914 |
| 1671 | Ga0501034_0095353 | 3300049571 | Bacteria | 2972 |
| 1672 | Ga0501034_0351804 | 3300049571 | Bacteria | 1401 |
| 1673 | Ga0501034_0395891 | 3300049571 | Bacteria | 1304 |
| 1674 | Ga0501036_0005563 | 3300049572 | Bacteria | 10220 |
| 1675 | Ga0501036_0060890 | 3300049572 | Bacteria | 3197 |
| 1676 | Ga0501036_0078279 | 3300049572 | Bacteria | 2796 |
| 1677 | Ga0501036_0105762 | 3300049572 | Bacteria | 2380 |
| 1678 | Ga0501036_0144838 | 3300049572 | Bacteria | 2004 |
| 1679 | Ga0501036_0159884 | 3300049572 | Bacteria | 1899 |
| 1680 | Ga0501036_0168217 | 3300049572 | Bacteria | 1847 |
| 1681 | Ga0501037_0077015 | 3300049573 | Bacteria | 2420 |
| 1682 | Ga0501037_0272967 | 3300049573 | Bacteria | 1180 |
| 1683 | Ga0501038_0000212 | 3300049574 | Bacteria | 49792 |
| 1684 | Ga0501038_0038476 | 3300049574 | Bacteria | 4188 |
| 1685 | Ga0501038_0041934 | 3300049574 | Bacteria | 3989 |
| 1686 | Ga0501038_0062611 | 3300049574 | Bacteria | 3179 |
| 1687 | Ga0501038_0108450 | 3300049574 | Bacteria | 2302 |
| 1688 | Ga0501038_0303172 | 3300049574 | Bacteria | 1253 |
| 1689 | Ga0501039_0000072 | 3300049575 | Bacteria | 76673 |
| 1690 | Ga0501039_0001156 | 3300049575 | Bacteria | 19441 |
| 1691 | Ga0501039_0001269 | 3300049575 | Bacteria | 18465 |
| 1692 | Ga0501039_0131020 | 3300049575 | Bacteria | 1968 |
| 1693 | Ga0501039_0164694 | 3300049575 | Bacteria | 1743 |
| 1694 | Ga0501039_0171729 | 3300049575 | Bacteria | 1704 |
| 1695 | Ga0501039_0212676 | 3300049575 | Bacteria | 1520 |
| 1696 | Ga0501039_0222609 | 3300049575 | Bacteria | 1483 |
| 1697 | Ga0501039_0288359 | 3300049575 | Bacteria | 1290 |
| 1698 | Ga0501040_0006079 | 3300049576 | Bacteria | 7826 |
| 1699 | Ga0501040_0018714 | 3300049576 | Bacteria | 4600 |
| 1700 | Ga0501040_0048495 | 3300049576 | Bacteria | 2902 |
| 1701 | Ga0501040_0100972 | 3300049576 | Bacteria | 2012 |
| 1702 | Ga0501040_0139595 | 3300049576 | Bacteria | 1706 |
| 1703 | Ga0501041_0047400 | 3300049577 | Bacteria | 2616 |
| 1704 | Ga0501041_0134161 | 3300049577 | Bacteria | 1542 |
| 1705 | Ga0501042_0003193 | 3300049578 | Bacteria | 10236 |
| 1706 | Ga0501042_0013582 | 3300049578 | Bacteria | 5544 |
| 1707 | Ga0501042_0022117 | 3300049578 | Bacteria | 4440 |
| 1708 | Ga0501042_0102590 | 3300049578 | Bacteria | 2058 |
| 1709 | Ga0501042_0111497 | 3300049578 | Bacteria | 1970 |
| 1710 | Ga0501042_0250921 | 3300049578 | Bacteria | 1277 |
| 1711 | Ga0501043_0047927 | 3300049579 | Bacteria | 3359 |
| 1712 | Ga0501046_0001060 | 3300049580 | Bacteria | 26935 |
| 1713 | Ga0501046_0006019 | 3300049580 | Bacteria | 10788 |
| 1714 | Ga0501046_0014835 | 3300049580 | Bacteria | 6560 |
| 1715 | Ga0501046_0019160 | 3300049580 | Bacteria | 5676 |
| 1716 | Ga0501046_0022425 | 3300049580 | Bacteria | 5202 |
| 1717 | Ga0501046_0078669 | 3300049580 | Bacteria | 2551 |
| 1718 | Ga0501046_0094723 | 3300049580 | Bacteria | 2294 |
| 1719 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 1720 | Ga0501047_0001212 | 3300049581 | Bacteria | 25586 |
| 1721 | Ga0501047_0005869 | 3300049581 | Bacteria | 11555 |
| 1722 | Ga0501047_0059552 | 3300049581 | Bacteria | 3686 |
| 1723 | Ga0501047_0068651 | 3300049581 | Bacteria | 3414 |
| 1724 | Ga0501048_0000501 | 3300049582 | Bacteria | 27413 |
| 1725 | Ga0501048_0006738 | 3300049582 | Bacteria | 8727 |
| 1726 | Ga0501048_0016001 | 3300049582 | Bacteria | 5532 |
| 1727 | Ga0501048_0020369 | 3300049582 | Bacteria | 4860 |
| 1728 | Ga0501048_0130259 | 3300049582 | Bacteria | 1778 |
| 1729 | Ga0501048_0155930 | 3300049582 | Bacteria | 1615 |
| 1730 | Ga0501048_0205546 | 3300049582 | Bacteria | 1396 |
| 1731 | Ga0501067_0001590 | 3300049583 | Bacteria | 12434 |
| 1732 | Ga0501067_0012802 | 3300049583 | Bacteria | 4646 |
| 1733 | Ga0501067_0018310 | 3300049583 | Bacteria | 3880 |
| 1734 | Ga0501067_0037014 | 3300049583 | Bacteria | 2710 |
| 1735 | Ga0501067_0054271 | 3300049583 | Bacteria | 2220 |
| 1736 | Ga0501067_0054439 | 3300049583 | Bacteria | 2217 |
| 1737 | Ga0501067_0086970 | 3300049583 | Bacteria | 1734 |
| 1738 | Ga0501068_0003501 | 3300049584 | Bacteria | 8471 |
| 1739 | Ga0501068_0029846 | 3300049584 | Bacteria | 3232 |
| 1740 | Ga0501068_0106078 | 3300049584 | Bacteria | 1744 |
| 1741 | Ga0501069_0026314 | 3300049585 | Bacteria | 3185 |
| 1742 | Ga0501069_0138060 | 3300049585 | Bacteria | 1398 |
| 1743 | Ga0501069_0141669 | 3300049585 | Bacteria | 1379 |
| 1744 | Ga0501069_0155621 | 3300049585 | Bacteria | 1315 |
| 1745 | Ga0501070_0004020 | 3300049586 | Bacteria | 12633 |
| 1746 | Ga0501070_0016965 | 3300049586 | Bacteria | 6110 |
| 1747 | Ga0501070_0060711 | 3300049586 | Bacteria | 3133 |
| 1748 | Ga0501071_0042773 | 3300049587 | Bacteria | 3247 |
| 1749 | Ga0501071_0086964 | 3300049587 | Bacteria | 2293 |
| 1750 | Ga0501071_0193098 | 3300049587 | Bacteria | 1528 |
| 1751 | Ga0501071_0199519 | 3300049587 | Bacteria | 1502 |
| 1752 | Ga0501071_0289925 | 3300049587 | Bacteria | 1239 |
| 1753 | Ga0501072_0005670 | 3300049588 | Bacteria | 9507 |
| 1754 | Ga0501072_0040546 | 3300049588 | Bacteria | 3656 |
| 1755 | Ga0501072_0160162 | 3300049588 | Bacteria | 1795 |
| 1756 | Ga0501072_0161704 | 3300049588 | Bacteria | 1786 |
| 1757 | Ga0501072_0193359 | 3300049588 | Bacteria | 1622 |
| 1758 | Ga0501072_0285120 | 3300049588 | Bacteria | 1313 |
| 1759 | Ga0501073_0028073 | 3300049589 | Bacteria | 4020 |
| 1760 | Ga0501073_0105941 | 3300049589 | Bacteria | 1951 |
| 1761 | Ga0501073_0146428 | 3300049589 | Bacteria | 1637 |
| 1762 | Ga0501074_0010949 | 3300049590 | Bacteria | 6583 |
| 1763 | Ga0501074_0144720 | 3300049590 | Bacteria | 1700 |
| 1764 | Ga0501075_0013901 | 3300049591 | Bacteria | 5758 |
| 1765 | Ga0501075_0065131 | 3300049591 | Bacteria | 2749 |
| 1766 | Ga0501075_0083379 | 3300049591 | Bacteria | 2421 |
| 1767 | Ga0501075_0089183 | 3300049591 | Bacteria | 2338 |
| 1768 | Ga0501075_0137758 | 3300049591 | Bacteria | 1860 |
| 1769 | Ga0501075_0155558 | 3300049591 | Bacteria | 1743 |
| 1770 | Ga0501075_0188194 | 3300049591 | Bacteria | 1574 |
| 1771 | Ga0501076_0023202 | 3300049592 | Bacteria | 4780 |
| 1772 | Ga0501076_0039204 | 3300049592 | Bacteria | 3720 |
| 1773 | Ga0501076_0073626 | 3300049592 | Bacteria | 2735 |
| 1774 | Ga0501076_0079492 | 3300049592 | Bacteria | 2631 |
| 1775 | Ga0501076_0115786 | 3300049592 | Bacteria | 2169 |
| 1776 | Ga0501076_0120432 | 3300049592 | Bacteria | 2125 |
| 1777 | Ga0501076_0121280 | 3300049592 | Bacteria | 2117 |
| 1778 | Ga0501076_0129409 | 3300049592 | Bacteria | 2047 |
| 1779 | Ga0501076_0141391 | 3300049592 | Bacteria | 1955 |
| 1780 | Ga0501076_0251755 | 3300049592 | Bacteria | 1445 |
| 1781 | Ga0501076_0251920 | 3300049592 | Bacteria | 1445 |
| 1782 | Ga0501077_0031283 | 3300049593 | Bacteria | 3386 |
| 1783 | Ga0501077_0057632 | 3300049593 | Bacteria | 2466 |
| 1784 | Ga0501077_0082358 | 3300049593 | Bacteria | 2039 |
| 1785 | Ga0501077_0112695 | 3300049593 | Bacteria | 1724 |
| 1786 | Ga0501077_0118636 | 3300049593 | Bacteria | 1676 |
| 1787 | Ga0501077_0127280 | 3300049593 | Bacteria | 1615 |
| 1788 | Ga0501077_0190947 | 3300049593 | Bacteria | 1301 |
| 1789 | Ga0501077_0199970 | 3300049593 | Bacteria | 1269 |
| 1790 | Ga0501198_000368 | 3300049649 | Bacteria | 5651 |
| 1791 | Ga0501199_001333 | 3300049650 | Bacteria | 2222 |
| 1792 | Ga0501206_000344 | 3300049653 | Bacteria | 5506 |
| 1793 | Ga0501207_001334 | 3300049654 | Bacteria | 3067 |
| 1794 | Ga0501208_000919 | 3300049655 | Bacteria | 2563 |
| 1795 | Ga0501211_001971 | 3300049658 | Bacteria | 2191 |
| 1796 | Ga0501217_027815 | 3300049661 | Bacteria | 1374 |
| 1797 | Ga0501223_010696 | 3300049663 | Bacteria | 1843 |
| 1798 | Ga0501227_002932 | 3300049665 | Bacteria | 3731 |
| 1799 | Ga0501228_000191 | 3300049666 | Bacteria | 3553 |
| 1800 | Ga0501230_000123 | 3300049667 | Bacteria | 5948 |
| 1801 | Ga0501238_002198 | 3300049671 | Bacteria | 2310 |
| 1802 | Ga0501239_000520 | 3300049672 | Bacteria | 3020 |
| 1803 | Ga0501240_007700 | 3300049673 | Bacteria | 1362 |
| 1804 | Ga0501246_001971 | 3300049676 | Bacteria | 1605 |
| 1805 | Ga0501248_000546 | 3300049678 | Bacteria | 2091 |
| 1806 | Ga0501249_022446 | 3300049679 | Bacteria | 1382 |
| 1807 | Ga0501251_000031 | 3300049681 | Bacteria | 10430 |
| 1808 | Ga0501252_005815 | 3300049682 | Bacteria | 1353 |
| 1809 | Ga0501253_000193 | 3300049683 | Bacteria | 4570 |
| 1810 | Ga0501255_004416 | 3300049684 | Bacteria | 1359 |
| 1811 | Ga0501256_000081 | 3300049685 | Bacteria | 5018 |
| 1812 | Ga0501257_013729 | 3300049686 | Bacteria | 1858 |
| 1813 | Ga0501258_000070 | 3300049687 | Bacteria | 5267 |
| 1814 | Ga0501261_000363 | 3300049690 | Bacteria | 6080 |
| 1815 | Ga0501221_000136 | 3300049704 | Bacteria | 9511 |
| 1816 | Ga0501225_0000149 | 3300049705 | Bacteria | 21494 |
| 1817 | Ga0501225_0028573 | 3300049705 | Bacteria | 1533 |
| 1818 | Ga0501229_000082 | 3300049706 | Bacteria | 9579 |
| 1819 | Ga0501245_010629 | 3300049708 | Bacteria | 1331 |
| 1820 | Ga0501079_0074707 | 3300049741 | Bacteria | 2620 |
| 1821 | Ga0501079_0097101 | 3300049741 | Bacteria | 2284 |
| 1822 | Ga0501079_0122450 | 3300049741 | Bacteria | 2023 |
| 1823 | Ga0501079_0148612 | 3300049741 | Bacteria | 1827 |
| 1824 | Ga0501079_0155907 | 3300049741 | Bacteria | 1780 |
| 1825 | Ga0501079_0172008 | 3300049741 | Bacteria | 1689 |
| 1826 | Ga0501079_0195009 | 3300049741 | Bacteria | 1581 |
| 1827 | Ga0501079_0198243 | 3300049741 | Bacteria | 1567 |
| 1828 | Ga0501079_0243130 | 3300049741 | Bacteria | 1406 |
| 1829 | Ga0501079_0255552 | 3300049741 | Bacteria | 1369 |
| 1830 | Ga0501080_0000005 | 3300049742 | Bacteria | 176271 |
| 1831 | Ga0501080_0013007 | 3300049742 | Bacteria | 7641 |
| 1832 | Ga0501080_0045341 | 3300049742 | Bacteria | 4093 |
| 1833 | Ga0501080_0051985 | 3300049742 | Bacteria | 3813 |
| 1834 | Ga0501080_0060529 | 3300049742 | Bacteria | 3525 |
| 1835 | Ga0501080_0081520 | 3300049742 | Bacteria | 3006 |
| 1836 | Ga0501080_0133051 | 3300049742 | Bacteria | 2302 |
| 1837 | Ga0501080_0133128 | 3300049742 | Bacteria | 2301 |
| 1838 | Ga0501080_0138462 | 3300049742 | Bacteria | 2251 |
| 1839 | Ga0501081_0000419 | 3300049743 | Bacteria | 23462 |
| 1840 | Ga0501081_0024655 | 3300049743 | Bacteria | 4041 |
| 1841 | Ga0501081_0032063 | 3300049743 | Bacteria | 3563 |
| 1842 | Ga0501081_0089729 | 3300049743 | Bacteria | 2160 |
| 1843 | Ga0501081_0103607 | 3300049743 | Bacteria | 2013 |
| 1844 | Ga0501081_0270779 | 3300049743 | Bacteria | 1242 |
| 1845 | Ga0501241_003890 | 3300049758 | Bacteria | 2813 |
| 1846 | Ga0501262_002660 | 3300049759 | Bacteria | 2019 |
| 1847 | Ga0501263_003193 | 3300049760 | Bacteria | 1732 |
| 1848 | Ga0501265_000713 | 3300049762 | Bacteria | 3634 |
| 1849 | Ga0501268_002568 | 3300049765 | Bacteria | 2400 |
| 1850 | Ga0501269_004855 | 3300049766 | Bacteria | 1617 |
| 1851 | Ga0501271_000769 | 3300049768 | Bacteria | 2716 |
| 1852 | Ga0501273_003810 | 3300049770 | Bacteria | 1626 |
| 1853 | Ga0501275_000495 | 3300049772 | Bacteria | 4427 |
| 1854 | Ga0501276_001067 | 3300049773 | Bacteria | 1797 |
| 1855 | Ga0501278_000188 | 3300049774 | Bacteria | 4814 |
| 1856 | Ga0501280_000659 | 3300049776 | Bacteria | 7698 |
| 1857 | Ga0501281_00945 | 3300049777 | Bacteria | 2440 |
| 1858 | Ga0501283_006667 | 3300049779 | Bacteria | 1624 |
| 1859 | Ga0501283_008288 | 3300049779 | Bacteria | 1495 |
| 1860 | Ga0501035_0000049 | 3300049822 | Bacteria | 145684 |
| 1861 | Ga0501035_0012246 | 3300049822 | Bacteria | 7929 |
| 1862 | Ga0501035_0019292 | 3300049822 | Bacteria | 6275 |
| 1863 | Ga0501035_0071258 | 3300049822 | Bacteria | 3078 |
| 1864 | Ga0501035_0085598 | 3300049822 | Bacteria | 2778 |
| 1865 | Ga0501035_0109032 | 3300049822 | Bacteria | 2427 |
| 1866 | Ga0501044_0000030 | 3300049823 | Bacteria | 173442 |
| 1867 | Ga0501044_0000222 | 3300049823 | Bacteria | 71930 |
| 1868 | Ga0501044_0038683 | 3300049823 | Bacteria | 4980 |
| 1869 | Ga0501044_0073422 | 3300049823 | Bacteria | 3477 |
| 1870 | Ga0501045_0064837 | 3300049824 | Bacteria | 2682 |
| 1871 | Ga0501045_0070030 | 3300049824 | Bacteria | 2580 |
| 1872 | Ga0501045_0071503 | 3300049824 | Bacteria | 2553 |
| 1873 | Ga0501045_0079394 | 3300049824 | Bacteria | 2419 |
| 1874 | Ga0501045_0079903 | 3300049824 | Bacteria | 2411 |
| 1875 | Ga0501045_0104129 | 3300049824 | Bacteria | 2102 |
| 1876 | Ga0501045_0113403 | 3300049824 | Bacteria | 2010 |
| 1877 | Ga0501045_0148251 | 3300049824 | Bacteria | 1745 |
| 1878 | Ga0501045_0167482 | 3300049824 | Bacteria | 1636 |
| 1879 | Ga0501212_000067 | 3300049851 | Bacteria | 7460 |
| 1880 | Ga0501226_000129 | 3300049853 | Bacteria | 14953 |
| 1881 | nmdc:mga03683_18960_c1 | 3300050489 | Bacteria | 1949 |
| 1882 | nmdc:mga03683_429_c1 | 3300050489 | Bacteria | 12155 |
| 1883 | nmdc:mga03683_52353_c1 | 3300050489 | Bacteria | 1706 |
| 1884 | nmdc:mga00v17_201903_c1 | 3300050491 | Bacteria | 1285 |
| 1885 | nmdc:mga0yw44_93780_c1 | 3300050492 | Bacteria | 1902 |
| 1886 | nmdc:mga0k408_18213_c1 | 3300050493 | Bacteria | 3919 |
