F496417

General Info

Members Datasets Scaffolds Average Seq Length
2112 739 1955 304

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0024032|Ga0495686_0024032_1431_2483
Length 350
Sequence MPRFTAPRASRQSAASAALSHRQRAFSLFFDFFRTLAVATLICGSLAYDNIMTFEGRFREHILPEQVHILNVSFLVPTMRREFGGCAGNIAYALHLLGGDARIMATLGAVDAQLYIDRLDRLGLAKAHVRVLPDTYSAQAMITTDLENNQITAFHPGAMMQSHLNRADEAPGIKLGIVAPDGFDGMIQHSEQFAAKGVPFIFDPGQGLPLFDGASLRRMIELATYVAVNDYEAKLVSNKTGWSIEEIASHVDALIVTRGEHGSQIHHAGGIEEIPAVQAQRVLDPTGCGDAFRGGLLYGIEKGLGWATSGRLASLMGALKIEHQGPQNYAPSRAEINERFKQAFGYELAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
12 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
13 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
14 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
15 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
16 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
17 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
18 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
19 2519103095 Burkholderia sp. KJ006 Isolate Nodule
20 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
21 2547132374 Acidovorax radicis N35 Isolate Unclassified
22 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
23 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
24 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
25 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
26 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
27 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
28 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
29 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
30 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
31 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
32 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
33 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
34 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
35 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
36 2643221570 Acidovorax sp. Root568 Isolate Unclassified
37 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
38 2643221596 Acidovorax sp. Root70 Isolate Unclassified
39 2643221609 Acidovorax sp. Root217 Isolate Unclassified
40 2643221611 Acidovorax sp. Root219 Isolate Unclassified
41 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
42 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
43 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
44 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
45 2643221652 Acidovorax sp. Root402 Isolate Unclassified
46 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
47 2643221658 Variovorax sp. Root411 Isolate Unclassified
48 2643221660 Methylibium sp. Root1272 Isolate Unclassified
49 2643221672 Variovorax sp. Root434 Isolate Unclassified
50 2643221683 Variovorax sp. Root473 Isolate Unclassified
51 2643221717 Acidovorax sp. Root267 Isolate Unclassified
52 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
53 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
54 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
55 2721755523 Delftia sp. HK171 Isolate Unclassified
56 2738541277 Variovorax sp. GV051 Isolate Unclassified
57 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
58 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
59 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
60 2738541307 Variovorax sp. GV008 Isolate Unclassified
61 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
62 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
63 2738543012 Acidovorax sp. CF301 Isolate Unclassified
64 2738543013 Variovorax sp. BT01 Isolate Unclassified
65 2738543019 Variovorax sp. GV040 Isolate Unclassified
66 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
67 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
68 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
69 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
70 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
71 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
72 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
73 2816332133 Acidovorax radicis 2721A Isolate Unclassified
74 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
75 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
76 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
77 2818991446 Variovorax sp. 1180 Isolate Unclassified
78 2818991450 Burkholderia sp. 604 Isolate Unclassified
79 2818991452 Burkholderia cepacia 561 Isolate Unclassified
80 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
81 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
82 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
83 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
84 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
85 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
86 2842677519 Variovorax sp. R-72495 Isolate Unclassified
87 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
88 2842733646 Variovorax sp. R-72446 Isolate Unclassified
89 2842747753 Variovorax sp. R-72060 Isolate Unclassified
90 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
91 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
92 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
93 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
94 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
95 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
96 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
97 2885198086 Variovorax sp. 679 Isolate Unclassified
98 2885211737 Variovorax sp. 553 Isolate Unclassified
99 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
100 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
101 2899924645 Variovorax sp. 369 Isolate Unclassified
102 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
103 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
104 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
105 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
106 2904456579 Variovorax sp. 2002 Isolate Unclassified
107 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
108 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
109 2904564687 Burkholderia sp. 571 Isolate Unclassified
110 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
111 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
112 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
113 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
114 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
115 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
116 2928037797 Variovorax sp. 1126 Isolate Unclassified
117 2928044640 Variovorax sp. 1128 Isolate Unclassified
118 2928051484 Variovorax sp. 1133 Isolate Unclassified
119 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
120 2928070936 Variovorax gossypii 1167 Isolate Unclassified
121 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
122 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
123 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
124 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
125 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
126 2928163908 Burkholderia sp. 567 Isolate Unclassified
127 2928170801 Burkholderia sp. 572 Isolate Unclassified
128 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
129 2928536128 Burkholderia sola 565 Isolate Unclassified
130 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
131 2929520902 Variovorax beijingensis 502 Isolate Unclassified
132 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
133 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
134 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
135 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
136 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
137 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
138 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
139 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
140 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
141 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
142 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
143 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
144 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
145 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
146 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
147 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
148 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
149 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
150 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
151 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
152 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
153 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
154 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
155 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
156 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
157 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
158 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
159 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
160 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
161 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
162 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
163 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
164 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
165 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
166 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
167 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
168 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
169 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
170 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
171 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
172 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
173 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
174 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
175 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
176 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
177 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
178 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
179 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
180 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
181 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
182 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
183 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
184 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
185 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
188 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
189 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
192 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
193 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
194 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
195 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
196 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
197 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
198 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
199 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
200 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
201 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
202 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
203 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
204 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
205 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
206 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
207 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
208 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
209 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
210 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
211 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
212 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
213 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
214 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
215 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
216 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
217 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
218 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
219 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
220 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
221 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
222 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
223 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
224 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
225 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
226 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
227 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
228 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
229 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
230 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
231 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
232 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
233 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
234 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
235 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
236 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
237 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
238 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
239 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
240 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
245 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
246 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
247 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
248 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
249 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
250 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
251 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
252 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
253 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
254 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
255 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
256 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
257 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
258 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
259 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
260 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
261 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
262 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
263 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
264 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
265 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
267 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
268 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
269 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
270 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
271 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
272 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
273 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
274 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
275 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
276 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
277 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
278 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
279 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
280 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
281 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
282 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
283 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
284 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
285 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
286 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
287 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
288 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
289 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
290 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
291 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
292 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
293 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
294 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
295 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
296 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
297 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
298 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
299 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
300 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
301 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
302 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
303 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
304 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
305 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
306 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
307 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
312 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
314 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
315 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
316 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
319 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
320 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
321 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
322 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
324 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
325 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
328 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
330 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
333 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
393 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
394 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
395 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
396 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
397 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
398 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
399 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
400 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
401 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
402 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
403 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
404 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
405 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
409 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
410 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
411 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
412 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
413 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
414 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
415 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
416 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
417 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
418 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
419 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
420 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
421 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
422 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
423 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
424 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
425 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
426 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
427 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
428 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
429 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
430 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
431 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
432 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
433 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
434 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
435 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
436 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
437 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
438 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
439 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
440 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
441 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
442 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
443 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
444 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
445 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
446 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
447 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
448 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
449 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
450 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
451 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
452 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
453 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
454 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
455 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
456 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
457 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
458 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
459 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
460 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
461 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
462 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
463 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
464 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
465 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
466 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
467 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
468 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
469 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
470 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
471 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
472 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
473 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
474 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
475 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
476 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
477 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
478 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
479 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
480 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
481 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
482 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
483 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
484 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
485 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
486 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
487 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
488 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
489 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
490 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
491 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
492 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
493 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
494 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
495 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
496 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
497 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
498 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
499 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
500 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
501 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
502 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
503 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
504 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
505 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
506 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
507 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
508 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
509 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
510 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
511 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
512 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
513 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
514 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
515 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
516 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
517 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
518 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
519 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
520 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
521 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
522 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
523 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
524 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
525 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
526 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
527 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
528 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
529 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
530 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
531 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
532 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
533 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
534 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
535 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
536 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
537 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
538 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
539 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
540 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
541 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
542 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
543 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
544 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
545 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
546 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
547 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
548 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
549 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
550 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
551 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
552 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
553 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
554 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
555 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
556 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
557 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
558 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
559 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
560 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
561 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
562 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
563 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
564 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
565 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
566 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
567 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
568 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
569 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
570 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
571 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
572 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
573 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
574 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
575 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
576 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
577 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
578 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
579 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
580 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
581 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
582 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
583 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
584 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
585 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
586 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
587 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
588 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
589 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
590 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
591 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
592 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
593 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
594 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
595 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
596 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
597 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
598 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
599 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
600 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
601 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
602 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
603 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
604 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
605 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
606 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
607 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
608 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
609 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
610 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
611 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
612 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
613 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
614 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
615 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
616 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
617 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
618 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
619 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
620 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
621 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
622 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
623 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
624 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
625 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
626 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
627 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
628 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
629 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
630 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
631 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
632 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
633 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
634 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
635 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
636 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
637 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
638 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
639 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
640 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
641 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
642 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
643 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
644 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
645 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
646 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
647 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
648 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
649 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
650 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
652 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
653 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
654 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
655 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
656 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
657 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
658 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
659 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
660 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
661 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
662 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
663 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
664 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
665 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
666 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
667 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
668 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
669 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
670 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
671 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
672 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
673 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
674 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
675 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
676 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
677 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
678 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
679 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
680 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
681 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
682 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
683 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
684 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
685 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
686 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
687 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
688 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
689 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
690 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
691 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
692 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
693 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
694 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
695 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
696 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
697 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
698 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
699 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
700 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
701 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
702 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
703 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
704 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
705 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
706 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
707 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
708 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
709 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
710 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
711 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
712 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
713 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
714 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
715 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
716 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
717 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
718 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
719 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
720 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
721 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
722 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
723 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
724 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
725 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
726 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
727 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
728 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
729 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
730 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
731 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
732 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
733 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
734 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
735 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
736 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
737 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
738 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
739 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.23
Metatranscriptomes 0.28
Isolates 7.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.99
Nodule 1.33
Rhizoplane 3.69
Rhizosphere 65.34
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2000172 2162886007 Bacteria 1176
2 JGI24740J21852_10015733 3300001979 Bacteria 2751
3 JGI24740J21852_10021639 3300001979 Bacteria 2226
4 JGI24740J21852_10022466 3300001979 Bacteria 2171
5 JGI24739J22299_10001586 3300001989 Bacteria 8607
6 JGI24739J22299_10009303 3300001989 Bacteria 3666
7 JGI24739J22299_10009996 3300001989 Bacteria 3527
8 JGI24739J22299_10014340 3300001989 Bacteria 2884
9 JGI24739J22299_10019252 3300001989 Bacteria 2446
10 JGI24739J22299_10028600 3300001989 Bacteria 1943
11 JGI24735J21928_10000832 3300002067 Bacteria 10968
12 JGI24735J21928_10001906 3300002067 Bacteria 7309
13 JGI24735J21928_10015579 3300002067 Bacteria 2369
14 JGI24735J21928_10019476 3300002067 Bacteria 2085
15 JGI24735J21928_10024157 3300002067 Bacteria 1841
16 JGI24738J21930_10004382 3300002075 Bacteria 3464
17 JGI25155J39150_1000029 3300002704 Bacteria 118964
18 JGI25156J39149_1000062 3300002705 Bacteria 84500
19 JGI25156J39149_1000972 3300002705 Bacteria 13646
20 JGI25156J39149_1002143 3300002705 Bacteria 7428
21 JGI25156J39149_1008324 3300002705 Bacteria 2623
22 JGI25154J39366_1000053 3300002738 Bacteria 119466
23 JGI25154J39366_1002519 3300002738 Bacteria 4666
24 JGI25158J39367_1006874 3300002739 Bacteria 1620
25 JGI25157J39369_1000046 3300002741 Bacteria 119470
26 JGI25157J39369_1000566 3300002741 Bacteria 22112
27 JGI25157J39369_1001869 3300002741 Bacteria 6467
28 JGI25152J39213_1003527 3300002773 Bacteria 5297
29 JGI25152J39213_1003641 3300002773 Bacteria 5197
30 JGI25152J39213_1009037 3300002773 Bacteria 2407
31 JGI25150J39212_1001665 3300002774 Bacteria 6023
32 JGI25150J39212_1008515 3300002774 Bacteria 2003
33 JGI25150J39212_1009459 3300002774 Bacteria 1853
34 JGI25159J45721_1004656 3300002987 Bacteria 4488
35 JGI25159J45721_1005158 3300002987 Bacteria 4139
36 JGI25159J45721_1027372 3300002987 Bacteria 968
37 JGI25151J46595_10000972 3300003187 Bacteria 21720
38 JGI25151J46595_10007385 3300003187 Bacteria 5392
39 JGI25151J46595_10011904 3300003187 Bacteria 3978
40 JGI25151J46595_10045112 3300003187 Bacteria 1559
41 JGI25165J46597_1001521 3300003214 Bacteria 11703
42 rootH1_10002532 3300003316 Bacteria 4043
43 rootH1_10033773 3300003316 Bacteria 2681
44 rootH1_10033773 3300003323 Bacteria 4965
45 rootH2_10053797 3300003320 Bacteria 3723
46 rootL2_10068878 3300003322 Bacteria 5416
47 rootL2_10123562 3300003322 Bacteria 2543
48 JGI25160J50197_1000253 3300003354 Bacteria 40838
49 JGI25160J50197_1000267 3300003354 Bacteria 39167
50 JGI25160J50197_1007641 3300003354 Bacteria 4213
51 JGI25160J50197_1008079 3300003354 Bacteria 4043
52 JGI25161J50226_1000046 3300003374 Bacteria 116165
53 JGI25161J50226_1003803 3300003374 Bacteria 3336
54 Ga0006562J51391_1008696 3300003578 Bacteria 1730
55 Ga0006562J51391_1089387 3300003578 Bacteria 2352
56 Ga0055539_1000823 3300003752 Bacteria 7298
57 Ga0055539_1001731 3300003752 Bacteria 3811
58 Ga0055533_1000033 3300003756 Bacteria 265716
59 Ga0055533_1001062 3300003756 Bacteria 7897
60 Ga0055533_1002034 3300003756 Bacteria 4904
61 Ga0055532_1000147 3300003758 Bacteria 68782
62 Ga0055532_1001552 3300003758 Bacteria 6174
63 Ga0055525_1000626 3300003759 Bacteria 14516
64 Ga0055527_1000093 3300003760 Bacteria 68782
65 Ga0055527_1001123 3300003760 Bacteria 6174
66 Ga0055527_1002270 3300003760 Bacteria 3350
67 Ga0055535_1000094 3300003761 Bacteria 97073
68 Ga0055535_1000729 3300003761 Bacteria 24824
69 Ga0055535_1001191 3300003761 Bacteria 14998
70 Ga0055535_1002534 3300003761 Bacteria 6204
71 Ga0055535_1002543 3300003761 Bacteria 6174
72 Ga0055542_1000051 3300003762 Bacteria 175242
73 Ga0055542_1000131 3300003762 Bacteria 97073
74 Ga0055542_1002424 3300003762 Bacteria 6204
75 Ga0055542_1004439 3300003762 Bacteria 3414
76 Ga0055529_1000238 3300003763 Bacteria 68782
77 Ga0055529_1000486 3300003763 Bacteria 36917
78 Ga0055529_1000651 3300003763 Bacteria 25034
79 Ga0055529_1001365 3300003763 Bacteria 7929
80 Ga0055526_1001406 3300003771 Bacteria 17111
81 Ga0055526_1014040 3300003771 Bacteria 3328
82 Ga0055526_1018128 3300003771 Bacteria 2645
83 Ga0055526_1033140 3300003771 Bacteria 1440
84 Ga0055537_1002635 3300003773 Bacteria 5869
85 Ga0055537_1003042 3300003773 Bacteria 5295
86 Ga0055537_1009743 3300003773 Bacteria 2088
87 Ga0055524_1000044 3300003775 Bacteria 151631
88 Ga0055524_1000109 3300003775 Bacteria 100308
89 Ga0055536_1003791 3300003781 Bacteria 7969
90 Ga0055536_1004594 3300003781 Bacteria 6997
91 Ga0055536_1006845 3300003781 Bacteria 5211
92 Ga0055536_1026835 3300003781 Bacteria 1607
93 Ga0055536_1033906 3300003781 Bacteria 1297
94 Ga0055534_1001210 3300003784 Bacteria 10819
95 Ga0055534_1002774 3300003784 Bacteria 5869
96 Ga0055534_1005114 3300003784 Bacteria 3604
97 Ga0055534_1009933 3300003784 Bacteria 2028
98 Ga0055528_1000287 3300003790 Bacteria 43121
99 Ga0055528_1002575 3300003790 Bacteria 9606
100 Ga0055528_1006257 3300003790 Bacteria 5416
101 Ga0055530_10002335 3300003791 Bacteria 12367
102 Ga0055530_10002509 3300003791 Bacteria 11727
103 Ga0055540_1000013 3300003792 Bacteria 262274
104 Ga0055540_1000116 3300003792 Bacteria 83801