| 1887 | nmdc:mga0k408_27225_c1 | 3300050493 | Bacteria | 3246 |
| 1888 | nmdc:mga0k408_4095_c1 | 3300050493 | Bacteria | 7742 |
| 1889 | nmdc:mga0k408_50045_c1 | 3300050493 | Bacteria | 2419 |
| 1890 | nmdc:mga07m45_11904_c1 | 3300050496 | Bacteria | 4583 |
| 1891 | nmdc:mga05p37_119087_c1 | 3300050507 | Bacteria | 3244 |
| 1892 | nmdc:mga05p37_12453_c1 | 3300050507 | Bacteria | 10158 |
| 1893 | nmdc:mga05p37_125066_c1 | 3300050507 | Bacteria | 3158 |
| 1894 | nmdc:mga05p37_129158_c1 | 3300050507 | Bacteria | 3102 |
| 1895 | nmdc:mga05p37_15056_c1 | 3300050507 | Bacteria | 9285 |
| 1896 | nmdc:mga05p37_1773_c1 | 3300050507 | Bacteria | 25196 |
| 1897 | nmdc:mga05p37_180664_c1 | 3300050507 | Bacteria | 2567 |
| 1898 | nmdc:mga05p37_19612_c1 | 3300050507 | Bacteria | 8178 |
| 1899 | nmdc:mga05p37_210322_c1 | 3300050507 | Bacteria | 2352 |
| 1900 | nmdc:mga05p37_213294_c1 | 3300050507 | Bacteria | 2333 |
| 1901 | nmdc:mga05p37_235738_c1 | 3300050507 | Bacteria | 2203 |
| 1902 | nmdc:mga05p37_2437_c1 | 3300050507 | Bacteria | 21635 |
| 1903 | nmdc:mga05p37_2645_c1 | 3300050507 | Bacteria | 20857 |
| 1904 | nmdc:mga05p37_2754_c1 | 3300050507 | Bacteria | 20427 |
| 1905 | nmdc:mga05p37_36180_c1 | 3300050507 | Bacteria | 6059 |
| 1906 | nmdc:mga05p37_38754_c1 | 3300050507 | Bacteria | 5848 |
| 1907 | nmdc:mga05p37_422974_c1 | 3300050507 | Bacteria | 1550 |
| 1908 | nmdc:mga05p37_4273_c1 | 3300050507 | Bacteria | 16689 |
| 1909 | nmdc:mga05p37_459650_c1 | 3300050507 | Bacteria | 1471 |
| 1910 | nmdc:mga05p37_49398_c1 | 3300050507 | Bacteria | 5174 |
| 1911 | nmdc:mga05p37_544344_c1 | 3300050507 | Bacteria | 1323 |
| 1912 | nmdc:mga05p37_548375_c1 | 3300050507 | Bacteria | 1317 |
| 1913 | nmdc:mga05p37_568608_c1 | 3300050507 | Bacteria | 1286 |
| 1914 | nmdc:mga05p37_60272_c1 | 3300050507 | Bacteria | 4673 |
| 1915 | nmdc:mga05p37_64836_c1 | 3300050507 | Bacteria | 4495 |
| 1916 | nmdc:mga05p37_66256_c1 | 3300050507 | Bacteria | 4442 |
| 1917 | nmdc:mga05p37_94703_c1 | 3300050507 | Bacteria | 3679 |
| 1918 | nmdc:mga05p37_96138_c1 | 3300050507 | Bacteria | 3649 |
| 1919 | nmdc:mga09592_129009_c1 | 3300050508 | Bacteria | 2175 |
| 1920 | nmdc:mga09592_1370_c1 | 3300050508 | Bacteria | 19524 |
| 1921 | nmdc:mga09592_170261_c1 | 3300050508 | Bacteria | 1883 |
| 1922 | nmdc:mga09592_177703_c1 | 3300050508 | Bacteria | 1841 |
| 1923 | nmdc:mga09592_192404_c1 | 3300050508 | Bacteria | 1766 |
| 1924 | nmdc:mga09592_2394_c1 | 3300050508 | Bacteria | 15146 |
| 1925 | nmdc:mga09592_252820_c1 | 3300050508 | Bacteria | 1528 |
| 1926 | nmdc:mga09592_40151_c1 | 3300050508 | Bacteria | 3931 |
| 1927 | nmdc:mga09592_46677_c1 | 3300050508 | Bacteria | 3649 |
| 1928 | nmdc:mga09592_65529_c1 | 3300050508 | Bacteria | 3078 |
| 1929 | nmdc:mga09592_7464_c1 | 3300050508 | Bacteria | 8886 |
| 1930 | nmdc:mga0qj67_108914_c1 | 3300050509 | Bacteria | 2235 |
| 1931 | nmdc:mga0qj67_111484_c1 | 3300050509 | Bacteria | 2209 |
| 1932 | nmdc:mga0qj67_15872_c1 | 3300050509 | Bacteria | 5703 |
| 1933 | nmdc:mga0qj67_18360_c1 | 3300050509 | Bacteria | 5330 |
| 1934 | nmdc:mga0qj67_220862_c1 | 3300050509 | Bacteria | 1538 |
| 1935 | nmdc:mga0qj67_22931_c1 | 3300050509 | Bacteria | 4797 |
| 1936 | nmdc:mga0qj67_23583_c1 | 3300050509 | Bacteria | 4735 |
| 1937 | nmdc:mga0qj67_24513_c1 | 3300050509 | Bacteria | 4651 |
| 1938 | nmdc:mga0qj67_2465_c1 | 3300050509 | Bacteria | 13183 |
| 1939 | nmdc:mga0qj67_25617_c1 | 3300050509 | Bacteria | 4558 |
| 1940 | nmdc:mga0qj67_32040_c1 | 3300050509 | Bacteria | 4098 |
| 1941 | nmdc:mga0qj67_42067_c1 | 3300050509 | Bacteria | 2048 |
| 1942 | nmdc:mga0qj67_53256_c1 | 3300050509 | Bacteria | 3204 |
| 1943 | nmdc:mga0qj67_630_c1 | 3300050509 | Bacteria | 24211 |
| 1944 | nmdc:mga0qj67_65307_c1 | 3300050509 | Bacteria | 2897 |
| 1945 | nmdc:mga06r32_102584_c1 | 3300050510 | Bacteria | 2808 |
| 1946 | nmdc:mga06r32_11036_c1 | 3300050510 | Bacteria | 8132 |
| 1947 | nmdc:mga06r32_1300_c1 | 3300050510 | Bacteria | 22515 |
| 1948 | nmdc:mga06r32_145834_c1 | 3300050510 | Bacteria | 2344 |
| 1949 | nmdc:mga06r32_194953_c1 | 3300050510 | Bacteria | 2013 |
| 1950 | nmdc:mga06r32_208220_c1 | 3300050510 | Bacteria | 1944 |
| 1951 | nmdc:mga06r32_212712_c1 | 3300050510 | Bacteria | 1921 |
| 1952 | nmdc:mga06r32_26386_c1 | 3300050510 | Bacteria | 5415 |
| 1953 | nmdc:mga06r32_29260_c1 | 3300050510 | Bacteria | 5161 |
| 1954 | nmdc:mga06r32_36320_c1 | 3300050510 | Bacteria | 4655 |
| 1955 | nmdc:mga06r32_37302_c1 | 3300050510 | Bacteria | 4598 |
| 1956 | nmdc:mga06r32_638_c1 | 3300050510 | Bacteria | 30472 |
| 1957 | nmdc:mga06r32_66201_c1 | 3300050510 | Bacteria | 3486 |
| 1958 | nmdc:mga06r32_8250_c1 | 3300050510 | Bacteria | 9379 |
| 1959 | nmdc:mga06r32_85977_c1 | 3300050510 | Bacteria | 3067 |
| 1960 | nmdc:mga06r32_89288_c1 | 3300050510 | Bacteria | 3009 |
| 1961 | nmdc:mga06r32_89403_c1 | 3300050510 | Bacteria | 3007 |
| 1962 | nmdc:mga06r32_95660_c1 | 3300050510 | Bacteria | 2907 |
| 1963 | nmdc:mga08y16_1022_c1 | 3300050511 | Bacteria | 27431 |
| 1964 | nmdc:mga08y16_1323_c1 | 3300050511 | Bacteria | 24650 |
| 1965 | nmdc:mga08y16_15702_c1 | 3300050511 | Bacteria | 7965 |
| 1966 | nmdc:mga08y16_16100_c1 | 3300050511 | Bacteria | 7864 |
| 1967 | nmdc:mga08y16_292599_c1 | 3300050511 | Bacteria | 1679 |
| 1968 | nmdc:mga08y16_296_c1 | 3300050511 | Bacteria | 44778 |
| 1969 | nmdc:mga08y16_304248_c1 | 3300050511 | Bacteria | 1643 |
| 1970 | nmdc:mga08y16_42140_c1 | 3300050511 | Bacteria | 4781 |
| 1971 | nmdc:mga08y16_549_c1 | 3300050511 | Bacteria | 34756 |
| 1972 | nmdc:mga08y16_75541_c1 | 3300050511 | Bacteria | 3513 |
| 1973 | nmdc:mga08y16_76045_c1 | 3300050511 | Bacteria | 3500 |
| 1974 | nmdc:mga0n895_10725_c1 | 3300050512 | Bacteria | 8121 |
| 1975 | nmdc:mga0n895_14066_c1 | 3300050512 | Bacteria | 7253 |
| 1976 | nmdc:mga0n895_14488_c1 | 3300050512 | Bacteria | 7163 |
| 1977 | nmdc:mga0n895_155153_c1 | 3300050512 | Bacteria | 2320 |
| 1978 | nmdc:mga0n895_24922_c1 | 3300050512 | Bacteria | 5644 |
| 1979 | nmdc:mga0n895_257540_c1 | 3300050512 | Bacteria | 1771 |
| 1980 | nmdc:mga0n895_283_c1 | 3300050512 | Bacteria | 33340 |
| 1981 | nmdc:mga0n895_313932_c1 | 3300050512 | Bacteria | 1588 |
| 1982 | nmdc:mga0n895_402289_c1 | 3300050512 | Bacteria | 1385 |
| 1983 | nmdc:mga0n895_508839_c1 | 3300050512 | Bacteria | 1213 |
| 1984 | nmdc:mga0n895_662409_c1 | 3300050512 | Bacteria | 1042 |
| 1985 | nmdc:mga0n895_8378_c1 | 3300050512 | Bacteria | 8949 |
| 1986 | nmdc:mga0n895_87742_c1 | 3300050512 | Bacteria | 3109 |
| 1987 | nmdc:mga0rr50_101579_c1 | 3300050513 | Bacteria | 2261 |
| 1988 | nmdc:mga0rr50_187395_c1 | 3300050513 | Bacteria | 1694 |
| 1989 | nmdc:mga0rr50_23493_c1 | 3300050513 | Bacteria | 4252 |
| 1990 | nmdc:mga0rr50_263993_c1 | 3300050513 | Bacteria | 1433 |
| 1991 | nmdc:mga0rr50_31921_c1 | 3300050513 | Bacteria | 3746 |
| 1992 | nmdc:mga0rr50_40686_c1 | 3300050513 | Bacteria | 3381 |
| 1993 | nmdc:mga0rr50_48387_c1 | 3300050513 | Bacteria | 3143 |
| 1994 | nmdc:mga0rr50_58209_c1 | 3300050513 | Bacteria | 2895 |
| 1995 | nmdc:mga0rr50_66150_c1 | 3300050513 | Bacteria | 2741 |
| 1996 | nmdc:mga0rr50_70345_c1 | 3300050513 | Bacteria | 2666 |
| 1997 | nmdc:mga0rr50_96239_c1 | 3300050513 | Bacteria | 2316 |
| 1998 | nmdc:mga08x19_115351_c1 | 3300050514 | Bacteria | 1795 |
| 1999 | nmdc:mga08x19_130065_c1 | 3300050514 | Bacteria | 1693 |
| 2000 | nmdc:mga08x19_19796_c1 | 3300050514 | Bacteria | 4136 |
| 2001 | nmdc:mga08x19_239060_c1 | 3300050514 | Bacteria | 1251 |
| 2002 | nmdc:mga08x19_68418_c1 | 3300050514 | Bacteria | 2311 |
| 2003 | nmdc:mga08x19_96494_c1 | 3300050514 | Bacteria | 1957 |
| 2004 | nmdc:mga0a205_135421_c1 | 3300050515 | Bacteria | 2364 |
| 2005 | nmdc:mga0a205_14811_c1 | 3300050515 | Bacteria | 7277 |
| 2006 | nmdc:mga0a205_163229_c1 | 3300050515 | Bacteria | 2124 |
| 2007 | nmdc:mga0a205_194670_c1 | 3300050515 | Bacteria | 1918 |
| 2008 | nmdc:mga0a205_195858_c1 | 3300050515 | Bacteria | 1912 |
| 2009 | nmdc:mga0a205_208182_c1 | 3300050515 | Bacteria | 1845 |
| 2010 | nmdc:mga0a205_23945_c1 | 3300050515 | Bacteria | 5796 |
| 2011 | nmdc:mga0a205_2463_c1 | 3300050515 | Bacteria | 16328 |
| 2012 | nmdc:mga0a205_2479_c1 | 3300050515 | Bacteria | 16274 |
| 2013 | nmdc:mga0a205_312773_c1 | 3300050515 | Bacteria | 1442 |
| 2014 | nmdc:mga0a205_387_c1 | 3300050515 | Bacteria | 33459 |
| 2015 | nmdc:mga0a205_5469_c1 | 3300050515 | Bacteria | 11438 |
| 2016 | nmdc:mga0a205_68067_c1 | 3300050515 | Bacteria | 3439 |
| 2017 | nmdc:mga0a205_8273_c1 | 3300050515 | Bacteria | 9459 |
| 2018 | nmdc:mga0a205_96842_c1 | 3300050515 | Bacteria | 2850 |
| 2019 | Ga0495601_0001193 | 3300053077 | Bacteria | 14223 |
| 2020 | Ga0495601_0002682 | 3300053077 | Bacteria | 10083 |
| 2021 | Ga0495601_0005148 | 3300053077 | Bacteria | 7599 |
| 2022 | Ga0495601_0026408 | 3300053077 | Bacteria | 3585 |
| 2023 | Ga0495601_0051000 | 3300053077 | Bacteria | 2611 |
| 2024 | Ga0495601_0144334 | 3300053077 | Bacteria | 1553 |
| 2025 | Ga0495612_0000272 | 3300053078 | Bacteria | 21285 |
| 2026 | Ga0495612_0001186 | 3300053078 | Bacteria | 10745 |
| 2027 | Ga0495612_0002689 | 3300053078 | Bacteria | 7345 |
| 2028 | Ga0495612_0033867 | 3300053078 | Bacteria | 2067 |
| 2029 | Ga0495595_0001637 | 3300053084 | Bacteria | 8760 |
| 2030 | Ga0495595_0011179 | 3300053084 | Bacteria | 3749 |
| 2031 | Ga0495595_0018090 | 3300053084 | Bacteria | 3040 |
| 2032 | Ga0495619_0002351 | 3300053085 | Bacteria | 12447 |
| 2033 | Ga0495619_0027494 | 3300053085 | Bacteria | 3664 |
| 2034 | Ga0495619_0041602 | 3300053085 | Bacteria | 3006 |
| 2035 | Ga0495619_0046149 | 3300053085 | Bacteria | 2864 |
| 2036 | Ga0495619_0059772 | 3300053085 | Bacteria | 2532 |
| 2037 | Ga0495619_0121031 | 3300053085 | Bacteria | 1794 |
| 2038 | Ga0495619_0163807 | 3300053085 | Bacteria | 1536 |
| 2039 | Ga0495619_0184991 | 3300053085 | Bacteria | 1441 |
| 2040 | Ga0500566_0042381 | 3300053094 | Bacteria | 2626 |
| 2041 | Ga0500641_0069441 | 3300053096 | Bacteria | 1481 |
| 2042 | Ga0500555_000080 | 3300053103 | Bacteria | 46241 |
| 2043 | Ga0500556_0000010 | 3300053104 | Bacteria | 258288 |
| 2044 | Ga0500642_0027843 | 3300053130 | Bacteria | 2324 |
| 2045 | Ga0500616_0008552 | 3300053153 | Bacteria | 6340 |
| 2046 | Ga0500639_000165 | 3300053163 | Bacteria | 32213 |
| 2047 | Ga0500637_0002795 | 3300053178 | Bacteria | 7839 |
| 2048 | Ga0501084_0004756 | 3300054114 | Bacteria | 11097 |
| 2049 | Ga0501084_0058084 | 3300054114 | Bacteria | 3237 |
| 2050 | Ga0501084_0090898 | 3300054114 | Bacteria | 2563 |
| 2051 | Ga0501084_0092931 | 3300054114 | Bacteria | 2532 |
| 2052 | Ga0501084_0122785 | 3300054114 | Bacteria | 2184 |
| 2053 | Ga0501084_0158687 | 3300054114 | Bacteria | 1908 |
| 2054 | Ga0501084_0161711 | 3300054114 | Bacteria | 1889 |
| 2055 | Ga0501084_0163516 | 3300054114 | Bacteria | 1878 |
| 2056 | Ga0501084_0182026 | 3300054114 | Bacteria | 1774 |
| 2057 | Ga0501084_0202926 | 3300054114 | Bacteria | 1673 |
| 2058 | Ga0501084_0360478 | 3300054114 | Bacteria | 1228 |
| 2059 | Ga0590071_017277 | 3300059421 | Bacteria | 1694 |
| 2060 | Ga0590075_004418 | 3300059424 | Bacteria | 3328 |
| 2061 | Ga0587084_002785 | 3300059477 | Bacteria | 1856 |
| 2062 | Ga0587066_006000 | 3300059490 | Bacteria | 1581 |
| 2063 | Ga0587066_010524 | 3300059490 | Bacteria | 1336 |
| 2064 | Ga0587070_006486 | 3300059491 | Bacteria | 1581 |
| 2065 | Ga0587073_0008387 | 3300059492 | Bacteria | 1671 |
| 2066 | Ga0587073_0011099 | 3300059492 | Bacteria | 1530 |
| 2067 | Ga0587077_002191 | 3300059493 | Bacteria | 2269 |
| 2068 | Ga0587080_002077 | 3300059503 | Bacteria | 2303 |
| 2069 | Ga0587082_002150 | 3300059504 | Bacteria | 2178 |
| 2070 | Ga0587082_005840 | 3300059504 | Bacteria | 1617 |
| 2071 | Ga0587083_0009205 | 3300059505 | Bacteria | 1569 |
| 2072 | Ga0587088_005803 | 3300059508 | Bacteria | 1640 |
| 2073 | Ga0587090_001583 | 3300059510 | Bacteria | 2340 |
| 2074 | Ga0587090_005804 | 3300059510 | Bacteria | 1563 |
| 2075 | Ga0587091_001928 | 3300059511 | Bacteria | 2358 |
| 2076 | Ga0587101_005388 | 3300059623 | Bacteria | 1418 |
| 2077 | Ga0587067_007675 | 3300059640 | Bacteria | 1551 |
| 2078 | Ga0587068_002101 | 3300059641 | Bacteria | 2377 |
| 2079 | Ga0587068_007185 | 3300059641 | Bacteria | 1581 |
| 2080 | Ga0587069_001180 | 3300059642 | Bacteria | 2315 |
| 2081 | Ga0587072_007679 | 3300059643 | Bacteria | 1686 |
| 2082 | Ga0587075_004270 | 3300059644 | Bacteria | 1649 |
| 2083 | Ga0587076_006638 | 3300059645 | Bacteria | 1551 |
| 2084 | Ga0587078_003195 | 3300059646 | Bacteria | 1644 |
| 2085 | Ga0587079_007334 | 3300059647 | Bacteria | 1646 |
| 2086 | Ga0587071_008168 | 3300060344 | Bacteria | 1690 |
| 2087 | Ga0501082_0042649 | 3300060353 | Bacteria | 3911 |
| 2088 | Ga0501082_0050059 | 3300060353 | Bacteria | 3603 |
| 2089 | Ga0501082_0057195 | 3300060353 | Bacteria | 3360 |
| 2090 | Ga0501082_0089615 | 3300060353 | Bacteria | 2656 |