105 Ga0055540_1000401 3300003792 Bacteria 35216
106 Ga0055540_1002542 3300003792 Bacteria 9516
107 Ga0055540_1005647 3300003792 Bacteria 5192
108 Ga0055540_1008596 3300003792 Bacteria 3660
109 Ga0055540_1012543 3300003792 Bacteria 2652
110 Ga0055540_1025044 3300003792 Bacteria 1468
111 Ga0055531_10001209 3300003794 Bacteria 19790
112 Ga0055531_10002832 3300003794 Bacteria 11351
113 Ga0055531_10003298 3300003794 Bacteria 10339
114 Ga0055531_10008229 3300003794 Bacteria 5550
115 Ga0055543_1003087 3300004625 Bacteria 5115
116 Ga0055543_1004223 3300004625 Bacteria 3971
117 Ga0065165_1001067 3300005262 Bacteria 32780
118 Ga0065165_1008862 3300005262 Bacteria 4619
119 Ga0065165_1011665 3300005262 Bacteria 3635
120 Ga0065714_10067070 3300005288 Bacteria 5932
121 Ga0065704_10000527 3300005289 Bacteria 22779
122 Ga0065704_10158325 3300005289 Bacteria 1374
123 Ga0065704_10174071 3300005289 Bacteria 1274
124 Ga0065707_10083566 3300005295 Bacteria 8759
125 Ga0065707_10100635 3300005295 Bacteria 2916
126 Ga0070658_10029174 3300005327 Bacteria 4432
127 Ga0070658_10043608 3300005327 Bacteria 3623
128 Ga0070658_10046742 3300005327 Bacteria 3502
129 Ga0070658_10061070 3300005327 Bacteria 3070
130 Ga0070658_10087088 3300005327 Bacteria 2570
131 Ga0070658_10093402 3300005327 Bacteria 2481
132 Ga0070658_10118072 3300005327 Bacteria 2202
133 Ga0070658_10140541 3300005327 Bacteria 2017
134 Ga0070658_10271628 3300005327 Bacteria 1442
135 Ga0070658_10327523 3300005327 Bacteria 1309
136 Ga0070676_10002353 3300005328 Bacteria 9679
137 Ga0070676_10021471 3300005328 Bacteria 3615
138 Ga0070676_10027594 3300005328 Bacteria 3221
139 Ga0070676_10037269 3300005328 Bacteria 2804
140 Ga0070683_100012048 3300005329 Bacteria 7501
141 Ga0070690_100045855 3300005330 Bacteria 2778
142 Ga0070690_100073900 3300005330 Bacteria 2219
143 Ga0070670_100011320 3300005331 Bacteria 7624
144 Ga0070670_100016165 3300005331 Bacteria 6404
145 Ga0070670_100059375 3300005331 Bacteria 3283
146 Ga0070670_100070179 3300005331 Bacteria 3008
147 Ga0070670_100305349 3300005331 Bacteria 1392
148 Ga0070670_100370845 3300005331 Bacteria 1260
149 Ga0070670_100385259 3300005331 Bacteria 1236
150 Ga0070677_10003229 3300005333 Bacteria 5248
151 Ga0070677_10042814 3300005333 Bacteria 1795
152 Ga0070677_10066252 3300005333 Bacteria 1505
153 Ga0070677_10070070 3300005333 Bacteria 1473
154 Ga0070677_10111828 3300005333 Bacteria 1220
155 Ga0068869_100002073 3300005334 Bacteria 12041
156 Ga0068869_100131563 3300005334 Bacteria 1924
157 Ga0070666_10014588 3300005335 Bacteria 5002
158 Ga0070666_10029875 3300005335 Bacteria 3586
159 Ga0070666_10140395 3300005335 Bacteria 1683
160 Ga0070680_100002568 3300005336 Bacteria 13425
161 Ga0070680_100124631 3300005336 Bacteria 2152
162 Ga0070682_100334982 3300005337 Bacteria 1123
163 Ga0068868_100007829 3300005338 Bacteria 7627
164 Ga0068868_100025882 3300005338 Bacteria 4467
165 Ga0068868_100098794 3300005338 Bacteria 2361
166 Ga0068868_100115494 3300005338 Bacteria 2185
167 Ga0068868_100247283 3300005338 Bacteria 1500
168 Ga0070660_100000030 3300005339 Bacteria 86675
169 Ga0070660_100002928 3300005339 Bacteria 11747
170 Ga0070660_100006575 3300005339 Bacteria 8062
171 Ga0070660_100061236 3300005339 Bacteria 2922
172 Ga0070660_100199745 3300005339 Bacteria 1622
173 Ga0070660_100201185 3300005339 Bacteria 1616
174 Ga0070660_100288579 3300005339 Bacteria 1343
175 Ga0070661_100000191 3300005344 Bacteria 50550
176 Ga0070661_100006151 3300005344 Bacteria 8271
177 Ga0070661_100100264 3300005344 Bacteria 2153
178 Ga0070668_100063892 3300005347 Bacteria 2853
179 Ga0070668_100134279 3300005347 Bacteria 1988
180 Ga0070668_100252674 3300005347 Bacteria 1464
181 Ga0070669_100003192 3300005353 Bacteria 11785
182 Ga0070669_100012209 3300005353 Bacteria 6096
183 Ga0070669_100023682 3300005353 Bacteria 4398
184 Ga0070669_100032424 3300005353 Bacteria 3773
185 Ga0070669_100155548 3300005353 Bacteria 1773
186 Ga0070675_100005810 3300005354 Bacteria 9446
187 Ga0070675_100018991 3300005354 Bacteria 5476
188 Ga0070675_100019134 3300005354 Bacteria 5455
189 Ga0070675_100173236 3300005354 Bacteria 1862
190 Ga0070671_100004694 3300005355 Bacteria 10847
191 Ga0070671_100009086 3300005355 Bacteria 7977
192 Ga0070671_100071354 3300005355 Bacteria 2898
193 Ga0070671_100124330 3300005355 Bacteria 2171
194 Ga0070671_100211519 3300005355 Bacteria 1645
195 Ga0070671_100232875 3300005355 Bacteria 1563
196 Ga0070674_100001665 3300005356 Bacteria 12000
197 Ga0070674_100002116 3300005356 Bacteria 10899
198 Ga0070674_100050016 3300005356 Bacteria 2876
199 Ga0070674_100054802 3300005356 Bacteria 2759
200 Ga0070674_100076248 3300005356 Bacteria 2383
201 Ga0070674_100101111 3300005356 Bacteria 2100
202 Ga0070673_100019126 3300005364 Bacteria 4914
203 Ga0070673_100094230 3300005364 Bacteria 2454
204 Ga0070673_100101876 3300005364 Bacteria 2366
205 Ga0070673_100117614 3300005364 Bacteria 2212
206 Ga0070673_100119195 3300005364 Bacteria 2199
207 Ga0070673_100203326 3300005364 Bacteria 1707
208 Ga0070673_100468047 3300005364 Bacteria 1136
209 Ga0070659_100000124 3300005366 Bacteria 58501
210 Ga0070659_100001083 3300005366 Bacteria 19883
211 Ga0070659_100008597 3300005366 Bacteria 7465
212 Ga0070659_100033840 3300005366 Bacteria 3972
213 Ga0070667_100010447 3300005367 Bacteria 7665
214 Ga0070667_100019372 3300005367 Bacteria 5645
215 Ga0070667_100021857 3300005367 Bacteria 5309
216 Ga0070667_100036235 3300005367 Bacteria 4135
217 Ga0070667_100061297 3300005367 Bacteria 3185
218 Ga0070667_100100233 3300005367 Bacteria 2501
219 Ga0070667_100126515 3300005367 Bacteria 2227
220 Ga0070667_100126857 3300005367 Bacteria 2224
221 Ga0070714_100152907 3300005435 Bacteria 2081
222 Ga0070711_100112208 3300005439 Bacteria 2003
223 Ga0070700_100053384 3300005441 Bacteria 2522
224 Ga0070708_100213156 3300005445 Bacteria 1810
225 Ga0070708_100560270 3300005445 Bacteria 1078
226 Ga0070663_100000037 3300005455 Bacteria 62561
227 Ga0070663_100000198 3300005455 Bacteria 29990
228 Ga0070663_100049890 3300005455 Bacteria 2975
229 Ga0070663_100090772 3300005455 Bacteria 2263
230 Ga0070663_100353108 3300005455 Bacteria 1191
231 Ga0070678_100000674 3300005456 Bacteria 16779
232 Ga0070678_100027759 3300005456 Bacteria 3848
233 Ga0070678_100054892 3300005456 Bacteria 2906
234 Ga0070678_100067241 3300005456 Bacteria 2666
235 Ga0070678_100073277 3300005456 Bacteria 2569
236 Ga0070678_100075770 3300005456 Bacteria 2532
237 Ga0070678_100099681 3300005456 Bacteria 2248
238 Ga0070678_100159634 3300005456 Bacteria 1825
239 Ga0070678_100299072 3300005456 Bacteria 1367
240 Ga0070678_100632315 3300005456 Bacteria 958
241 Ga0070662_100001463 3300005457 Bacteria 14552
242 Ga0070662_100024144 3300005457 Bacteria 4184
243 Ga0070662_100078143 3300005457 Bacteria 2457
244 Ga0070662_100123845 3300005457 Bacteria 1984
245 Ga0068867_100001272 3300005459 Bacteria 17401
246 Ga0068867_100006011 3300005459 Bacteria 8604
247 Ga0068867_100013864 3300005459 Bacteria 5706
248 Ga0068867_100014758 3300005459 Bacteria 5537
249 Ga0068867_100056970 3300005459 Bacteria 2893
250 Ga0068867_100102328 3300005459 Bacteria 2189
251 Ga0068867_100104602 3300005459 Bacteria 2167
252 Ga0070706_100001272 3300005467 Bacteria 26932
253 Ga0070706_100137603 3300005467 Bacteria 2279
254 Ga0070707_100266756 3300005468 Bacteria 1665
255 Ga0070698_100051994 3300005471 Bacteria 4170
256 Ga0070679_100004721 3300005530 Bacteria 12564
257 Ga0070679_100019495 3300005530 Bacteria 6596
258 Ga0070684_100013947 3300005535 Bacteria 6495
259 Ga0070684_100138708 3300005535 Bacteria 2198
260 Ga0068853_100007636 3300005539 Bacteria 8665
261 Ga0068853_100042442 3300005539 Bacteria 3888
262 Ga0068853_100076302 3300005539 Bacteria 2926
263 Ga0068853_100250860 3300005539 Bacteria 1624
264 Ga0070672_100000561 3300005543 Bacteria 21760
265 Ga0070672_100000591 3300005543 Bacteria 21269
266 Ga0070672_100025794 3300005543 Bacteria 4366
267 Ga0070672_100108817 3300005543 Bacteria 2257
268 Ga0070672_100120116 3300005543 Bacteria 2150
269 Ga0070672_100131068 3300005543 Bacteria 2060
270 Ga0070693_100025519 3300005547 Bacteria 3182
271 Ga0070665_100002855 3300005548 Bacteria 18686
272 Ga0070665_100046807 3300005548 Bacteria 4342
273 Ga0070665_100083138 3300005548 Bacteria 3207
274 Ga0070665_100117101 3300005548 Bacteria 2667
275 Ga0070665_100276259 3300005548 Bacteria 1682
276 Ga0070665_100298079 3300005548 Bacteria 1615
277 Ga0068855_100001358 3300005563 Bacteria 30324
278 Ga0068855_100003246 3300005563 Bacteria 19887
279 Ga0068855_100069778 3300005563 Bacteria 4089
280 Ga0068855_100082007 3300005563 Bacteria 3738
281 Ga0068855_100235056 3300005563 Bacteria 2050
282 Ga0068855_100261708 3300005563 Bacteria 1927
283 Ga0070664_100001381 3300005564 Bacteria 19335
284 Ga0070664_100007606 3300005564 Bacteria 8748
285 Ga0070664_100053568 3300005564 Bacteria 3420
286 Ga0070664_100060838 3300005564 Bacteria 3217
287 Ga0070664_100067936 3300005564 Bacteria 3047
288 Ga0070664_100224281 3300005564 Bacteria 1682
289 Ga0068857_100040571 3300005577 Bacteria 4128
290 Ga0068857_100157185 3300005577 Bacteria 2062
291 Ga0068857_100171631 3300005577 Bacteria 1971
292 Ga0068854_100008427 3300005578 Bacteria 6628
293 Ga0068854_100053557 3300005578 Bacteria 2898
294 Ga0068854_100102894 3300005578 Bacteria 2143
295 Ga0068854_100198262 3300005578 Bacteria 1576
296 Ga0068854_100411045 3300005578 Bacteria 1122
297 Ga0068856_100046079 3300005614 Bacteria 4295
298 Ga0068856_100063805 3300005614 Bacteria 3639
299 Ga0068856_100091026 3300005614 Bacteria 3035
300 Ga0068856_100259273 3300005614 Bacteria 1754
301 Ga0070702_100016039 3300005615 Bacteria 3838
302 Ga0068852_100025539 3300005616 Bacteria 4788
303 Ga0068852_100035241 3300005616 Bacteria 4172
304 Ga0068852_100045366 3300005616 Bacteria 3738
305 Ga0068852_100121065 3300005616 Bacteria 2396
306 Ga0068852_100126681 3300005616 Bacteria 2346
307 Ga0068852_100217318 3300005616 Bacteria 1816
308 Ga0068859_100016209 3300005617 Bacteria 7485
309 Ga0068859_100055113 3300005617 Bacteria 4000
310 Ga0068859_100068068 3300005617 Bacteria 3596
311 Ga0068859_100143965 3300005617 Bacteria 2458
312 Ga0068864_100010993 3300005618 Bacteria 7485
313 Ga0068864_100016150 3300005618 Bacteria 6213
314 Ga0068864_100017095 3300005618 Bacteria 6047
315 Ga0068864_100088984 3300005618 Bacteria 2720
316 Ga0068864_100134287 3300005618 Bacteria 2227
317 Ga0068866_10008734 3300005718 Bacteria 4282
318 Ga0068866_10067113 3300005718 Bacteria 1882
319 Ga0068866_10122085 3300005718 Bacteria 1469
320 Ga0068861_100056611 3300005719 Bacteria 2993
321 Ga0068861_100154985 3300005719 Bacteria 1883
322 Ga0068851_10004731 3300005834 Bacteria 6163
323 Ga0068851_10008664 3300005834 Bacteria 4709
324 Ga0068851_10012104 3300005834 Bacteria 4061
325 Ga0068851_10043047 3300005834 Bacteria 2275
326 Ga0068851_10131107 3300005834 Bacteria 1356
327 Ga0068870_10002620 3300005840 Bacteria 7529
328 Ga0068870_10059276 3300005840 Bacteria 2052
329 Ga0068863_100031384 3300005841 Bacteria 5071
330 Ga0068863_100098241 3300005841 Bacteria 2780
331 Ga0068863_100182376 3300005841 Bacteria 2015
332 Ga0068863_100266706 3300005841 Bacteria 1656
333 Ga0068858_100108008 3300005842 Bacteria 2598
334 Ga0068860_100000384 3300005843 Bacteria 57893
335 Ga0068860_100030965 3300005843 Bacteria 5145
336 Ga0068862_100006573 3300005844 Bacteria 9645
337 Ga0068862_100020286 3300005844 Bacteria 5551
338 Ga0068862_100036236 3300005844 Bacteria 4181
339 Ga0068862_100061392 3300005844 Bacteria 3231
340 Ga0075365_10003706 3300006038 Bacteria 7943
341 Ga0075365_10005806 3300006038 Bacteria 6704
342 Ga0075365_10102901 3300006038 Bacteria 1957
343 Ga0075368_10004563 3300006042 Bacteria 4705
344 Ga0075368_10024726 3300006042 Bacteria 2302
345 Ga0075368_10034026 3300006042 Bacteria 1984
346 Ga0075368_10061925 3300006042 Bacteria 1499
347 Ga0075368_10082457 3300006042 Bacteria 1310
348 Ga0075363_100005789 3300006048 Bacteria 5549
349 Ga0075363_100010419 3300006048 Bacteria 4416
350 Ga0075363_100012621 3300006048 Bacteria 4075
351 Ga0075363_100021176 3300006048 Bacteria 3271
352 Ga0075364_10027705 3300006051 Bacteria 3622
353 Ga0075364_10028255 3300006051 Bacteria 3589
354 Ga0075364_10060248 3300006051 Bacteria 2489
355 Ga0075364_10085223 3300006051 Bacteria 2092
356 Ga0075364_10134422 3300006051 Bacteria 1661
357 Ga0075432_10001571 3300006058 Bacteria 7485
358 Ga0075432_10011559 3300006058 Bacteria 3000
359 Ga0075432_10011753 3300006058 Bacteria 2976
360 Ga0075362_10018876 3300006177 Bacteria 2860
361 Ga0075362_10034529 3300006177 Bacteria 2205
362 Ga0075362_10043673 3300006177 Bacteria 1985
363 Ga0075362_10074067 3300006177 Bacteria 1559
364 Ga0075362_10077023 3300006177 Bacteria 1532
365 Ga0075367_10041612 3300006178 Bacteria 2687
366 Ga0075367_10091504 3300006178 Bacteria 1851
367 Ga0075367_10111162 3300006178 Bacteria 1682
368 Ga0075367_10145160 3300006178 Bacteria 1471
369 Ga0075369_10003511 3300006186 Bacteria 5707
370 Ga0075366_10001740 3300006195 Bacteria 10952
371 Ga0075366_10004822 3300006195 Bacteria 7277
372 Ga0075366_10014446 3300006195 Bacteria 4510
373 Ga0075366_10018110 3300006195 Bacteria 4067
374 Ga0075366_10029438 3300006195 Bacteria 3225
375 Ga0075366_10032029 3300006195 Bacteria 3095
376 Ga0075366_10034583 3300006195 Bacteria 2977
377 Ga0075366_10038850 3300006195 Bacteria 2811
378 Ga0075366_10064550 3300006195 Bacteria 2177
379 Ga0075366_10072162 3300006195 Bacteria 2057
380 Ga0075366_10105968 3300006195 Bacteria 1690
381 Ga0075366_10123749 3300006195 Bacteria 1559
382 Ga0075366_10154790 3300006195 Bacteria 1388
383 Ga0075366_10279340 3300006195 Bacteria 1020
384 Ga0097621_100016477 3300006237 Bacteria 5588
385 Ga0097621_100040372 3300006237 Bacteria 3752
386 Ga0097621_100102002 3300006237 Bacteria 2415
387 Ga0097621_100115507 3300006237 Bacteria 2272
388 Ga0097621_100245721 3300006237 Bacteria 1566
389 Ga0075370_10000655 3300006353 Bacteria 13473
390 Ga0075370_10001068 3300006353 Bacteria 11409
391 Ga0075370_10001217 3300006353 Bacteria 10880
392 Ga0075370_10002553 3300006353 Bacteria 8473
393 Ga0075370_10004950 3300006353 Bacteria 6547
394 Ga0075370_10008610 3300006353 Bacteria 5259
395 Ga0075370_10009932 3300006353 Bacteria 4960
396 Ga0075370_10010373 3300006353 Bacteria 4870
397 Ga0075370_10018767 3300006353 Bacteria 3756
398 Ga0075370_10020440 3300006353 Bacteria 3620
399 Ga0075370_10023793 3300006353 Bacteria 3378
400 Ga0075370_10043697 3300006353 Bacteria 2533
401 Ga0075370_10062020 3300006353 Bacteria 2130
402 Ga0075370_10068570 3300006353 Bacteria 2026
403 Ga0075370_10164498 3300006353 Bacteria 1303
404 Ga0068871_100006832 3300006358 Bacteria 8118
405 Ga0068871_100011233 3300006358 Bacteria 6562
406 Ga0068871_100056045 3300006358 Bacteria 3202
407 Ga0068871_100058756 3300006358 Bacteria 3132
408 Ga0068871_100076780 3300006358 Bacteria 2759
409 Ga0068871_100275789 3300006358 Bacteria 1470
410 Ga0075428_100065550 3300006844 Bacteria 3977
411 Ga0075430_100017776 3300006846 Bacteria 6053
412 Ga0075430_100034176 3300006846 Bacteria 4315
413 Ga0075431_100043158 3300006847 Bacteria 4653
414 Ga0075431_100109237 3300006847 Bacteria 2855
415 Ga0075429_100001780 3300006880 Bacteria 17837
416 Ga0075429_100202144 3300006880 Bacteria 1741
417 Ga0068865_100027004 3300006881 Bacteria 3789
418 Ga0068865_100174076 3300006881 Bacteria 1652
419 Ga0068865_100232553 3300006881 Bacteria 1447
420 Ga0068865_100404320 3300006881 Bacteria 1119
421 Ga0097620_100016209 3300006931 Bacteria 7485
422 Ga0097620_100055112 3300006931 Bacteria 4000
423 Ga0097620_100068066 3300006931 Bacteria 3596
424 Ga0097620_100143961 3300006931 Bacteria 2458
425 Ga0079104_1000001 3300006946 Bacteria 521847
426 Ga0079104_1000037 3300006946 Bacteria 189207
427 Ga0099826_10029246 3300006948 Bacteria 4017
428 Ga0105251_10001046 3300009011 Bacteria 24248
429 Ga0105251_10001356 3300009011 Bacteria 21161
430 Ga0105251_10039285 3300009011 Bacteria 2313
431 Ga0105244_10004162 3300009036 Bacteria 10071
432 Ga0105244_10166434 3300009036 Bacteria 1051
433 Ga0105250_10000024 3300009092 Bacteria 218115
434 Ga0105250_10004389 3300009092 Bacteria 6499
435 Ga0105250_10071185 3300009092 Bacteria 1404
436 Ga0105240_10022347 3300009093 Bacteria 8387
437 Ga0105240_10026040 3300009093 Bacteria 7681
438 Ga0105240_10040696 3300009093 Bacteria 5941
439 Ga0105240_10045918 3300009093 Bacteria 5539
440 Ga0105240_10052923 3300009093 Bacteria 5100
441 Ga0105240_10070914 3300009093 Bacteria 4309
442 Ga0105240_10156609 3300009093 Bacteria 2708
443 Ga0105240_10209237 3300009093 Bacteria 2281
444 Ga0105240_10327337 3300009093 Bacteria 1745
445 Ga0105240_10445709 3300009093 Bacteria 1450
446 Ga0111539_10060338 3300009094 Bacteria 4495
447 Ga0111539_10271886 3300009094 Bacteria 1972
448 Ga0105245_10034605 3300009098 Bacteria 4482
449 Ga0105245_10093165 3300009098 Bacteria 2775
450 Ga0105245_10157375 3300009098 Bacteria 2153
451 Ga0105247_10059547 3300009101 Bacteria 2364
452 Ga0114129_10140897 3300009147 Bacteria 3306
453 Ga0114129_10461854 3300009147 Bacteria 1664
454 Ga0105243_10000717 3300009148 Bacteria 31849
455 Ga0105243_10001616 3300009148 Bacteria 19597
456 Ga0105243_10004194 3300009148 Bacteria 11428
457 Ga0105243_10007467 3300009148 Bacteria 8401
458 Ga0105243_10026229 3300009148 Bacteria 4460
459 Ga0105243_10173558 3300009148 Bacteria 1869
460 Ga0105243_10480087 3300009148 Bacteria 1173
461 Ga0105243_10515124 3300009148 Bacteria 1136
462 Ga0105241_10074922 3300009174 Bacteria 2636
463 Ga0105241_10214144 3300009174 Bacteria 1616
464 Ga0105241_10241412 3300009174 Bacteria 1527
465 Ga0105241_10397525 3300009174 Bacteria 1208
466 Ga0105242_10009890 3300009176 Bacteria 7305
467 Ga0105242_10028593 3300009176 Bacteria 4440
468 Ga0105242_10493595 3300009176 Bacteria 1163
469 Ga0105248_10001281 3300009177 Bacteria 28058
470 Ga0105248_10008736 3300009177 Bacteria 11130
471 Ga0105248_10049405 3300009177 Bacteria 4718
472 Ga0105248_10131583 3300009177 Bacteria 2823
473 Ga0105237_10000556 3300009545 Bacteria 52272
474 Ga0105237_10007711 3300009545 Bacteria 11757
475 Ga0105237_10028525 3300009545 Bacteria 5683
476 Ga0105237_10058752 3300009545 Bacteria 3849
477 Ga0105237_10068926 3300009545 Bacteria 3532
478 Ga0105237_10108013 3300009545 Bacteria 2774
479 Ga0105238_10026268 3300009551 Bacteria 5935
480 Ga0105238_10027640 3300009551 Bacteria 5782
481 Ga0105238_10175713 3300009551 Bacteria 2118
482 Ga0105249_10139237 3300009553 Bacteria 2325
483 Ga0105249_10151308 3300009553 Bacteria 2234
484 Ga0105249_10173475 3300009553 Bacteria 2093
485 Ga0105239_10009186 3300010375 Bacteria 11180
486 Ga0105239_10009931 3300010375 Bacteria 10687
487 Ga0105239_10038650 3300010375 Bacteria 5230
488 Ga0105239_10040258 3300010375 Bacteria 5121
489 Ga0105239_10076382 3300010375 Bacteria 3684
490 Ga0105239_10279324 3300010375 Bacteria 1880
491 Ga0105239_10291649 3300010375 Bacteria 1837
492 Ga0105239_10436795 3300010375 Bacteria 1484
493 Ga0105246_10084870 3300011119 Bacteria 2266
494 Ga0105246_10101314 3300011119 Bacteria 2097
495 Ga0157347_1001810 3300012502 Bacteria 1741
496 Ga0157373_10012730 3300013100 Bacteria 6182
497 Ga0157373_10015071 3300013100 Bacteria 5654
498 Ga0157373_10034332 3300013100 Bacteria 3643
499 Ga0157371_10047269 3300013102 Bacteria 3060
500 Ga0157371_10271892 3300013102 Bacteria 1223
501 Ga0157370_10004360 3300013104 Bacteria 16243
502 Ga0157370_10004787 3300013104 Bacteria 15389
503 Ga0157370_10008219 3300013104 Bacteria 11271
504 Ga0157370_10056527 3300013104 Bacteria 3734
505 Ga0157370_10118160 3300013104 Bacteria 2477
506 Ga0157370_10245960 3300013104 Bacteria 1655
507 Ga0157370_10297234 3300013104 Bacteria 1491
508 Ga0157369_10005112 3300013105 Bacteria 15359
509 Ga0157369_10009680 3300013105 Bacteria 11022
510 Ga0157369_10010962 3300013105 Bacteria 10318
511 Ga0157369_10231818 3300013105 Bacteria 1930
512 Ga0157369_10295049 3300013105 Bacteria 1687
513 Ga0157374_10000055 3300013296 Bacteria 120079
514 Ga0157374_10048045 3300013296 Bacteria 3959
515 Ga0157374_10056243 3300013296 Bacteria 3672
516 Ga0157374_10116117 3300013296 Bacteria 2578
517 Ga0157374_10213959 3300013296 Bacteria 1890
518 Ga0157378_10073496 3300013297 Bacteria 3074
519 Ga0157378_10330714 3300013297 Bacteria 1483
520 Ga0157378_10394175 3300013297 Bacteria 1363
521 Ga0157378_10424204 3300013297 Bacteria 1315
522 Ga0163162_10001850 3300013306 Bacteria 19919
523 Ga0163162_10023858 3300013306 Bacteria 6036
524 Ga0163162_10100990 3300013306 Bacteria 2976
525 Ga0163162_10161062 3300013306 Bacteria 2366
526 Ga0163162_10229335 3300013306 Bacteria 1987
527 Ga0163162_10271740 3300013306 Bacteria 1827
528 Ga0163162_10648168 3300013306 Bacteria 1180
529 Ga0157372_10001079 3300013307 Bacteria 29711
530 Ga0157372_10014393 3300013307 Bacteria 8460
531 Ga0157372_10026578 3300013307 Bacteria 6298
532 Ga0157372_10089270 3300013307 Bacteria 3502
533 Ga0157372_10136120 3300013307 Bacteria 2829
534 Ga0157375_10004718 3300013308 Bacteria 11854
535 Ga0157375_10033306 3300013308 Bacteria 4894
536 Ga0157375_10041692 3300013308 Bacteria 4435
537 Ga0157375_10052470 3300013308 Bacteria 4009
538 Ga0157375_10170908 3300013308 Bacteria 2321
539 Ga0157375_10201713 3300013308 Bacteria 2145
540 Ga0157375_10248624 3300013308 Bacteria 1939
541 Ga0157375_10269486 3300013308 Bacteria 1865
542 Ga0157375_10431467 3300013308 Bacteria 1484
543 Ga0157375_10508267 3300013308 Bacteria 1369
544 Ga0163163_10615525 3300014325 Bacteria 1149
545 Ga0157380_10002464 3300014326 Bacteria 12468
546 Ga0157380_10010786 3300014326 Bacteria 6585
547 Ga0157380_10028519 3300014326 Bacteria 4257