| 2091 | Ga0501082_0109383 | 3300060353 | Bacteria | 2392 |
| 2092 | Ga0501082_0196250 | 3300060353 | Bacteria | 1756 |
| 2093 | Ga0501082_0205918 | 3300060353 | Bacteria | 1711 |
| 2094 | Ga0501082_0307130 | 3300060353 | Bacteria | 1381 |
| 2095 | Ga0530510_0015805 | 3300061734 | Bacteria | 5336 |
| 2096 | Ga0530510_0019238 | 3300061734 | Bacteria | 4846 |
| 2097 | Ga0530510_0045499 | 3300061734 | Bacteria | 3171 |
| 2098 | Ga0530510_0111613 | 3300061734 | Bacteria | 2003 |
| 2099 | Ga0530510_0193098 | 3300061734 | Bacteria | 1511 |
| 2100 | 2513658386 | 2513237096 | Bacteria | 8722461 |
| 2101 | 2513695943 | 2513237101 | Bacteria | 7952346 |
| 2102 | 2513857538 | 2513237137 | Bacteria | 9558895 |
| 2103 | 2513920122 | 2513237145 | Bacteria | 8979722 |
| 2104 | 2517893491 | 2517572143 | Bacteria | 9484767 |
| 2105 | 2524537996 | 2524023228 | Bacteria | 10118060 |
| 2106 | 2524539164 | 2524023228 | Bacteria | 10118060 |
| 2107 | 2601445477 | 2600255229 | Bacteria | 1988965 |
| 2108 | 2671118129 | 2667528175 | Bacteria | 7532676 |
| 2109 | 2671122206 | 2667528175 | Bacteria | 7532676 |
| 2110 | 2723846175 | 2721755755 | Bacteria | 8322773 |
| 2111 | 2728747746 | 2728368998 | Bacteria | 8720350 |
| 2112 | 2728752494 | 2728368998 | Bacteria | 8720350 |
| 2113 | 2793071752 | 2791355197 | Bacteria | 8420563 |
| 2114 | 2793076655 | |||
| 2115 | 2848298226 | 2848297114 | Bacteria | 3608511 |
| 2116 | 2874610915 | 2874604998 | Bacteria | 7834745 |
| 2117 | 2876810428 | 2876808645 | Bacteria | 8824342 |
| 2118 | 2879110528 | 2879110137 | Bacteria | 8907982 |
| 2119 | 2883294839 | 2883291878 | Bacteria | 5894118 |
| 2120 | 2883294852 | 2883291878 | Bacteria | 5894118 |
| 2121 | 2889041124 | 2889033259 | Bacteria | 9099371 |
| 2122 | 2903758269 | 2903748898 | Bacteria | 9972761 |
| 2123 | 2904696889 | 2904690495 | Bacteria | 9412302 |
| 2124 | 2904701652 | |||
| 2125 | 2906642791 | 2906635258 | Bacteria | 8601019 |
| 2126 | 2906665926 | 2906660503 | Bacteria | 8595048 |
| 2127 | 2908761465 | 2908756301 | Bacteria | 8864324 |
| 2128 | 2922361971 | 2922361189 | Bacteria | 7436256 |
| 2129 | 2922392023 | 2922386360 | Bacteria | 7017218 |
| 2130 | 2922428985 | |||
| 2131 | 2935637752 | 2935630451 | Bacteria | 8169952 |
| 2132 | 2941514425 | 2941507105 | Bacteria | 8166816 |
| 2133 | 2941522321 | 2941515067 | Bacteria | 8166720 |
| 2134 | 2941530160 | 2941523033 | Bacteria | 8169134 |
| 2135 | 3005479130 | 3005474847 | Bacteria | 9259049 |
| 2136 | 8002061395 | 8002060224 | Bacteria | 4026565 |
| 2137 | 8002061906 | 8002060224 | Bacteria | 4026565 |
| 2138 | 8006934630 | 8006933436 | Bacteria | 10410654 |
| 2139 | 8006942218 | 8006933436 | Bacteria | 10410654 |
| 2140 | 8006964529 | 8006964411 | Bacteria | 8966052 |
| 2141 | 8006974600 | 8006973647 | Bacteria | 10679141 |
| 2142 | 8006981952 | 8006973647 | Bacteria | 10679141 |
| 2143 | 8006986852 | 8006984368 | Bacteria | 9651211 |
| 2144 | 8006996071 | 8006994254 | Bacteria | 8309700 |
| 2145 | 8019564041 | 8019555841 | Bacteria | 9642137 |
| 2146 | 8019567346 | 8019565922 | Bacteria | 9639779 |
| 2147 | 8019574117 | 8019565922 | Bacteria | 9639779 |
| 2148 | 8056680461 | 8056673599 | Bacteria | 7871253 |
| 2149 | 8056691226 | 8056689827 | Bacteria | 6712655 |
| 2150 | Ga0157372_10197313 | |||
| 2151 | SwRhRL2b_contig_1298163 | |||
| 2152 | JGI24746J21847_1008028 | |||
| 2153 | JGI24737J22298_10024194 | |||
| 2154 | JGI24750J21931_1000315 | |||
| 2155 | JGI24034J26672_10002296 | |||
| 2156 | JGI24742J22300_10007414 | |||
| 2157 | JGI24742J22300_10010336 | |||
| 2158 | JGI24751J29686_10023018 | |||
| 2159 | JGI25406J46586_10022422 | |||
| 2160 | JGI26128J50194_1001392 | |||
| 2161 | JGI26129J50193_1000031 | |||
| 2162 | JGI26145J50221_1000624 | |||
| 2163 | JGI26134J50242_100275 | |||
| 2164 | JGI26133J50247_100062 | |||
| 2165 | JGI26132J50249_100231 | |||
| 2166 | JGI26143J51219_1000496 | |||
| 2167 | JGI26141J51220_1001165 | |||
| 2168 | JGI25405J52794_10001096 | |||
| 2169 | JGI25405J52794_10018929 | |||
| 2170 | Ga0058863_10074882 | |||
| 2171 | Ga0058863_10078133 | |||
| 2172 | Ga0058863_11936457 | |||
| 2173 | Ga0058861_10030509 | |||
| 2174 | Ga0058861_10159963 | |||
| 2175 | Ga0058861_12046052 | |||
| 2176 | Ga0058862_12356670 | |||
| 2177 | Ga0058862_12636649 | |||
| 2178 | Ga0058862_12778063 | |||
| 2179 | Ga0065704_10085384 | |||
| 2180 | Ga0065704_10117584 | |||
| 2181 | Ga0065715_10121960 | |||
| 2182 | Ga0065707_10002120 | |||
| 2183 | Ga0065707_10013752 | |||
| 2184 | Ga0065707_10084753 | |||
| 2185 | Ga0065707_10087315 | |||
| 2186 | Ga0065707_10136871 | |||
| 2187 | Ga0070658_10003484 | |||
| 2188 | Ga0070658_10005421 | |||
| 2189 | Ga0070658_10090607 | |||
| 2190 | Ga0070676_10000852 | |||
| 2191 | Ga0070676_10000896 | |||
| 2192 | Ga0070676_10029802 | |||
| 2193 | Ga0070676_10116078 | |||
| 2194 | Ga0070676_10136272 | |||
| 2195 | Ga0070683_100014149 | |||
| 2196 | Ga0070683_100019046 | |||
| 2197 | Ga0070683_100111556 | |||
| 2198 | Ga0070683_100196719 | |||
| 2199 | Ga0070690_100013884 | |||
| 2200 | Ga0070690_100078403 | |||
| 2201 | Ga0070690_100150078 | |||
| 2202 | Ga0070670_100003642 | |||
| 2203 | Ga0070670_100016207 | |||
| 2204 | Ga0070670_100046278 | |||
| 2205 | Ga0070670_100046292 | |||
| 2206 | Ga0070670_100062871 | |||
| 2207 | Ga0070670_100202418 | |||
| 2208 | Ga0070677_10003182 | |||
| 2209 | Ga0070677_10031276 | |||
| 2210 | Ga0068869_100006678 | |||
| 2211 | Ga0068869_100017207 | |||
| 2212 | Ga0068869_100128651 | |||
| 2213 | Ga0068869_100176193 | |||
| 2214 | Ga0070666_10032094 | |||
| 2215 | Ga0070680_100003246 | |||
| 2216 | Ga0070680_100003723 | |||
| 2217 | Ga0070680_100004063 | |||
| 2218 | Ga0070680_100013921 | |||
| 2219 | Ga0070680_100023192 | |||
| 2220 | Ga0070680_100027839 | |||
| 2221 | Ga0070680_100076391 | |||
| 2222 | Ga0070682_100017497 | |||
| 2223 | Ga0070682_100030502 | |||
| 2224 | Ga0068868_100001296 | |||
| 2225 | Ga0068868_100029640 | |||
| 2226 | Ga0068868_100206860 | |||
| 2227 | Ga0070660_100037805 | |||
| 2228 | Ga0070660_100075828 | |||
| 2229 | Ga0070660_100102672 | |||
| 2230 | Ga0070660_100139761 | |||
| 2231 | Ga0070660_100166869 | |||
| 2232 | Ga0070689_100006170 | |||
| 2233 | Ga0070689_100009184 | |||
| 2234 | Ga0070689_100032105 | |||
| 2235 | Ga0070689_100042151 | |||
| 2236 | Ga0070689_100051095 | |||
| 2237 | Ga0070689_100067740 | |||
| 2238 | Ga0070689_100096452 | |||
| 2239 | Ga0070689_100172197 | |||
| 2240 | Ga0070689_100219614 | |||
| 2241 | Ga0070691_10003913 | |||
| 2242 | Ga0070691_10020426 | |||
| 2243 | Ga0070691_10089558 | |||
| 2244 | Ga0070687_100004595 | |||
| 2245 | Ga0070687_100008671 | |||
| 2246 | Ga0070687_100014797 | |||
| 2247 | Ga0070687_100051544 | |||
| 2248 | Ga0070687_100060107 | |||
| 2249 | Ga0070661_100016310 | |||
| 2250 | Ga0070661_100042876 | |||
| 2251 | Ga0070661_100055375 | |||
| 2252 | Ga0070692_10013859 | |||
| 2253 | Ga0070692_10016750 | |||
| 2254 | Ga0070692_10027186 | |||
| 2255 | Ga0070668_100008383 | |||
| 2256 | Ga0070668_100017094 | |||
| 2257 | Ga0070668_100021697 | |||
| 2258 | Ga0070668_100035029 | |||
| 2259 | Ga0070668_100047647 | |||
| 2260 | Ga0070668_100246401 | |||
| 2261 | Ga0070669_100001998 | |||
| 2262 | Ga0070669_100013454 | |||
| 2263 | Ga0070669_100062002 | |||
| 2264 | Ga0070669_100066784 | |||
| 2265 | Ga0070675_100006526 | |||
| 2266 | Ga0070675_100018790 | |||
| 2267 | Ga0070675_100031007 | |||
| 2268 | Ga0070675_100074752 | |||
| 2269 | Ga0070675_100085083 | |||
| 2270 | Ga0070675_100096991 | |||
| 2271 | Ga0070675_100146178 | |||
| 2272 | Ga0070671_100079316 | |||
| 2273 | Ga0070671_100255325 | |||
| 2274 | Ga0070674_100001606 | |||
| 2275 | Ga0070674_100016846 | |||
| 2276 | Ga0070674_100030757 | |||
| 2277 | Ga0070674_100046250 | |||
| 2278 | Ga0070674_100142411 | |||
| 2279 | Ga0070673_100006677 | |||
| 2280 | Ga0070673_100026334 | |||
| 2281 | Ga0070673_100113997 | |||
| 2282 | Ga0070673_100189528 | |||
| 2283 | Ga0070688_100007379 | |||
| 2284 | Ga0070688_100041679 | |||
| 2285 | Ga0070688_100065254 | |||
| 2286 | Ga0070688_100096758 | |||
| 2287 | Ga0070659_100002785 | |||
| 2288 | Ga0070659_100019303 | |||
| 2289 | Ga0070659_100055980 | |||
| 2290 | Ga0070667_100055123 | |||
| 2291 | Ga0070667_100147072 | |||
| 2292 | Ga0070667_100328861 | |||
| 2293 | Ga0070703_10040799 | |||
| 2294 | Ga0070709_10002316 | |||
| 2295 | Ga0070709_10002621 | |||
| 2296 | Ga0070709_10008272 | |||
| 2297 | Ga0070709_10012009 | |||
| 2298 | Ga0070709_10016990 | |||
| 2299 | Ga0070709_10108541 | |||
| 2300 | Ga0070709_10204897 | |||
| 2301 | Ga0070714_100004755 | |||
| 2302 | Ga0070714_100055490 | |||
| 2303 | Ga0070714_100168597 | |||
| 2304 | Ga0070714_100268807 | |||
| 2305 | Ga0070713_100008004 | |||
| 2306 | Ga0070713_100022673 | |||
| 2307 | Ga0070713_100040073 | |||
| 2308 | Ga0070710_10006065 | |||
| 2309 | Ga0070710_10010819 | |||
| 2310 | Ga0070710_10092907 | |||
| 2311 | Ga0070701_10005417 | |||
| 2312 | Ga0070701_10023488 | |||
| 2313 | Ga0070711_100004283 | |||
| 2314 | Ga0070711_100015384 | |||
| 2315 | Ga0070711_100056462 | |||
| 2316 | Ga0070711_100077038 | |||
| 2317 | Ga0070705_100000175 | |||
| 2318 | Ga0070705_100002479 | |||
| 2319 | Ga0070705_100030070 | |||
| 2320 | Ga0070705_100033592 | |||
| 2321 | Ga0070705_100077350 | |||
| 2322 | Ga0070705_100126283 | |||
| 2323 | Ga0070700_100006909 | |||
| 2324 | Ga0070700_100009943 | |||
| 2325 | Ga0070700_100026867 | |||
| 2326 | Ga0070700_100030535 | |||
| 2327 | Ga0070700_100049208 | |||
| 2328 | Ga0070700_100078943 | |||
| 2329 | Ga0070700_100081059 | |||
| 2330 | Ga0070694_100002980 | |||
| 2331 | Ga0070694_100006648 | |||
| 2332 | Ga0070694_100025235 | |||
| 2333 | Ga0070694_100031890 | |||
| 2334 | Ga0070694_100034838 | |||
| 2335 | Ga0070694_100046376 | |||
| 2336 | Ga0070694_100100295 | |||
| 2337 | Ga0070694_100100423 | |||
| 2338 | Ga0070694_100194307 | |||
| 2339 | Ga0070694_100207796 | |||
| 2340 | Ga0070708_100014393 | |||
| 2341 | Ga0070708_100022190 | |||
| 2342 | Ga0070708_100025481 | |||
| 2343 | Ga0070708_100111985 | |||
| 2344 | Ga0070708_100130593 | |||
| 2345 | Ga0070708_100188023 | |||
| 2346 | Ga0070708_100210303 | |||
| 2347 | Ga0070708_100229002 | |||
| 2348 | Ga0070708_100262798 | |||
| 2349 | Ga0070708_100301947 | |||
| 2350 | Ga0070663_100204481 | |||
| 2351 | Ga0070678_100006525 | |||
| 2352 | Ga0070678_100036552 | |||
| 2353 | Ga0070678_100206605 | |||
| 2354 | Ga0070678_100224962 | |||
| 2355 | Ga0070662_100011148 | |||
| 2356 | Ga0070662_100014975 | |||
| 2357 | Ga0070662_100039023 | |||
| 2358 | Ga0070662_100045356 | |||
| 2359 | Ga0070662_100176892 | |||
| 2360 | Ga0070681_10002397 | |||
| 2361 | Ga0070681_10003472 | |||
| 2362 | Ga0070681_10007223 | |||
| 2363 | Ga0070681_10011126 | |||
| 2364 | Ga0070681_10025568 | |||
| 2365 | Ga0070681_10051196 | |||
| 2366 | Ga0070681_10079820 | |||
| 2367 | Ga0070681_10088539 | |||
| 2368 | Ga0070681_10105124 | |||
| 2369 | Ga0070681_10125946 | |||
| 2370 | Ga0070681_10167382 | |||
| 2371 | Ga0070681_10204011 | |||
| 2372 | Ga0070681_10370452 | |||
| 2373 | Ga0068867_100005066 | |||
| 2374 | Ga0068867_100100295 | |||
| 2375 | Ga0070685_10005310 | |||
| 2376 | Ga0070706_100004157 | |||
| 2377 | Ga0070706_100006592 | |||
| 2378 | Ga0070706_100023324 | |||
| 2379 | Ga0070706_100025041 | |||
| 2380 | Ga0070706_100048078 | |||
| 2381 | Ga0070706_100101171 | |||
| 2382 | Ga0070706_100123427 | |||
| 2383 | Ga0070706_100126482 | |||
| 2384 | Ga0070706_100135765 | |||
| 2385 | Ga0070706_100162922 | |||
| 2386 | Ga0070706_100253012 | |||
| 2387 | Ga0070707_100000111 | |||
| 2388 | Ga0070707_100019949 | |||
| 2389 | Ga0070707_100071190 | |||
| 2390 | Ga0070707_100074279 | |||
| 2391 | Ga0070707_100075299 | |||
| 2392 | Ga0070707_100088344 | |||
| 2393 | Ga0070707_100103404 | |||
| 2394 | Ga0070707_100108107 | |||
| 2395 | Ga0070707_100158149 | |||
| 2396 | Ga0070707_100225531 | |||
| 2397 | Ga0070707_100244470 | |||
| 2398 | Ga0070698_100000732 | |||
| 2399 | Ga0070698_100001954 | |||
| 2400 | Ga0070698_100048367 | |||
| 2401 | Ga0070698_100064792 | |||
| 2402 | Ga0070698_100138610 | |||
| 2403 | Ga0070698_100142564 | |||
| 2404 | Ga0070698_100145856 | |||
| 2405 | Ga0070698_100249357 | |||
| 2406 | Ga0070699_100025317 | |||
| 2407 | Ga0070699_100033808 | |||
| 2408 | Ga0070699_100041434 | |||
| 2409 | Ga0070699_100051744 | |||
| 2410 | Ga0070699_100053750 | |||
| 2411 | Ga0070699_100069767 | |||
| 2412 | Ga0070699_100319853 | |||
| 2413 | Ga0070679_100000601 | |||
| 2414 | Ga0070679_100023697 | |||
| 2415 | Ga0070679_100044346 | |||
| 2416 | Ga0070679_100045790 | |||
| 2417 | Ga0070679_100069873 | |||
| 2418 | Ga0070679_100072402 | |||
| 2419 | Ga0070679_100278807 | |||
| 2420 | Ga0070679_100343498 | |||
| 2421 | Ga0070684_100034431 | |||
| 2422 | Ga0070684_100041680 | |||
| 2423 | Ga0070684_100142679 | |||
| 2424 | Ga0070697_100024423 | |||
| 2425 | Ga0070697_100036389 | |||
| 2426 | Ga0070697_100046677 | |||