548 Ga0157380_10058160 3300014326 Bacteria 3081
549 Ga0157380_10142114 3300014326 Bacteria 2064
550 Ga0182008_10001216 3300014497 Bacteria 17752
551 Ga0182008_10002832 3300014497 Bacteria 10726
552 Ga0182008_10051879 3300014497 Bacteria 2034
553 Ga0182008_10090444 3300014497 Bacteria 1509
554 Ga0157377_10000032 3300014745 Bacteria 121003
555 Ga0157377_10009578 3300014745 Bacteria 4761
556 Ga0157377_10083182 3300014745 Bacteria 1875
557 Ga0157379_10000140 3300014968 Bacteria 51940
558 Ga0157379_10030694 3300014968 Bacteria 4786
559 Ga0157379_10040091 3300014968 Bacteria 4179
560 Ga0157379_10080472 3300014968 Bacteria 2918
561 Ga0157376_10029344 3300014969 Bacteria 4380
562 Ga0157376_10231648 3300014969 Bacteria 1716
563 Ga0182006_1000937 3300015261 Bacteria 19449
564 Ga0182006_1024117 3300015261 Bacteria 2511
565 Ga0182006_1052009 3300015261 Bacteria 1574
566 Ga0182006_1099398 3300015261 Bacteria 1035
567 Ga0182007_10008568 3300015262 Bacteria 4189
568 Ga0182007_10013833 3300015262 Bacteria 3063
569 Ga0182005_1006014 3300015265 Bacteria 3748
570 Ga0182005_1014889 3300015265 Bacteria 2173
571 Ga0183362_10003 3300015683 Bacteria 977584
572 Ga0183361_10012 3300016635 Bacteria 203395
573 Ga0163161_10000564 3300017792 Bacteria 29865
574 Ga0163161_10003519 3300017792 Bacteria 10962
575 Ga0163161_10080802 3300017792 Bacteria 2393
576 Ga0163161_10166430 3300017792 Bacteria 1683
577 Ga0206356_11831093 3300020070 Bacteria 3815
578 Ga0206350_10052148 3300020080 Bacteria 2179
579 Ga0206353_11895329 3300020082 Bacteria 3896
580 Ga0213872_10010842 3300021361 Bacteria 4325
581 Ga0213872_10020982 3300021361 Bacteria 3008
582 Ga0224712_10000038 3300022467 Bacteria 20134
583 Ga0209435_100003 3300025206 Bacteria 669534
584 Ga0209435_107807 3300025206 Bacteria 1181
585 Ga0209436_109565 3300025208 Bacteria 1833
586 Ga0209674_100013 3300025226 Bacteria 813140
587 Ga0209674_100064 3300025226 Bacteria 265769
588 Ga0209674_100235 3300025226 Bacteria 48669
589 Ga0209672_100010 3300025228 Bacteria 873151
590 Ga0209672_100028 3300025228 Bacteria 341962
591 Ga0209672_100159 3300025228 Bacteria 57910
592 Ga0209672_101163 3300025228 Bacteria 10774
593 Ga0209672_101715 3300025228 Bacteria 7025
594 Ga0209147_100006 3300025229 Bacteria 873276
595 Ga0209147_100489 3300025229 Bacteria 23675
596 Ga0209147_100972 3300025229 Bacteria 12533
597 Ga0209147_101140 3300025229 Bacteria 10907
598 Ga0209563_100099 3300025230 Bacteria 153336
599 Ga0207427_101233 3300025231 Bacteria 9806
600 Ga0207427_101487 3300025231 Bacteria 8380
601 Ga0209258_100010 3300025242 Bacteria 873276
602 Ga0209258_100132 3300025242 Bacteria 175292
603 Ga0209258_100319 3300025242 Bacteria 74569
604 Ga0209258_100680 3300025242 Bacteria 23675
605 Ga0209258_100711 3300025242 Bacteria 22277
606 Ga0209258_103186 3300025242 Bacteria 3685
607 Ga0207425_1000663 3300025245 Bacteria 18873
608 Ga0207425_1000860 3300025245 Bacteria 14864
609 Ga0207425_1001147 3300025245 Bacteria 11910
610 Ga0207425_1006555 3300025245 Bacteria 3170
611 Ga0207425_1011205 3300025245 Bacteria 2147
612 Ga0209646_1000008 3300025246 Bacteria 669534
613 Ga0209646_1000060 3300025246 Bacteria 256386
614 Ga0209026_1000007 3300025250 Bacteria 669534
615 Ga0209026_1000049 3300025250 Bacteria 255273
616 Ga0209677_100331 3300025253 Bacteria 30340
617 Ga0209677_101713 3300025253 Bacteria 9123
618 Ga0209677_104963 3300025253 Bacteria 3624
619 Ga0209148_1000007 3300025254 Bacteria 1592273
620 Ga0209148_1000081 3300025254 Bacteria 273676
621 Ga0209148_1000189 3300025254 Bacteria 116838
622 Ga0209148_1002637 3300025254 Bacteria 5828
623 Ga0209759_1000026 3300025256 Bacteria 311743
624 Ga0209759_1000192 3300025256 Bacteria 97685
625 Ga0209759_1000272 3300025256 Bacteria 73495
626 Ga0209759_1000406 3300025256 Bacteria 53034
627 Ga0209759_1000580 3300025256 Bacteria 36036
628 Ga0209759_1000994 3300025256 Bacteria 19456
629 Ga0209759_1004232 3300025256 Bacteria 5432
630 Ga0209759_1004890 3300025256 Bacteria 4850
631 Ga0209759_1009438 3300025256 Bacteria 2950
632 Ga0209759_1010952 3300025256 Bacteria 2616
633 Ga0209759_1014706 3300025256 Bacteria 2055
634 Ga0209129_1000084 3300025258 Bacteria 182554
635 Ga0209129_1000342 3300025258 Bacteria 40192
636 Ga0209129_1004856 3300025258 Bacteria 5041
637 Ga0209129_1008280 3300025258 Bacteria 2920
638 Ga0209129_1009416 3300025258 Bacteria 2576
639 Ga0209233_1000244 3300025261 Bacteria 90133
640 Ga0209565_1000169 3300025263 Bacteria 84839
641 Ga0209565_1000200 3300025263 Bacteria 71490
642 Ga0209565_1000364 3300025263 Bacteria 38944
643 Ga0209565_1000456 3300025263 Bacteria 31480
644 Ga0209565_1000559 3300025263 Bacteria 25609
645 Ga0209565_1007535 3300025263 Bacteria 2926
646 Ga0209565_1011308 3300025263 Bacteria 2175
647 Ga0209565_1014946 3300025263 Bacteria 1766
648 Ga0209455_1000050 3300025272 Bacteria 373239
649 Ga0209455_1000157 3300025272 Bacteria 119719
650 Ga0209455_1000162 3300025272 Bacteria 116963
651 Ga0209455_1003216 3300025272 Bacteria 5900
652 Ga0209673_1000009 3300025273 Bacteria 620735
653 Ga0209673_1000012 3300025273 Bacteria 579480
654 Ga0209673_1000038 3300025273 Bacteria 312957
655 Ga0209673_1000114 3300025273 Bacteria 178557
656 Ga0209673_1000916 3300025273 Bacteria 37512
657 Ga0209673_1003435 3300025273 Bacteria 9352
658 Ga0209673_1024843 3300025273 Bacteria 2004
659 Ga0209673_1044124 3300025273 Bacteria 1238
660 Ga0209130_1000064 3300025284 Bacteria 196568
661 Ga0209130_1000621 3300025284 Bacteria 33935
662 Ga0209130_1001722 3300025284 Bacteria 13115
663 Ga0209130_1002100 3300025284 Bacteria 10662
664 Ga0209130_1003661 3300025284 Bacteria 6359
665 Ga0209675_1000062 3300025291 Bacteria 178557
666 Ga0209675_1000144 3300025291 Bacteria 94908
667 Ga0209675_1001396 3300025291 Bacteria 14032
668 Ga0209675_1001454 3300025291 Bacteria 13668
669 Ga0209675_1002861 3300025291 Bacteria 8569
670 Ga0209675_1006470 3300025291 Bacteria 4689
671 Ga0209676_1000051 3300025292 Bacteria 389016
672 Ga0209676_1000817 3300025292 Bacteria 40674
673 Ga0209676_1000999 3300025292 Bacteria 33230
674 Ga0209676_1001040 3300025292 Bacteria 32079
675 Ga0209676_1004639 3300025292 Bacteria 7558
676 Ga0209676_1006824 3300025292 Bacteria 5536
677 Ga0209676_1020602 3300025292 Bacteria 2235
678 Ga0209676_1025777 3300025292 Bacteria 1879
679 Ga0209025_1000678 3300025294 Bacteria 58460
680 Ga0209025_1000719 3300025294 Bacteria 56292
681 Ga0209025_1000861 3300025294 Bacteria 47942
682 Ga0209025_1004306 3300025294 Bacteria 12471
683 Ga0209025_1005452 3300025294 Bacteria 10371
684 Ga0209025_1005522 3300025294 Bacteria 10266
685 Ga0209025_1013723 3300025294 Bacteria 5062
686 Ga0209025_1019670 3300025294 Bacteria 3741
687 Ga0209025_1045314 3300025294 Bacteria 1825
688 Ga0209564_1000136 3300025295 Bacteria 185198
689 Ga0209564_1000797 3300025295 Bacteria 43362
690 Ga0209564_1001058 3300025295 Bacteria 33490
691 Ga0209564_1001096 3300025295 Bacteria 32208
692 Ga0209564_1002960 3300025295 Bacteria 12246
693 Ga0209564_1005340 3300025295 Bacteria 7378
694 Ga0209564_1008441 3300025295 Bacteria 5081
695 Ga0209758_1000045 3300025297 Bacteria 369174
696 Ga0209758_1000275 3300025297 Bacteria 102404
697 Ga0209758_1000754 3300025297 Bacteria 46944
698 Ga0209758_1005541 3300025297 Bacteria 9635
699 Ga0209758_1012521 3300025297 Bacteria 4736
700 Ga0209050_1000044 3300025298 Bacteria 391114
701 Ga0209050_1000052 3300025298 Bacteria 351785
702 Ga0209050_1002554 3300025298 Bacteria 15213
703 Ga0209050_1009392 3300025298 Bacteria 5013
704 Ga0209050_1010791 3300025298 Bacteria 4445
705 Ga0209050_1014302 3300025298 Bacteria 3431
706 Ga0209050_1026814 3300025298 Bacteria 1917
707 Ga0209256_1000003 3300025299 Bacteria 1661127
708 Ga0209256_1000015 3300025299 Bacteria 622953
709 Ga0209256_1000206 3300025299 Bacteria 111425
710 Ga0209256_1000239 3300025299 Bacteria 97580
711 Ga0209256_1020997 3300025299 Bacteria 2022
712 Ga0209256_1039080 3300025299 Bacteria 1223
713 Ga0207426_1000037 3300025302 Bacteria 442735
714 Ga0207426_1000049 3300025302 Bacteria 401954
715 Ga0207426_1000086 3300025302 Bacteria 292089
716 Ga0207426_1000116 3300025302 Bacteria 225245
717 Ga0207426_1000346 3300025302 Bacteria 85832
718 Ga0207426_1005947 3300025302 Bacteria 5414
719 Ga0207426_1015713 3300025302 Bacteria 2739
720 Ga0209051_1000015 3300025303 Bacteria 546798
721 Ga0209051_1000022 3300025303 Bacteria 474879
722 Ga0209051_1000025 3300025303 Bacteria 415397
723 Ga0209051_1000031 3300025303 Bacteria 391114
724 Ga0209051_1000420 3300025303 Bacteria 58383
725 Ga0209051_1000617 3300025303 Bacteria 40926
726 Ga0209051_1000824 3300025303 Bacteria 32075
727 Ga0209051_1001151 3300025303 Bacteria 24034
728 Ga0209051_1002289 3300025303 Bacteria 13991
729 Ga0209051_1005082 3300025303 Bacteria 7821
730 Ga0209051_1007105 3300025303 Bacteria 6186
731 Ga0209051_1024938 3300025303 Bacteria 2446
732 Ga0209257_1000030 3300025304 Bacteria 689812
733 Ga0209257_1000037 3300025304 Bacteria 612915
734 Ga0209257_1000039 3300025304 Bacteria 591694
735 Ga0209257_1000058 3300025304 Bacteria 381686
736 Ga0209257_1000977 3300025304 Bacteria 38863
737 Ga0209257_1001416 3300025304 Bacteria 28573
738 Ga0209257_1004064 3300025304 Bacteria 11744
739 Ga0209257_1008578 3300025304 Bacteria 5758
740 Ga0209257_1009671 3300025304 Bacteria 5093
741 Ga0209257_1021120 3300025304 Bacteria 2378
742 Ga0207697_10012806 3300025315 Bacteria 3508
743 Ga0207656_10005042 3300025321 Bacteria 4641
744 Ga0207656_10008795 3300025321 Bacteria 3733
745 Ga0207656_10011307 3300025321 Bacteria 3371
746 Ga0207656_10026909 3300025321 Bacteria 2348
747 Ga0207696_1000096 3300025711 Bacteria 177263
748 Ga0207655_1001268 3300025728 Bacteria 24088
749 Ga0207713_1000247 3300025735 Bacteria 68982
750 Ga0207713_1041182 3300025735 Bacteria 1930
751 Ga0207682_10005710 3300025893 Bacteria 5046
752 Ga0207682_10008702 3300025893 Bacteria 4014
753 Ga0207682_10024155 3300025893 Bacteria 2405
754 Ga0207682_10055603 3300025893 Bacteria 1646
755 Ga0207682_10070595 3300025893 Bacteria 1479
756 Ga0207682_10121627 3300025893 Bacteria 1158
757 Ga0207642_10127325 3300025899 Bacteria 1323
758 Ga0207688_10263125 3300025901 Bacteria 1047
759 Ga0207680_10013405 3300025903 Bacteria 4209
760 Ga0207680_10048049 3300025903 Bacteria 2532
761 Ga0207647_10000188 3300025904 Bacteria 50006
762 Ga0207647_10000869 3300025904 Bacteria 23399
763 Ga0207647_10021937 3300025904 Bacteria 4250
764 Ga0207647_10040868 3300025904 Bacteria 2918
765 Ga0207645_10000171 3300025907 Bacteria 51812
766 Ga0207645_10012472 3300025907 Bacteria 5763
767 Ga0207645_10020233 3300025907 Bacteria 4359
768 Ga0207645_10026582 3300025907 Bacteria 3740
769 Ga0207645_10027182 3300025907 Bacteria 3696
770 Ga0207645_10074239 3300025907 Bacteria 2177
771 Ga0207643_10005722 3300025908 Bacteria 6647
772 Ga0207643_10029190 3300025908 Bacteria 3067
773 Ga0207643_10246663 3300025908 Bacteria 1099
774 Ga0207705_10000221 3300025909 Bacteria 56813
775 Ga0207705_10025243 3300025909 Bacteria 4243
776 Ga0207705_10028977 3300025909 Bacteria 3948
777 Ga0207705_10119706 3300025909 Bacteria 1953
778 Ga0207705_10331886 3300025909 Bacteria 1170
779 Ga0207684_10020776 3300025910 Bacteria 5610
780 Ga0207684_10117918 3300025910 Bacteria 2274
781 Ga0207707_10103935 3300025912 Bacteria 2483
782 Ga0207695_10004740 3300025913 Bacteria 18409
783 Ga0207695_10015091 3300025913 Bacteria 9113
784 Ga0207695_10023457 3300025913 Bacteria 6970
785 Ga0207695_10049567 3300025913 Bacteria 4425
786 Ga0207695_10090052 3300025913 Bacteria 3084
787 Ga0207695_10158719 3300025913 Bacteria 2195
788 Ga0207695_10281641 3300025913 Bacteria 1556
789 Ga0207695_10368930 3300025913 Bacteria 1322
790 Ga0207671_10005185 3300025914 Bacteria 12115
791 Ga0207671_10009196 3300025914 Bacteria 8287
792 Ga0207671_10022653 3300025914 Bacteria 4746
793 Ga0207671_10143827 3300025914 Bacteria 1839
794 Ga0207671_10269900 3300025914 Bacteria 1340
795 Ga0207660_10031458 3300025917 Bacteria 3655
796 Ga0207660_10057840 3300025917 Bacteria 2778
797 Ga0207657_10000064 3300025919 Bacteria 99069
798 Ga0207657_10004640 3300025919 Bacteria 14511
799 Ga0207657_10052515 3300025919 Bacteria 3537
800 Ga0207657_10101416 3300025919 Bacteria 2389
801 Ga0207657_10142845 3300025919 Bacteria 1955
802 Ga0207649_10003359 3300025920 Bacteria 8754
803 Ga0207649_10111584 3300025920 Bacteria 1828
804 Ga0207652_10036056 3300025921 Bacteria 4179
805 Ga0207646_10029822 3300025922 Bacteria 4952
806 Ga0207681_10001755 3300025923 Bacteria 13925
807 Ga0207681_10008014 3300025923 Bacteria 6462
808 Ga0207681_10038931 3300025923 Bacteria 3153
809 Ga0207681_10086351 3300025923 Bacteria 2229
810 Ga0207694_10006495 3300025924 Bacteria 8897
811 Ga0207694_10046172 3300025924 Bacteria 3367
812 Ga0207650_10000149 3300025925 Bacteria 83837
813 Ga0207650_10003696 3300025925 Bacteria 10462
814 Ga0207650_10027122 3300025925 Bacteria 4097
815 Ga0207650_10158731 3300025925 Bacteria 1790
816 Ga0207650_10300731 3300025925 Bacteria 1310
817 Ga0207659_10001112 3300025926 Bacteria 15936
818 Ga0207659_10008170 3300025926 Bacteria 6480
819 Ga0207659_10034567 3300025926 Bacteria 3487
820 Ga0207659_10319205 3300025926 Bacteria 1281
821 Ga0207687_10079496 3300025927 Bacteria 2364
822 Ga0207687_10171809 3300025927 Bacteria 1672
823 Ga0207687_10249285 3300025927 Bacteria 1411
824 Ga0207644_10029239 3300025931 Bacteria 3822
825 Ga0207644_10059566 3300025931 Bacteria 2761
826 Ga0207644_10137604 3300025931 Bacteria 1877
827 Ga0207644_10163053 3300025931 Bacteria 1734
828 Ga0207690_10000060 3300025932 Bacteria 99148
829 Ga0207690_10001370 3300025932 Bacteria 15294
830 Ga0207690_10010413 3300025932 Bacteria 5525
831 Ga0207706_10000327 3300025933 Bacteria 51547
832 Ga0207706_10001200 3300025933 Bacteria 26157
833 Ga0207706_10008543 3300025933 Bacteria 9436
834 Ga0207706_10068765 3300025933 Bacteria 3115
835 Ga0207706_10184799 3300025933 Bacteria 1831
836 Ga0207706_10228177 3300025933 Bacteria 1630
837 Ga0207706_10232922 3300025933 Bacteria 1611
838 Ga0207706_10327239 3300025933 Bacteria 1333
839 Ga0207686_10003227 3300025934 Bacteria 8767
840 Ga0207686_10099402 3300025934 Bacteria 1939
841 Ga0207686_10212284 3300025934 Bacteria 1392
842 Ga0207709_10000167 3300025935 Bacteria 88877
843 Ga0207709_10000572 3300025935 Bacteria 31041
844 Ga0207709_10001051 3300025935 Bacteria 20412
845 Ga0207709_10001477 3300025935 Bacteria 16306
846 Ga0207709_10219870 3300025935 Bacteria 1369
847 Ga0207669_10002372 3300025937 Bacteria 8013
848 Ga0207669_10027664 3300025937 Bacteria 3108
849 Ga0207669_10048839 3300025937 Bacteria 2517
850 Ga0207669_10052751 3300025937 Bacteria 2445
851 Ga0207669_10127489 3300025937 Bacteria 1742
852 Ga0207669_10352608 3300025937 Bacteria 1137
853 Ga0207704_10050525 3300025938 Bacteria 2509
854 Ga0207704_10134655 3300025938 Bacteria 1718
855 Ga0207704_10155859 3300025938 Bacteria 1619
856 Ga0207691_10000362 3300025940 Bacteria 45799
857 Ga0207691_10000559 3300025940 Bacteria 37169
858 Ga0207691_10004379 3300025940 Bacteria 13691
859 Ga0207691_10019231 3300025940 Bacteria 6466
860 Ga0207691_10027591 3300025940 Bacteria 5323
861 Ga0207691_10079792 3300025940 Bacteria 2944
862 Ga0207691_10115396 3300025940 Bacteria 2385
863 Ga0207691_10118941 3300025940 Bacteria 2343
864 Ga0207691_10175577 3300025940 Bacteria 1874
865 Ga0207711_10003826 3300025941 Bacteria 12946
866 Ga0207711_10013604 3300025941 Bacteria 6760
867 Ga0207711_10013970 3300025941 Bacteria 6670
868 Ga0207711_10035676 3300025941 Bacteria 4217
869 Ga0207711_10169069 3300025941 Bacteria 1983
870 Ga0207711_10229225 3300025941 Bacteria 1701
871 Ga0207689_10005832 3300025942 Bacteria 10920
872 Ga0207689_10067737 3300025942 Bacteria 2934
873 Ga0207689_10090342 3300025942 Bacteria 2516
874 Ga0207689_10110561 3300025942 Bacteria 2258
875 Ga0207689_10190466 3300025942 Bacteria 1692
876 Ga0207661_10066729 3300025944 Bacteria 2923
877 Ga0207661_10361611 3300025944 Bacteria 1311
878 Ga0207679_10000313 3300025945 Bacteria 36405
879 Ga0207679_10009139 3300025945 Bacteria 6336
880 Ga0207679_10040602 3300025945 Bacteria 3332
881 Ga0207679_10043650 3300025945 Bacteria 3230
882 Ga0207679_10054904 3300025945 Bacteria 2935
883 Ga0207667_10002443 3300025949 Bacteria 23225
884 Ga0207667_10005486 3300025949 Bacteria 15464
885 Ga0207667_10021484 3300025949 Bacteria 7150
886 Ga0207667_10094881 3300025949 Bacteria 3080
887 Ga0207667_10207931 3300025949 Bacteria 2006
888 Ga0207667_10278800 3300025949 Bacteria 1708
889 Ga0207651_10014266 3300025960 Bacteria 4580
890 Ga0207651_10026206 3300025960 Bacteria 3637
891 Ga0207651_10032202 3300025960 Bacteria 3364
892 Ga0207651_10083854 3300025960 Bacteria 2306
893 Ga0207651_10188987 3300025960 Bacteria 1641
894 Ga0207651_10255739 3300025960 Bacteria 1435
895 Ga0207651_10444250 3300025960 Bacteria 1112
896 Ga0207712_10014991 3300025961 Bacteria 4994
897 Ga0207640_10040930 3300025981 Bacteria 2944
898 Ga0207640_10154648 3300025981 Bacteria 1689
899 Ga0207658_10009698 3300025986 Bacteria 6536
900 Ga0207658_10017527 3300025986 Bacteria 4937
901 Ga0207658_10042580 3300025986 Bacteria 3295
902 Ga0207658_10096417 3300025986 Bacteria 2306
903 Ga0207658_10156322 3300025986 Bacteria 1864
904 Ga0207658_10232227 3300025986 Bacteria 1558
905 Ga0207677_10007425 3300026023 Bacteria 6063
906 Ga0207677_10020334 3300026023 Bacteria 4029
907 Ga0207677_10139750 3300026023 Bacteria 1852
908 Ga0207677_10203959 3300026023 Bacteria 1574
909 Ga0207703_10009460 3300026035 Bacteria 7653
910 Ga0207703_10065016 3300026035 Bacteria 2996
911 Ga0207703_10457216 3300026035 Bacteria 1193
912 Ga0207639_10105221 3300026041 Bacteria 2289
913 Ga0207639_10122643 3300026041 Bacteria 2138
914 Ga0207678_10000233 3300026067 Bacteria 49821
915 Ga0207678_10000684 3300026067 Bacteria 31001
916 Ga0207678_10007290 3300026067 Bacteria 9801
917 Ga0207678_10072411 3300026067 Bacteria 2953
918 Ga0207678_10127354 3300026067 Bacteria 2172
919 Ga0207678_10272080 3300026067 Bacteria 1453
920 Ga0207708_10112931 3300026075 Bacteria 2110
921 Ga0207708_10140717 3300026075 Bacteria 1892
922 Ga0207702_10000395 3300026078 Bacteria 49788
923 Ga0207702_10022131 3300026078 Bacteria 5269
924 Ga0207702_10080989 3300026078 Bacteria 2819
925 Ga0207702_10255805 3300026078 Bacteria 1647
926 Ga0207702_10375834 3300026078 Bacteria 1365
927 Ga0207641_10044755 3300026088 Bacteria 3723
928 Ga0207641_10046333 3300026088 Bacteria 3664
929 Ga0207641_10060193 3300026088 Bacteria 3236
930 Ga0207641_10793408 3300026088 Bacteria 936
931 Ga0207648_10000450 3300026089 Bacteria 45586
932 Ga0207648_10000790 3300026089 Bacteria 35657
933 Ga0207648_10001193 3300026089 Bacteria 29116
934 Ga0207648_10013992 3300026089 Bacteria 7436
935 Ga0207648_10027644 3300026089 Bacteria 5034
936 Ga0207648_10053938 3300026089 Bacteria 3513
937 Ga0207648_10080605 3300026089 Bacteria 2839
938 Ga0207648_10165453 3300026089 Bacteria 1954
939 Ga0207676_10011836 3300026095 Bacteria 6242
940 Ga0207676_10015722 3300026095 Bacteria 5468
941 Ga0207676_10068636 3300026095 Bacteria 2836
942 Ga0207676_10163267 3300026095 Bacteria 1932
943 Ga0207676_10357594 3300026095 Bacteria 1352
944 Ga0207676_10553251 3300026095 Bacteria 1099
945 Ga0207674_10003791 3300026116 Bacteria 18445
946 Ga0207674_10131495 3300026116 Bacteria 2465
947 Ga0207674_10202043 3300026116 Bacteria 1937
948 Ga0207674_10205618 3300026116 Bacteria 1918
949 Ga0207674_10219631 3300026116 Bacteria 1849
950 Ga0207674_10280038 3300026116 Bacteria 1616
951 Ga0207674_10573705 3300026116 Bacteria 1090
952 Ga0207675_100000186 3300026118 Bacteria 56221
953 Ga0207675_100001873 3300026118 Bacteria 21025
954 Ga0207675_100007853 3300026118 Bacteria 10066
955 Ga0207675_100033459 3300026118 Bacteria 4789
956 Ga0207675_100158376 3300026118 Bacteria 2159
957 Ga0207683_10001421 3300026121 Bacteria 21648
958 Ga0207683_10038660 3300026121 Bacteria 4161
959 Ga0207683_10043980 3300026121 Bacteria 3903
960 Ga0207683_10101575 3300026121 Bacteria 2568
961 Ga0207683_10120483 3300026121 Bacteria 2355
962 Ga0207683_10178346 3300026121 Bacteria 1926
963 Ga0207683_10207870 3300026121 Bacteria 1780
964 Ga0207683_10213200 3300026121 Bacteria 1758
965 Ga0207683_10313587 3300026121 Bacteria 1436
966 Ga0207683_10326777 3300026121 Bacteria 1405
967 Ga0207698_10042409 3300026142 Bacteria 3399
968 Ga0207698_10048807 3300026142 Bacteria 3217
969 Ga0207698_10112785 3300026142 Bacteria 2283
970 Ga0207698_10166172 3300026142 Bacteria 1937
971 Ga0207698_10246750 3300026142 Bacteria 1631
972 Ga0209281_1000002 3300027111 Bacteria 1924012
973 Ga0209281_1000057 3300027111 Bacteria 307145
974 Ga0209281_1031074 3300027111 Bacteria 954
975 Ga0209371_1000114 3300027312 Bacteria 139090
976 Ga0209371_1001990 3300027312 Bacteria 12330
977 Ga0209996_1002892 3300027395 Bacteria 2140
978 Ga0209968_1001737 3300027526 Bacteria 3299
979 Ga0209970_1002523 3300027614 Bacteria 3101
980 Ga0210002_1001738 3300027617 Bacteria 3111
981 Ga0209983_1000360 3300027665 Bacteria 9605
982 Ga0209282_1000832 3300027666 Bacteria 15880
983 Ga0209966_1000138 3300027695 Bacteria 30805
984 Ga0209998_10000686 3300027717 Bacteria 9052
985 Ga0209998_10009329 3300027717 Bacteria 2037
986 Ga0209813_10021556 3300027866 Bacteria 1813
987 Ga0209974_10000459 3300027876 Bacteria 13516
988 Ga0209974_10001528 3300027876 Bacteria 8396
989 Ga0209974_10005321 3300027876 Bacteria 4538
990 Ga0209974_10009195 3300027876 Bacteria 3356
991 Ga0209974_10030664 3300027876 Bacteria 1782
992 Ga0207428_10139944 3300027907 Bacteria 1848
993 Ga0268266_10028422 3300028379 Bacteria 4753
994 Ga0268266_10072619 3300028379 Bacteria 2985
995 Ga0268266_10159186 3300028379 Bacteria 2042
996 Ga0268266_10182421 3300028379 Bacteria 1912