| 2427 | Ga0070697_100068800 | |||
| 2428 | Ga0070697_100089953 | |||
| 2429 | Ga0070697_100120873 | |||
| 2430 | Ga0070697_100135504 | |||
| 2431 | Ga0070697_100141679 | |||
| 2432 | Ga0070697_100144992 | |||
| 2433 | Ga0070697_100286344 | |||
| 2434 | Ga0068853_100026550 | |||
| 2435 | Ga0068853_100212483 | |||
| 2436 | Ga0070672_100003949 | |||
| 2437 | Ga0070672_100026322 | |||
| 2438 | Ga0070672_100171558 | |||
| 2439 | Ga0070672_100204838 | |||
| 2440 | Ga0070672_100245379 | |||
| 2441 | Ga0070686_100021163 | |||
| 2442 | Ga0070686_100051285 | |||
| 2443 | Ga0070686_100160151 | |||
| 2444 | Ga0070695_100008312 | |||
| 2445 | Ga0070695_100013344 | |||
| 2446 | Ga0070695_100033166 | |||
| 2447 | Ga0070695_100088152 | |||
| 2448 | Ga0070695_100150576 | |||
| 2449 | Ga0070695_100172301 | |||
| 2450 | Ga0070696_100005231 | |||
| 2451 | Ga0070696_100013998 | |||
| 2452 | Ga0070696_100028628 | |||
| 2453 | Ga0070696_100032388 | |||
| 2454 | Ga0070696_100042413 | |||
| 2455 | Ga0070696_100051895 | |||
| 2456 | Ga0070696_100053018 | |||
| 2457 | Ga0070696_100077257 | |||
| 2458 | Ga0070696_100105886 | |||
| 2459 | Ga0070696_100171415 | |||
| 2460 | Ga0070693_100043429 | |||
| 2461 | Ga0070665_100001142 | |||
| 2462 | Ga0070665_100106126 | |||
| 2463 | Ga0070665_100110500 | |||
| 2464 | Ga0070665_100194758 | |||
| 2465 | Ga0070665_100256810 | |||
| 2466 | Ga0070704_100003747 | |||
| 2467 | Ga0070704_100021663 | |||
| 2468 | Ga0070704_100023271 | |||
| 2469 | Ga0070704_100042785 | |||
| 2470 | Ga0068855_100016427 | |||
| 2471 | Ga0068855_100034201 | |||
| 2472 | Ga0068855_100041438 | |||
| 2473 | Ga0068855_100125252 | |||
| 2474 | Ga0068855_100156517 | |||
| 2475 | Ga0068855_100211199 | |||
| 2476 | Ga0068855_100307246 | |||
| 2477 | Ga0068855_100373693 | |||
| 2478 | Ga0070664_100011074 | |||
| 2479 | Ga0070664_100068537 | |||
| 2480 | Ga0070664_100139427 | |||
| 2481 | Ga0068857_100002740 | |||
| 2482 | Ga0068857_100015888 | |||
| 2483 | Ga0068857_100026578 | |||
| 2484 | Ga0068857_100061458 | |||
| 2485 | Ga0068854_100051569 | |||
| 2486 | Ga0068856_100163441 | |||
| 2487 | Ga0070702_100002572 | |||
| 2488 | Ga0070702_100008493 | |||
| 2489 | Ga0070702_100009357 | |||
| 2490 | Ga0070702_100016820 | |||
| 2491 | Ga0068852_100009981 | |||
| 2492 | Ga0068852_100021426 | |||
| 2493 | Ga0068852_100097256 | |||
| 2494 | Ga0068859_100003294 | |||
| 2495 | Ga0068859_100011939 | |||
| 2496 | Ga0068859_100015547 | |||
| 2497 | Ga0068859_100028177 | |||
| 2498 | Ga0068859_100083516 | |||
| 2499 | Ga0068859_100285147 | |||
| 2500 | Ga0068859_100300736 | |||
| 2501 | Ga0068864_100006580 | |||
| 2502 | Ga0068864_100012293 | |||
| 2503 | Ga0068864_100081652 | |||
| 2504 | Ga0068864_100112489 | |||
| 2505 | Ga0068866_10007241 | |||
| 2506 | Ga0068866_10012598 | |||
| 2507 | Ga0068866_10023782 | |||
| 2508 | Ga0068861_100000975 | |||
| 2509 | Ga0068861_100025036 | |||
| 2510 | Ga0068861_100109023 | |||
| 2511 | Ga0068861_100117879 | |||
| 2512 | Ga0068861_100288270 | |||
| 2513 | Ga0068863_100002641 | |||
| 2514 | Ga0068863_100043145 | |||
| 2515 | Ga0068863_100051547 | |||
| 2516 | Ga0068863_100064103 | |||
| 2517 | Ga0068863_100111800 | |||
| 2518 | Ga0068863_100202272 | |||
| 2519 | Ga0068863_100279109 | |||
| 2520 | Ga0068858_100003549 | |||
| 2521 | Ga0068858_100025878 | |||
| 2522 | Ga0068858_100060745 | |||
| 2523 | Ga0068858_100227052 | |||
| 2524 | Ga0068858_100306229 | |||
| 2525 | Ga0068860_100002169 | |||
| 2526 | Ga0068860_100004188 | |||
| 2527 | Ga0068860_100022141 | |||
| 2528 | Ga0068860_100105193 | |||
| 2529 | Ga0068860_100377495 | |||
| 2530 | Ga0068862_100000764 | |||
| 2531 | Ga0068862_100002926 | |||
| 2532 | Ga0068862_100003483 | |||
| 2533 | Ga0068862_100009767 | |||
| 2534 | Ga0068862_100010512 | |||
| 2535 | Ga0068862_100013561 | |||
| 2536 | Ga0068862_100054158 | |||
| 2537 | Ga0068862_100067739 | |||
| 2538 | Ga0068862_100088084 | |||
| 2539 | Ga0068862_100255669 | |||
| 2540 | Ga0081455_10000048 | |||
| 2541 | Ga0081455_10001008 | |||
| 2542 | Ga0081455_10002584 | |||
| 2543 | Ga0081455_10011198 | |||
| 2544 | Ga0081455_10020498 | |||
| 2545 | Ga0081455_10021909 | |||
| 2546 | Ga0081455_10151707 | |||
| 2547 | Ga0081455_10217200 | |||
| 2548 | Ga0081538_10025683 | |||
| 2549 | Ga0081538_10026012 | |||
| 2550 | Ga0081538_10027178 | |||
| 2551 | Ga0081540_1000039 | |||
| 2552 | Ga0081540_1001954 | |||
| 2553 | Ga0081540_1004248 | |||
| 2554 | Ga0081540_1005100 | |||
| 2555 | Ga0081540_1015691 | |||
| 2556 | Ga0081540_1032077 | |||
| 2557 | Ga0081540_1035908 | |||
| 2558 | Ga0081540_1042197 | |||
| 2559 | Ga0081540_1048547 | |||
| 2560 | Ga0081540_1051845 | |||
| 2561 | Ga0081540_1054086 | |||
| 2562 | Ga0081539_10005565 | |||
| 2563 | Ga0081539_10023434 | |||
| 2564 | Ga0081539_10029077 | |||
| 2565 | Ga0081539_10042213 | |||
| 2566 | Ga0081539_10042683 | |||
| 2567 | Ga0081539_10069342 | |||
| 2568 | Ga0070717_10039765 | |||
| 2569 | Ga0070717_10117638 | |||
| 2570 | Ga0070717_10126952 | |||
| 2571 | Ga0070717_10300996 | |||
| 2572 | Ga0075365_10056321 | |||
| 2573 | Ga0075365_10084311 | |||
| 2574 | Ga0075363_100004519 | |||
| 2575 | Ga0075364_10010958 | |||
| 2576 | Ga0075432_10005809 | |||
| 2577 | Ga0075432_10009022 | |||
| 2578 | Ga0070715_10006350 | |||
| 2579 | Ga0070715_10010428 | |||
| 2580 | Ga0070715_10021362 | |||
| 2581 | Ga0070715_10046249 | |||
| 2582 | Ga0070716_100005648 | |||
| 2583 | Ga0070716_100008042 | |||
| 2584 | Ga0070716_100014776 | |||
| 2585 | Ga0070716_100034413 | |||
| 2586 | Ga0070716_100114378 | |||
| 2587 | Ga0070716_100170288 | |||
| 2588 | Ga0070716_100201717 | |||
| 2589 | Ga0070712_100002022 | |||
| 2590 | Ga0070712_100121632 | |||
| 2591 | Ga0070712_100161335 | |||
| 2592 | Ga0075362_10001094 | |||
| 2593 | Ga0075362_10029472 | |||
| 2594 | Ga0075367_10047918 | |||
| 2595 | Ga0075369_10016456 | |||
| 2596 | Ga0075366_10005041 | |||
| 2597 | Ga0075366_10006363 | |||
| 2598 | Ga0075366_10134608 | |||
| 2599 | Ga0097621_100002102 | |||
| 2600 | Ga0097621_100012152 | |||
| 2601 | Ga0097621_100027490 | |||
| 2602 | Ga0097621_100163010 | |||
| 2603 | Ga0075370_10026686 | |||
| 2604 | Ga0075370_10112241 | |||
| 2605 | Ga0068871_100008543 | |||
| 2606 | Ga0068871_100034414 | |||
| 2607 | Ga0068871_100222917 | |||
| 2608 | Ga0068871_100262605 | |||
| 2609 | Ga0075428_100003062 | |||
| 2610 | Ga0075428_100012165 | |||
| 2611 | Ga0075428_100012701 | |||
| 2612 | Ga0075428_100014750 | |||
| 2613 | Ga0075428_100031483 | |||
| 2614 | Ga0075428_100031769 | |||
| 2615 | Ga0075428_100032084 | |||
| 2616 | Ga0075428_100070970 | |||
| 2617 | Ga0075428_100096246 | |||
| 2618 | Ga0075428_100100956 | |||
| 2619 | Ga0075428_100123298 | |||
| 2620 | Ga0075428_100175030 | |||
| 2621 | Ga0075428_100181164 | |||
| 2622 | Ga0075428_100226820 | |||
| 2623 | Ga0075430_100000196 | |||
| 2624 | Ga0075430_100000588 | |||
| 2625 | Ga0075430_100001414 | |||
| 2626 | Ga0075430_100002137 | |||
| 2627 | Ga0075430_100005309 | |||
| 2628 | Ga0075430_100012839 | |||
| 2629 | Ga0075430_100024234 | |||
| 2630 | Ga0075430_100030156 | |||
| 2631 | Ga0075430_100049042 | |||
| 2632 | Ga0075430_100074672 | |||
| 2633 | Ga0075430_100105672 | |||
| 2634 | Ga0075431_100000285 | |||
| 2635 | Ga0075431_100015841 | |||
| 2636 | Ga0075431_100017225 | |||
| 2637 | Ga0075431_100019032 | |||
| 2638 | Ga0075431_100025863 | |||
| 2639 | Ga0075431_100031481 | |||
| 2640 | Ga0075431_100091921 | |||
| 2641 | Ga0075431_100177690 | |||
| 2642 | Ga0075431_100182184 | |||
| 2643 | Ga0075431_100186865 | |||
| 2644 | Ga0075431_100196910 | |||
| 2645 | Ga0075431_100235873 | |||
| 2646 | Ga0075431_100306437 | |||
| 2647 | Ga0075431_100311671 | |||
| 2648 | Ga0075431_100379713 | |||
| 2649 | Ga0075433_10000728 | |||
| 2650 | Ga0075433_10002316 | |||
| 2651 | Ga0075433_10042950 | |||
| 2652 | Ga0075433_10056647 | |||
| 2653 | Ga0075433_10207815 | |||
| 2654 | Ga0075433_10221288 | |||
| 2655 | Ga0075433_10232108 | |||
| 2656 | Ga0075433_10322591 | |||
| 2657 | Ga0075434_100003094 | |||
| 2658 | Ga0075434_100079053 | |||
| 2659 | Ga0075434_100098077 | |||
| 2660 | Ga0075434_100098215 | |||
| 2661 | Ga0075434_100106220 | |||
| 2662 | Ga0075434_100214139 | |||
| 2663 | Ga0075434_100350883 | |||
| 2664 | Ga0075434_100410412 | |||
| 2665 | Ga0075429_100000573 | |||
| 2666 | Ga0075429_100015763 | |||
| 2667 | Ga0075429_100026560 | |||
| 2668 | Ga0075429_100066007 | |||
| 2669 | Ga0075429_100161147 | |||
| 2670 | Ga0068865_100013360 | |||
| 2671 | Ga0068865_100070394 | |||
| 2672 | Ga0068865_100080162 | |||
| 2673 | Ga0068865_100104200 | |||
| 2674 | Ga0068865_100211460 | |||
| 2675 | Ga0075436_100040622 | |||
| 2676 | Ga0075436_100051066 | |||
| 2677 | Ga0075436_100096253 | |||
| 2678 | Ga0097620_100003294 | |||
| 2679 | Ga0097620_100011939 | |||
| 2680 | Ga0097620_100015546 | |||
| 2681 | Ga0097620_100028177 | |||
| 2682 | Ga0097620_100083510 | |||
| 2683 | Ga0097620_100285152 | |||
| 2684 | Ga0097620_100300703 | |||
| 2685 | Ga0099822_1017947 | |||
| 2686 | Ga0075435_100049503 | |||
| 2687 | Ga0075435_100077177 | |||
| 2688 | Ga0075435_100133447 | |||
| 2689 | Ga0075435_100165794 | |||
| 2690 | Ga0075435_100217013 | |||
| 2691 | Ga0075435_100270475 | |||
| 2692 | Ga0099795_10014852 | |||
| 2693 | Ga0099795_10031443 | |||
| 2694 | Ga0105244_10054642 | |||
| 2695 | Ga0105240_10000041 | |||
| 2696 | Ga0105240_10004245 | |||
| 2697 | Ga0105240_10062946 | |||
| 2698 | Ga0105240_10317079 | |||
| 2699 | Ga0111539_10000254 | |||
| 2700 | Ga0111539_10000683 | |||
| 2701 | Ga0111539_10002526 | |||
| 2702 | Ga0111539_10011739 | |||
| 2703 | Ga0111539_10065953 | |||
| 2704 | Ga0111539_10099479 | |||
| 2705 | Ga0111539_10128818 | |||
| 2706 | Ga0111539_10145820 | |||
| 2707 | Ga0111539_10236594 | |||
| 2708 | Ga0111539_10279893 | |||
| 2709 | Ga0105245_10183915 | |||
| 2710 | Ga0105245_10242990 | |||
| 2711 | Ga0114129_10005890 | |||
| 2712 | Ga0114129_10007918 | |||
| 2713 | Ga0114129_10008352 | |||
| 2714 | Ga0114129_10008584 | |||
| 2715 | Ga0114129_10022594 | |||
| 2716 | Ga0114129_10023982 | |||
| 2717 | Ga0114129_10024415 | |||
| 2718 | Ga0114129_10030751 | |||
| 2719 | Ga0114129_10036192 | |||
| 2720 | Ga0114129_10058827 | |||
| 2721 | Ga0114129_10116757 | |||
| 2722 | Ga0114129_10147439 | |||
| 2723 | Ga0114129_10173993 | |||
| 2724 | Ga0114129_10195878 | |||
| 2725 | Ga0114129_10271585 | |||
| 2726 | Ga0114129_10338416 | |||
| 2727 | Ga0114129_10357525 | |||
| 2728 | Ga0114129_10427049 | |||
| 2729 | Ga0114129_10595964 | |||
| 2730 | Ga0105243_10031684 | |||
| 2731 | Ga0105243_10079528 | |||
| 2732 | Ga0105243_10111592 | |||
| 2733 | Ga0105243_10227041 | |||
| 2734 | Ga0105242_10017209 | |||
| 2735 | Ga0105242_10055724 | |||
| 2736 | Ga0105248_10004070 | |||
| 2737 | Ga0105248_10023633 | |||
| 2738 | Ga0105248_10036522 | |||
| 2739 | Ga0105248_10050272 | |||
| 2740 | Ga0105248_10052133 | |||
| 2741 | Ga0105248_10332211 | |||
| 2742 | Ga0105237_10091369 | |||
| 2743 | Ga0105237_10214518 | |||
| 2744 | Ga0105238_10094918 | |||
| 2745 | Ga0105249_10000580 | |||
| 2746 | Ga0105249_10004567 | |||
| 2747 | Ga0105249_10008223 | |||
| 2748 | Ga0105249_10018979 | |||
| 2749 | Ga0105249_10127689 | |||
| 2750 | Ga0099796_10018211 | |||
| 2751 | Ga0099796_10029177 | |||
| 2752 | Ga0105239_10006094 | |||
| 2753 | Ga0105239_10023806 | |||
| 2754 | Ga0105246_10002307 | |||
| 2755 | Ga0105246_10140884 | |||
| 2756 | Ga0157326_1000019 | |||
| 2757 | Ga0157371_10010154 | |||
| 2758 | Ga0157371_10012727 | |||
| 2759 | Ga0157369_10067134 | |||
| 2760 | Ga0157369_10152920 | |||
| 2761 | Ga0157369_10320029 | |||
| 2762 | Ga0157374_10000059 | |||
| 2763 | Ga0157374_10000420 | |||
| 2764 | Ga0157374_10011042 | |||
| 2765 | Ga0157374_10063069 | |||
| 2766 | Ga0157378_10015692 | |||
| 2767 | Ga0157378_10037718 | |||
| 2768 | Ga0157378_10089479 | |||
| 2769 | Ga0157378_10130357 | |||
| 2770 | Ga0157378_10200348 | |||
| 2771 | Ga0157378_10201694 | |||
| 2772 | Ga0163162_10006136 | |||
| 2773 | Ga0163162_10148135 | |||
| 2774 | Ga0163162_10234444 | |||
| 2775 | Ga0163162_10245555 | |||
| 2776 | Ga0157372_10043257 | |||
| 2777 | Ga0157375_10026125 | |||
| 2778 | Ga0157375_10043876 | |||
| 2779 | Ga0157375_10108740 | |||
| 2780 | Ga0157375_10190591 | |||
| 2781 | Ga0163163_10006954 | |||
| 2782 | Ga0163163_10022770 | |||
| 2783 | Ga0163163_10073351 | |||
| 2784 | Ga0163163_10103076 | |||
| 2785 | Ga0163163_10254024 | |||
| 2786 | Ga0163163_10389447 | |||
| 2787 | Ga0157380_10017794 | |||
| 2788 | Ga0157380_10130825 | |||
| 2789 | Ga0157380_10290076 | |||
| 2790 | Ga0157377_10036391 | |||
| 2791 | Ga0157379_10035446 | |||
| 2792 | Ga0157379_10072718 | |||
| 2793 | Ga0157379_10073976 | |||
| 2794 | Ga0157379_10174229 | |||
| 2795 | Ga0157376_10000366 | |||
| 2796 | Ga0157376_10021266 | |||
| 2797 | Ga0157376_10062627 | |||
| 2798 | Ga0157376_10072830 | |||
| 2799 | Ga0206356_10491331 | |||
| 2800 | Ga0206355_1150548 | |||
| 2801 | Ga0206352_10908026 | |||