997 Ga0268266_10244102 3300028379 Bacteria 1659
998 Ga0268265_10006473 3300028380 Bacteria 7937
999 Ga0268265_10017660 3300028380 Bacteria 4930
1000 Ga0268265_10048239 3300028380 Bacteria 3196
1001 Ga0268265_10142528 3300028380 Bacteria 2008
1002 Ga0268265_10164701 3300028380 Bacteria 1888
1003 Ga0268264_10002327 3300028381 Bacteria 16797
1004 Ga0268264_10007640 3300028381 Bacteria 9011
1005 Ga0268264_10130336 3300028381 Bacteria 2228
1006 Ga0268264_10274119 3300028381 Bacteria 1577
1007 Ga0265334_10000038 3300028573 Bacteria 100961
1008 Ga0265334_10028236 3300028573 Bacteria 2256
1009 Ga0265336_10000040 3300028666 Bacteria 138266
1010 Ga0307517_10002864 3300028786 Bacteria 27354
1011 Ga0307517_10084727 3300028786 Bacteria 2664
1012 Ga0307517_10148095 3300028786 Bacteria 1621
1013 Ga0307515_10000278 3300028794 Bacteria 125493
1014 Ga0307515_10001613 3300028794 Bacteria 50267
1015 Ga0307515_10001625 3300028794 Bacteria 50019
1016 Ga0307515_10003475 3300028794 Bacteria 33121
1017 Ga0307515_10005665 3300028794 Bacteria 25226
1018 Ga0307515_10031234 3300028794 Bacteria 8891
1019 Ga0307515_10031933 3300028794 Bacteria 8747
1020 Ga0307515_10217032 3300028794 Bacteria 1741
1021 Ga0265338_10000409 3300028800 Bacteria 76989
1022 Ga0265338_10000410 3300028800 Bacteria 76570
1023 Ga0265324_10009599 3300029957 Bacteria 3770
1024 Ga0265324_10018631 3300029957 Bacteria 2507
1025 Ga0268256_1000177 3300030500 Bacteria 75500
1026 Ga0268256_1001738 3300030500 Bacteria 12330
1027 Ga0307512_10020320 3300030522 Bacteria 6016
1028 Ga0307512_10132583 3300030522 Bacteria 1556
1029 Ga0307512_10195570 3300030522 Bacteria 1106
1030 Ga0316177_1053509 3300030731 Bacteria 4538
1031 Ga0314311_1052885 3300030733 Bacteria 3436
1032 Ga0316178_1008540 3300030735 Bacteria 3052
1033 Ga0316181_1130612 3300030744 Bacteria 4718
1034 Ga0316182_1433267 3300030745 Bacteria 4090
1035 Ga0265330_10000044 3300031235 Bacteria 113679
1036 Ga0265332_10000046 3300031238 Bacteria 113777
1037 Ga0265332_10004610 3300031238 Bacteria 6449
1038 Ga0265340_10006548 3300031247 Bacteria 6399
1039 Ga0265340_10020106 3300031247 Bacteria 3436
1040 Ga0265340_10030289 3300031247 Bacteria 2712
1041 Ga0265340_10055264 3300031247 Bacteria 1913
1042 Ga0265331_10028127 3300031250 Bacteria 2813
1043 Ga0265331_10075722 3300031250 Bacteria 1569
1044 Ga0265327_10000178 3300031251 Bacteria 135732
1045 Ga0265327_10010623 3300031251 Bacteria 6445
1046 Ga0265327_10063393 3300031251 Bacteria 1877
1047 Ga0265316_10000180 3300031344 Bacteria 71764
1048 Ga0307513_10000008 3300031456 Bacteria 442128
1049 Ga0307513_10000441 3300031456 Bacteria 59706
1050 Ga0307513_10025212 3300031456 Bacteria 6896
1051 Ga0307513_10036901 3300031456 Bacteria 5444
1052 Ga0307513_10044997 3300031456 Bacteria 4828
1053 Ga0307513_10132842 3300031456 Bacteria 2431
1054 Ga0307513_10147842 3300031456 Bacteria 2265
1055 Ga0307513_10185660 3300031456 Bacteria 1937
1056 Ga0307509_10000991 3300031507 Bacteria 48763
1057 Ga0307509_10091612 3300031507 Bacteria 3110
1058 Ga0307509_10115853 3300031507 Bacteria 2671
1059 Ga0307509_10150965 3300031507 Bacteria 2239
1060 Ga0307509_10169857 3300031507 Bacteria 2062
1061 Ga0307509_10246278 3300031507 Bacteria 1575
1062 Ga0307408_100000229 3300031548 Bacteria 59103
1063 Ga0307408_100001734 3300031548 Bacteria 15949
1064 Ga0307408_100069075 3300031548 Bacteria 2604
1065 Ga0307408_100129551 3300031548 Bacteria 1966
1066 Ga0307408_100158453 3300031548 Bacteria 1795
1067 Ga0307408_100190791 3300031548 Bacteria 1651
1068 Ga0307408_100242045 3300031548 Bacteria 1483
1069 Ga0307408_100352232 3300031548 Bacteria 1250
1070 Ga0265313_10000102 3300031595 Bacteria 86997
1071 Ga0307508_10000043 3300031616 Bacteria 143889
1072 Ga0307508_10008769 3300031616 Bacteria 9334
1073 Ga0307514_10000850 3300031649 Bacteria 49169
1074 Ga0307514_10002962 3300031649 Bacteria 16858
1075 Ga0307514_10051575 3300031649 Bacteria 3187
1076 Ga0307514_10143879 3300031649 Bacteria 1615
1077 Ga0307514_10227969 3300031649 Bacteria 1133
1078 Ga0316575_10016586 3300031665 Bacteria 2790
1079 Ga0265314_10000130 3300031711 Bacteria 113776
1080 Ga0265314_10002601 3300031711 Bacteria 18259
1081 Ga0316576_10003443 3300031727 Bacteria 9268
1082 Ga0316576_10291199 3300031727 Bacteria 1221
1083 Ga0307516_10000419 3300031730 Bacteria 55599
1084 Ga0307516_10000953 3300031730 Bacteria 39905
1085 Ga0307516_10017660 3300031730 Bacteria 7434
1086 Ga0307516_10052978 3300031730 Bacteria 3970
1087 Ga0307516_10079661 3300031730 Bacteria 3120
1088 Ga0307516_10098376 3300031730 Bacteria 2744
1089 Ga0307516_10258669 3300031730 Bacteria 1432
1090 Ga0307405_10006234 3300031731 Bacteria 5846
1091 Ga0307405_10022793 3300031731 Bacteria 3547
1092 Ga0307405_10046765 3300031731 Bacteria 2661
1093 Ga0307405_10049995 3300031731 Bacteria 2586
1094 Ga0307405_10159967 3300031731 Bacteria 1594
1095 Ga0316577_10031841 3300031733 Bacteria 2946
1096 Ga0307413_10024560 3300031824 Bacteria 3288
1097 Ga0307413_10026162 3300031824 Bacteria 3212
1098 Ga0307410_10009498 3300031852 Bacteria 5456
1099 Ga0307410_10037404 3300031852 Bacteria 3170
1100 Ga0307410_10363856 3300031852 Bacteria 1159
1101 Ga0307406_10000591 3300031901 Bacteria 20868
1102 Ga0307406_10006447 3300031901 Bacteria 6477
1103 Ga0307406_10019188 3300031901 Bacteria 4010
1104 Ga0307407_10147861 3300031903 Bacteria 1523
1105 Ga0307412_10000044 3300031911 Bacteria 165237
1106 Ga0307412_10012422 3300031911 Bacteria 4966
1107 Ga0307412_10089609 3300031911 Bacteria 2148
1108 Ga0307412_10148863 3300031911 Bacteria 1724
1109 Ga0307412_10263091 3300031911 Bacteria 1346
1110 Ga0307412_10323309 3300031911 Bacteria 1228
1111 Ga0307412_10359582 3300031911 Bacteria 1172
1112 Ga0307412_10489779 3300031911 Bacteria 1021
1113 Ga0307409_100003205 3300031995 Bacteria 8806
1114 Ga0307409_100005035 3300031995 Bacteria 7528
1115 Ga0307409_100091270 3300031995 Bacteria 2496
1116 Ga0307409_100137407 3300031995 Bacteria 2100
1117 Ga0307416_100012555 3300032002 Bacteria 5714
1118 Ga0307416_100018314 3300032002 Bacteria 4930
1119 Ga0307416_100022955 3300032002 Bacteria 4517
1120 Ga0307416_100049793 3300032002 Bacteria 3334
1121 Ga0307416_100086625 3300032002 Bacteria 2671
1122 Ga0307416_100087583 3300032002 Bacteria 2659
1123 Ga0307416_100119263 3300032002 Bacteria 2346
1124 Ga0307416_100119492 3300032002 Bacteria 2345
1125 Ga0307416_100175880 3300032002 Bacteria 1999
1126 Ga0307416_100356653 3300032002 Bacteria 1482
1127 Ga0307414_10017945 3300032004 Bacteria 4341
1128 Ga0307411_10031809 3300032005 Bacteria 3252
1129 Ga0307411_10079139 3300032005 Bacteria 2256
1130 Ga0307411_10254896 3300032005 Bacteria 1382
1131 Ga0307411_10290230 3300032005 Bacteria 1306
1132 Ga0307411_10302337 3300032005 Bacteria 1284
1133 Ga0307415_100003949 3300032126 Bacteria 7623
1134 Ga0307415_100024845 3300032126 Bacteria 3750
1135 Ga0307415_100053110 3300032126 Bacteria 2759
1136 Ga0316583_10035785 3300032133 Bacteria 1762
1137 Ga0316585_10012534 3300032137 Bacteria 2513
1138 Ga0316580_10010417 3300032139 Bacteria 2809
1139 Ga0307507_10039242 3300033179 Bacteria 4783
1140 Ga0373930_0014021 3300034816 Bacteria 1487
1141 Ga0373934_0099337 3300035086 Bacteria 1176
1142 Ga0373936_0091216 3300035113 Bacteria 1278
1143 Ga0373955_0017537 3300035172 Bacteria 3546
1144 Ga0373942_0011463 3300035207 Bacteria 2103
1145 Ga0316574_0000259 3300035398 Bacteria 19426
1146 Ga0316574_0210229 3300035398 Bacteria 1248
1147 Ga0373924_0081314 3300035410 Bacteria 1378
1148 Ga0373931_0008764 3300035691 Bacteria 4814
1149 Ga0373931_0011924 3300035691 Bacteria 4206
1150 Ga0373935_0208350 3300035692 Bacteria 1354
1151 Ga0373935_0313957 3300035692 Bacteria 1111
1152 Ga0373927_0000001 3300035695 Bacteria 1082160
1153 Ga0373927_0078949 3300035695 Bacteria 2132
1154 Ga0373933_0098498 3300035724 Bacteria 1812
1155 Ga0373947_0097465 3300035725 Bacteria 1843
1156 Ga0373947_0291770 3300035725 Bacteria 1086
1157 Ga0373937_0089120 3300036401 Bacteria 2856
1158 Ga0373937_0099879 3300036401 Bacteria 2692
1159 Ga0373937_0229489 3300036401 Bacteria 1748
1160 Ga0373937_0269447 3300036401 Bacteria 1607
1161 Ga0316582_0078283 3300036647 Bacteria 2153
1162 Ga0316582_0178454 3300036647 Bacteria 1444
1163 Ga0316584_0032131 3300036712 Bacteria 3883
1164 Ga0316584_0225816 3300036712 Bacteria 1374
1165 Ga0373925_0001792 3300037068 Bacteria 17899
1166 Ga0373925_0077160 3300037068 Bacteria 2528
1167 Ga0373925_0189554 3300037068 Bacteria 1631
1168 Ga0395899_0000008 3300037312 Bacteria 567572
1169 Ga0395899_0002984 3300037312 Bacteria 13533
1170 Ga0395899_0029971 3300037312 Bacteria 4094
1171 Ga0395899_0045609 3300037312 Bacteria 3266
1172 Ga0395899_0048201 3300037312 Bacteria 3171
1173 Ga0395899_0145400 3300037312 Bacteria 1684
1174 Ga0395900_0000055 3300037418 Bacteria 219875
1175 Ga0395900_0000617 3300037418 Bacteria 48154
1176 Ga0395900_0006242 3300037418 Bacteria 12437
1177 Ga0395900_0006516 3300037418 Bacteria 12165
1178 Ga0395900_0016169 3300037418 Bacteria 7600
1179 Ga0395900_0095300 3300037418 Bacteria 3058
1180 Ga0395900_0099142 3300037418 Bacteria 2993
1181 Ga0395900_0145236 3300037418 Bacteria 2426
1182 Ga0395900_0162784 3300037418 Bacteria 2275
1183 Ga0395900_0303388 3300037418 Bacteria 1582
1184 Ga0395898_0000119 3300037466 Bacteria 209937
1185 Ga0395898_0001022 3300037466 Bacteria 43575
1186 Ga0395898_0006191 3300037466 Bacteria 12821
1187 Ga0395898_0007201 3300037466 Bacteria 11808
1188 Ga0395898_0008920 3300037466 Bacteria 10562
1189 Ga0395898_0012459 3300037466 Bacteria 8791
1190 Ga0395898_0075544 3300037466 Bacteria 3255
1191 Ga0395898_0089327 3300037466 Bacteria 2965
1192 Ga0395898_0113131 3300037466 Bacteria 2601
1193 Ga0395905_0000088 3300037471 Bacteria 152506
1194 Ga0395905_0000201 3300037471 Bacteria 92923
1195 Ga0395905_0007574 3300037471 Bacteria 10789
1196 Ga0395905_0009071 3300037471 Bacteria 9755
1197 Ga0395905_0018061 3300037471 Bacteria 6696
1198 Ga0395905_0034496 3300037471 Bacteria 4751
1199 Ga0395905_0037897 3300037471 Bacteria 4524
1200 Ga0395905_0040013 3300037471 Bacteria 4398
1201 Ga0395905_0047000 3300037471 Bacteria 4046
1202 Ga0395905_0047693 3300037471 Bacteria 4013
1203 Ga0395905_0084987 3300037471 Bacteria 2965
1204 Ga0395905_0176063 3300037471 Bacteria 2008
1205 Ga0395905_0287098 3300037471 Bacteria 1532
1206 Ga0395901_0000003 3300038443 Bacteria 701538
1207 Ga0395901_0000186 3300038443 Bacteria 79718
1208 Ga0395901_0001180 3300038443 Bacteria 27770
1209 Ga0395901_0001409 3300038443 Bacteria 25099
1210 Ga0395901_0003137 3300038443 Bacteria 16603
1211 Ga0395901_0025819 3300038443 Bacteria 6032
1212 Ga0395901_0048381 3300038443 Bacteria 4415
1213 Ga0395901_0079879 3300038443 Bacteria 3415
1214 Ga0395901_0146573 3300038443 Bacteria 2481
1215 Ga0395901_0277142 3300038443 Bacteria 1743
1216 Ga0436365_1244488 3300039437 Bacteria 4690
1217 Ga0436365_1657226 3300039437 Bacteria 2305
1218 Ga0436360_0754952 3300039438 Bacteria 1501
1219 Ga0436361_0010589 3300039447 Bacteria 5514
1220 Ga0436361_0148040 3300039447 Bacteria 5288
1221 Ga0436361_0327454 3300039447 Bacteria 1099
1222 Ga0436361_0523338 3300039447 Bacteria 7577
1223 Ga0439436_0002666 3300041404 Bacteria 5378
1224 Ga0439436_0004111 3300041404 Bacteria 4457
1225 Ga0439438_017758 3300041405 Bacteria 2039
1226 Ga0439439_0004613 3300041406 Bacteria 3117
1227 Ga0439439_0009114 3300041406 Bacteria 2355
1228 Ga0439447_031999 3300041407 Bacteria 1317
1229 Ga0439466_0008984 3300041411 Bacteria 3756
1230 Ga0439466_0013895 3300041411 Bacteria 2941
1231 Ga0439466_0023634 3300041411 Bacteria 2160
1232 Ga0439465_0000423 3300041413 Bacteria 12334
1233 Ga0439465_0046201 3300041413 Bacteria 1417
1234 Ga0451804_0097016 3300041463 Bacteria 1674
1235 Ga0439431_0002666 3300041997 Bacteria 3935
1236 Ga0439431_0040775 3300041997 Bacteria 1182
1237 Ga0439433_0004604 3300041999 Bacteria 2964
1238 Ga0439433_0009084 3300041999 Bacteria 2163
1239 Ga0439433_0017947 3300041999 Bacteria 1573
1240 Ga0439442_002618 3300042002 Bacteria 3532
1241 Ga0439442_007450 3300042002 Bacteria 2199
1242 Ga0439445_0001349 3300042004 Bacteria 5314
1243 Ga0439445_0009382 3300042004 Bacteria 2306
1244 Ga0439448_0006903 3300042005 Bacteria 3275
1245 Ga0439432_005010 3300042006 Bacteria 4789
1246 Ga0439432_008828 3300042006 Bacteria 3525
1247 Ga0439449_0003281 3300042007 Bacteria 6307
1248 Ga0439449_0006421 3300042007 Bacteria 4497
1249 Ga0439449_0020974 3300042007 Bacteria 2448
1250 Ga0439452_005776 3300042010 Bacteria 3950
1251 Ga0439455_0040424 3300042012 Bacteria 1192
1252 Ga0439457_003844 3300042014 Bacteria 4024
1253 Ga0439457_005538 3300042014 Bacteria 3170
1254 Ga0439462_0005972 3300042015 Bacteria 3016
1255 Ga0439462_0008820 3300042015 Bacteria 2548
1256 Ga0439462_0015867 3300042015 Bacteria 1944
1257 Ga0450911_001624 3300042115 Bacteria 5013
1258 Ga0450919_003028 3300042121 Bacteria 2141
1259 Ga0450919_004441 3300042121 Bacteria 1715
1260 Ga0450920_005654 3300042122 Bacteria 2228
1261 Ga0450923_004932 3300042125 Bacteria 2126
1262 Ga0450897_001376 3300042128 Bacteria 1650
1263 Ga0450894_009746 3300042131 Bacteria 1245
1264 Ga0450898_013925 3300042134 Bacteria 1347
1265 Ga0450906_005055 3300042145 Bacteria 2734
1266 Ga0439446_0004291 3300042156 Bacteria 3605
1267 Ga0439446_0007197 3300042156 Bacteria 2919
1268 Ga0439458_0021265 3300042157 Bacteria 1501
1269 Ga0450909_005002 3300042185 Bacteria 1904
1270 Ga0439434_0005803 3300042435 Bacteria 3605
1271 Ga0439434_0020316 3300042435 Bacteria 1994
1272 Ga0450918_000014 3300042531 Bacteria 34950
1273 Ga0451577_0020219 3300042876 Bacteria 6114
1274 Ga0451577_0027448 3300042876 Bacteria 5153
1275 Ga0451577_0030668 3300042876 Bacteria 4856
1276 Ga0451577_0058212 3300042876 Bacteria 3445
1277 Ga0451577_0084426 3300042876 Bacteria 2833
1278 Ga0451577_0230250 3300042876 Bacteria 1676
1279 Ga0451577_0486130 3300042876 Bacteria 1121
1280 Ga0451577_0519119 3300042876 Bacteria 1081
1281 Ga0451577_0544344 3300042876 Bacteria 1054
1282 Ga0466969_0000013 3300044656 Bacteria 111537
1283 Ga0466969_0000949 3300044656 Bacteria 15630
1284 Ga0466969_0001609 3300044656 Bacteria 12093
1285 Ga0466969_0012997 3300044656 Bacteria 4384
1286 Ga0466969_0015995 3300044656 Bacteria 3931
1287 Ga0466969_0017510 3300044656 Bacteria 3738
1288 Ga0466969_0040127 3300044656 Bacteria 2346
1289 Ga0466972_0006888 3300044658 Bacteria 5702
1290 Ga0466972_0041080 3300044658 Bacteria 2252
1291 Ga0466972_0092942 3300044658 Bacteria 1430
1292 Ga0466972_0192277 3300044658 Bacteria 956
1293 Ga0466973_0051992 3300044659 Bacteria 3778
1294 Ga0466977_0001419 3300044666 Bacteria 9865
1295 Ga0453683_0005267 3300044673 Bacteria 9049
1296 Ga0466965_0000123 3300044683 Bacteria 21985
1297 Ga0466965_0003102 3300044683 Bacteria 7241
1298 Ga0466965_0017787 3300044683 Bacteria 3400
1299 Ga0466965_0020023 3300044683 Bacteria 3214
1300 Ga0466965_0063128 3300044683 Bacteria 1853
1301 Ga0466965_0075883 3300044683 Bacteria 1696
1302 Ga0466966_0005342 3300044684 Bacteria 8450
1303 Ga0466966_0009778 3300044684 Bacteria 6356
1304 Ga0466966_0014484 3300044684 Bacteria 5218
1305 Ga0466966_0018138 3300044684 Bacteria 4644
1306 Ga0466966_0024309 3300044684 Bacteria 3963
1307 Ga0466966_0057982 3300044684 Bacteria 2448
1308 Ga0466966_0069918 3300044684 Bacteria 2201
1309 Ga0466966_0096405 3300044684 Bacteria 1832
1310 Ga0466961_0000097 3300044693 Bacteria 56628
1311 Ga0466961_0005590 3300044693 Bacteria 7940
1312 Ga0466961_0005894 3300044693 Bacteria 7765
1313 Ga0466961_0021899 3300044693 Bacteria 4112
1314 Ga0466961_0032901 3300044693 Bacteria 3331
1315 Ga0466961_0036998 3300044693 Bacteria 3132
1316 Ga0466961_0053993 3300044693 Bacteria 2563
1317 Ga0466961_0057586 3300044693 Bacteria 2473
1318 Ga0466961_0098985 3300044693 Bacteria 1838
1319 Ga0466961_0121724 3300044693 Bacteria 1638
1320 Ga0466963_0003740 3300044694 Bacteria 8761
1321 Ga0466963_0004173 3300044694 Bacteria 8365
1322 Ga0466963_0014644 3300044694 Bacteria 4840
1323 Ga0466963_0017489 3300044694 Bacteria 4469
1324 Ga0466964_0002945 3300044706 Bacteria 6149
1325 Ga0466964_0004584 3300044706 Bacteria 5110
1326 Ga0466964_0006456 3300044706 Bacteria 4370
1327 Ga0466964_0022376 3300044706 Bacteria 2452
1328 Ga0453684_0064177 3300044712 Bacteria 4692
1329 Ga0453684_0094337 3300044712 Bacteria 3681
1330 Ga0453684_0471873 3300044712 Bacteria 1393
1331 Ga0466971_0000504 3300044719 Bacteria 15342
1332 Ga0466971_0001432 3300044719 Bacteria 10033
1333 Ga0466971_0011044 3300044719 Bacteria 3953
1334 Ga0466971_0053739 3300044719 Bacteria 1815
1335 Ga0466968_0001837 3300044735 Bacteria 7661
1336 Ga0466968_0009580 3300044735 Bacteria 3729
1337 Ga0466968_0044066 3300044735 Bacteria 1890
1338 Ga0466970_0007260 3300044765 Bacteria 5550
1339 Ga0466970_0011454 3300044765 Bacteria 4521
1340 Ga0466970_0014926 3300044765 Bacteria 3993
1341 Ga0466970_0036442 3300044765 Bacteria 2606
1342 Ga0466970_0147699 3300044765 Bacteria 1297
1343 Ga0466970_0176655 3300044765 Bacteria 1184
1344 Ga0466957_0000539 3300044842 Bacteria 19128
1345 Ga0466957_0012295 3300044842 Bacteria 4956
1346 Ga0466957_0018632 3300044842 Bacteria 4078
1347 Ga0466957_0023435 3300044842 Bacteria 3649
1348 Ga0466957_0029906 3300044842 Bacteria 3250
1349 Ga0466957_0036640 3300044842 Bacteria 2950
1350 Ga0466957_0042464 3300044842 Bacteria 2751
1351 Ga0466957_0138205 3300044842 Bacteria 1568
1352 Ga0466960_0015378 3300044901 Bacteria 3297
1353 Ga0466959_0002979 3300045049 Bacteria 10939
1354 Ga0466959_0008158 3300045049 Bacteria 7387
1355 Ga0466959_0014340 3300045049 Bacteria 5753
1356 Ga0466959_0014953 3300045049 Bacteria 5655
1357 Ga0466959_0016377 3300045049 Bacteria 5415
1358 Ga0466959_0026132 3300045049 Bacteria 4329
1359 Ga0466959_0026878 3300045049 Bacteria 4268
1360 Ga0451576_0004140 3300045051 Bacteria 19114
1361 Ga0451576_0005316 3300045051 Bacteria 16185
1362 Ga0451576_0125631 3300045051 Bacteria 2673
1363 Ga0451576_0141532 3300045051 Bacteria 2508
1364 Ga0451576_0306196 3300045051 Bacteria 1662
1365 Ga0466958_0001102 3300045836 Bacteria 12464
1366 Ga0466958_0002984 3300045836 Bacteria 8670
1367 Ga0466958_0004646 3300045836 Bacteria 7283
1368 Ga0466958_0023471 3300045836 Bacteria 3621
1369 Ga0466958_0051558 3300045836 Bacteria 2491
1370 Ga0466958_0077556 3300045836 Bacteria 2041
1371 Ga0466958_0156798 3300045836 Bacteria 1437
1372 Ga0466967_0038188 3300045976 Bacteria 4116
1373 Ga0466967_0118948 3300045976 Bacteria 2438
1374 Ga0495627_004659 3300046453 Bacteria 5683
1375 Ga0495592_0000083 3300046454 Bacteria 83092
1376 Ga0495603_0016875 3300046455 Bacteria 4418
1377 Ga0495603_0018357 3300046455 Bacteria 4232
1378 Ga0495603_0021773 3300046455 Bacteria 3881
1379 Ga0495590_0002529 3300046457 Bacteria 7562
1380 Ga0495590_0003479 3300046457 Bacteria 6426
1381 Ga0495590_0018743 3300046457 Bacteria 2475
1382 Ga0495590_0056633 3300046457 Bacteria 1370
1383 Ga0495629_0000435 3300046459 Bacteria 34798
1384 Ga0495629_0010284 3300046459 Bacteria 6814
1385 Ga0495629_0032324 3300046459 Bacteria 3705
1386 Ga0495638_0001279 3300046460 Bacteria 23471
1387 Ga0495638_0028380 3300046460 Bacteria 3614
1388 Ga0495638_0035464 3300046460 Bacteria 3180
1389 Ga0495638_0038688 3300046460 Bacteria 3029
1390 Ga0495638_0099070 3300046460 Bacteria 1745
1391 Ga0495651_0012666 3300046462 Bacteria 6509
1392 Ga0495651_0031127 3300046462 Bacteria 4161
1393 Ga0495653_0011577 3300046463 Bacteria 7201
1394 Ga0495653_0017356 3300046463 Bacteria 5854
1395 Ga0495653_0033707 3300046463 Bacteria 4054
1396 Ga0495653_0161105 3300046463 Bacteria 1557
1397 Ga0495650_0010246 3300046471 Bacteria 5243
1398 Ga0495650_0010780 3300046471 Bacteria 5073
1399 Ga0495650_0012278 3300046471 Bacteria 4618
1400 Ga0495650_0012626 3300046471 Bacteria 4529
1401 Ga0495650_0025076 3300046471 Bacteria 2803
1402 Ga0495580_0002727 3300046472 Bacteria 15255
1403 Ga0495580_0015520 3300046472 Bacteria 5742
1404 Ga0495580_0019594 3300046472 Bacteria 5026
1405 Ga0495580_0054629 3300046472 Bacteria 2816
1406 Ga0495582_0003165 3300046473 Bacteria 9239
1407 Ga0495582_0015340 3300046473 Bacteria 4209
1408 Ga0495582_0062889 3300046473 Bacteria 2050
1409 Ga0495605_0001677 3300046474 Bacteria 14240
1410 Ga0495605_0003727 3300046474 Bacteria 9047
1411 Ga0495605_0005370 3300046474 Bacteria 7466
1412 Ga0495605_0011125 3300046474 Bacteria 5027
1413 Ga0495639_0050169 3300046475 Bacteria 1895
1414 Ga0495639_0122795 3300046475 Bacteria 1239
1415 Ga0495662_0028754 3300046476 Bacteria 2684
1416 Ga0495664_0107329 3300046477 Bacteria 1684
1417 Ga0495585_0025842 3300046492 Bacteria 3359
1418 Ga0495585_0033696 3300046492 Bacteria 2898
1419 Ga0495594_0042901 3300046499 Bacteria 2478
1420 Ga0495596_0002371 3300046500 Bacteria 10186
1421 Ga0495607_0001295 3300046501 Bacteria 22335
1422 Ga0495583_0000046 3300046506 Bacteria 218059
1423 Ga0495583_0001786 3300046506 Bacteria 20452
1424 Ga0495583_0031064 3300046506 Bacteria 2594
1425 Ga0495583_0098639 3300046506 Bacteria 1249
1426 Ga0495606_0009903 3300046507 Bacteria 7984
1427 Ga0495606_0012415 3300046507 Bacteria 6832
1428 Ga0495606_0017858 3300046507 Bacteria 5342
1429 Ga0495606_0030879 3300046507 Bacteria 3735
1430 Ga0495608_0005823 3300046511 Bacteria 8779
1431 Ga0495608_0059087 3300046511 Bacteria 2526
1432 Ga0495610_0017143 3300046512 Bacteria 4138
1433 Ga0495610_0063688 3300046512 Bacteria 1745
1434 Ga0495610_0079448 3300046512 Bacteria 1510
1435 Ga0495610_0100862 3300046512 Bacteria 1293
1436 Ga0495616_0010949 3300046513 Bacteria 5221
1437 Ga0495618_0039869 3300046514 Bacteria 2953
1438 Ga0495618_0049058 3300046514 Bacteria 2666
1439 Ga0495620_0008721 3300046515 Bacteria 5428
1440 Ga0495620_0022789 3300046515 Bacteria 3008
1441 Ga0495628_0014240 3300046516 Bacteria 6672
1442 Ga0495628_0015663 3300046516 Bacteria 6331
1443 Ga0495628_0025127 3300046516 Bacteria 4868
1444 Ga0495628_0062511 3300046516 Bacteria 2918
1445 Ga0495628_0063794 3300046516 Bacteria 2885
1446 Ga0495628_0101954 3300046516 Bacteria 2214
1447 Ga0495628_0168601 3300046516 Bacteria 1661
1448 Ga0495630_0009640 3300046517 Bacteria 6945
1449 Ga0495630_0009921 3300046517 Bacteria 6858
1450 Ga0495630_0025580 3300046517 Bacteria 4366
1451 Ga0495630_0028399 3300046517 Bacteria 4157
1452 Ga0495630_0196255 3300046517 Bacteria 1540
1453 Ga0495631_0009290 3300046518 Bacteria 4916
1454 Ga0495632_0025195 3300046519 Bacteria 3149
1455 Ga0495632_0030573 3300046519 Bacteria 2794
1456 Ga0495637_0007657 3300046520 Bacteria 5342
1457 Ga0495637_0041700 3300046520 Bacteria 1967
1458 Ga0495643_0016865 3300046522 Bacteria 4284
1459 Ga0495643_0074946 3300046522 Bacteria 1771
1460 Ga0495648_0015337 3300046524 Bacteria 5567
1461 Ga0495648_0046072 3300046524 Bacteria 2706
1462 Ga0495648_0051821 3300046524 Bacteria 2497
1463 Ga0495648_0193323 3300046524 Bacteria 1025
1464 Ga0495666_0000312 3300046526 Bacteria 21158
1465 Ga0495666_0008912 3300046526 Bacteria 5022
1466 Ga0495666_0010894 3300046526 Bacteria 4533
1467 Ga0495666_0014331 3300046526 Bacteria 3948
1468 Ga0495666_0021382 3300046526 Bacteria 3202
1469 Ga0495642_0011096 3300046528 Bacteria 3455
1470 Ga0495642_0018510 3300046528 Bacteria 2726
1471 Ga0495642_0022273 3300046528 Bacteria 2496
1472 Ga0495642_0043843 3300046528 Bacteria 1825
1473 Ga0495652_0016164 3300046529 Bacteria 6672
1474 Ga0495652_0016400 3300046529 Bacteria 6628
1475 Ga0495652_0050813 3300046529 Bacteria 3543
1476 Ga0495654_0011924 3300046530 Bacteria 4687
1477 Ga0495654_0036872 3300046530 Bacteria 2455
1478 Ga0495654_0057364 3300046530 Bacteria 1881
1479 Ga0495654_0058531 3300046530 Bacteria 1859
1480 Ga0495654_0060787 3300046530 Bacteria 1815
1481 Ga0495654_0079860 3300046530 Bacteria 1536
1482 Ga0495665_0001728 3300046531 Bacteria 11736
1483 Ga0495665_0012824 3300046531 Bacteria 4535
1484 Ga0495665_0085997 3300046531 Bacteria 1653
1485 Ga0495640_0014915 3300046533 Bacteria 5860
1486 Ga0495640_0018453 3300046533 Bacteria 5171
1487 Ga0495640_0030287 3300046533 Bacteria 3876
1488 Ga0495640_0143765 3300046533 Bacteria 1536
1489 Ga0495586_0003487 3300046535 Bacteria 8433
1490 Ga0495586_0016069 3300046535 Bacteria 3982
1491 Ga0495587_0008906 3300046536 Bacteria 6439
1492 Ga0495587_0011020 3300046536 Bacteria 5733
1493 Ga0495621_0002266 3300046539 Bacteria 5149
1494 Ga0495597_0000375 3300046542 Bacteria 39117
1495 Ga0495645_0004117 3300046543 Bacteria 9929
1496 Ga0495645_0004970 3300046543 Bacteria 9102
1497 Ga0495645_0009452 3300046543 Bacteria 6809
1498 Ga0495645_0014857 3300046543 Bacteria 5532
1499 Ga0495645_0081219 3300046543 Bacteria 2326
1500 Ga0495645_0218080 3300046543 Bacteria 1285
1501 Ga0495622_0001742 3300046557 Bacteria 10765
1502 Ga0495622_0067794 3300046557 Bacteria 1648
1503 Ga0495622_0120540 3300046557 Bacteria 1198
1504 Ga0495667_0072405 3300046559 Bacteria 2246
1505 Ga0495656_0000093 3300046615 Bacteria 38558
1506 Ga0495656_0010958 3300046615 Bacteria 3315
1507 Ga0495656_0139776 3300046615 Bacteria 1160
1508 Ga0495668_0035385 3300046616 Bacteria 2800
1509 Ga0495634_0007024 3300046642 Bacteria 8491
1510 Ga0495634_0013442 3300046642 Bacteria 5915
1511 Ga0495611_0174330 3300046648 Bacteria 1005
1512 Ga0495625_0006471 3300046660 Bacteria 10414
1513 Ga0495625_0021959 3300046660 Bacteria 4901
1514 Ga0495625_0025834 3300046660 Bacteria 4446
1515 Ga0495625_0045681 3300046660 Bacteria 3164
1516 Ga0495625_0065022 3300046660 Bacteria 2572
1517 Ga0495625_0101325 3300046660 Bacteria 1978
1518 Ga0495635_0010924 3300046663 Bacteria 6366
1519 Ga0495635_0058416 3300046663 Bacteria 2653
1520 Ga0495635_0149873 3300046663 Bacteria 1588
1521 Ga0495661_0011904 3300046665 Bacteria 5888
1522 Ga0495661_0031644 3300046665 Bacteria 3354
1523 Ga0495661_0071760 3300046665 Bacteria 2022
1524 Ga0495661_0094642 3300046665 Bacteria 1693
1525 Ga0495661_0102836 3300046665 Bacteria 1605
1526 Ga0495588_0100652 3300046674 Bacteria 1518
1527 Ga0495657_0086145 3300046675 Bacteria 2024
1528 Ga0495599_0089214 3300046678 Bacteria 1924
1529 Ga0495623_0012666 3300046679 Bacteria 5458
1530 Ga0495623_0029794 3300046679 Bacteria 3511
1531 Ga0495623_0121569 3300046679 Bacteria 1571
1532 Ga0495646_0010083 3300046680 Bacteria 6008
1533 Ga0495646_0021153 3300046680 Bacteria 4112
1534 Ga0495646_0029670 3300046680 Bacteria 3418
1535 Ga0495646_0035385 3300046680 Bacteria 3098
1536 Ga0495646_0058263 3300046680 Bacteria 2309
1537 Ga0495646_0139746 3300046680 Bacteria 1355
1538 Ga0495646_0180125 3300046680 Bacteria 1160
1539 Ga0495646_0204939 3300046680 Bacteria 1073
1540 Ga0495647_0008552 3300046681 Bacteria 3443
1541 Ga0495647_0051411 3300046681 Bacteria 1602
1542 Ga0495658_0026326 3300046683 Bacteria 3116
1543 Ga0495658_0032199 3300046683 Bacteria 2861
1544 Ga0495658_0152022 3300046683 Bacteria 1422
1545 Ga0495658_0202880 3300046683 Bacteria 1236
1546 Ga0495669_0019731 3300046684 Bacteria 2912
1547 Ga0495669_0026016 3300046684 Bacteria 2556
1548 Ga0495669_0077652 3300046684 Bacteria 1521
1549 Ga0495613_0013918 3300046689 Bacteria 5969
1550 Ga0495613_0016988 3300046689 Bacteria 5416
1551 Ga0495613_0068051 3300046689 Bacteria 2598
1552 Ga0495613_0269178 3300046689 Bacteria 1185
1553 Ga0495624_0005072 3300046690 Bacteria 9522
1554 Ga0495624_0011219 3300046690 Bacteria 6161
1555 Ga0495624_0011784 3300046690 Bacteria 6002
1556 Ga0495624_0043778 3300046690 Bacteria 2855
1557 Ga0495624_0064022 3300046690 Bacteria 2298
1558 Ga0495624_0078910 3300046690 Bacteria 2041
1559 Ga0495624_0099729 3300046690 Bacteria 1788
1560 Ga0495670_0043719 3300046691 Bacteria 2236
1561 Ga0495670_0073490 3300046691 Bacteria 1733
1562 Ga0495671_0010188 3300046692 Bacteria 5220
1563 Ga0495671_0142773 3300046692 Bacteria 1166
1564 Ga0495649_0011823 3300046694 Bacteria 5105
1565 Ga0495649_0013874 3300046694 Bacteria 4633
1566 Ga0495649_0015693 3300046694 Bacteria 4306
1567 Ga0495589_0007925 3300046794 Bacteria 5564
1568 Ga0495589_0015293 3300046794 Bacteria 3951
1569 Ga0495589_0015460 3300046794 Bacteria 3927
1570 Ga0495589_0016034 3300046794 Bacteria 3850
1571 Ga0495589_0045458 3300046794 Bacteria 2181
1572 Ga0495589_0103082 3300046794 Bacteria 1379
1573 Ga0495600_0013023 3300046809 Bacteria 5217
1574 Ga0495600_0026069 3300046809 Bacteria 3770
1575 Ga0495660_0020091 3300046810 Bacteria 3831
1576 Ga0495660_0177360 3300046810 Bacteria 1033
1577 Ga0495581_0002940 3300047315 Bacteria 9747
1578 Ga0495581_0005503 3300047315 Bacteria 7332
1579 Ga0495581_0009878 3300047315 Bacteria 5521
1580 Ga0495604_0013068 3300047317 Bacteria 6615
1581 Ga0495604_0019673 3300047317 Bacteria 5401
1582 Ga0495604_0024834 3300047317 Bacteria 4780
1583 Ga0495604_0072231 3300047317 Bacteria 2608
1584 Ga0495604_0194812 3300047317 Bacteria 1410
1585 Ga0495674_0008675 3300047319 Bacteria 9666
1586 Ga0495674_0010569 3300047319 Bacteria 8735
1587 Ga0495674_0021217 3300047319 Bacteria 6009
1588 Ga0495674_0029278 3300047319 Bacteria 5017
1589 Ga0495674_0239839 3300047319 Bacteria 1494
1590 Ga0495674_0359172 3300047319 Bacteria 1181
1591 Ga0495672_0023709 3300047320 Bacteria 3965
1592 Ga0495672_0031388 3300047320 Bacteria 3316
1593 Ga0495672_0033899 3300047320 Bacteria 3161
1594 Ga0495676_0023336 3300047321 Bacteria 5371
1595 Ga0495676_0058404 3300047321 Bacteria 3035
1596 Ga0495676_0190340 3300047321 Bacteria 1431
1597 Ga0495680_0011744 3300047322 Bacteria 7737
1598 Ga0495680_0015810 3300047322 Bacteria 6496
1599 Ga0495680_0024541 3300047322 Bacteria 5000
1600 Ga0495680_0048303 3300047322 Bacteria 3342
1601 Ga0495680_0134447 3300047322 Bacteria 1814
1602 Ga0495680_0181230 3300047322 Bacteria 1520
1603 Ga0495680_0277956 3300047322 Bacteria 1181
1604 Ga0495683_0005588 3300047323 Bacteria 6968
1605 Ga0495683_0005955 3300047323 Bacteria 6697
1606 Ga0495683_0006679 3300047323 Bacteria 6285
1607 Ga0495683_0038929 3300047323 Bacteria 2405
1608 Ga0495683_0059117 3300047323 Bacteria 1902
1609 Ga0495683_0068720 3300047323 Bacteria 1742
1610 Ga0495687_000032 3300047443 Bacteria 273607
1611 Ga0495687_001691 3300047443 Bacteria 19685
1612 Ga0495687_012058 3300047443 Bacteria 4594
1613 Ga0495687_014297 3300047443 Bacteria 4092
1614 Ga0495687_038596 3300047443 Bacteria 2118
1615 Ga0495687_044618 3300047443 Bacteria 1925
1616 Ga0495675_0006553 3300047444 Bacteria 7129
1617 Ga0495675_0030790 3300047444 Bacteria 3423
1618 Ga0495675_0037162 3300047444 Bacteria 3101
1619 Ga0495675_0061024 3300047444 Bacteria 2389
1620 Ga0495675_0091183 3300047444 Bacteria 1913
1621 Ga0495679_000586 3300047446 Bacteria 25086
1622 Ga0495679_000669 3300047446 Bacteria 22427
1623 Ga0495679_004378 3300047446 Bacteria 6537
1624 Ga0495679_042073 3300047446 Bacteria 1411
1625 Ga0495673_0026935 3300047469 Bacteria 2740
1626 Ga0495673_0028020 3300047469 Bacteria 2672
1627 Ga0495681_0039739 3300047470 Bacteria 2295
1628 Ga0495681_0101385 3300047470 Bacteria 1258
1629 Ga0495684_0141066 3300047471 Bacteria 1807
1630 Ga0495686_0000038 3300047472 Bacteria 306383
1631 Ga0495686_0013865 3300047472 Bacteria 5578
1632 Ga0495686_0024032 3300047472 Bacteria 4008
1633 Ga0495593_0008362 3300047673 Bacteria 6020
1634 Ga0495593_0010775 3300047673 Bacteria 5270
1635 Ga0495593_0013043 3300047673 Bacteria 4745
1636 Ga0495593_0016025 3300047673 Bacteria 4231
1637 Ga0495593_0042652 3300047673 Bacteria 2434
1638 Ga0495593_0102908 3300047673 Bacteria 1463
1639 Ga0495593_0136877 3300047673 Bacteria 1241
1640 Ga0495602_0018226 3300048088 Bacteria 7019
1641 Ga0495602_0048561 3300048088 Bacteria 3812
1642 Ga0495602_0072648 3300048088 Bacteria 2932
1643 Ga0495602_0446021 3300048088 Bacteria 914
1644 Ga0495614_0000551 3300048089 Bacteria 15510
1645 Ga0495614_0015930 3300048089 Bacteria 3274
1646 Ga0495615_0006141 3300048090 Bacteria 2206
1647 Ga0495615_0010353 3300048090 Bacteria 1861
1648 Ga0495626_0021860 3300048091 Bacteria 3167
1649 Ga0496100_0025334 3300048903 Bacteria 3627
1650 Ga0496100_0056985 3300048903 Bacteria 2558
1651 Ga0496100_0073144 3300048903 Bacteria 2293
1652 Ga0496100_0100032 3300048903 Bacteria 1996
1653 Ga0496100_0428392 3300048903 Bacteria 1011
1654 Ga0496101_0040006 3300048904 Bacteria 3338
1655 Ga0496101_0044838 3300048904 Bacteria 3165
1656 Ga0496101_0093358 3300048904 Bacteria 2241
1657 Ga0496101_0104306 3300048904 Bacteria 2126
1658 Ga0496101_0116304 3300048904 Bacteria 2017
1659 Ga0496101_0180267 3300048904 Bacteria 1626
1660 Ga0496102_0003391 3300048905 Bacteria 13513
1661 Ga0496102_0006345 3300048905 Bacteria 10082
1662 Ga0496102_0080921 3300048905 Bacteria 2993
1663 Ga0496102_0089590 3300048905 Bacteria 2846
1664 Ga0496102_0115818 3300048905 Bacteria 2501
1665 Ga0496102_0192350 3300048905 Bacteria 1923
1666 Ga0496103_0014447 3300048906 Bacteria 4687
1667 Ga0496103_0024845 3300048906 Bacteria 3616
1668 Ga0496103_0033542 3300048906 Bacteria 3137
1669 Ga0496103_0067287 3300048906 Bacteria 2237
1670 Ga0496103_0073280 3300048906 Bacteria 2145
1671 Ga0496104_0035333 3300048907 Bacteria 4666
1672 Ga0496104_0119594 3300048907 Bacteria 2529
1673 Ga0496104_0205089 3300048907 Bacteria 1883
1674 Ga0496104_0320354 3300048907 Bacteria 1463
1675 Ga0496105_0012736 3300048908 Bacteria 6662
1676 Ga0496105_0019712 3300048908 Bacteria 5441
1677 Ga0496105_0061714 3300048908 Bacteria 3093
1678 Ga0496105_0064690 3300048908 Bacteria 3018
1679 Ga0496105_0100867 3300048908 Bacteria 2384
1680 Ga0496106_0000878 3300048909 Bacteria 21912
1681 Ga0496106_0026341 3300048909 Bacteria 4329
1682 Ga0496106_0171600 3300048909 Bacteria 1719
1683 Ga0496106_0241980 3300048909 Bacteria 1442
1684 Ga0496107_0010890 3300048910 Bacteria 6327
1685 Ga0496107_0040742 3300048910 Bacteria 3335
1686 Ga0496107_0041048 3300048910 Bacteria 3322
1687 Ga0496107_0337470 3300048910 Bacteria 1121
1688 Ga0496108_0079212 3300048911 Bacteria 2781
1689 Ga0496108_0090556 3300048911 Bacteria 2600
1690 Ga0496108_0198980 3300048911 Bacteria 1738
1691 Ga0496108_0230820 3300048911 Bacteria 1609
1692 Ga0496108_0296491 3300048911 Bacteria 1408
1693 Ga0496109_0007893 3300048912 Bacteria 9020
1694 Ga0496109_0064946 3300048912 Bacteria 3341
1695 Ga0496109_0310104 3300048912 Bacteria 1489
1696 Ga0496109_0313764 3300048912 Bacteria 1479
1697 Ga0496109_0457294 3300048912 Bacteria 1206
1698 Ga0496109_0589928 3300048912 Bacteria 1047
1699 Ga0496110_0014636 3300048913 Bacteria 6519
1700 Ga0496110_0051156 3300048913 Bacteria 3630
1701 Ga0496110_0073005 3300048913 Bacteria 3045
1702 Ga0496110_0170272 3300048913 Bacteria 1976
1703 Ga0496110_0196810 3300048913 Bacteria 1830
1704 Ga0496111_0026659 3300048914 Bacteria 4082
1705 Ga0496111_0043172 3300048914 Bacteria 3240
1706 Ga0496111_0407158 3300048914 Bacteria 1005
1707 Ga0496112_0004682 3300048915 Bacteria 11639
1708 Ga0496112_0058215 3300048915 Bacteria 3805
1709 Ga0496112_0181380 3300048915 Bacteria 2069
1710 Ga0496113_0013680 3300048916 Bacteria 5509
1711 Ga0496114_0012142 3300048917 Bacteria 6892
1712 Ga0496114_0020908 3300048917 Bacteria 5316
1713 Ga0496114_0069722 3300048917 Bacteria 2952
1714 Ga0496114_0105423 3300048917 Bacteria 2411
1715 Ga0496114_0171809 3300048917 Bacteria 1889
1716 Ga0496114_0228340 3300048917 Bacteria 1635
1717 Ga0496114_0424892 3300048917 Bacteria 1177
1718 Ga0496116_0005753 3300048919 Bacteria 11403
1719 Ga0496116_0022942 3300048919 Bacteria 4659
1720 Ga0496116_0041504 3300048919 Bacteria 3156
1721 Ga0496116_0045870 3300048919 Bacteria 2954
1722 Ga0496117_0002010 3300048920 Bacteria 26944
1723 Ga0496117_0016433 3300048920 Bacteria 6247
1724 Ga0496117_0024976 3300048920 Bacteria 4707
1725 Ga0496117_0026535 3300048920 Bacteria 4531
1726 Ga0496117_0035962 3300048920 Bacteria 3711
1727 Ga0496117_0055689 3300048920 Bacteria 2760
1728 Ga0496117_0059213 3300048920 Bacteria 2647
1729 Ga0496117_0085715 3300048920 Bacteria 2049
1730 Ga0496117_0155410 3300048920 Bacteria 1347
1731 Ga0496118_0003941 3300048921 Bacteria 18152
1732 Ga0496118_0005114 3300048921 Bacteria 15073
1733 Ga0496118_0015312 3300048921 Bacteria 7106
1734 Ga0496118_0016258 3300048921 Bacteria 6834
1735 Ga0496118_0019836 3300048921 Bacteria 5992
1736 Ga0496118_0022761 3300048921 Bacteria 5463
1737 Ga0496118_0024552 3300048921 Bacteria 5198
1738 Ga0496118_0071198 3300048921 Bacteria 2504
1739 Ga0496118_0099290 3300048921 Bacteria 1974
1740 Ga0496118_0112138 3300048921 Bacteria 1806
1741 Ga0496119_0044606 3300048922 Bacteria 2789
1742 Ga0496121_0004860 3300048924 Bacteria 17659
1743 Ga0496121_0008669 3300048924 Bacteria 11879
1744 Ga0496121_0013013 3300048924 Bacteria 8990
1745 Ga0496121_0038682 3300048924 Bacteria 4217
1746 Ga0496121_0051898 3300048924 Bacteria 3450
1747 Ga0496121_0053661 3300048924 Bacteria 3375
1748 Ga0496121_0090236 3300048924 Bacteria 2396
1749 Ga0496121_0166407 3300048924 Bacteria 1606
1750 Ga0496121_0272172 3300048924 Bacteria 1163
1751 Ga0496122_0009581 3300048925 Bacteria 10161
1752 Ga0496122_0012379 3300048925 Bacteria 8507
1753 Ga0496122_0042948 3300048925 Bacteria 3548
1754 Ga0496123_0000117 3300048926 Bacteria 161679
1755 Ga0496123_0023016 3300048926 Bacteria 4783
1756 Ga0496123_0044858 3300048926 Bacteria 3018
1757 Ga0496123_0117252 3300048926 Bacteria 1506
1758 Ga0496124_0022614 3300048927 Bacteria 5758
1759 Ga0496124_0026014 3300048927 Bacteria 5285
1760 Ga0496124_0038839 3300048927 Bacteria 4130
1761 Ga0496124_0043950 3300048927 Bacteria 3837
1762 Ga0496124_0158444 3300048927 Bacteria 1767
1763 Ga0496124_0254458 3300048927 Bacteria 1296
1764 Ga0496125_0002451 3300048928 Bacteria 24101
1765 Ga0496125_0005319 3300048928 Bacteria 14389
1766 Ga0496125_0007743 3300048928 Bacteria 11374
1767 Ga0496125_0019479 3300048928 Bacteria 6398
1768 Ga0496125_0032186 3300048928 Bacteria 4662
1769 Ga0496125_0042957 3300048928 Bacteria 3843
1770 Ga0496125_0045868 3300048928 Bacteria 3673
1771 Ga0496125_0052356 3300048928 Bacteria 3357
1772 Ga0496125_0117315 3300048928 Bacteria 1909
1773 Ga0496125_0228260 3300048928 Bacteria 1193
1774 Ga0496125_0287660 3300048928 Bacteria 1014
1775 Ga0496126_0000603 3300048929 Bacteria 67970
1776 Ga0496126_0001240 3300048929 Bacteria 41387
1777 Ga0496126_0004105 3300048929 Bacteria 17618
1778 Ga0496126_0014923 3300048929 Bacteria 7835
1779 Ga0496126_0023952 3300048929 Bacteria 5903
1780 Ga0496126_0029295 3300048929 Bacteria 5231
1781 Ga0496126_0126065 3300048929 Bacteria 2216
1782 Ga0496126_0128364 3300048929 Bacteria 2193
1783 Ga0495678_006109 3300049459 Bacteria 6478
1784 Ga0495678_035851 3300049459 Bacteria 2030
1785 Ga0495678_067499 3300049459 Bacteria 1321
1786 Ga0495682_0024930 3300049460 Bacteria 2227
1787 Ga0495682_0042308 3300049460 Bacteria 1669
1788 Ga0501031_0005202 3300049568 Bacteria 8480
1789 Ga0501032_0175735 3300049569 Bacteria 1403
1790 Ga0501034_0065293 3300049571 Bacteria 3651
1791 Ga0501034_0411784 3300049571 Bacteria 1274
1792 Ga0501036_0165854 3300049572 Bacteria 1862
1793 Ga0501036_0602221 3300049572 Bacteria 911
1794 Ga0501037_0055390 3300049573 Bacteria 2899
1795 Ga0501037_0319269 3300049573 Bacteria 1076
1796 Ga0501040_0371672 3300049576 Bacteria 1025
1797 Ga0501043_0024039 3300049579 Bacteria 4781
1798 Ga0501043_0036887 3300049579 Bacteria 3846
1799 Ga0501043_0074954 3300049579 Bacteria 2658
1800 Ga0501046_0007148 3300049580 Bacteria 9821
1801 Ga0501046_0031102 3300049580 Bacteria 4330
1802 Ga0501047_0000081 3300049581 Bacteria 122697
1803 Ga0501048_0000437 3300049582 Bacteria 29246
1804 Ga0501072_0437856 3300049588 Bacteria 1035
1805 Ga0501073_0080799 3300049589 Bacteria 2261
1806 Ga0501074_0420442 3300049590 Bacteria 948
1807 Ga0501223_002814 3300049663 Bacteria 3816
1808 Ga0501249_011852 3300049679 Bacteria 1836
1809 Ga0501253_004485 3300049683 Bacteria 1765
1810 Ga0501080_0017839 3300049742 Bacteria 6570
1811 Ga0501083_0261266 3300049744 Bacteria 1126
1812 Ga0501241_029115 3300049758 Bacteria 1039
1813 Ga0501266_001508 3300049763 Bacteria 2963
1814 Ga0501035_0089415 3300049822 Bacteria 2712
1815 Ga0501035_0089561 3300049822 Bacteria 2710
1816 Ga0501044_0013961 3300049823 Bacteria 8676
1817 Ga0501044_0300475 3300049823 Bacteria 1534
1818 nmdc:mga03683_38269_c1 3300050489 Bacteria 1958
1819 nmdc:mga03683_54218_c1 3300050489 Bacteria 1681
1820 nmdc:mga03n38_16354_c1 3300050490 Bacteria 2884
1821 nmdc:mga03n38_30797_c1 3300050490 Bacteria 2259
1822 nmdc:mga03n38_40034_c1 3300050490 Bacteria 2035
1823 nmdc:mga03n38_7921_c1 3300050490 Bacteria 3782
1824 nmdc:mga00v17_109294_c1 3300050491 Bacteria 1753
1825 nmdc:mga00v17_56127_c1 3300050491 Bacteria 2407
1826 nmdc:mga00v17_58310_c1 3300050491 Bacteria 2365
1827 nmdc:mga00v17_76948_c1 3300050491 Bacteria 2077
1828 nmdc:mga0yw44_120510_c1 3300050492 Bacteria 1689
1829 nmdc:mga0yw44_21049_c1 3300050492 Bacteria 3632
1830 nmdc:mga0yw44_27186_c1 3300050492 Bacteria 3275
1831 nmdc:mga0yw44_76991_c1 3300050492 Bacteria 2083
1832 nmdc:mga0k408_102881_c1 3300050493 Bacteria 1685
1833 nmdc:mga0k408_106608_c1 3300050493 Bacteria 1655
1834 nmdc:mga0k408_11020_c1 3300050493 Bacteria 4909
1835 nmdc:mga0k408_120148_c1 3300050493 Bacteria 1556
1836 nmdc:mga0k408_14765_c1 3300050493 Bacteria 4309
1837 nmdc:mga0k408_15277_c1 3300050493 Bacteria 4243
1838 nmdc:mga0k408_158278_c1 3300050493 Bacteria 1349
1839 nmdc:mga0k408_178034_c1 3300050493 Bacteria 1268
1840 nmdc:mga0k408_180_c1 3300050493 Bacteria 33189
1841 nmdc:mga0k408_1901_c1 3300050493 Bacteria 11173
1842 nmdc:mga0k408_23223_c1 3300050493 Bacteria 3497
1843 nmdc:mga0k408_295857_c1 3300050493 Bacteria 966
1844 nmdc:mga0k408_31153_c1 3300050493 Bacteria 3043
1845 nmdc:mga0k408_65204_c1 3300050493 Bacteria 2120
1846 nmdc:mga0k408_84308_c1 3300050493 Bacteria 1864
1847 nmdc:mga06z11_103636_c1 3300050494 Bacteria 1565
1848 nmdc:mga06z11_207030_c1 3300050494 Bacteria 1142
1849 nmdc:mga06z11_230060_c1 3300050494 Bacteria 1086
1850 nmdc:mga06z11_83259_c1 3300050494 Bacteria 1721
1851 nmdc:mga04h51_27958_c1 3300050495 Bacteria 1756
1852 nmdc:mga07m45_1080_c2 3300050496 Bacteria 9686
1853 nmdc:mga07m45_137244_c1 3300050496 Bacteria 1416
1854 nmdc:mga07m45_14573_c1 3300050496 Bacteria 4192
1855 nmdc:mga07m45_16829_c1 3300050496 Bacteria 3918
1856 nmdc:mga07m45_189577_c1 3300050496 Bacteria 1196
1857 nmdc:mga07m45_202571_c1 3300050496 Bacteria 1155
1858 nmdc:mga07m45_28123_c1 3300050496 Bacteria 3103
1859 nmdc:mga07m45_31773_c1 3300050496 Bacteria 2926
1860 nmdc:mga07m45_38713_c1 3300050496 Bacteria 2662
1861 nmdc:mga07m45_39928_c1 3300050496 Bacteria 2625
1862 nmdc:mga07m45_44985_c1 3300050496 Bacteria 2478
1863 nmdc:mga07m45_4613_c1 3300050496 Bacteria 6756
1864 nmdc:mga07m45_56660_c1 3300050496 Bacteria 2215
1865 nmdc:mga07m45_5876_c1 3300050496 Bacteria 6159
1866 nmdc:mga07m45_7867_c1 3300050496 Bacteria 5457
1867 nmdc:mga07m45_8525_c1 3300050496 Bacteria 5275
1868 nmdc:mga07m45_96921_c1 3300050496 Bacteria 1692
1869 nmdc:mga07m45_99997_c1 3300050496 Bacteria 1665
1870 nmdc:mga05p37_118730_c1 3300050507 Bacteria 3249
1871 nmdc:mga05p37_122733_c1 3300050507 Bacteria 3191
1872 nmdc:mga09592_105364_c1 3300050508 Bacteria 2418
1873 nmdc:mga09592_11912_c1 3300050508 Bacteria 7074
1874 nmdc:mga09592_280982_c1 3300050508 Bacteria 1444
1875 nmdc:mga0qj67_20345_c1 3300050509 Bacteria 5078
1876 nmdc:mga0qj67_261960_c1 3300050509 Bacteria 1402
1877 nmdc:mga0qj67_6586_c1 3300050509 Bacteria 8532
1878 nmdc:mga06r32_8110_c1 3300050510 Bacteria 9447
1879 nmdc:mga08y16_33703_c1 3300050511 Bacteria 5378
1880 nmdc:mga08y16_473894_c1 3300050511 Bacteria 1274
1881 nmdc:mga0sz30_138823_c1 3300050516 Bacteria 1073