| 2802 | Ga0206352_11257230 | |||
| 2803 | Ga0206350_10871634 | |||
| 2804 | Ga0206354_10060344 | |||
| 2805 | Ga0206354_10418299 | |||
| 2806 | Ga0213872_10080721 | |||
| 2807 | Ga0213874_10005086 | |||
| 2808 | Ga0213876_10004873 | |||
| 2809 | Ga0213876_10005191 | |||
| 2810 | Ga0213876_10024479 | |||
| 2811 | Ga0213876_10036554 | |||
| 2812 | Ga0224712_10012105 | |||
| 2813 | Ga0224712_10056701 | |||
| 2814 | Ga0228598_1000842 | |||
| 2815 | Ga0228598_1009546 | |||
| 2816 | Ga0209233_1002757 | |||
| 2817 | Ga0209758_1000294 | |||
| 2818 | Ga0209758_1003798 | |||
| 2819 | Ga0209758_1006193 | |||
| 2820 | Ga0207697_10007256 | |||
| 2821 | Ga0207697_10008426 | |||
| 2822 | Ga0207697_10010465 | |||
| 2823 | Ga0207696_1012954 | |||
| 2824 | Ga0207653_10001008 | |||
| 2825 | Ga0207682_10015238 | |||
| 2826 | Ga0207682_10018511 | |||
| 2827 | Ga0207682_10097011 | |||
| 2828 | Ga0207692_10001850 | |||
| 2829 | Ga0207692_10001861 | |||
| 2830 | Ga0207692_10004350 | |||
| 2831 | Ga0207692_10008328 | |||
| 2832 | Ga0207642_10010483 | |||
| 2833 | Ga0207642_10017186 | |||
| 2834 | Ga0207642_10083695 | |||
| 2835 | Ga0207642_10084880 | |||
| 2836 | Ga0207642_10086501 | |||
| 2837 | Ga0207710_10033867 | |||
| 2838 | Ga0207647_10057140 | |||
| 2839 | Ga0207647_10070290 | |||
| 2840 | Ga0207685_10002961 | |||
| 2841 | Ga0207685_10006264 | |||
| 2842 | Ga0207685_10013698 | |||
| 2843 | Ga0207685_10027209 | |||
| 2844 | Ga0207699_10010108 | |||
| 2845 | Ga0207699_10015690 | |||
| 2846 | Ga0207699_10048407 | |||
| 2847 | Ga0207699_10080717 | |||
| 2848 | Ga0207699_10086124 | |||
| 2849 | Ga0207699_10118915 | |||
| 2850 | Ga0207645_10000909 | |||
| 2851 | Ga0207645_10001246 | |||
| 2852 | Ga0207645_10030019 | |||
| 2853 | Ga0207645_10039141 | |||
| 2854 | Ga0207643_10025597 | |||
| 2855 | Ga0207643_10030502 | |||
| 2856 | Ga0207643_10079555 | |||
| 2857 | Ga0207643_10083433 | |||
| 2858 | Ga0207705_10007506 | |||
| 2859 | Ga0207705_10097755 | |||
| 2860 | Ga0207684_10000334 | |||
| 2861 | Ga0207684_10005045 | |||
| 2862 | Ga0207684_10033102 | |||
| 2863 | Ga0207684_10065816 | |||
| 2864 | Ga0207684_10091560 | |||
| 2865 | Ga0207684_10099628 | |||
| 2866 | Ga0207684_10116816 | |||
| 2867 | Ga0207684_10253520 | |||
| 2868 | Ga0207654_10144844 | |||
| 2869 | Ga0207707_10002337 | |||
| 2870 | Ga0207707_10003270 | |||
| 2871 | Ga0207707_10004335 | |||
| 2872 | Ga0207707_10012860 | |||
| 2873 | Ga0207707_10013953 | |||
| 2874 | Ga0207707_10022768 | |||
| 2875 | Ga0207707_10027678 | |||
| 2876 | Ga0207707_10056109 | |||
| 2877 | Ga0207707_10059354 | |||
| 2878 | Ga0207707_10073265 | |||
| 2879 | Ga0207707_10108444 | |||
| 2880 | Ga0207707_10182832 | |||
| 2881 | Ga0207707_10205128 | |||
| 2882 | Ga0207695_10000093 | |||
| 2883 | Ga0207695_10003067 | |||
| 2884 | Ga0207695_10017539 | |||
| 2885 | Ga0207693_10001366 | |||
| 2886 | Ga0207693_10001926 | |||
| 2887 | Ga0207693_10003338 | |||
| 2888 | Ga0207693_10048951 | |||
| 2889 | Ga0207693_10062321 | |||
| 2890 | Ga0207693_10090627 | |||
| 2891 | Ga0207693_10113671 | |||
| 2892 | Ga0207663_10000218 | |||
| 2893 | Ga0207663_10000533 | |||
| 2894 | Ga0207663_10013116 | |||
| 2895 | Ga0207663_10041305 | |||
| 2896 | Ga0207663_10064474 | |||
| 2897 | Ga0207663_10076841 | |||
| 2898 | Ga0207663_10085049 | |||
| 2899 | Ga0207663_10278742 | |||
| 2900 | Ga0207660_10001269 | |||
| 2901 | Ga0207660_10001710 | |||
| 2902 | Ga0207660_10001861 | |||
| 2903 | Ga0207660_10009536 | |||
| 2904 | Ga0207660_10011255 | |||
| 2905 | Ga0207660_10013609 | |||
| 2906 | Ga0207660_10025700 | |||
| 2907 | Ga0207660_10036064 | |||
| 2908 | Ga0207660_10059416 | |||
| 2909 | Ga0207660_10067521 | |||
| 2910 | Ga0207660_10209597 | |||
| 2911 | Ga0207662_10000695 | |||
| 2912 | Ga0207662_10000745 | |||
| 2913 | Ga0207662_10006823 | |||
| 2914 | Ga0207662_10011914 | |||
| 2915 | Ga0207662_10016037 | |||
| 2916 | Ga0207662_10045667 | |||
| 2917 | Ga0207662_10091381 | |||
| 2918 | Ga0207657_10045238 | |||
| 2919 | Ga0207657_10057829 | |||
| 2920 | Ga0207657_10059343 | |||
| 2921 | Ga0207657_10082571 | |||
| 2922 | Ga0207657_10155717 | |||
| 2923 | Ga0207657_10182426 | |||
| 2924 | Ga0207649_10006102 | |||
| 2925 | Ga0207649_10007666 | |||
| 2926 | Ga0207649_10008227 | |||
| 2927 | Ga0207649_10018776 | |||
| 2928 | Ga0207652_10004826 | |||
| 2929 | Ga0207652_10006486 | |||
| 2930 | Ga0207652_10022531 | |||
| 2931 | Ga0207652_10031244 | |||
| 2932 | Ga0207652_10044290 | |||
| 2933 | Ga0207652_10196571 | |||
| 2934 | Ga0207646_10000163 | |||
| 2935 | Ga0207646_10012943 | |||
| 2936 | Ga0207646_10071440 | |||
| 2937 | Ga0207646_10077354 | |||
| 2938 | Ga0207646_10110092 | |||
| 2939 | Ga0207646_10220554 | |||
| 2940 | Ga0207646_10226890 | |||
| 2941 | Ga0207646_10248979 | |||
| 2942 | Ga0207681_10000921 | |||
| 2943 | Ga0207681_10001456 | |||
| 2944 | Ga0207681_10003904 | |||
| 2945 | Ga0207681_10005449 | |||
| 2946 | Ga0207681_10020067 | |||
| 2947 | Ga0207681_10031873 | |||
| 2948 | Ga0207681_10117087 | |||
| 2949 | Ga0207681_10284402 | |||
| 2950 | Ga0207694_10135749 | |||
| 2951 | Ga0207650_10006954 | |||
| 2952 | Ga0207650_10018698 | |||
| 2953 | Ga0207650_10028886 | |||
| 2954 | Ga0207650_10039543 | |||
| 2955 | Ga0207650_10042551 | |||
| 2956 | Ga0207650_10067277 | |||
| 2957 | Ga0207650_10115619 | |||
| 2958 | Ga0207650_10132476 | |||
| 2959 | Ga0207650_10135504 | |||
| 2960 | Ga0207659_10000959 | |||
| 2961 | Ga0207659_10007653 | |||
| 2962 | Ga0207659_10012855 | |||
| 2963 | Ga0207659_10053718 | |||
| 2964 | Ga0207659_10060754 | |||
| 2965 | Ga0207659_10100538 | |||
| 2966 | Ga0207659_10154739 | |||
| 2967 | Ga0207687_10106619 | |||
| 2968 | Ga0207700_10026269 | |||
| 2969 | Ga0207700_10036414 | |||
| 2970 | Ga0207664_10261591 | |||
| 2971 | Ga0207644_10076837 | |||
| 2972 | Ga0207644_10164498 | |||
| 2973 | Ga0207690_10022305 | |||
| 2974 | Ga0207690_10023620 | |||
| 2975 | Ga0207706_10002035 | |||
| 2976 | Ga0207706_10005841 | |||
| 2977 | Ga0207706_10028938 | |||
| 2978 | Ga0207706_10053166 | |||
| 2979 | Ga0207686_10001079 | |||
| 2980 | Ga0207686_10015176 | |||
| 2981 | Ga0207686_10018632 | |||
| 2982 | Ga0207686_10030722 | |||
| 2983 | Ga0207686_10033926 | |||
| 2984 | Ga0207686_10042605 | |||
| 2985 | Ga0207686_10049385 | |||
| 2986 | Ga0207709_10002980 | |||
| 2987 | Ga0207709_10034936 | |||
| 2988 | Ga0207709_10072298 | |||
| 2989 | Ga0207709_10137952 | |||
| 2990 | Ga0207709_10157252 | |||
| 2991 | Ga0207670_10012034 | |||
| 2992 | Ga0207670_10036246 | |||
| 2993 | Ga0207670_10039944 | |||
| 2994 | Ga0207670_10081319 | |||
| 2995 | Ga0207670_10242798 | |||
| 2996 | Ga0207669_10011707 | |||
| 2997 | Ga0207669_10026425 | |||
| 2998 | Ga0207669_10028160 | |||
| 2999 | Ga0207669_10146520 | |||
| 3000 | Ga0207669_10164508 | |||
| 3001 | Ga0207704_10003676 | |||
| 3002 | Ga0207704_10008696 | |||
| 3003 | Ga0207704_10037526 | |||
| 3004 | Ga0207704_10223226 | |||
| 3005 | Ga0207665_10005278 | |||
| 3006 | Ga0207665_10057769 | |||
| 3007 | Ga0207665_10108523 | |||
| 3008 | Ga0207665_10141623 | |||
| 3009 | Ga0207691_10018044 | |||
| 3010 | Ga0207691_10028811 | |||
| 3011 | Ga0207691_10031365 | |||
| 3012 | Ga0207691_10187260 | |||
| 3013 | Ga0207711_10002753 | |||
| 3014 | Ga0207711_10012732 | |||
| 3015 | Ga0207711_10020060 | |||
| 3016 | Ga0207711_10030222 | |||
| 3017 | Ga0207711_10057259 | |||
| 3018 | Ga0207711_10290926 | |||
| 3019 | Ga0207711_10404715 | |||
| 3020 | Ga0207689_10004653 | |||
| 3021 | Ga0207689_10044042 | |||
| 3022 | Ga0207689_10101234 | |||
| 3023 | Ga0207689_10204162 | |||
| 3024 | Ga0207661_10001853 | |||
| 3025 | Ga0207661_10021271 | |||
| 3026 | Ga0207661_10043353 | |||
| 3027 | Ga0207661_10059157 | |||
| 3028 | Ga0207661_10084492 | |||
| 3029 | Ga0207661_10102602 | |||
| 3030 | Ga0207661_10152829 | |||
| 3031 | Ga0207679_10001341 | |||
| 3032 | Ga0207679_10001347 | |||
| 3033 | Ga0207679_10002943 | |||
| 3034 | Ga0207679_10006574 | |||
| 3035 | Ga0207679_10040166 | |||
| 3036 | Ga0207679_10381630 | |||
| 3037 | Ga0207667_10002033 | |||
| 3038 | Ga0207667_10004001 | |||
| 3039 | Ga0207667_10016094 | |||
| 3040 | Ga0207667_10042200 | |||
| 3041 | Ga0207667_10044959 | |||
| 3042 | Ga0207667_10071599 | |||
| 3043 | Ga0207651_10001504 | |||
| 3044 | Ga0207651_10035925 | |||
| 3045 | Ga0207651_10080597 | |||
| 3046 | Ga0207651_10161489 | |||
| 3047 | Ga0207712_10000596 | |||
| 3048 | Ga0207712_10002234 | |||
| 3049 | Ga0207712_10009138 | |||
| 3050 | Ga0207712_10023580 | |||
| 3051 | Ga0207712_10043142 | |||
| 3052 | Ga0207712_10058166 | |||
| 3053 | Ga0207712_10058973 | |||
| 3054 | Ga0207712_10152678 | |||
| 3055 | Ga0207668_10001639 | |||
| 3056 | Ga0207668_10024669 | |||
| 3057 | Ga0207668_10028177 | |||
| 3058 | Ga0207668_10031247 | |||
| 3059 | Ga0207668_10047791 | |||
| 3060 | Ga0207668_10310721 | |||
| 3061 | Ga0207658_10035012 | |||
| 3062 | Ga0207677_10017448 | |||
| 3063 | Ga0207677_10119516 | |||
| 3064 | Ga0207677_10189306 | |||
| 3065 | Ga0207677_10298127 | |||
| 3066 | Ga0207703_10008320 | |||
| 3067 | Ga0207703_10012297 | |||
| 3068 | Ga0207703_10093383 | |||
| 3069 | Ga0207703_10101060 | |||
| 3070 | Ga0207703_10139787 | |||
| 3071 | Ga0207703_10170199 | |||
| 3072 | Ga0207703_10235862 | |||
| 3073 | Ga0207703_10301979 | |||
| 3074 | Ga0207639_10019041 | |||
| 3075 | Ga0207678_10000118 | |||
| 3076 | Ga0207678_10035455 | |||
| 3077 | Ga0207678_10039362 | |||
| 3078 | Ga0207678_10095005 | |||
| 3079 | Ga0207678_10207924 | |||
| 3080 | Ga0207678_10296505 | |||
| 3081 | Ga0207708_10004898 | |||
| 3082 | Ga0207708_10007880 | |||
| 3083 | Ga0207708_10054897 | |||
| 3084 | Ga0207708_10090622 | |||
| 3085 | Ga0207708_10122644 | |||
| 3086 | Ga0207702_10000678 | |||
| 3087 | Ga0207702_10066250 | |||
| 3088 | Ga0207702_10209393 | |||
| 3089 | Ga0207641_10006730 | |||
| 3090 | Ga0207641_10011831 | |||
| 3091 | Ga0207641_10114560 | |||
| 3092 | Ga0207648_10016323 | |||
| 3093 | Ga0207648_10052941 | |||
| 3094 | Ga0207648_10079224 | |||
| 3095 | Ga0207648_10083752 | |||
| 3096 | Ga0207648_10085952 | |||
| 3097 | Ga0207648_10145976 | |||
| 3098 | Ga0207648_10222012 | |||
| 3099 | Ga0207676_10011825 | |||
| 3100 | Ga0207676_10048181 | |||
| 3101 | Ga0207676_10052602 | |||
| 3102 | Ga0207676_10213603 | |||
| 3103 | Ga0207674_10019696 | |||
| 3104 | Ga0207674_10100148 | |||
| 3105 | Ga0207674_10156626 | |||
| 3106 | Ga0207674_10164710 | |||
| 3107 | Ga0207674_10194383 | |||
| 3108 | Ga0207674_10295767 | |||
| 3109 | Ga0207674_10295768 | |||
| 3110 | Ga0207675_100001482 | |||
| 3111 | Ga0207675_100013949 | |||
| 3112 | Ga0207675_100022225 | |||
| 3113 | Ga0207675_100034087 | |||
| 3114 | Ga0207675_100059999 | |||
| 3115 | Ga0207675_100086719 | |||
| 3116 | Ga0207675_100151309 | |||
| 3117 | Ga0207683_10001846 | |||
| 3118 | Ga0207683_10120249 | |||
| 3119 | Ga0207698_10063499 | |||
| 3120 | Ga0207698_10107570 | |||
| 3121 | Ga0207698_10394090 | |||
| 3122 | Ga0209973_1001352 | |||
| 3123 | Ga0209589_1000009 | |||
| 3124 | Ga0209969_1000998 | |||
| 3125 | Ga0209969_1005374 | |||
| 3126 | Ga0209700_100017 | |||
| 3127 | Ga0209967_1005224 | |||
| 3128 | Ga0209967_1007178 | |||
| 3129 | Ga0209981_1002218 | |||
| 3130 | Ga0209996_1000062 | |||
| 3131 | Ga0209984_1000027 | |||
| 3132 | Ga0209984_1001796 | |||
| 3133 | Ga0210000_1000018 | |||
| 3134 | Ga0210000_1002528 | |||
| 3135 | Ga0209995_1000072 | |||
| 3136 | Ga0209995_1002667 | |||
| 3137 | Ga0209995_1009379 | |||
| 3138 | Ga0209968_1000094 | |||
| 3139 | Ga0209968_1005632 | |||
| 3140 | Ga0209982_1000629 | |||
| 3141 | Ga0209970_1011065 | |||
| 3142 | Ga0210002_1001045 | |||
| 3143 | Ga0209983_1004487 | |||
| 3144 | Ga0209588_1000683 | |||
| 3145 | Ga0209588_1010983 | |||
| 3146 | Ga0209588_1018885 | |||
| 3147 | Ga0209971_1000266 | |||
| 3148 | Ga0209971_1010223 | |||
| 3149 | Ga0209971_1011157 | |||
| 3150 | Ga0209971_1011882 | |||
| 3151 | Ga0209966_1008167 | |||
| 3152 | Ga0209998_10003141 | |||
| 3153 | Ga0209974_10011093 | |||
| 3154 | Ga0207428_10000452 | |||
| 3155 | Ga0207428_10002442 | |||
| 3156 | Ga0207428_10002487 | |||
| 3157 | Ga0207428_10002947 | |||
| 3158 | Ga0207428_10008077 | |||
| 3159 | Ga0207428_10019254 | |||
| 3160 | Ga0207428_10019939 | |||
| 3161 | Ga0207428_10024590 | |||
| 3162 | Ga0207428_10087244 | |||
| 3163 | Ga0207428_10155353 | |||
| 3164 | Ga0268266_10016375 | |||
| 3165 | Ga0268266_10038713 | |||
| 3166 | Ga0268266_10069684 | |||
| 3167 | Ga0268266_10290198 | |||
| 3168 | Ga0268265_10000619 | |||
| 3169 | Ga0268265_10002653 | |||
| 3170 | Ga0268265_10003125 | |||
| 3171 | Ga0268265_10004276 | |||
| 3172 | Ga0268265_10023953 | |||
| 3173 | Ga0268265_10056115 | |||
| 3174 | Ga0268265_10148761 | |||
| 3175 | Ga0268264_10001609 | |||
| 3176 | Ga0268264_10002890 | |||
| 3177 | Ga0268264_10028955 | |||
| 3178 | Ga0268264_10076084 | |||
| 3179 | Ga0268264_10125894 | |||
| 3180 | Ga0268264_10142124 | |||
| 3181 | Ga0265334_10000037 | |||
| 3182 | Ga0265318_10001354 | |||
| 3183 | Ga0307517_10023999 | |||
| 3184 | Ga0265338_10083880 | |||
| 3185 | Ga0265330_10026535 | |||
| 3186 | Ga0265330_10040631 | |||
| 3187 | Ga0265332_10003683 | |||
| 3188 | Ga0265332_10025986 | |||
| 3189 | Ga0265320_10006474 | |||
| 3190 | Ga0265320_10069334 | |||
| 3191 | Ga0265325_10001769 | |||
| 3192 | Ga0265325_10042129 | |||
| 3193 | Ga0265325_10042338 | |||
| 3194 | Ga0265340_10003857 | |||
| 3195 | Ga0265340_10008522 | |||
| 3196 | Ga0265340_10009510 | |||
| 3197 | Ga0265331_10030089 | |||
| 3198 | Ga0265331_10033286 | |||
| 3199 | Ga0265327_10034681 | |||
| 3200 | Ga0265327_10068129 | |||
| 3201 | Ga0265316_10018043 | |||
| 3202 | Ga0307513_10204004 | |||
| 3203 | Ga0307408_100002257 | |||
| 3204 | Ga0307408_100002760 | |||
| 3205 | Ga0307408_100170999 | |||
| 3206 | Ga0307408_100189027 | |||
| 3207 | Ga0265313_10001884 | |||
| 3208 | Ga0265313_10055251 | |||
| 3209 | Ga0307508_10026303 | |||
| 3210 | Ga0307508_10047547 | |||
| 3211 | Ga0316575_10000334 | |||
| 3212 | Ga0316579_10098817 | |||
| 3213 | Ga0265314_10004347 | |||
| 3214 | Ga0265314_10004621 | |||
| 3215 | Ga0265314_10014975 | |||
| 3216 | Ga0265314_10031643 | |||
| 3217 | Ga0265314_10140826 | |||
| 3218 | Ga0265342_10025101 | |||
| 3219 | Ga0316576_10015331 | |||
| 3220 | Ga0316578_10069120 | |||
| 3221 | Ga0307405_10000834 | |||
| 3222 | Ga0307405_10051255 | |||
| 3223 | Ga0307405_10106508 | |||
| 3224 | Ga0316577_10000808 | |||
| 3225 | Ga0307413_10001842 | |||
| 3226 | Ga0307413_10006517 | |||
| 3227 | Ga0307413_10006826 | |||
| 3228 | Ga0307413_10029378 | |||
| 3229 | Ga0307413_10088705 | |||
| 3230 | Ga0307413_10130446 | |||
| 3231 | Ga0307410_10001490 | |||
| 3232 | Ga0307410_10037876 | |||
| 3233 | Ga0307410_10045318 | |||
| 3234 | Ga0307410_10046976 | |||
| 3235 | Ga0307410_10049143 | |||
| 3236 | Ga0307410_10100632 | |||
| 3237 | Ga0307406_10001264 | |||
| 3238 | Ga0307406_10002275 | |||
| 3239 | Ga0307406_10015689 | |||
| 3240 | Ga0307406_10025885 | |||
| 3241 | Ga0307406_10057841 | |||
| 3242 | Ga0307407_10017582 | |||
| 3243 | Ga0307407_10038507 | |||
| 3244 | Ga0307407_10090479 | |||
| 3245 | Ga0307412_10007821 | |||
| 3246 | Ga0307412_10009892 | |||
| 3247 | Ga0307412_10058964 | |||
| 3248 | Ga0307412_10079641 | |||
| 3249 | Ga0307412_10163159 | |||
| 3250 | Ga0307409_100007839 | |||
| 3251 | Ga0307409_100009070 | |||
| 3252 | Ga0307409_100019491 | |||
| 3253 | Ga0307409_100055682 | |||
| 3254 | Ga0307409_100096366 | |||
| 3255 | Ga0307409_100178900 | |||
| 3256 | Ga0307416_100001472 | |||
| 3257 | Ga0307416_100083952 | |||
| 3258 | Ga0307416_100096391 | |||
| 3259 | Ga0307416_100274081 | |||
| 3260 | Ga0307416_100523430 | |||
| 3261 | Ga0307414_10004583 | |||
| 3262 | Ga0307414_10080884 | |||
| 3263 | Ga0307414_10179904 | |||
| 3264 | Ga0307411_10007737 | |||
| 3265 | Ga0307411_10041503 | |||
| 3266 | Ga0307411_10107058 | |||
| 3267 | Ga0307411_10153895 | |||
| 3268 | Ga0307415_100001337 | |||
| 3269 | Ga0307415_100004471 | |||
| 3270 | Ga0307415_100017287 | |||
| 3271 | Ga0307415_100055843 | |||
| 3272 | Ga0307415_100095105 | |||
| 3273 | Ga0307415_100340738 | |||
| 3274 | Ga0316583_10001183 | |||
| 3275 | Ga0316585_10037261 | |||
| 3276 | Ga0316593_10051045 | |||
| 3277 | Ga0307510_10061720 | |||
| 3278 | Ga0315911_1000009 | |||
| 3279 | Ga0316592_1003439 | |||
| 3280 | Ga0316592_1008612 | |||
| 3281 | Ga0316588_1000228 | |||
| 3282 | Ga0316588_1006825 | |||
| 3283 | Ga0316588_1016804 | |||
| 3284 | Ga0316587_1000001 | |||
| 3285 | Ga0316587_1000006 | |||
| 3286 | Ga0316596_1028364 | |||
| 3287 | Ga0316215_1002072 | |||
| 3288 | Ga0373930_0008465 | |||
| 3289 | Ga0373948_0008982 | |||
| 3290 | Ga0373950_0016909 | |||
| 3291 | Ga0373959_0004698 | |||
| 3292 | Ga0373959_0008900 | |||
| 3293 | Ga0373938_0019036 | |||
| 3294 | Ga0373926_0002802 | |||
| 3295 | Ga0373926_0015003 | |||
| 3296 | Ga0373926_0025049 | |||
| 3297 | Ga0373928_0001860 | |||
| 3298 | Ga0373928_0017566 | |||
| 3299 | Ga0373929_0012636 | |||
| 3300 | Ga0373934_0000472 | |||
| 3301 | Ga0373934_0016588 | |||
| 3302 | Ga0373934_0069427 | |||
| 3303 | Ga0373934_0071452 | |||
| 3304 | Ga0373940_0000987 | |||
| 3305 | Ga0373949_0003354 | |||
| 3306 | Ga0373949_0010232 | |||
| 3307 | Ga0373949_0011969 | |||
| 3308 | Ga0373923_0026151 | |||
| 3309 | Ga0373923_0032751 | |||
| 3310 | Ga0373939_0010982 | |||
| 3311 | Ga0373939_0011969 | |||
| 3312 | Ga0373939_0016474 | |||
| 3313 | Ga0373939_0019524 | |||
| 3314 | Ga0373941_0011416 | |||
| 3315 | Ga0373941_0029431 | |||
| 3316 | Ga0373941_0042549 | |||
| 3317 | Ga0373941_0068417 | |||
| 3318 | Ga0373945_0085162 | |||
| 3319 | Ga0373953_0005866 | |||
| 3320 | Ga0373953_0028142 | |||
| 3321 | Ga0373954_0031264 | |||
| 3322 | Ga0373954_0087250 | |||
| 3323 | Ga0373956_0001329 | |||
| 3324 | Ga0373956_0038502 | |||
| 3325 | Ga0373956_0076406 | |||
| 3326 | Ga0373956_0078110 | |||
| 3327 | Ga0373957_0025695 | |||
| 3328 | Ga0373957_0030047 | |||
| 3329 | Ga0373957_0045634 | |||
| 3330 | Ga0373960_0009168 | |||
| 3331 | Ga0373960_0017396 | |||
| 3332 | Ga0373960_0019913 | |||
| 3333 | Ga0373943_0014563 | |||
| 3334 | Ga0373943_0097484 | |||
| 3335 | Ga0373946_0007151 | |||
| 3336 | Ga0373946_0018716 | |||
| 3337 | Ga0373946_0027375 | |||
| 3338 | Ga0373946_0095766 | |||
| 3339 | Ga0373955_0000309 | |||
| 3340 | Ga0373955_0012698 | |||
| 3341 | Ga0373955_0043063 | |||
| 3342 | Ga0373942_0008030 | |||
| 3343 | Ga0373942_0027676 | |||
| 3344 | Ga0373942_0034045 | |||
| 3345 | Ga0373942_0035913 | |||
| 3346 | Ga0373961_0020667 | |||
| 3347 | Ga0373961_0029361 | |||
| 3348 | Ga0373961_0034513 | |||
| 3349 | Ga0373962_0002684 | |||
| 3350 | Ga0373962_0013863 | |||
| 3351 | Ga0373962_0016237 | |||
| 3352 | Ga0373962_0021559 | |||
| 3353 | Ga0373924_0001445 | |||
| 3354 | Ga0373924_0011533 | |||
| 3355 | Ga0373931_0003223 | |||
| 3356 | Ga0373931_0008373 | |||
| 3357 | Ga0373931_0020620 | |||
| 3358 | Ga0373931_0035165 | |||
| 3359 | Ga0373931_0047139 | |||
| 3360 | Ga0373931_0072741 | |||
| 3361 | Ga0373931_0132212 | |||
| 3362 | Ga0373931_0135530 | |||
| 3363 | Ga0373935_0001142 | |||
| 3364 | Ga0373935_0008159 | |||
| 3365 | Ga0373935_0090314 | |||
| 3366 | Ga0373927_0029867 | |||
| 3367 | Ga0373927_0036111 | |||
| 3368 | Ga0373927_0053681 | |||
| 3369 | Ga0373927_0095902 | |||
| 3370 | Ga0373933_0000191 | |||
| 3371 | Ga0373933_0000226 | |||
| 3372 | Ga0373933_0002765 | |||
| 3373 | Ga0373933_0026815 | |||
| 3374 | Ga0373933_0057615 | |||
| 3375 | Ga0373933_0070349 | |||
| 3376 | Ga0373933_0082667 | |||
| 3377 | Ga0373933_0115338 | |||
| 3378 | Ga0373947_0012496 | |||
| 3379 | Ga0373947_0018231 | |||
| 3380 | Ga0373947_0028579 | |||
| 3381 | Ga0373947_0075744 | |||
| 3382 | Ga0373947_0106809 | |||
| 3383 | Ga0373947_0147968 | |||
| 3384 | Ga0310104_02351 | |||
| 3385 | Ga0373937_0000625 | |||
| 3386 | Ga0373937_0000922 | |||
| 3387 | Ga0373937_0007608 | |||
| 3388 | Ga0373937_0011530 | |||
| 3389 | Ga0373937_0020942 | |||
| 3390 | Ga0373937_0042587 | |||
| 3391 | Ga0373937_0057225 | |||
| 3392 | Ga0373937_0077479 | |||
| 3393 | Ga0373937_0082050 | |||
| 3394 | Ga0373937_0087155 | |||
| 3395 | Ga0373937_0110593 | |||
| 3396 | Ga0373937_0128072 | |||
| 3397 | Ga0373937_0144716 | |||
| 3398 | Ga0373937_0364132 | |||
| 3399 | Ga0373937_0560283 | |||
| 3400 | Ga0316582_0010203 | |||
| 3401 | Ga0316582_0020988 | |||
| 3402 | Ga0316582_0145583 | |||
| 3403 | Ga0316582_0159975 | |||
| 3404 | Ga0316584_0186233 | |||
| 3405 | Ga0373925_0011980 | |||
| 3406 | Ga0373925_0015764 | |||
| 3407 | Ga0373925_0029577 | |||
| 3408 | Ga0373925_0029981 | |||
| 3409 | Ga0373925_0042031 | |||
| 3410 | Ga0373925_0045962 | |||
| 3411 | Ga0373925_0065943 | |||
| 3412 | Ga0373925_0087086 | |||
| 3413 | Ga0373925_0103338 | |||
| 3414 | Ga0373925_0114848 | |||
| 3415 | Ga0373925_0116539 | |||
| 3416 | Ga0373925_0128704 | |||
| 3417 | Ga0373925_0216071 | |||
| 3418 | Ga0373925_0219440 | |||
| 3419 | Ga0395899_0009753 | |||
| 3420 | Ga0395899_0126969 | |||
| 3421 | Ga0395900_0001056 | |||
| 3422 | Ga0395900_0006668 | |||
| 3423 | Ga0395900_0013202 | |||
| 3424 | Ga0395900_0037244 | |||
| 3425 | Ga0395900_0058815 | |||
| 3426 | Ga0395900_0304856 | |||
| 3427 | Ga0395898_0004457 | |||
| 3428 | Ga0395898_0007760 | |||
| 3429 | Ga0395898_0039516 | |||
| 3430 | Ga0395898_0047677 | |||
| 3431 | Ga0395898_0158194 | |||
| 3432 | Ga0395905_0025260 | |||
| 3433 | Ga0395905_0038275 | |||
| 3434 | Ga0395905_0099808 | |||
| 3435 | Ga0395905_0155091 | |||
| 3436 | Ga0395905_0163267 | |||
| 3437 | Ga0395905_0193597 | |||
| 3438 | Ga0395905_0206228 | |||
| 3439 | Ga0395905_0383764 | |||
| 3440 | Ga0436364_0001908 | |||
| 3441 | Ga0436364_0931532 | |||
| 3442 | Ga0395901_0001137 | |||
| 3443 | Ga0395901_0001770 | |||
| 3444 | Ga0395901_0001933 | |||
| 3445 | Ga0395901_0010920 | |||
| 3446 | Ga0395901_0016009 | |||
| 3447 | Ga0395901_0388912 | |||
| 3448 | Ga0436365_0274631 | |||
| 3449 | Ga0436365_0774305 | |||
| 3450 | Ga0436365_1048027 | |||
| 3451 | Ga0436365_1305368 | |||
| 3452 | Ga0436360_0092949 | |||
| 3453 | Ga0436360_1325874 | |||
| 3454 | Ga0436361_0047865 | |||
| 3455 | Ga0436361_0496850 | |||
| 3456 | Ga0436363_0329569 | |||
| 3457 | Ga0436363_1374698 | |||
| 3458 | Ga0436362_0394382 | |||
| 3459 | Ga0436362_0603905 | |||
| 3460 | Ga0439447_009570 | |||
| 3461 | Ga0439453_0001969 | |||
| 3462 | Ga0439453_0016685 | |||
| 3463 | Ga0439461_0004017 | |||
| 3464 | Ga0439466_0025975 | |||
| 3465 | Ga0439465_0010957 | |||
| 3466 | Ga0451855_0958738 | |||
| 3467 | Ga0439437_001583 | |||
| 3468 | Ga0439441_003681 | |||
| 3469 | Ga0439442_009336 | |||
| 3470 | Ga0439448_0025835 | |||
| 3471 | Ga0439448_0053979 | |||
| 3472 | Ga0439450_013574 | |||
| 3473 | Ga0439455_0009644 | |||
| 3474 | Ga0439455_0018111 | |||
| 3475 | Ga0439455_0027284 | |||
| 3476 | Ga0450921_000329 | |||
| 3477 | Ga0450923_001795 | |||
| 3478 | Ga0450923_008971 | |||
| 3479 | Ga0450888_001021 | |||
| 3480 | Ga0450902_008086 | |||
| 3481 | Ga0450910_002597 | |||
| 3482 | Ga0439458_0012925 | |||
| 3483 | Ga0439458_0017725 | |||
| 3484 | Ga0439434_0001339 | |||
| 3485 | Ga0439434_0020661 | |||
| 3486 | Ga0439444_0021580 | |||
| 3487 | Ga0439459_0017297 | |||
| 3488 | Ga0439464_0010092 | |||
| 3489 | Ga0439464_0013994 | |||
| 3490 | Ga0439464_0021224 | |||
| 3491 | Ga0439464_0025031 | |||
| 3492 | Ga0439460_0016615 | |||
| 3493 | Ga0439460_0021671 | |||
| 3494 | Ga0439460_0034043 | |||
| 3495 | Ga0450893_0012896 | |||
| 3496 | Ga0451577_0000001 | |||
| 3497 | Ga0451577_0000139 | |||
| 3498 | Ga0451577_0003185 | |||
| 3499 | Ga0451577_0107174 | |||
| 3500 | Ga0451577_0134120 | |||
| 3501 | Ga0451577_0262410 | |||
| 3502 | Ga0451577_0315405 | |||
| 3503 | Ga0466969_0008223 | |||
| 3504 | Ga0453683_0000392 | |||
| 3505 | Ga0453683_0008242 | |||
| 3506 | Ga0453683_0018335 | |||
| 3507 | Ga0466963_0102827 | |||
| 3508 | Ga0453684_0007134 | |||
| 3509 | Ga0453684_0011806 | |||
| 3510 | Ga0453684_0016991 | |||
| 3511 | Ga0453684_0017055 | |||
| 3512 | Ga0453684_0023903 | |||
| 3513 | Ga0453684_0039258 | |||
| 3514 | Ga0453684_0043642 | |||
| 3515 | Ga0453684_0180682 | |||
| 3516 | Ga0453684_0344576 | |||
| 3517 | Ga0453684_0441992 | |||
| 3518 | Ga0466957_0172776 | |||
| 3519 | Ga0466960_0052749 | |||
| 3520 | Ga0451576_0001666 | |||
| 3521 | Ga0451576_0004133 | |||
| 3522 | Ga0451576_0005560 | |||
| 3523 | Ga0451576_0033892 | |||
| 3524 | Ga0451576_0067523 | |||
| 3525 | Ga0451576_0125552 | |||
| 3526 | Ga0451576_0132335 | |||
| 3527 | Ga0451576_0145157 | |||
| 3528 | Ga0451576_0176609 | |||
| 3529 | Ga0451576_0191597 | |||
| 3530 | Ga0451576_0302716 | |||
| 3531 | Ga0451576_0396244 | |||
| 3532 | Ga0451576_0421819 | |||
| 3533 | Ga0451576_0509390 | |||
| 3534 | Ga0466967_0083665 | |||
| 3535 | Ga0495592_0001172 | |||
| 3536 | Ga0495592_0057874 | |||
| 3537 | Ga0495592_0078693 | |||
| 3538 | Ga0495592_0112240 | |||
| 3539 | Ga0495592_0187398 | |||
| 3540 | Ga0495590_0033830 | |||
| 3541 | Ga0495629_0010959 | |||
| 3542 | Ga0495629_0013164 | |||
| 3543 | Ga0495629_0041225 | |||
| 3544 | Ga0495629_0050570 | |||
| 3545 | Ga0495629_0153391 | |||
| 3546 | Ga0495651_0000116 | |||
| 3547 | Ga0495651_0004583 | |||
| 3548 | Ga0495651_0012754 | |||
| 3549 | Ga0495651_0086816 | |||
| 3550 | Ga0495653_0000992 | |||
| 3551 | Ga0495653_0043909 | |||
| 3552 | Ga0495653_0075445 | |||
| 3553 | Ga0495580_0025129 | |||
| 3554 | Ga0495580_0070479 | |||
| 3555 | Ga0495580_0077981 | |||
| 3556 | Ga0495580_0084214 | |||
| 3557 | Ga0495580_0122521 | |||
| 3558 | Ga0495580_0129835 | |||
| 3559 | Ga0495582_0000533 | |||
| 3560 | Ga0495582_0003714 | |||
| 3561 | Ga0495582_0036893 | |||
| 3562 | Ga0495582_0047252 | |||
| 3563 | Ga0495582_0102061 | |||
| 3564 | Ga0495582_0111841 | |||
| 3565 | Ga0495639_0004359 | |||
| 3566 | Ga0495639_0004660 | |||
| 3567 | Ga0495639_0013867 | |||
| 3568 | Ga0495662_0000285 | |||
| 3569 | Ga0495662_0023087 | |||
| 3570 | Ga0495662_0039096 | |||
| 3571 | Ga0495662_0058686 | |||
| 3572 | Ga0495662_0137064 | |||