1882 Ga0500610_0017443 3300053079 Bacteria 3449
1883 Ga0500635_0002933 3300053080 Bacteria 4244
1884 Ga0495595_0053991 3300053084 Bacteria 1868
1885 Ga0500578_0005345 3300053086 Bacteria 8753
1886 Ga0500643_033823 3300053087 Bacteria 1543
1887 Ga0500644_0034829 3300053088 Bacteria 1627
1888 Ga0500644_0041826 3300053088 Bacteria 1524
1889 Ga0500646_0006795 3300053090 Bacteria 2911
1890 Ga0500583_0069455 3300053092 Bacteria 1682
1891 Ga0500651_0001184 3300053093 Bacteria 12929
1892 Ga0500651_0105421 3300053093 Bacteria 1725
1893 Ga0500566_0042570 3300053094 Bacteria 2620
1894 Ga0500641_0033526 3300053096 Bacteria 2039
1895 Ga0500641_0157497 3300053096 Bacteria 980
1896 Ga0500562_009775 3300053108 Bacteria 2426
1897 Ga0500571_010204 3300053110 Bacteria 5186
1898 Ga0500592_002516 3300053116 Bacteria 2946
1899 Ga0500593_004248 3300053117 Bacteria 5529
1900 Ga0500593_005007 3300053117 Bacteria 5179
1901 Ga0500594_0002887 3300053118 Bacteria 3748
1902 Ga0500607_004076 3300053121 Bacteria 10228
1903 Ga0500607_157388 3300053121 Bacteria 1043
1904 Ga0500608_052891 3300053122 Bacteria 1950
1905 Ga0500618_005216 3300053125 Bacteria 3993
1906 Ga0500618_024938 3300053125 Bacteria 1437
1907 Ga0500628_013528 3300053129 Bacteria 1525
1908 Ga0500642_0032245 3300053130 Bacteria 2197
1909 Ga0500652_001096 3300053131 Bacteria 8741
1910 Ga0500652_061228 3300053131 Bacteria 1550
1911 Ga0500655_000973 3300053133 Bacteria 5518
1912 Ga0500655_003694 3300053133 Bacteria 2757
1913 Ga0500658_0014450 3300053134 Bacteria 2922
1914 Ga0500658_0014484 3300053134 Bacteria 2919
1915 Ga0500559_0000019 3300053136 Bacteria 134862
1916 Ga0500559_0006560 3300053136 Bacteria 5250
1917 Ga0500559_0008187 3300053136 Bacteria 4597
1918 Ga0500559_0040403 3300053136 Bacteria 2031
1919 Ga0500559_0056979 3300053136 Bacteria 1735
1920 Ga0500564_065220 3300053138 Bacteria 1648
1921 Ga0500564_074841 3300053138 Bacteria 1524
1922 Ga0500568_0004052 3300053139 Bacteria 7934
1923 Ga0500568_0019868 3300053139 Bacteria 2912
1924 Ga0500568_0049311 3300053139 Bacteria 1662
1925 Ga0500568_0053770 3300053139 Bacteria 1577
1926 Ga0500574_003820 3300053141 Bacteria 2723
1927 Ga0500616_0008283 3300053153 Bacteria 6474
1928 Ga0500619_000136 3300053154 Bacteria 18807
1929 Ga0500622_0000279 3300053156 Bacteria 52053
1930 Ga0500622_0001954 3300053156 Bacteria 15525
1931 Ga0500622_0115321 3300053156 Bacteria 1308
1932 Ga0500624_003773 3300053157 Bacteria 1986
1933 Ga0500627_0030706 3300053158 Bacteria 2251
1934 Ga0500638_032571 3300053162 Bacteria 2517
1935 Ga0500636_0009113 3300053177 Bacteria 5767
1936 Ga0500636_0092456 3300053177 Bacteria 1731
1937 Ga0500570_078721 3300053724 Bacteria 1497
1938 Ga0500570_108423 3300053724 Bacteria 1137
1939 Ga0500625_112485 3300053729 Bacteria 1114
1940 Ga0500645_002482 3300053730 Bacteria 8186
1941 Ga0500645_002742 3300053730 Bacteria 7636
1942 Ga0500645_006573 3300053730 Bacteria 4129
1943 Ga0500645_065739 3300053730 Bacteria 1044
1944 Ga0500587_001577 3300053739 Bacteria 3243
1945 Ga0500661_008532 3300055283 Bacteria 1885
1946 Ga0590075_023637 3300059424 Bacteria 1541
1947 Ga0590075_029114 3300059424 Bacteria 1395
1948 Ga0590077_030573 3300059426 Bacteria 1175
1949 Ga0501082_0221316 3300060353 Bacteria 1647
1950 Ga0466962_0002133 3300061719 Bacteria 9343
1951 Ga0466962_0008013 3300061719 Bacteria 5066
1952 Ga0466962_0009252 3300061719 Bacteria 4719
1953 Ga0466962_0013511 3300061719 Bacteria 3930
1954 Ga0466962_0014733 3300061719 Bacteria 3768
1955 Ga0466962_0207580 3300061719 Bacteria 958

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0602221 Ga0501036_0602221_80_892 259
2 3300049822 Ga0501035_0089415 Ga0501035_0089415_16_828 259
3 3300046471 Ga0495650_0025076 Ga0495650_0025076_1947_2792 267
4 3300046516 Ga0495628_0168601 Ga0495628_0168601_791_1636 267
5 3300047323 Ga0495683_0038929 Ga0495683_0038929_1532_2377 267
6 3300047446 Ga0495679_042073 Ga0495679_042073_26_871 267
7 3300048088 Ga0495602_0446021 Ga0495602_0446021_25_870 267
8 3300049572 Ga0501036_0165854 Ga0501036_0165854_24_863 269
9 3300050508 nmdc:mga09592_105364_c1 nmdc:mga09592_105364_c1_1557_2396 269
10 3300009101 Ga0105247_10059547 Ga0105247_100595472 273
11 3300014326 Ga0157380_10002464 Ga0157380_1000246410 273
12 3300025908 Ga0207643_10246663 Ga0207643_102466631 273
13 3300046460 Ga0495638_0001279 Ga0495638_0001279_3306_4319 273
14 3300048921 Ga0496118_0112138 Ga0496118_0112138_149_1114 273
15 3300046557 Ga0495622_0120540 Ga0495622_0120540_350_1180 275
16 3300048914 Ga0496111_0407158 Ga0496111_0407158_163_993 275
17 3300050508 nmdc:mga09592_280982_c1 nmdc:mga09592_280982_c1_573_1427 282
18 iso_pu_bacteria 2842733646 2842734028 282
19 iso_pu_bacteria 2928037797 2928042808 282
20 iso_pu_bacteria 2929520902 2929521608 282
21 3300001979 JGI24740J21852_10021639 JGI24740J21852_100216394 284
22 3300039447 Ga0436361_0327454 Ga0436361_0327454_17_916 284
23 3300044658 Ga0466972_0192277 Ga0466972_0192277_44_940 284
24 3300046690 Ga0495624_0078910 Ga0495624_0078910_12_908 284
25 3300042876 Ga0451577_0230250 Ga0451577_0230250_765_1658 286
26 3300042876 Ga0451577_0544344 Ga0451577_0544344_108_998 286
27 3300049573 Ga0501037_0319269 Ga0501037_0319269_130_1023 286
28 3300049576 Ga0501040_0371672 Ga0501040_0371672_39_932 286
29 3300049588 Ga0501072_0437856 Ga0501072_0437856_114_1007 286
30 3300053121 Ga0500607_157388 Ga0500607_157388_32_892 286
31 3300053730 Ga0500645_065739 Ga0500645_065739_155_1015 286
32 3300048909 Ga0496106_0171600 Ga0496106_0171600_247_1143 287
33 3300042876 Ga0451577_0030668 Ga0451577_0030668_1414_2322 288
34 3300046533 Ga0495640_0143765 Ga0495640_0143765_506_1375 288
35 iso_pu_bacteria 2919704043 2919706240 289
36 3300006353 Ga0075370_10008610 Ga0075370_100086105 291
37 3300050496 nmdc:mga07m45_28123_c1 nmdc:mga07m45_28123_c1_1826_2737 291
38 iso_pu_bacteria 2643221644 2644246865 291
39 iso_pu_bacteria 2881101125 2881103102 291
40 3300035695 Ga0373927_0000001 Ga0373927_0000001_963114_964031 292
41 iso_pu_bacteria 2721755523 2722885660 292
42 iso_pu_bacteria 2839138175 2839142178 292
43 3300005327 Ga0070658_10029174 Ga0070658_100291745 293
44 3300025909 Ga0207705_10028977 Ga0207705_100289772 293
45 3300037466 Ga0395898_0075544 Ga0395898_0075544_1890_2771 293
46 3300037471 Ga0395905_0047693 Ga0395905_0047693_369_1250 293
47 3300037471 Ga0395905_0176063 Ga0395905_0176063_241_1152 293
48 3300037471 Ga0395905_0287098 Ga0395905_0287098_537_1418 293
49 3300042157 Ga0439458_0021265 Ga0439458_0021265_340_1251 293
50 3300046615 Ga0495656_0010958 Ga0495656_0010958_216_1097 293
51 3300046660 Ga0495625_0101325 Ga0495625_0101325_37_918 293
52 iso_pu_bacteria 2513237166 2514046149 293
53 iso_pu_bacteria 2547132374 2548501499 293
54 iso_pu_bacteria 2562617112 2563061766 293
55 iso_pu_bacteria 2643221609 2644059276 293
56 iso_pu_bacteria 2643221611 2644075686 293
57 iso_pu_bacteria 2643221717 2644645213 293
58 iso_pu_bacteria 2711768613 2713478400 293
59 iso_pu_bacteria 2738543012 2739240770 293
60 iso_pu_bacteria 2791355137 2792835767 293
61 iso_pu_bacteria 2816332133 2816472151 293
62 iso_pu_bacteria 2842718218 2842718390 293
63 iso_pu_bacteria 2894023352 2894027353 293
64 iso_pu_bacteria 2904615490 2904619017 293
65 iso_pu_bacteria 2921643360 2921653483 293
66 iso_pu_bacteria 2939631187 2939635522 293
67 iso_pu_bacteria 2974320154 2974320646 293
68 iso_pu_bacteria 642555112 642594423 293
69 3300031247 Ga0265340_10006548 Ga0265340_100065482 294
70 3300031548 Ga0307408_100069075 Ga0307408_1000690752 294
71 3300032002 Ga0307416_100022955 Ga0307416_1000229554 294
72 3300050509 nmdc:mga0qj67_261960_c1 nmdc:mga0qj67_261960_c1_39_1004 294
73 iso_pu_bacteria 2501025502 2501081589 294
74 iso_pu_bacteria 2501025504 2501407922 294
75 iso_pu_bacteria 2510065045 2510252377 294
76 iso_pu_bacteria 2510917013 2511085528 294
77 iso_pu_bacteria 2510917014 2511095669 294
78 iso_pu_bacteria 2510917015 2511103578 294
79 iso_pu_bacteria 2512047030 2512344698 294
80 iso_pu_bacteria 2513237082 2513556986 294
81 iso_pu_bacteria 2513237083 2513564518 294
82 iso_pu_bacteria 2513237151 2513963005 294
83 iso_pu_bacteria 2515154122 2515682482 294
84 iso_pu_bacteria 2515154123 2515690342 294
85 iso_pu_bacteria 2515154189 2516023748 294
86 iso_pu_bacteria 2519103095 2519457750 294
87 iso_pu_bacteria 2526164713 2527080119 294
88 iso_pu_bacteria 2582581311 2585294563 294
89 iso_pu_bacteria 2599185239 2599736870 294
90 iso_pu_bacteria 2599185240 2599743010 294
91 iso_pu_bacteria 2599185355 2600205128 294
92 iso_pu_bacteria 2600255067 2600813727 294
93 iso_pu_bacteria 2643221570 2643867265 294
94 iso_pu_bacteria 2643221596 2643990183 294
95 iso_pu_bacteria 2643221652 2644295673 294
96 iso_pu_bacteria 2675903129 2676742117 294
97 iso_pu_bacteria 2718217991 2719641469 294
98 iso_pu_bacteria 2738541296 2738824424 294
99 iso_pu_bacteria 2738541298 2738836833 294
100 iso_pu_bacteria 2738541306 2738878364 294
101 iso_pu_bacteria 2738543002 2739190056 294
102 iso_pu_bacteria 2738543008 2739224957 294
103 iso_pu_bacteria 2744054900 2746088886 294
104 iso_pu_bacteria 2744054901 2746096488 294
105 iso_pu_bacteria 2751185846 2753569610 294
106 iso_pu_bacteria 2808606384 2808971716 294
107 iso_pu_bacteria 2808606390 2809006545 294
108 iso_pu_bacteria 2808606391 2809013537 294
109 iso_pu_bacteria 2816332253 2817259937 294
110 iso_pu_bacteria 2816332256 2817277600 294
111 iso_pu_bacteria 2816332286 2817456987 294
112 iso_pu_bacteria 2818991450 2819623463 294
113 iso_pu_bacteria 2818991452 2819632371 294
114 iso_pu_bacteria 2842324504 2842324560 294
115 iso_pu_bacteria 2842348783 2842348839 294
116 iso_pu_bacteria 2842454564 2842457455 294
117 iso_pu_bacteria 2856287931 2856290930 294
118 iso_pu_bacteria 2857357740 2857363677 294
119 iso_pu_bacteria 2863421361 2863421415 294
120 iso_pu_bacteria 2870068957 2870069157 294
121 iso_pu_bacteria 2883087390 2883095334 294
122 iso_pu_bacteria 2885270888 2885279725 294
123 iso_pu_bacteria 2900634093 2900637274 294
124 iso_pu_bacteria 2902682994 2902691251 294
125 iso_pu_bacteria 2904483920 2904487893 294
126 iso_pu_bacteria 2904564687 2904565596 294
127 iso_pu_bacteria 2904571731 2904572639 294
128 iso_pu_bacteria 2919527303 2919529197 294
129 iso_pu_bacteria 2928108538 2928113608 294
130 iso_pu_bacteria 2928135762 2928140679 294
131 iso_pu_bacteria 2928157003 2928159996 294
132 iso_pu_bacteria 2928163908 2928163963 294
133 iso_pu_bacteria 2928170801 2928177181 294
134 iso_pu_bacteria 2928503688 2928506204 294
135 iso_pu_bacteria 2928536128 2928538838 294
136 iso_pu_bacteria 2945934425 2945938172 294
137 iso_pu_bacteria 2981990288 2981994437 294
138 iso_pu_bacteria 2990703756 2990705110 294
139 iso_pu_bacteria 2990710928 2990711098 294
140 iso_pu_bacteria 641736151 642426165 294
141 iso_pu_bacteria 641736154 642416972 294
142 iso_pu_bacteria 642555113 642623004 294
143 iso_pu_bacteria 8003955200 8003960983 294
144 iso_pu_bacteria 8018845410 8018849505 294
145 iso_pu_bacteria 8020807995 8020809947 294
146 iso_pu_bacteria 8020938398 8020939501 294
147 iso_pu_bacteria 8020945358 8020947548 294
148 iso_pu_bacteria 8020953355 8020953917 294
149 iso_pu_bacteria 8021120328 8021126888 294
150 iso_pu_bacteria 8039098773 8039099828 294
151 iso_pu_bacteria 8040167225 8040170859 294
152 iso_pu_bacteria 8040173305 8040175227 294
153 iso_pu_bacteria 8055266321 8055267477 294
154 iso_pu_bacteria 8055301274 8055308192 294
155 3300005344 Ga0070661_100000191 Ga0070661_10000019115 295
156 3300005354 Ga0070675_100173236 Ga0070675_1001732362 295
157 3300005356 Ga0070674_100076248 Ga0070674_1000762482 295
158 3300005366 Ga0070659_100001083 Ga0070659_10000108314 295
159 3300005456 Ga0070678_100027759 Ga0070678_1000277593 295
160 3300005548 Ga0070665_100046807 Ga0070665_1000468073 295
161 3300005564 Ga0070664_100001381 Ga0070664_10000138115 295
162 3300005564 Ga0070664_100053568 Ga0070664_1000535682 295
163 3300025909 Ga0207705_10331886 Ga0207705_103318862 295
164 3300025932 Ga0207690_10001370 Ga0207690_1000137012 295
165 3300025945 Ga0207679_10000313 Ga0207679_1000031329 295
166 3300025945 Ga0207679_10040602 Ga0207679_100406024 295
167 3300026121 Ga0207683_10043980 Ga0207683_100439803 295
168 3300027614 Ga0209970_1002523 Ga0209970_10025233 295
169 3300027876 Ga0209974_10009195 Ga0209974_100091952 295
170 3300027876 Ga0209974_10030664 Ga0209974_100306642 295
171 3300031235 Ga0265330_10000044 Ga0265330_1000004411 295
172 3300031238 Ga0265332_10000046 Ga0265332_1000004685 295
173 3300031247 Ga0265340_10030289 Ga0265340_100302892 295
174 3300031711 Ga0265314_10000130 Ga0265314_1000013011 295
175 3300037312 Ga0395899_0029971 Ga0395899_0029971_907_1794 295
176 3300037418 Ga0395900_0099142 Ga0395900_0099142_1458_2345 295
177 3300037466 Ga0395898_0008920 Ga0395898_0008920_1324_2211 295
178 3300037466 Ga0395898_0012459 Ga0395898_0012459_7501_8388 295
179 3300037471 Ga0395905_0000088 Ga0395905_0000088_61261_62148 295
180 3300037471 Ga0395905_0007574 Ga0395905_0007574_7236_8123 295
181 3300037471 Ga0395905_0009071 Ga0395905_0009071_8367_9254 295
182 3300037471 Ga0395905_0018061 Ga0395905_0018061_1103_1990 295
183 3300037471 Ga0395905_0047000 Ga0395905_0047000_176_1063 295
184 3300038443 Ga0395901_0048381 Ga0395901_0048381_2082_2969 295
185 3300038443 Ga0395901_0079879 Ga0395901_0079879_709_1596 295
186 3300038443 Ga0395901_0277142 Ga0395901_0277142_459_1346 295
187 3300039437 Ga0436365_1657226 Ga0436365_1657226_294_1223 295
188 3300042121 Ga0450919_003028 Ga0450919_003028_817_1707 295
189 3300042122 Ga0450920_005654 Ga0450920_005654_200_1090 295
190 3300042531 Ga0450918_000014 Ga0450918_000014_3198_4088 295
191 3300044656 Ga0466969_0015995 Ga0466969_0015995_2300_3187 295
192 3300044666 Ga0466977_0001419 Ga0466977_0001419_3591_4517 295
193 3300044684 Ga0466966_0024309 Ga0466966_0024309_2563_3450 295
194 3300044693 Ga0466961_0005894 Ga0466961_0005894_4378_5265 295
195 3300044765 Ga0466970_0036442 Ga0466970_0036442_1306_2193 295
196 3300045049 Ga0466959_0016377 Ga0466959_0016377_2104_2991 295
197 3300045836 Ga0466958_0156798 Ga0466958_0156798_303_1190 295
198 3300046522 Ga0495643_0074946 Ga0495643_0074946_177_1064 295
199 3300048909 Ga0496106_0000878 Ga0496106_0000878_7642_8574 295
200 3300048924 Ga0496121_0004860 Ga0496121_0004860_10584_11516 295
201 3300049569 Ga0501032_0175735 Ga0501032_0175735_250_1137 295
202 3300049571 Ga0501034_0065293 Ga0501034_0065293_2664_3551 295
203 3300049579 Ga0501043_0036887 Ga0501043_0036887_2302_3189 295
204 3300049579 Ga0501043_0074954 Ga0501043_0074954_380_1306 295
205 3300049580 Ga0501046_0007148 Ga0501046_0007148_2693_3580 295
206 3300049589 Ga0501073_0080799 Ga0501073_0080799_1341_2228 295
207 3300049590 Ga0501074_0420442 Ga0501074_0420442_11_898 295
208 3300049742 Ga0501080_0017839 Ga0501080_0017839_2767_3654 295
209 3300049823 Ga0501044_0013961 Ga0501044_0013961_1374_2261 295
210 3300061719 Ga0466962_0207580 Ga0466962_0207580_26_913 295
211 iso_pu_bacteria 2932422444 2932425450 295
212 3300003792 Ga0055540_1008596 Ga0055540_10085962 296
213 3300003794 Ga0055531_10002832 Ga0055531_100028329 296
214 3300005327 Ga0070658_10043608 Ga0070658_100436083 296
215 3300005331 Ga0070670_100070179 Ga0070670_1000701791 296
216 3300005336 Ga0070680_100124631 Ga0070680_1001246312 296
217 3300005338 Ga0068868_100025882 Ga0068868_1000258822 296
218 3300005338 Ga0068868_100098794 Ga0068868_1000987943 296
219 3300005339 Ga0070660_100006575 Ga0070660_1000065757 296
220 3300005435 Ga0070714_100152907 Ga0070714_1001529072 296
221 3300005530 Ga0070679_100004721 Ga0070679_1000047211 296
222 3300005618 Ga0068864_100017095 Ga0068864_1000170956 296
223 3300005841 Ga0068863_100031384 Ga0068863_1000313843 296
224 3300006038 Ga0075365_10005806 Ga0075365_100058064 296
225 3300006042 Ga0075368_10024726 Ga0075368_100247262 296
226 3300006048 Ga0075363_100005789 Ga0075363_1000057894 296
227 3300006195 Ga0075366_10034583 Ga0075366_100345832 296
228 3300006946 Ga0079104_1000037 Ga0079104_100003766 296
229 3300009098 Ga0105245_10157375 Ga0105245_101573752 296
230 3300009148 Ga0105243_10001616 Ga0105243_1000161610 296
231 3300009551 Ga0105238_10026268 Ga0105238_100262683 296
232 3300025303 Ga0209051_1000025 Ga0209051_1000025321 296
233 3300025304 Ga0209257_1000039 Ga0209257_1000039287 296
234 3300025913 Ga0207695_10158719 Ga0207695_101587192 296
235 3300025935 Ga0207709_10000167 Ga0207709_1000016757 296
236 3300025941 Ga0207711_10229225 Ga0207711_102292252 296
237 3300025942 Ga0207689_10110561 Ga0207689_101105612 296
238 3300025949 Ga0207667_10207931 Ga0207667_102079312 296
239 3300025949 Ga0207667_10278800 Ga0207667_102788002 296
240 3300026023 Ga0207677_10020334 Ga0207677_100203343 296
241 3300026088 Ga0207641_10044755 Ga0207641_100447553 296
242 3300026095 Ga0207676_10553251 Ga0207676_105532512 296
243 3300026116 Ga0207674_10219631 Ga0207674_102196312 296
244 3300027111 Ga0209281_1000002 Ga0209281_1000002850 296
245 3300031238 Ga0265332_10004610 Ga0265332_100046106 296
246 3300031250 Ga0265331_10028127 Ga0265331_100281273 296
247 3300031711 Ga0265314_10002601 Ga0265314_100026018 296
248 3300031911 Ga0307412_10263091 Ga0307412_102630912 296
249 3300031911 Ga0307412_10359582 Ga0307412_103595822 296
250 3300037312 Ga0395899_0002984 Ga0395899_0002984_4863_5768 296
251 3300037312 Ga0395899_0145400 Ga0395899_0145400_139_1035 296
252 3300037418 Ga0395900_0006516 Ga0395900_0006516_10983_11888 296
253 3300037418 Ga0395900_0162784 Ga0395900_0162784_599_1495 296
254 3300037466 Ga0395898_0113131 Ga0395898_0113131_278_1183 296
255 3300038443 Ga0395901_0003137 Ga0395901_0003137_10587_11492 296
256 3300038443 Ga0395901_0025819 Ga0395901_0025819_891_1787 296
257 3300041406 Ga0439439_0009114 Ga0439439_0009114_956_1852 296
258 3300041997 Ga0439431_0040775 Ga0439431_0040775_54_956 296
259 3300042007 Ga0439449_0003281 Ga0439449_0003281_2586_3482 296
260 3300042185 Ga0450909_005002 Ga0450909_005002_383_1285 296
261 3300044673 Ga0453683_0005267 Ga0453683_0005267_5864_6760 296
262 3300044693 Ga0466961_0121724 Ga0466961_0121724_651_1547 296
263 3300044842 Ga0466957_0138205 Ga0466957_0138205_357_1253 296
264 3300045051 Ga0451576_0004140 Ga0451576_0004140_17416_18312 296
265 3300048090 Ga0495615_0006141 Ga0495615_0006141_1022_1918 296
266 3300050492 nmdc:mga0yw44_120510_c1 nmdc:mga0yw44_120510_c1_493_1389 296
267 3300050493 nmdc:mga0k408_31153_c1 nmdc:mga0k408_31153_c1_919_1827 296
268 3300059424 Ga0590075_029114 Ga0590075_029114_258_1160 296
269 iso_pu_bacteria 2511231002 2511243596 296
270 iso_pu_bacteria 2513020051 2513228292 296
271 iso_pu_bacteria 2585428057 2587725673 296
272 iso_pu_bacteria 2585428058 2587735108 296
273 iso_pu_bacteria 2585428062 2587754098 296
274 iso_pu_bacteria 2588253510 2588290604 296
275 iso_pu_bacteria 2599185214 2599620842 296
276 iso_pu_bacteria 2599185226 2599674352 296
277 iso_pu_bacteria 2599185227 2599678542 296
278 iso_pu_bacteria 2599185229 2599690353 296
279 iso_pu_bacteria 2643221592 2643968318 296
280 iso_pu_bacteria 2643221625 2644143529 296
281 iso_pu_bacteria 2643221628 2644161368 296
282 iso_pu_bacteria 2643221648 2644272096 296
283 iso_pu_bacteria 2643221654 2644301334 296
284 iso_pu_bacteria 2643221658 2644324085 296
285 iso_pu_bacteria 2643221660 2644338585 296
286 iso_pu_bacteria 2643221672 2644400729 296
287 iso_pu_bacteria 2643221683 2644465968 296
288 iso_pu_bacteria 2738541277 2738720693 296
289 iso_pu_bacteria 2738541307 2738882293 296
290 iso_pu_bacteria 2738543013 2739251940 296
291 iso_pu_bacteria 2738543019 2739279892 296
292 iso_pu_bacteria 2818991446 2819601966 296
293 iso_pu_bacteria 2831265667 2831269795 296
294 iso_pu_bacteria 2838054893 2838055187 296
295 iso_pu_bacteria 2842677519 2842680882 296
296 iso_pu_bacteria 2842747753 2842749692 296
297 iso_pu_bacteria 2885192300 2885196723 296
298 iso_pu_bacteria 2885198086 2885201815 296
299 iso_pu_bacteria 2885211737 2885215475 296
300 iso_pu_bacteria 2899924645 2899927277 296
301 iso_pu_bacteria 2904434214 2904438477 296
302 iso_pu_bacteria 2904449895 2904453968 296
303 iso_pu_bacteria 2904456579 2904459494 296
304 iso_pu_bacteria 2904541872 2904549914 296
305 iso_pu_bacteria 2919462493 2919465453 296
306 iso_pu_bacteria 2928044640 2928048765 296
307 iso_pu_bacteria 2928051484 2928055097 296
308 iso_pu_bacteria 2928064002 2928068523 296
309 iso_pu_bacteria 2928070936 2928073570 296
310 iso_pu_bacteria 2928084124 2928089727 296
311 iso_pu_bacteria 2928115317 2928117222 296
312 iso_pu_bacteria 2929160207 2929161345 296
313 iso_pu_bacteria 2945909444 2945914189 296
314 iso_pu_bacteria 2945945610 2945949758 296
315 iso_pu_bacteria 2945972063 2945973779 296
316 iso_pu_bacteria 2945984333 2945990427 296
317 iso_pu_bacteria 2954767861 2954770631 296
318 3300003322 rootL2_10068878 rootL2_100688782 297
319 3300003354 JGI25160J50197_1000267 JGI25160J50197_10002672 297
320 3300005262 Ga0065165_1001067 Ga0065165_10010672 297
321 3300005328 Ga0070676_10002353 Ga0070676_100023533 297
322 3300005338 Ga0068868_100247283 Ga0068868_1002472832 297
323 3300005354 Ga0070675_100019134 Ga0070675_1000191344 297
324 3300005355 Ga0070671_100232875 Ga0070671_1002328752 297
325 3300005364 Ga0070673_100094230 Ga0070673_1000942302 297
326 3300005367 Ga0070667_100061297 Ga0070667_1000612973 297
327 3300005456 Ga0070678_100159634 Ga0070678_1001596342 297
328 3300005577 Ga0068857_100157185 Ga0068857_1001571852 297
329 3300006051 Ga0075364_10060248 Ga0075364_100602482 297
330 3300009011 Ga0105251_10039285 Ga0105251_100392852 297
331 3300009148 Ga0105243_10173558 Ga0105243_101735582 297
332 3300009176 Ga0105242_10009890 Ga0105242_100098903 297