| 3573 | Ga0495662_0148498 | |||
| 3574 | Ga0495664_0000961 | |||
| 3575 | Ga0495584_0014690 | |||
| 3576 | Ga0495584_0033702 | |||
| 3577 | Ga0495594_0006984 | |||
| 3578 | Ga0495594_0026625 | |||
| 3579 | Ga0495594_0033559 | |||
| 3580 | Ga0495594_0040646 | |||
| 3581 | Ga0495594_0054681 | |||
| 3582 | Ga0495594_0085743 | |||
| 3583 | Ga0495596_0065051 | |||
| 3584 | Ga0495607_0105852 | |||
| 3585 | Ga0495606_0010760 | |||
| 3586 | Ga0495608_0001013 | |||
| 3587 | Ga0495608_0059430 | |||
| 3588 | Ga0495618_0008291 | |||
| 3589 | Ga0495618_0059266 | |||
| 3590 | Ga0495618_0096188 | |||
| 3591 | Ga0495628_0042659 | |||
| 3592 | Ga0495628_0051410 | |||
| 3593 | Ga0495628_0112083 | |||
| 3594 | Ga0495630_0000003 | |||
| 3595 | Ga0495630_0017202 | |||
| 3596 | Ga0495630_0034149 | |||
| 3597 | Ga0495630_0082123 | |||
| 3598 | Ga0495632_0090958 | |||
| 3599 | Ga0495643_0000057 | |||
| 3600 | Ga0495648_0003969 | |||
| 3601 | Ga0495666_0113004 | |||
| 3602 | Ga0495652_0001095 | |||
| 3603 | Ga0495652_0005949 | |||
| 3604 | Ga0495652_0040514 | |||
| 3605 | Ga0495652_0101153 | |||
| 3606 | Ga0495652_0124434 | |||
| 3607 | Ga0495665_0002814 | |||
| 3608 | Ga0495665_0007282 | |||
| 3609 | Ga0495665_0014231 | |||
| 3610 | Ga0495640_0020543 | |||
| 3611 | Ga0495640_0031131 | |||
| 3612 | Ga0495640_0064598 | |||
| 3613 | Ga0495640_0082221 | |||
| 3614 | Ga0495586_0030719 | |||
| 3615 | Ga0495586_0036590 | |||
| 3616 | Ga0495586_0081706 | |||
| 3617 | Ga0495586_0119850 | |||
| 3618 | Ga0495586_0201956 | |||
| 3619 | Ga0495587_0000143 | |||
| 3620 | Ga0495587_0000383 | |||
| 3621 | Ga0495587_0003735 | |||
| 3622 | Ga0495587_0004112 | |||
| 3623 | Ga0495598_0039224 | |||
| 3624 | Ga0495621_0025602 | |||
| 3625 | Ga0495645_0001091 | |||
| 3626 | Ga0495645_0001110 | |||
| 3627 | Ga0495645_0001766 | |||
| 3628 | Ga0495645_0012119 | |||
| 3629 | Ga0495633_0058911 | |||
| 3630 | Ga0495633_0070105 | |||
| 3631 | Ga0495667_0001636 | |||
| 3632 | Ga0495667_0011265 | |||
| 3633 | Ga0495667_0042365 | |||
| 3634 | Ga0495667_0107565 | |||
| 3635 | Ga0495634_0001443 | |||
| 3636 | Ga0495634_0018723 | |||
| 3637 | Ga0495635_0000158 | |||
| 3638 | Ga0495635_0007400 | |||
| 3639 | Ga0495635_0013387 | |||
| 3640 | Ga0495635_0079904 | |||
| 3641 | Ga0495659_0002742 | |||
| 3642 | Ga0495659_0008622 | |||
| 3643 | Ga0495659_0014552 | |||
| 3644 | Ga0495659_0021391 | |||
| 3645 | Ga0495659_0025300 | |||
| 3646 | Ga0495588_0021926 | |||
| 3647 | Ga0495657_0000476 | |||
| 3648 | Ga0495657_0032938 | |||
| 3649 | Ga0495657_0038867 | |||
| 3650 | Ga0495599_0000553 | |||
| 3651 | Ga0495599_0051496 | |||
| 3652 | Ga0495599_0059863 | |||
| 3653 | Ga0495623_0000017 | |||
| 3654 | Ga0495623_0037922 | |||
| 3655 | Ga0495623_0100595 | |||
| 3656 | Ga0495646_0002016 | |||
| 3657 | Ga0495647_0004317 | |||
| 3658 | Ga0495658_0001433 | |||
| 3659 | Ga0495658_0002526 | |||
| 3660 | Ga0495658_0010843 | |||
| 3661 | Ga0495658_0037637 | |||
| 3662 | Ga0495658_0071433 | |||
| 3663 | Ga0495613_0035991 | |||
| 3664 | Ga0495613_0056944 | |||
| 3665 | Ga0495613_0088810 | |||
| 3666 | Ga0495613_0215666 | |||
| 3667 | Ga0495624_0022926 | |||
| 3668 | Ga0495624_0033590 | |||
| 3669 | Ga0495671_0049169 | |||
| 3670 | Ga0495600_0029410 | |||
| 3671 | Ga0495600_0067651 | |||
| 3672 | Ga0495581_0001080 | |||
| 3673 | Ga0495581_0020101 | |||
| 3674 | Ga0495581_0020518 | |||
| 3675 | Ga0495581_0020800 | |||
| 3676 | Ga0495581_0117388 | |||
| 3677 | Ga0495604_0000017 | |||
| 3678 | Ga0495604_0067538 | |||
| 3679 | Ga0495636_0046182 | |||
| 3680 | Ga0495674_0003478 | |||
| 3681 | Ga0495674_0003779 | |||
| 3682 | Ga0495674_0008269 | |||
| 3683 | Ga0495674_0014556 | |||
| 3684 | Ga0495672_0004623 | |||
| 3685 | Ga0495676_0119184 | |||
| 3686 | Ga0495676_0192381 | |||
| 3687 | Ga0495680_0019971 | |||
| 3688 | Ga0495680_0062098 | |||
| 3689 | Ga0495680_0071580 | |||
| 3690 | Ga0495675_0001010 | |||
| 3691 | Ga0495675_0014092 | |||
| 3692 | Ga0495675_0199730 | |||
| 3693 | Ga0495684_0000095 | |||
| 3694 | Ga0495684_0033602 | |||
| 3695 | Ga0495593_0013848 | |||
| 3696 | Ga0495593_0048358 | |||
| 3697 | Ga0495602_0000485 | |||
| 3698 | Ga0495602_0000595 | |||
| 3699 | Ga0495602_0001119 | |||
| 3700 | Ga0495602_0042877 | |||
| 3701 | Ga0495614_0042180 | |||
| 3702 | Ga0495614_0083384 | |||
| 3703 | Ga0495615_0003581 | |||
| 3704 | Ga0495615_0017317 | |||
| 3705 | Ga0496100_0007174 | |||
| 3706 | Ga0496101_0000949 | |||
| 3707 | Ga0496101_0009865 | |||
| 3708 | Ga0496101_0024585 | |||
| 3709 | Ga0496101_0092511 | |||
| 3710 | Ga0496101_0129775 | |||
| 3711 | Ga0496102_0002642 | |||
| 3712 | Ga0496102_0003666 | |||
| 3713 | Ga0496102_0029697 | |||
| 3714 | Ga0496102_0047364 | |||
| 3715 | Ga0496102_0066985 | |||
| 3716 | Ga0496102_0068879 | |||
| 3717 | Ga0496102_0082955 | |||
| 3718 | Ga0496102_0094489 | |||
| 3719 | Ga0496102_0151946 | |||
| 3720 | Ga0496102_0156365 | |||
| 3721 | Ga0496102_0170502 | |||
| 3722 | Ga0496102_0296741 | |||
| 3723 | Ga0496103_0014722 | |||
| 3724 | Ga0496103_0022205 | |||
| 3725 | Ga0496103_0042027 | |||
| 3726 | Ga0496104_0000877 | |||
| 3727 | Ga0496104_0002308 | |||
| 3728 | Ga0496104_0015456 | |||
| 3729 | Ga0496104_0213706 | |||
| 3730 | Ga0496104_0310826 | |||
| 3731 | Ga0496105_0004564 | |||
| 3732 | Ga0496105_0020712 | |||
| 3733 | Ga0496105_0206979 | |||
| 3734 | Ga0496105_0221711 | |||
| 3735 | Ga0496106_0013980 | |||
| 3736 | Ga0496106_0020151 | |||
| 3737 | Ga0496106_0031117 | |||
| 3738 | Ga0496107_0000964 | |||
| 3739 | Ga0496107_0047674 | |||
| 3740 | Ga0496107_0073282 | |||
| 3741 | Ga0496107_0106102 | |||
| 3742 | Ga0496107_0153008 | |||
| 3743 | Ga0496108_0002874 | |||
| 3744 | Ga0496108_0018180 | |||
| 3745 | Ga0496108_0018765 | |||
| 3746 | Ga0496108_0039332 | |||
| 3747 | Ga0496108_0041216 | |||
| 3748 | Ga0496108_0110108 | |||
| 3749 | Ga0496108_0181253 | |||
| 3750 | Ga0496108_0183314 | |||
| 3751 | Ga0496109_0000518 | |||
| 3752 | Ga0496109_0009418 | |||
| 3753 | Ga0496109_0012751 | |||
| 3754 | Ga0496109_0019059 | |||
| 3755 | Ga0496109_0024078 | |||
| 3756 | Ga0496109_0027123 | |||
| 3757 | Ga0496109_0070950 | |||
| 3758 | Ga0496109_0116400 | |||
| 3759 | Ga0496109_0251306 | |||
| 3760 | Ga0496109_0270655 | |||
| 3761 | Ga0496109_0346469 | |||
| 3762 | Ga0496110_0001009 | |||
| 3763 | Ga0496110_0025610 | |||
| 3764 | Ga0496110_0040751 | |||
| 3765 | Ga0496110_0168266 | |||
| 3766 | Ga0496111_0035018 | |||
| 3767 | Ga0496111_0119557 | |||
| 3768 | Ga0496111_0156344 | |||
| 3769 | Ga0496111_0255744 | |||
| 3770 | Ga0496112_0000047 | |||
| 3771 | Ga0496112_0018432 | |||
| 3772 | Ga0496112_0023223 | |||
| 3773 | Ga0496112_0049360 | |||
| 3774 | Ga0496112_0050094 | |||
| 3775 | Ga0496112_0051573 | |||
| 3776 | Ga0496112_0061091 | |||
| 3777 | Ga0496112_0061243 | |||
| 3778 | Ga0496112_0070213 | |||
| 3779 | Ga0496112_0302638 | |||
| 3780 | Ga0496113_0016753 | |||
| 3781 | Ga0496113_0018957 | |||
| 3782 | Ga0496113_0065338 | |||
| 3783 | Ga0496113_0075614 | |||
| 3784 | Ga0496113_0152959 | |||
| 3785 | Ga0496113_0160607 | |||
| 3786 | Ga0496113_0163242 | |||
| 3787 | Ga0496114_0063260 | |||
| 3788 | Ga0496114_0119326 | |||
| 3789 | Ga0496115_0001671 | |||
| 3790 | Ga0496115_0007121 | |||
| 3791 | Ga0496115_0037529 | |||
| 3792 | Ga0496115_0042136 | |||
| 3793 | Ga0496115_0056597 | |||
| 3794 | Ga0496115_0148298 | |||
| 3795 | Ga0496121_0002196 | |||
| 3796 | Ga0496121_0003067 | |||
| 3797 | Ga0496126_0040052 | |||
| 3798 | Ga0501308_001422 | |||
| 3799 | Ga0501291_009303 | |||
| 3800 | Ga0501292_000099 | |||
| 3801 | Ga0501293_000646 | |||
| 3802 | Ga0501294_000377 | |||
| 3803 | Ga0501297_006292 | |||
| 3804 | Ga0501300_001419 | |||
| 3805 | Ga0501302_000215 | |||
| 3806 | Ga0501303_000203 | |||
| 3807 | Ga0501031_0038091 | |||
| 3808 | Ga0501031_0138467 | |||
| 3809 | Ga0501032_0001580 | |||
| 3810 | Ga0501032_0020821 | |||
| 3811 | Ga0501032_0037464 | |||
| 3812 | Ga0501032_0056579 | |||
| 3813 | Ga0501033_0000013 | |||
| 3814 | Ga0501034_0000208 | |||
| 3815 | Ga0501034_0002673 | |||
| 3816 | Ga0501034_0024772 | |||
| 3817 | Ga0501034_0032099 | |||
| 3818 | Ga0501034_0035297 | |||
| 3819 | Ga0501034_0057403 | |||
| 3820 | Ga0501034_0095353 | |||
| 3821 | Ga0501034_0351804 | |||
| 3822 | Ga0501034_0395891 | |||
| 3823 | Ga0501036_0005563 | |||
| 3824 | Ga0501036_0060890 | |||
| 3825 | Ga0501036_0078279 | |||
| 3826 | Ga0501036_0105762 | |||
| 3827 | Ga0501036_0144838 | |||
| 3828 | Ga0501036_0159884 | |||
| 3829 | Ga0501036_0168217 | |||
| 3830 | Ga0501037_0077015 | |||
| 3831 | Ga0501037_0272967 | |||
| 3832 | Ga0501038_0000212 | |||
| 3833 | Ga0501038_0038476 | |||
| 3834 | Ga0501038_0041934 | |||
| 3835 | Ga0501038_0062611 | |||
| 3836 | Ga0501038_0108450 | |||
| 3837 | Ga0501038_0303172 | |||
| 3838 | Ga0501039_0000072 | |||
| 3839 | Ga0501039_0001156 | |||
| 3840 | Ga0501039_0001269 | |||
| 3841 | Ga0501039_0131020 | |||
| 3842 | Ga0501039_0164694 | |||
| 3843 | Ga0501039_0171729 | |||
| 3844 | Ga0501039_0212676 | |||
| 3845 | Ga0501039_0222609 | |||
| 3846 | Ga0501039_0288359 | |||
| 3847 | Ga0501040_0006079 | |||
| 3848 | Ga0501040_0018714 | |||
| 3849 | Ga0501040_0048495 | |||
| 3850 | Ga0501040_0100972 | |||
| 3851 | Ga0501040_0139595 | |||
| 3852 | Ga0501041_0047400 | |||
| 3853 | Ga0501041_0134161 | |||
| 3854 | Ga0501042_0003193 | |||
| 3855 | Ga0501042_0013582 | |||
| 3856 | Ga0501042_0022117 | |||
| 3857 | Ga0501042_0102590 | |||
| 3858 | Ga0501042_0111497 | |||
| 3859 | Ga0501042_0250921 | |||
| 3860 | Ga0501043_0047927 | |||
| 3861 | Ga0501046_0001060 | |||
| 3862 | Ga0501046_0006019 | |||
| 3863 | Ga0501046_0014835 | |||
| 3864 | Ga0501046_0019160 | |||
| 3865 | Ga0501046_0022425 | |||
| 3866 | Ga0501046_0078669 | |||
| 3867 | Ga0501046_0094723 | |||
| 3868 | Ga0501047_0000235 | |||
| 3869 | Ga0501047_0001212 | |||
| 3870 | Ga0501047_0005869 | |||
| 3871 | Ga0501047_0059552 | |||
| 3872 | Ga0501047_0068651 | |||
| 3873 | Ga0501048_0000501 | |||
| 3874 | Ga0501048_0006738 | |||
| 3875 | Ga0501048_0016001 | |||
| 3876 | Ga0501048_0020369 | |||
| 3877 | Ga0501048_0130259 | |||
| 3878 | Ga0501048_0155930 | |||
| 3879 | Ga0501048_0205546 | |||
| 3880 | Ga0501067_0001590 | |||
| 3881 | Ga0501067_0012802 | |||
| 3882 | Ga0501067_0018310 | |||
| 3883 | Ga0501067_0037014 | |||
| 3884 | Ga0501067_0054271 | |||
| 3885 | Ga0501067_0054439 | |||
| 3886 | Ga0501067_0086970 | |||
| 3887 | Ga0501068_0003501 | |||
| 3888 | Ga0501068_0029846 | |||
| 3889 | Ga0501068_0106078 | |||
| 3890 | Ga0501069_0026314 | |||
| 3891 | Ga0501069_0138060 | |||
| 3892 | Ga0501069_0141669 | |||
| 3893 | Ga0501069_0155621 | |||
| 3894 | Ga0501070_0004020 | |||
| 3895 | Ga0501070_0016965 | |||
| 3896 | Ga0501070_0060711 | |||
| 3897 | Ga0501071_0042773 | |||
| 3898 | Ga0501071_0086964 | |||
| 3899 | Ga0501071_0193098 | |||
| 3900 | Ga0501071_0199519 | |||
| 3901 | Ga0501071_0289925 | |||
| 3902 | Ga0501072_0005670 | |||
| 3903 | Ga0501072_0040546 | |||
| 3904 | Ga0501072_0160162 | |||
| 3905 | Ga0501072_0161704 | |||
| 3906 | Ga0501072_0193359 | |||
| 3907 | Ga0501072_0285120 | |||
| 3908 | Ga0501073_0028073 | |||
| 3909 | Ga0501073_0105941 | |||
| 3910 | Ga0501073_0146428 | |||
| 3911 | Ga0501074_0010949 | |||
| 3912 | Ga0501074_0144720 | |||
| 3913 | Ga0501075_0013901 | |||
| 3914 | Ga0501075_0065131 | |||
| 3915 | Ga0501075_0083379 | |||
| 3916 | Ga0501075_0089183 | |||
| 3917 | Ga0501075_0137758 | |||
| 3918 | Ga0501075_0155558 | |||
| 3919 | Ga0501075_0188194 | |||
| 3920 | Ga0501076_0023202 | |||
| 3921 | Ga0501076_0039204 | |||
| 3922 | Ga0501076_0073626 | |||
| 3923 | Ga0501076_0079492 | |||
| 3924 | Ga0501076_0115786 | |||
| 3925 | Ga0501076_0120432 | |||
| 3926 | Ga0501076_0121280 | |||
| 3927 | Ga0501076_0129409 | |||
| 3928 | Ga0501076_0141391 | |||
| 3929 | Ga0501076_0251755 | |||
| 3930 | Ga0501076_0251920 | |||
| 3931 | Ga0501077_0031283 | |||
| 3932 | Ga0501077_0057632 | |||
| 3933 | Ga0501077_0082358 | |||
| 3934 | Ga0501077_0112695 | |||
| 3935 | Ga0501077_0118636 | |||
| 3936 | Ga0501077_0127280 | |||
| 3937 | Ga0501077_0190947 | |||
| 3938 | Ga0501077_0199970 | |||
| 3939 | Ga0501198_000368 | |||
| 3940 | Ga0501199_001333 | |||
| 3941 | Ga0501206_000344 | |||
| 3942 | Ga0501207_001334 | |||
| 3943 | Ga0501208_000919 | |||
| 3944 | Ga0501211_001971 | |||
| 3945 | Ga0501217_027815 | |||
| 3946 | Ga0501223_010696 | |||
| 3947 | Ga0501227_002932 | |||
| 3948 | Ga0501228_000191 | |||
| 3949 | Ga0501230_000123 | |||
| 3950 | Ga0501238_002198 | |||
| 3951 | Ga0501239_000520 | |||
| 3952 | Ga0501240_007700 | |||
| 3953 | Ga0501246_001971 | |||
| 3954 | Ga0501248_000546 | |||
| 3955 | Ga0501249_022446 | |||
| 3956 | Ga0501251_000031 | |||
| 3957 | Ga0501252_005815 | |||
| 3958 | Ga0501253_000193 | |||
| 3959 | Ga0501255_004416 | |||
| 3960 | Ga0501256_000081 | |||
| 3961 | Ga0501257_013729 | |||
| 3962 | Ga0501258_000070 | |||
| 3963 | Ga0501261_000363 | |||
| 3964 | Ga0501221_000136 | |||
| 3965 | Ga0501225_0000149 | |||
| 3966 | Ga0501225_0028573 | |||
| 3967 | Ga0501229_000082 | |||
| 3968 | Ga0501245_010629 | |||
| 3969 | Ga0501079_0074707 | |||
| 3970 | Ga0501079_0097101 | |||
| 3971 | Ga0501079_0122450 | |||
| 3972 | Ga0501079_0148612 | |||
| 3973 | Ga0501079_0155907 | |||
| 3974 | Ga0501079_0172008 | |||
| 3975 | Ga0501079_0195009 | |||
| 3976 | Ga0501079_0198243 | |||
| 3977 | Ga0501079_0243130 | |||
| 3978 | Ga0501079_0255552 | |||
| 3979 | Ga0501080_0000005 | |||
| 3980 | Ga0501080_0013007 | |||
| 3981 | Ga0501080_0045341 | |||
| 3982 | Ga0501080_0051985 | |||
| 3983 | Ga0501080_0060529 | |||
| 3984 | Ga0501080_0081520 | |||
| 3985 | Ga0501080_0133051 | |||
| 3986 | Ga0501080_0133128 | |||
| 3987 | Ga0501080_0138462 | |||
| 3988 | Ga0501081_0000419 | |||
| 3989 | Ga0501081_0024655 | |||
| 3990 | Ga0501081_0032063 | |||
| 3991 | Ga0501081_0089729 | |||
| 3992 | Ga0501081_0103607 | |||
| 3993 | Ga0501081_0270779 | |||
| 3994 | Ga0501241_003890 | |||
| 3995 | Ga0501262_002660 | |||
| 3996 | Ga0501263_003193 | |||
| 3997 | Ga0501265_000713 | |||
| 3998 | Ga0501268_002568 | |||
| 3999 | Ga0501269_004855 | |||
| 4000 | Ga0501271_000769 | |||
| 4001 | Ga0501273_003810 | |||
| 4002 | Ga0501275_000495 | |||
| 4003 | Ga0501276_001067 | |||
| 4004 | Ga0501278_000188 | |||
| 4005 | Ga0501280_000659 | |||
| 4006 | Ga0501281_00945 | |||
| 4007 | Ga0501283_006667 | |||
| 4008 | Ga0501283_008288 | |||
| 4009 | Ga0501035_0000049 | |||
| 4010 | Ga0501035_0012246 | |||
| 4011 | Ga0501035_0019292 | |||
| 4012 | Ga0501035_0071258 | |||
| 4013 | Ga0501035_0085598 | |||
| 4014 | Ga0501035_0109032 | |||
| 4015 | Ga0501044_0000030 | |||
| 4016 | Ga0501044_0000222 | |||
| 4017 | Ga0501044_0038683 | |||
| 4018 | Ga0501044_0073422 | |||
| 4019 | Ga0501045_0064837 | |||
| 4020 | Ga0501045_0070030 | |||
| 4021 | Ga0501045_0071503 | |||
| 4022 | Ga0501045_0079394 | |||
| 4023 | Ga0501045_0079903 | |||
| 4024 | Ga0501045_0104129 | |||
| 4025 | Ga0501045_0113403 | |||
| 4026 | Ga0501045_0148251 | |||
| 4027 | Ga0501045_0167482 | |||
| 4028 | Ga0501212_000067 | |||
| 4029 | Ga0501226_000129 | |||
| 4030 | nmdc:mga03683_18960_c1 | |||
| 4031 | nmdc:mga03683_429_c1 | |||
| 4032 | nmdc:mga03683_52353_c1 | |||
| 4033 | nmdc:mga00v17_201903_c1 | |||
| 4034 | nmdc:mga0yw44_93780_c1 | |||
| 4035 | nmdc:mga0k408_18213_c1 | |||
| 4036 | nmdc:mga0k408_27225_c1 | |||
| 4037 | nmdc:mga0k408_4095_c1 | |||
| 4038 | nmdc:mga0k408_50045_c1 | |||
| 4039 | nmdc:mga07m45_11904_c1 | |||
| 4040 | nmdc:mga05p37_119087_c1 | |||
| 4041 | nmdc:mga05p37_12453_c1 | |||
| 4042 | nmdc:mga05p37_125066_c1 | |||
| 4043 | nmdc:mga05p37_129158_c1 | |||
| 4044 | nmdc:mga05p37_15056_c1 | |||
| 4045 | nmdc:mga05p37_1773_c1 | |||
| 4046 | nmdc:mga05p37_180664_c1 | |||
| 4047 | nmdc:mga05p37_19612_c1 | |||
| 4048 | nmdc:mga05p37_210322_c1 | |||
| 4049 | nmdc:mga05p37_213294_c1 | |||
| 4050 | nmdc:mga05p37_235738_c1 | |||
| 4051 | nmdc:mga05p37_2437_c1 | |||
| 4052 | nmdc:mga05p37_2645_c1 | |||
| 4053 | nmdc:mga05p37_2754_c1 | |||
| 4054 | nmdc:mga05p37_36180_c1 | |||
| 4055 | nmdc:mga05p37_38754_c1 | |||
| 4056 | nmdc:mga05p37_422974_c1 | |||
| 4057 | nmdc:mga05p37_4273_c1 | |||
| 4058 | nmdc:mga05p37_459650_c1 | |||
| 4059 | nmdc:mga05p37_49398_c1 | |||
| 4060 | nmdc:mga05p37_544344_c1 | |||
| 4061 | nmdc:mga05p37_548375_c1 | |||
| 4062 | nmdc:mga05p37_568608_c1 | |||
| 4063 | nmdc:mga05p37_60272_c1 | |||
| 4064 | nmdc:mga05p37_64836_c1 | |||
| 4065 | nmdc:mga05p37_66256_c1 | |||
| 4066 | nmdc:mga05p37_94703_c1 | |||
| 4067 | nmdc:mga05p37_96138_c1 | |||
| 4068 | nmdc:mga09592_129009_c1 | |||
| 4069 | nmdc:mga09592_1370_c1 | |||
| 4070 | nmdc:mga09592_170261_c1 | |||
| 4071 | nmdc:mga09592_177703_c1 | |||
| 4072 | nmdc:mga09592_192404_c1 | |||
| 4073 | nmdc:mga09592_2394_c1 | |||
| 4074 | nmdc:mga09592_252820_c1 | |||
| 4075 | nmdc:mga09592_40151_c1 | |||
| 4076 | nmdc:mga09592_46677_c1 | |||
| 4077 | nmdc:mga09592_65529_c1 | |||
| 4078 | nmdc:mga09592_7464_c1 | |||
| 4079 | nmdc:mga0qj67_108914_c1 | |||
| 4080 | nmdc:mga0qj67_111484_c1 | |||
| 4081 | nmdc:mga0qj67_15872_c1 | |||
| 4082 | nmdc:mga0qj67_18360_c1 | |||
| 4083 | nmdc:mga0qj67_220862_c1 | |||
| 4084 | nmdc:mga0qj67_22931_c1 | |||
| 4085 | nmdc:mga0qj67_23583_c1 | |||
| 4086 | nmdc:mga0qj67_24513_c1 | |||
| 4087 | nmdc:mga0qj67_2465_c1 | |||
| 4088 | nmdc:mga0qj67_25617_c1 | |||
| 4089 | nmdc:mga0qj67_32040_c1 | |||
| 4090 | nmdc:mga0qj67_42067_c1 | |||
| 4091 | nmdc:mga0qj67_53256_c1 | |||
| 4092 | nmdc:mga0qj67_630_c1 | |||
| 4093 | nmdc:mga0qj67_65307_c1 | |||
| 4094 | nmdc:mga06r32_102584_c1 | |||
| 4095 | nmdc:mga06r32_11036_c1 | |||
| 4096 | nmdc:mga06r32_1300_c1 | |||
| 4097 | nmdc:mga06r32_145834_c1 | |||
| 4098 | nmdc:mga06r32_194953_c1 | |||
| 4099 | nmdc:mga06r32_208220_c1 | |||
| 4100 | nmdc:mga06r32_212712_c1 | |||
| 4101 | nmdc:mga06r32_26386_c1 | |||
| 4102 | nmdc:mga06r32_29260_c1 | |||
| 4103 | nmdc:mga06r32_36320_c1 | |||
| 4104 | nmdc:mga06r32_37302_c1 | |||
| 4105 | nmdc:mga06r32_638_c1 | |||
| 4106 | nmdc:mga06r32_66201_c1 | |||
| 4107 | nmdc:mga06r32_8250_c1 | |||
| 4108 | nmdc:mga06r32_85977_c1 | |||
| 4109 | nmdc:mga06r32_89288_c1 | |||
| 4110 | nmdc:mga06r32_89403_c1 | |||
| 4111 | nmdc:mga06r32_95660_c1 | |||
| 4112 | nmdc:mga08y16_1022_c1 | |||
| 4113 | nmdc:mga08y16_1323_c1 | |||
| 4114 | nmdc:mga08y16_15702_c1 | |||
| 4115 | nmdc:mga08y16_16100_c1 | |||
| 4116 | nmdc:mga08y16_292599_c1 | |||
| 4117 | nmdc:mga08y16_296_c1 | |||
| 4118 | nmdc:mga08y16_304248_c1 | |||
| 4119 | nmdc:mga08y16_42140_c1 | |||
| 4120 | nmdc:mga08y16_549_c1 | |||
| 4121 | nmdc:mga08y16_75541_c1 | |||
| 4122 | nmdc:mga08y16_76045_c1 | |||
| 4123 | nmdc:mga0n895_10725_c1 | |||
| 4124 | nmdc:mga0n895_14066_c1 | |||
| 4125 | nmdc:mga0n895_14488_c1 | |||
| 4126 | nmdc:mga0n895_155153_c1 | |||
| 4127 | nmdc:mga0n895_24922_c1 | |||
| 4128 | nmdc:mga0n895_257540_c1 | |||
| 4129 | nmdc:mga0n895_283_c1 | |||
| 4130 | nmdc:mga0n895_313932_c1 | |||
| 4131 | nmdc:mga0n895_402289_c1 | |||
| 4132 | nmdc:mga0n895_508839_c1 | |||
| 4133 | nmdc:mga0n895_662409_c1 | |||
| 4134 | nmdc:mga0n895_8378_c1 | |||
| 4135 | nmdc:mga0n895_87742_c1 | |||
| 4136 | nmdc:mga0rr50_101579_c1 | |||
| 4137 | nmdc:mga0rr50_187395_c1 | |||
| 4138 | nmdc:mga0rr50_23493_c1 | |||
| 4139 | nmdc:mga0rr50_263993_c1 | |||
| 4140 | nmdc:mga0rr50_31921_c1 | |||
| 4141 | nmdc:mga0rr50_40686_c1 | |||
| 4142 | nmdc:mga0rr50_48387_c1 | |||
| 4143 | nmdc:mga0rr50_58209_c1 | |||
| 4144 | nmdc:mga0rr50_66150_c1 | |||
| 4145 | nmdc:mga0rr50_70345_c1 | |||
| 4146 | nmdc:mga0rr50_96239_c1 | |||
| 4147 | nmdc:mga08x19_115351_c1 | |||
| 4148 | nmdc:mga08x19_130065_c1 | |||
| 4149 | nmdc:mga08x19_19796_c1 | |||
| 4150 | nmdc:mga08x19_239060_c1 | |||
| 4151 | nmdc:mga08x19_68418_c1 | |||
| 4152 | nmdc:mga08x19_96494_c1 | |||
| 4153 | nmdc:mga0a205_135421_c1 | |||
| 4154 | nmdc:mga0a205_14811_c1 | |||
| 4155 | nmdc:mga0a205_163229_c1 | |||
| 4156 | nmdc:mga0a205_194670_c1 | |||
| 4157 | nmdc:mga0a205_195858_c1 | |||
| 4158 | nmdc:mga0a205_208182_c1 | |||
| 4159 | nmdc:mga0a205_23945_c1 | |||
| 4160 | nmdc:mga0a205_2463_c1 | |||
| 4161 | nmdc:mga0a205_2479_c1 | |||
| 4162 | nmdc:mga0a205_312773_c1 | |||
| 4163 | nmdc:mga0a205_387_c1 | |||
| 4164 | nmdc:mga0a205_5469_c1 | |||
| 4165 | nmdc:mga0a205_68067_c1 | |||
| 4166 | nmdc:mga0a205_8273_c1 | |||
| 4167 | nmdc:mga0a205_96842_c1 | |||
| 4168 | Ga0495601_0001193 | |||
| 4169 | Ga0495601_0002682 | |||
| 4170 | Ga0495601_0005148 | |||
| 4171 | Ga0495601_0026408 | |||
| 4172 | Ga0495601_0051000 | |||
| 4173 | Ga0495601_0144334 | |||
| 4174 | Ga0495612_0000272 | |||
| 4175 | Ga0495612_0001186 | |||
| 4176 | Ga0495612_0002689 | |||
| 4177 | Ga0495612_0033867 | |||
| 4178 | Ga0495595_0001637 | |||
| 4179 | Ga0495595_0011179 | |||
| 4180 | Ga0495595_0018090 | |||
| 4181 | Ga0495619_0002351 | |||
| 4182 | Ga0495619_0027494 | |||
| 4183 | Ga0495619_0041602 | |||
| 4184 | Ga0495619_0046149 | |||
| 4185 | Ga0495619_0059772 | |||
| 4186 | Ga0495619_0121031 | |||
| 4187 | Ga0495619_0163807 | |||
| 4188 | Ga0495619_0184991 | |||
| 4189 | Ga0500566_0042381 | |||
| 4190 | Ga0500641_0069441 | |||
| 4191 | Ga0500555_000080 | |||
| 4192 | Ga0500556_0000010 | |||
| 4193 | Ga0500642_0027843 | |||
| 4194 | Ga0500616_0008552 | |||
| 4195 | Ga0500639_000165 | |||
| 4196 | Ga0500637_0002795 | |||
| 4197 | Ga0501084_0004756 | |||
| 4198 | Ga0501084_0058084 | |||
| 4199 | Ga0501084_0090898 | |||
| 4200 | Ga0501084_0092931 | |||
| 4201 | Ga0501084_0122785 | |||
| 4202 | Ga0501084_0158687 | |||
| 4203 | Ga0501084_0161711 | |||
| 4204 | Ga0501084_0163516 | |||
| 4205 | Ga0501084_0182026 | |||
| 4206 | Ga0501084_0202926 | |||
| 4207 | Ga0501084_0360478 | |||
| 4208 | Ga0590071_017277 | |||
| 4209 | Ga0590075_004418 | |||
| 4210 | Ga0587084_002785 | |||
| 4211 | Ga0587066_006000 | |||
| 4212 | Ga0587066_010524 | |||
| 4213 | Ga0587070_006486 | |||
| 4214 | Ga0587073_0008387 | |||
| 4215 | Ga0587073_0011099 | |||
| 4216 | Ga0587077_002191 | |||
| 4217 | Ga0587080_002077 | |||
| 4218 | Ga0587082_002150 | |||
| 4219 | Ga0587082_005840 | |||
| 4220 | Ga0587083_0009205 | |||
| 4221 | Ga0587088_005803 | |||
| 4222 | Ga0587090_001583 | |||
| 4223 | Ga0587090_005804 | |||
| 4224 | Ga0587091_001928 | |||
| 4225 | Ga0587101_005388 | |||
| 4226 | Ga0587067_007675 | |||
| 4227 | Ga0587068_002101 | |||
| 4228 | Ga0587068_007185 | |||
| 4229 | Ga0587069_001180 | |||
| 4230 | Ga0587072_007679 | |||
| 4231 | Ga0587075_004270 | |||
| 4232 | Ga0587076_006638 | |||
| 4233 | Ga0587078_003195 | |||
| 4234 | Ga0587079_007334 | |||
| 4235 | Ga0587071_008168 | |||
| 4236 | Ga0501082_0042649 | |||
| 4237 | Ga0501082_0050059 | |||
| 4238 | Ga0501082_0057195 | |||
| 4239 | Ga0501082_0089615 | |||
| 4240 | Ga0501082_0109383 | |||
| 4241 | Ga0501082_0196250 | |||
| 4242 | Ga0501082_0205918 | |||
| 4243 | Ga0501082_0307130 | |||
| 4244 | Ga0530510_0015805 | |||
| 4245 | Ga0530510_0019238 | |||
| 4246 | Ga0530510_0045499 | |||
| 4247 | Ga0530510_0111613 | |||
| 4248 | Ga0530510_0193098 | |||
| 4249 | 2513658386 | |||
| 4250 | 2513695943 | |||
| 4251 | 2513857538 | |||
| 4252 | 2513920122 | |||
| 4253 | 2517893491 | |||
| 4254 | 2524537996 | |||
| 4255 | 2524539164 | |||
| 4256 | 2601445477 | |||
| 4257 | 2671118129 | |||
| 4258 | 2671122206 | |||
| 4259 | 2723846175 | |||
| 4260 | 2728747746 | |||
| 4261 | 2728752494 | |||
| 4262 | 2793071752 | |||
| 4263 | 2793076655 | |||
| 4264 | 2848298226 | |||
| 4265 | 2874610915 | |||
| 4266 | 2876810428 | |||
| 4267 | 2879110528 | |||
| 4268 | 2883294839 | |||
| 4269 | 2883294852 | |||
| 4270 | 2889041124 | |||
| 4271 | 2903758269 | |||
| 4272 | 2904696889 | |||
| 4273 | 2904701652 | |||
| 4274 | 2906642791 | |||
| 4275 | 2906665926 | |||
| 4276 | 2908761465 | |||
| 4277 | 2922361971 | |||
| 4278 | 2922392023 | |||
| 4279 | 2922428985 | |||
| 4280 | 2935637752 | |||
| 4281 | 2941514425 | |||
| 4282 | 2941522321 | |||
| 4283 | 2941530160 | |||
| 4284 | 3005479130 | |||
| 4285 | 8002061395 | |||
| 4286 | 8002061906 | |||
| 4287 | 8006934630 | |||
| 4288 | 8006942218 | |||
| 4289 | 8006964529 | |||
| 4290 | 8006974600 | |||
| 4291 | 8006981952 | |||
| 4292 | 8006986852 | |||
| 4293 | 8006996071 | |||
| 4294 | 8019564041 | |||
| 4295 | 8019567346 | |||
| 4296 | 8019574117 | |||
| 4297 | 8056680461 | |||
| 4298 | 8056691226 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i4q-assembly1.cif.gz_C-2 | contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) | 0.9737 | 201 | 386 |
| 5i4q-assembly1.cif.gz_C-2 | contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) | 0.9686 | 201 | 386 |
| 2bvn-assembly2.cif.gz_B | e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia | 0.9199 | 7 | 386 |
| 6wd7-assembly1.cif.gz_8 | cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure ii-d) | 0.9193 | 291 | 385 |
| 6wd9-assembly1.cif.gz_8 | cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) | 0.9189 | 10 | 385 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2y12Z02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9842 | 199 | 288 | 2.40.30.10 |
| 5w7qA02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9821 | 199 | 292 | 2.40.30.10 |
| af_G5ECM6_248_343_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9808 | 199 | 289 | 2.40.30.10 |
| 4h9gA03 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9789 | 292 | 385 | 2.40.30.10 |
| af_Q7K3V6_252_380_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9786 | 199 | 319 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P7P1A2-F1-model_v4 | deleted | 1.006 | 206 | 288 |
|
| AF-A0A3S0V9N4-F1-model_v4 | Elongation factor Tu | 1.002 | 280 | 386 |
GO:0003746
GO:0005525 |
| AF-A0A352F424-F1-model_v4 | Elongation factor Tu (EC 3.6.5.3) | 1.001 | 294 | 386 |
GO:0003746
GO:0005525 GO:0005829 GO:0016787 |
| AF-A0A3D0F3T6-F1-model_v4 | Elongation factor Tu (EC 3.6.5.3) | 1.001 | 294 | 386 |
GO:0003746
GO:0005525 GO:0005829 GO:0016787 |
| AF-A0A1V5ZE31-F1-model_v4 | Elongation factor Tu | 1.001 | 304 | 386 |
GO:0003746
GO:0005525 |