333 3300016635 Ga0183361_10012 Ga0183361_10012161 297
334 3300025295 Ga0209564_1005340 Ga0209564_10053402 297
335 3300025302 Ga0207426_1000037 Ga0207426_100003758 297
336 3300025907 Ga0207645_10026582 Ga0207645_100265824 297
337 3300025926 Ga0207659_10008170 Ga0207659_100081704 297
338 3300025931 Ga0207644_10163053 Ga0207644_101630531 297
339 3300025934 Ga0207686_10003227 Ga0207686_100032276 297
340 3300025935 Ga0207709_10219870 Ga0207709_102198702 297
341 3300025960 Ga0207651_10083854 Ga0207651_100838542 297
342 3300025986 Ga0207658_10017527 Ga0207658_100175273 297
343 3300026023 Ga0207677_10139750 Ga0207677_101397502 297
344 3300026116 Ga0207674_10205618 Ga0207674_102056182 297
345 3300026121 Ga0207683_10326777 Ga0207683_103267772 297
346 3300027876 Ga0209974_10005321 Ga0209974_100053213 297
347 3300031548 Ga0307408_100000229 Ga0307408_10000022918 297
348 3300031901 Ga0307406_10000591 Ga0307406_1000059118 297
349 3300037471 Ga0395905_0000201 Ga0395905_0000201_56357_57301 297
350 3300042876 Ga0451577_0486130 Ga0451577_0486130_91_987 297
351 3300046455 Ga0495603_0021773 Ga0495603_0021773_736_1680 297
352 3300046457 Ga0495590_0056633 Ga0495590_0056633_171_1115 297
353 3300046474 Ga0495605_0003727 Ga0495605_0003727_7976_8920 297
354 3300046506 Ga0495583_0031064 Ga0495583_0031064_170_1114 297
355 3300046524 Ga0495648_0015337 Ga0495648_0015337_1174_2118 297
356 3300046531 Ga0495665_0085997 Ga0495665_0085997_577_1521 297
357 3300046542 Ga0495597_0000375 Ga0495597_0000375_8205_9101 297
358 3300046557 Ga0495622_0067794 Ga0495622_0067794_232_1176 297
359 3300046648 Ga0495611_0174330 Ga0495611_0174330_34_978 297
360 3300046794 Ga0495589_0045458 Ga0495589_0045458_372_1316 297
361 3300047319 Ga0495674_0239839 Ga0495674_0239839_317_1261 297
362 3300047320 Ga0495672_0031388 Ga0495672_0031388_834_1778 297
363 3300047323 Ga0495683_0059117 Ga0495683_0059117_947_1891 297
364 3300047443 Ga0495687_044618 Ga0495687_044618_509_1453 297
365 3300047469 Ga0495673_0028020 Ga0495673_0028020_246_1190 297
366 3300048903 Ga0496100_0025334 Ga0496100_0025334_1772_2716 297
367 3300048905 Ga0496102_0003391 Ga0496102_0003391_10508_11452 297
368 3300048905 Ga0496102_0115818 Ga0496102_0115818_1348_2286 297
369 3300048906 Ga0496103_0014447 Ga0496103_0014447_3072_4016 297
370 3300048908 Ga0496105_0061714 Ga0496105_0061714_1075_2019 297
371 3300048917 Ga0496114_0228340 Ga0496114_0228340_329_1267 297
372 3300048920 Ga0496117_0002010 Ga0496117_0002010_15307_16245 297
373 3300048920 Ga0496117_0059213 Ga0496117_0059213_912_1856 297
374 3300048921 Ga0496118_0003941 Ga0496118_0003941_14319_15263 297
375 3300048921 Ga0496118_0019836 Ga0496118_0019836_3041_3979 297
376 3300048929 Ga0496126_0001240 Ga0496126_0001240_38725_39663 297
377 3300049459 Ga0495678_035851 Ga0495678_035851_480_1424 297
378 3300049568 Ga0501031_0005202 Ga0501031_0005202_1267_2163 297
379 3300049663 Ga0501223_002814 Ga0501223_002814_214_1173 297
380 3300050491 nmdc:mga00v17_109294_c1 nmdc:mga00v17_109294_c1_697_1593 297
381 3300001989 JGI24739J22299_10001586 JGI24739J22299_100015868 298
382 3300001989 JGI24739J22299_10009303 JGI24739J22299_100093035 298
383 3300001989 JGI24739J22299_10009996 JGI24739J22299_100099962 298
384 3300001989 JGI24739J22299_10014340 JGI24739J22299_100143403 298
385 3300001989 JGI24739J22299_10019252 JGI24739J22299_100192523 298
386 3300002067 JGI24735J21928_10000832 JGI24735J21928_100008329 298
387 3300002067 JGI24735J21928_10001906 JGI24735J21928_100019066 298
388 3300002067 JGI24735J21928_10015579 JGI24735J21928_100155793 298
389 3300002067 JGI24735J21928_10019476 JGI24735J21928_100194761 298
390 3300002067 JGI24735J21928_10024157 JGI24735J21928_100241572 298
391 3300002075 JGI24738J21930_10004382 JGI24738J21930_100043823 298
392 3300002705 JGI25156J39149_1002143 JGI25156J39149_10021438 298
393 3300003214 JGI25165J46597_1001521 JGI25165J46597_100152110 298
394 3300003316 rootH1_10033773 rootH1_100337733 298
395 3300003756 Ga0055533_1001062 Ga0055533_10010627 298
396 3300003756 Ga0055533_1002034 Ga0055533_10020346 298
397 3300003758 Ga0055532_1000147 Ga0055532_100014713 298
398 3300003758 Ga0055532_1001552 Ga0055532_10015523 298
399 3300003760 Ga0055527_1000093 Ga0055527_100009313 298
400 3300003760 Ga0055527_1001123 Ga0055527_10011233 298
401 3300003760 Ga0055527_1002270 Ga0055527_10022703 298
402 3300003761 Ga0055535_1000094 Ga0055535_100009448 298
403 3300003761 Ga0055535_1002534 Ga0055535_10025343 298
404 3300003761 Ga0055535_1002543 Ga0055535_10025433 298
405 3300003762 Ga0055542_1000131 Ga0055542_100013148 298
406 3300003762 Ga0055542_1002424 Ga0055542_10024243 298
407 3300003762 Ga0055542_1004439 Ga0055542_10044393 298
408 3300003763 Ga0055529_1000238 Ga0055529_100023848 298
409 3300003763 Ga0055529_1001365 Ga0055529_10013655 298
410 3300003771 Ga0055526_1033140 Ga0055526_10331402 298
411 3300003790 Ga0055528_1002575 Ga0055528_10025758 298
412 3300005327 Ga0070658_10087088 Ga0070658_100870883 298
413 3300005327 Ga0070658_10140541 Ga0070658_101405411 298
414 3300005335 Ga0070666_10014588 Ga0070666_100145882 298
415 3300005339 Ga0070660_100000030 Ga0070660_10000003057 298
416 3300005339 Ga0070660_100002928 Ga0070660_10000292813 298
417 3300005344 Ga0070661_100100264 Ga0070661_1001002644 298
418 3300005366 Ga0070659_100000124 Ga0070659_10000012427 298
419 3300005367 Ga0070667_100126857 Ga0070667_1001268572 298
420 3300005455 Ga0070663_100000037 Ga0070663_10000003725 298
421 3300005455 Ga0070663_100049890 Ga0070663_1000498905 298
422 3300005563 Ga0068855_100001358 Ga0068855_10000135812 298
423 3300005563 Ga0068855_100003246 Ga0068855_1000032466 298
424 3300005616 Ga0068852_100035241 Ga0068852_1000352413 298
425 3300009011 Ga0105251_10001046 Ga0105251_1000104612 298
426 3300009011 Ga0105251_10001356 Ga0105251_1000135615 298
427 3300009092 Ga0105250_10004389 Ga0105250_100043896 298
428 3300009092 Ga0105250_10071185 Ga0105250_100711852 298
429 3300009093 Ga0105240_10022347 Ga0105240_100223474 298
430 3300009093 Ga0105240_10052923 Ga0105240_100529233 298
431 3300009093 Ga0105240_10327337 Ga0105240_103273372 298
432 3300009093 Ga0105240_10445709 Ga0105240_104457092 298
433 3300009545 Ga0105237_10007711 Ga0105237_100077113 298
434 3300009545 Ga0105237_10028525 Ga0105237_100285255 298
435 3300009551 Ga0105238_10175713 Ga0105238_101757133 298
436 3300009553 Ga0105249_10151308 Ga0105249_101513082 298
437 3300010375 Ga0105239_10009186 Ga0105239_100091867 298
438 3300010375 Ga0105239_10009931 Ga0105239_100099314 298
439 3300010375 Ga0105239_10076382 Ga0105239_100763824 298
440 3300010375 Ga0105239_10436795 Ga0105239_104367952 298
441 3300011119 Ga0105246_10084870 Ga0105246_100848702 298
442 3300013100 Ga0157373_10012730 Ga0157373_100127305 298
443 3300013104 Ga0157370_10004360 Ga0157370_1000436012 298
444 3300013104 Ga0157370_10004787 Ga0157370_100047875 298
445 3300013104 Ga0157370_10056527 Ga0157370_100565273 298
446 3300013104 Ga0157370_10245960 Ga0157370_102459602 298
447 3300013105 Ga0157369_10005112 Ga0157369_100051123 298
448 3300013105 Ga0157369_10009680 Ga0157369_1000968010 298
449 3300013296 Ga0157374_10000055 Ga0157374_1000005551 298
450 3300013296 Ga0157374_10048045 Ga0157374_100480454 298
451 3300013297 Ga0157378_10330714 Ga0157378_103307142 298
452 3300013306 Ga0163162_10001850 Ga0163162_1000185018 298
453 3300013306 Ga0163162_10229335 Ga0163162_102293353 298
454 3300013307 Ga0157372_10001079 Ga0157372_100010795 298
455 3300013308 Ga0157375_10004718 Ga0157375_100047184 298
456 3300014497 Ga0182008_10090444 Ga0182008_100904442 298
457 3300015262 Ga0182007_10008568 Ga0182007_100085685 298
458 3300015265 Ga0182005_1006014 Ga0182005_10060144 298
459 3300020070 Ga0206356_11831093 Ga0206356_118310933 298
460 3300020080 Ga0206350_10052148 Ga0206350_100521483 298
461 3300020082 Ga0206353_11895329 Ga0206353_118953293 298
462 3300021361 Ga0213872_10020982 Ga0213872_100209822 298
463 3300022467 Ga0224712_10000038 Ga0224712_100000383 298
464 3300025206 Ga0209435_107807 Ga0209435_1078071 298
465 3300025226 Ga0209674_100013 Ga0209674_100013714 298
466 3300025226 Ga0209674_100235 Ga0209674_10023534 298
467 3300025228 Ga0209672_100010 Ga0209672_100010767 298
468 3300025228 Ga0209672_100028 Ga0209672_10002818 298
469 3300025228 Ga0209672_100159 Ga0209672_10015938 298
470 3300025228 Ga0209672_101163 Ga0209672_1011633 298
471 3300025229 Ga0209147_100006 Ga0209147_100006767 298
472 3300025229 Ga0209147_100489 Ga0209147_1004895 298
473 3300025229 Ga0209147_101140 Ga0209147_1011405 298
474 3300025231 Ga0207427_101487 Ga0207427_1014873 298
475 3300025242 Ga0209258_100010 Ga0209258_100010767 298
476 3300025242 Ga0209258_100680 Ga0209258_1006805 298
477 3300025242 Ga0209258_100711 Ga0209258_1007115 298
478 3300025254 Ga0209148_1000081 Ga0209148_1000081221 298
479 3300025254 Ga0209148_1000189 Ga0209148_100018948 298
480 3300025254 Ga0209148_1002637 Ga0209148_10026373 298
481 3300025256 Ga0209759_1000192 Ga0209759_10001924 298
482 3300025256 Ga0209759_1000406 Ga0209759_100040612 298
483 3300025256 Ga0209759_1000580 Ga0209759_100058033 298
484 3300025256 Ga0209759_1004890 Ga0209759_10048904 298
485 3300025256 Ga0209759_1014706 Ga0209759_10147062 298
486 3300025261 Ga0209233_1000244 Ga0209233_100024437 298
487 3300025263 Ga0209565_1011308 Ga0209565_10113082 298
488 3300025272 Ga0209455_1000050 Ga0209455_1000050303 298
489 3300025272 Ga0209455_1000162 Ga0209455_100016261 298
490 3300025272 Ga0209455_1003216 Ga0209455_10032165 298
491 3300025273 Ga0209673_1000038 Ga0209673_1000038234 298
492 3300025295 Ga0209564_1002960 Ga0209564_10029606 298
493 3300025302 Ga0207426_1015713 Ga0207426_10157132 298
494 3300025735 Ga0207713_1000247 Ga0207713_10002479 298
495 3300025735 Ga0207713_1041182 Ga0207713_10411822 298
496 3300025903 Ga0207680_10013405 Ga0207680_100134054 298
497 3300025904 Ga0207647_10000869 Ga0207647_1000086918 298
498 3300025904 Ga0207647_10021937 Ga0207647_100219373 298
499 3300025904 Ga0207647_10040868 Ga0207647_100408684 298
500 3300025909 Ga0207705_10000221 Ga0207705_1000022110 298
501 3300025909 Ga0207705_10025243 Ga0207705_100252433 298
502 3300025913 Ga0207695_10004740 Ga0207695_1000474010 298
503 3300025913 Ga0207695_10015091 Ga0207695_100150918 298
504 3300025913 Ga0207695_10090052 Ga0207695_100900522 298
505 3300025913 Ga0207695_10368930 Ga0207695_103689302 298
506 3300025914 Ga0207671_10005185 Ga0207671_100051855 298
507 3300025914 Ga0207671_10009196 Ga0207671_100091969 298
508 3300025919 Ga0207657_10000064 Ga0207657_1000006438 298
509 3300025919 Ga0207657_10004640 Ga0207657_1000464013 298
510 3300025924 Ga0207694_10006495 Ga0207694_100064953 298
511 3300025932 Ga0207690_10000060 Ga0207690_1000006039 298
512 3300025934 Ga0207686_10212284 Ga0207686_102122842 298
513 3300025941 Ga0207711_10035676 Ga0207711_100356764 298
514 3300025949 Ga0207667_10002443 Ga0207667_1000244310 298
515 3300025949 Ga0207667_10005486 Ga0207667_1000548613 298
516 3300025949 Ga0207667_10021484 Ga0207667_100214841 298
517 3300025986 Ga0207658_10096417 Ga0207658_100964172 298
518 3300026067 Ga0207678_10000233 Ga0207678_1000023311 298
519 3300026067 Ga0207678_10272080 Ga0207678_102720801 298
520 3300027312 Ga0209371_1000114 Ga0209371_100011452 298
521 3300027312 Ga0209371_1001990 Ga0209371_10019907 298
522 3300028800 Ga0265338_10000409 Ga0265338_1000040918 298
523 3300028800 Ga0265338_10000410 Ga0265338_1000041026 298
524 3300030500 Ga0268256_1000177 Ga0268256_100017723 298
525 3300030500 Ga0268256_1001738 Ga0268256_10017387 298
526 3300031247 Ga0265340_10055264 Ga0265340_100552642 298
527 3300031507 Ga0307509_10246278 Ga0307509_102462781 298
528 3300031548 Ga0307408_100001734 Ga0307408_10000173413 298
529 3300031731 Ga0307405_10046765 Ga0307405_100467652 298
530 3300031911 Ga0307412_10000044 Ga0307412_10000044129 298
531 3300032002 Ga0307416_100175880 Ga0307416_1001758803 298
532 3300032005 Ga0307411_10302337 Ga0307411_103023371 298
533 3300036401 Ga0373937_0099879 Ga0373937_0099879_1333_2265 298
534 3300037312 Ga0395899_0000008 Ga0395899_0000008_508915_509853 298
535 3300037312 Ga0395899_0045609 Ga0395899_0045609_1719_2657 298
536 3300037312 Ga0395899_0048201 Ga0395899_0048201_2103_3041 298
537 3300037418 Ga0395900_0000055 Ga0395900_0000055_161218_162156 298
538 3300037418 Ga0395900_0006242 Ga0395900_0006242_9826_10761 298
539 3300037418 Ga0395900_0016169 Ga0395900_0016169_1932_2870 298
540 3300037418 Ga0395900_0095300 Ga0395900_0095300_1412_2347 298
541 3300037418 Ga0395900_0145236 Ga0395900_0145236_988_1926 298
542 3300037418 Ga0395900_0303388 Ga0395900_0303388_318_1307 298
543 3300037466 Ga0395898_0000119 Ga0395898_0000119_191697_192635 298
544 3300037466 Ga0395898_0001022 Ga0395898_0001022_29639_30574 298
545 3300037466 Ga0395898_0007201 Ga0395898_0007201_8602_9540 298
546 3300037471 Ga0395905_0084987 Ga0395905_0084987_1450_2388 298
547 3300038443 Ga0395901_0000003 Ga0395901_0000003_640203_641213 298
548 3300038443 Ga0395901_0000186 Ga0395901_0000186_65995_66930 298
549 3300038443 Ga0395901_0001409 Ga0395901_0001409_1583_2521 298
550 3300039438 Ga0436360_0754952 Ga0436360_0754952_323_1264 298
551 3300039447 Ga0436361_0010589 Ga0436361_0010589_3807_4745 298
552 3300042005 Ga0439448_0006903 Ga0439448_0006903_2000_2989 298
553 3300044656 Ga0466969_0000949 Ga0466969_0000949_3429_4367 298
554 3300044656 Ga0466969_0001609 Ga0466969_0001609_9421_10359 298
555 3300044656 Ga0466969_0040127 Ga0466969_0040127_500_1438 298
556 3300044658 Ga0466972_0041080 Ga0466972_0041080_109_1047 298
557 3300044658 Ga0466972_0092942 Ga0466972_0092942_338_1273 298
558 3300044659 Ga0466973_0051992 Ga0466973_0051992_2331_3269 298
559 3300044683 Ga0466965_0000123 Ga0466965_0000123_3461_4399 298
560 3300044683 Ga0466965_0017787 Ga0466965_0017787_1340_2278 298
561 3300044683 Ga0466965_0020023 Ga0466965_0020023_222_1160 298
562 3300044683 Ga0466965_0075883 Ga0466965_0075883_279_1217 298
563 3300044684 Ga0466966_0005342 Ga0466966_0005342_572_1510 298
564 3300044684 Ga0466966_0009778 Ga0466966_0009778_3763_4698 298
565 3300044684 Ga0466966_0014484 Ga0466966_0014484_1642_2580 298
566 3300044684 Ga0466966_0069918 Ga0466966_0069918_530_1468 298
567 3300044684 Ga0466966_0096405 Ga0466966_0096405_81_1019 298
568 3300044693 Ga0466961_0000097 Ga0466961_0000097_53435_54373 298
569 3300044693 Ga0466961_0005590 Ga0466961_0005590_2659_3597 298
570 3300044693 Ga0466961_0032901 Ga0466961_0032901_2160_3098 298
571 3300044693 Ga0466961_0036998 Ga0466961_0036998_1552_2487 298
572 3300044693 Ga0466961_0057586 Ga0466961_0057586_908_1846 298
573 3300044694 Ga0466963_0003740 Ga0466963_0003740_970_1908 298
574 3300044694 Ga0466963_0014644 Ga0466963_0014644_2274_3209 298
575 3300044694 Ga0466963_0017489 Ga0466963_0017489_157_1095 298
576 3300044706 Ga0466964_0002945 Ga0466964_0002945_3331_4269 298
577 3300044719 Ga0466971_0000504 Ga0466971_0000504_8449_9387 298
578 3300044719 Ga0466971_0011044 Ga0466971_0011044_763_1698 298
579 3300044719 Ga0466971_0053739 Ga0466971_0053739_847_1785 298
580 3300044735 Ga0466968_0009580 Ga0466968_0009580_1939_2877 298
581 3300044765 Ga0466970_0007260 Ga0466970_0007260_2349_3287 298
582 3300044765 Ga0466970_0011454 Ga0466970_0011454_2961_3899 298
583 3300044765 Ga0466970_0147699 Ga0466970_0147699_115_1053 298
584 3300044842 Ga0466957_0000539 Ga0466957_0000539_16006_16944 298
585 3300044842 Ga0466957_0012295 Ga0466957_0012295_2098_3036 298
586 3300044842 Ga0466957_0029906 Ga0466957_0029906_908_1846 298
587 3300044842 Ga0466957_0036640 Ga0466957_0036640_52_987 298
588 3300045049 Ga0466959_0002979 Ga0466959_0002979_2066_3004 298
589 3300045049 Ga0466959_0008158 Ga0466959_0008158_5948_6886 298
590 3300045049 Ga0466959_0014953 Ga0466959_0014953_1309_2247 298
591 3300045836 Ga0466958_0001102 Ga0466958_0001102_5016_5954 298
592 3300045836 Ga0466958_0002984 Ga0466958_0002984_951_1889 298
593 3300045836 Ga0466958_0077556 Ga0466958_0077556_891_1829 298
594 3300046455 Ga0495603_0016875 Ga0495603_0016875_1206_2207 298
595 3300046455 Ga0495603_0018357 Ga0495603_0018357_3200_4180 298
596 3300046457 Ga0495590_0002529 Ga0495590_0002529_1553_2491 298
597 3300046457 Ga0495590_0003479 Ga0495590_0003479_158_1096 298
598 3300046457 Ga0495590_0018743 Ga0495590_0018743_1081_2019 298
599 3300046459 Ga0495629_0000435 Ga0495629_0000435_15985_16965 298
600 3300046459 Ga0495629_0010284 Ga0495629_0010284_4266_5267 298
601 3300046460 Ga0495638_0038688 Ga0495638_0038688_168_1106 298
602 3300046460 Ga0495638_0099070 Ga0495638_0099070_282_1220 298
603 3300046462 Ga0495651_0012666 Ga0495651_0012666_2571_3563 298
604 3300046462 Ga0495651_0031127 Ga0495651_0031127_1936_2874 298
605 3300046463 Ga0495653_0011577 Ga0495653_0011577_2058_3059 298
606 3300046463 Ga0495653_0017356 Ga0495653_0017356_1487_2425 298
607 3300046463 Ga0495653_0033707 Ga0495653_0033707_2041_2979 298
608 3300046463 Ga0495653_0161105 Ga0495653_0161105_81_1019 298
609 3300046471 Ga0495650_0010246 Ga0495650_0010246_2530_3510 298
610 3300046471 Ga0495650_0012278 Ga0495650_0012278_417_1355 298
611 3300046471 Ga0495650_0012626 Ga0495650_0012626_2113_3051 298
612 3300046472 Ga0495580_0002727 Ga0495580_0002727_7047_8048 298
613 3300046472 Ga0495580_0015520 Ga0495580_0015520_3819_4757 298
614 3300046472 Ga0495580_0019594 Ga0495580_0019594_2637_3575 298
615 3300046472 Ga0495580_0054629 Ga0495580_0054629_822_1802 298
616 3300046473 Ga0495582_0003165 Ga0495582_0003165_3636_4637 298
617 3300046473 Ga0495582_0015340 Ga0495582_0015340_185_1123 298
618 3300046473 Ga0495582_0062889 Ga0495582_0062889_606_1544 298
619 3300046474 Ga0495605_0001677 Ga0495605_0001677_3039_3977 298
620 3300046474 Ga0495605_0005370 Ga0495605_0005370_3229_4167 298
621 3300046474 Ga0495605_0011125 Ga0495605_0011125_2650_3588 298
622 3300046476 Ga0495662_0028754 Ga0495662_0028754_216_1196 298
623 3300046477 Ga0495664_0107329 Ga0495664_0107329_285_1271 298
624 3300046492 Ga0495585_0025842 Ga0495585_0025842_357_1295 298
625 3300046499 Ga0495594_0042901 Ga0495594_0042901_1014_2015 298
626 3300046500 Ga0495596_0002371 Ga0495596_0002371_8083_9021 298
627 3300046506 Ga0495583_0001786 Ga0495583_0001786_5385_6323 298
628 3300046507 Ga0495606_0012415 Ga0495606_0012415_2266_3204 298
629 3300046507 Ga0495606_0017858 Ga0495606_0017858_790_1728 298
630 3300046507 Ga0495606_0030879 Ga0495606_0030879_777_1715 298
631 3300046511 Ga0495608_0005823 Ga0495608_0005823_3391_4383 298
632 3300046511 Ga0495608_0059087 Ga0495608_0059087_828_1766 298
633 3300046512 Ga0495610_0017143 Ga0495610_0017143_1088_2026 298
634 3300046514 Ga0495618_0039869 Ga0495618_0039869_469_1407 298
635 3300046514 Ga0495618_0049058 Ga0495618_0049058_133_1125 298
636 3300046515 Ga0495620_0008721 Ga0495620_0008721_2286_3224 298
637 3300046516 Ga0495628_0014240 Ga0495628_0014240_1406_2407 298
638 3300046516 Ga0495628_0015663 Ga0495628_0015663_3755_4690 298
639 3300046516 Ga0495628_0025127 Ga0495628_0025127_3878_4816 298
640 3300046516 Ga0495628_0062511 Ga0495628_0062511_1904_2842 298
641 3300046516 Ga0495628_0063794 Ga0495628_0063794_1535_2473 298
642 3300046516 Ga0495628_0101954 Ga0495628_0101954_908_1900 298
643 3300046517 Ga0495630_0009640 Ga0495630_0009640_3937_4875 298
644 3300046517 Ga0495630_0009921 Ga0495630_0009921_3546_4547 298
645 3300046517 Ga0495630_0025580 Ga0495630_0025580_2734_3726 298
646 3300046517 Ga0495630_0028399 Ga0495630_0028399_1777_2715 298
647 3300046522 Ga0495643_0016865 Ga0495643_0016865_2149_3087 298
648 3300046524 Ga0495648_0046072 Ga0495648_0046072_1185_2123 298
649 3300046524 Ga0495648_0051821 Ga0495648_0051821_42_980 298
650 3300046524 Ga0495648_0193323 Ga0495648_0193323_40_978 298
651 3300046526 Ga0495666_0000312 Ga0495666_0000312_1907_2908 298
652 3300046526 Ga0495666_0008912 Ga0495666_0008912_3935_4873 298
653 3300046526 Ga0495666_0010894 Ga0495666_0010894_985_1923 298
654 3300046526 Ga0495666_0014331 Ga0495666_0014331_1541_2479 298
655 3300046526 Ga0495666_0021382 Ga0495666_0021382_1542_2534 298
656 3300046528 Ga0495642_0011096 Ga0495642_0011096_1887_2825 298
657 3300046528 Ga0495642_0018510 Ga0495642_0018510_1026_1964 298
658 3300046529 Ga0495652_0016164 Ga0495652_0016164_1406_2407 298
659 3300046529 Ga0495652_0016400 Ga0495652_0016400_503_1441 298
660 3300046529 Ga0495652_0050813 Ga0495652_0050813_1983_2921 298
661 3300046530 Ga0495654_0036872 Ga0495654_0036872_341_1279 298
662 3300046530 Ga0495654_0057364 Ga0495654_0057364_728_1708 298
663 3300046530 Ga0495654_0079860 Ga0495654_0079860_366_1304 298
664 3300046531 Ga0495665_0001728 Ga0495665_0001728_9230_10231 298
665 3300046531 Ga0495665_0012824 Ga0495665_0012824_633_1571 298
666 3300046533 Ga0495640_0014915 Ga0495640_0014915_2733_3725 298
667 3300046533 Ga0495640_0018453 Ga0495640_0018453_4124_5125 298
668 3300046533 Ga0495640_0030287 Ga0495640_0030287_190_1128 298
669 3300046535 Ga0495586_0003487 Ga0495586_0003487_6099_7100 298
670 3300046535 Ga0495586_0016069 Ga0495586_0016069_296_1234 298
671 3300046536 Ga0495587_0008906 Ga0495587_0008906_1495_2496 298
672 3300046536 Ga0495587_0011020 Ga0495587_0011020_3512_4504 298
673 3300046543 Ga0495645_0004117 Ga0495645_0004117_7411_8412 298
674 3300046543 Ga0495645_0004970 Ga0495645_0004970_4593_5531 298
675 3300046543 Ga0495645_0009452 Ga0495645_0009452_2303_3283 298
676 3300046543 Ga0495645_0014857 Ga0495645_0014857_2511_3497 298
677 3300046557 Ga0495622_0001742 Ga0495622_0001742_7595_8533 298
678 3300046559 Ga0495667_0072405 Ga0495667_0072405_196_1176 298
679 3300046642 Ga0495634_0007024 Ga0495634_0007024_1529_2467 298
680 3300046642 Ga0495634_0013442 Ga0495634_0013442_1438_2439 298
681 3300046663 Ga0495635_0010924 Ga0495635_0010924_2505_3506 298
682 3300046663 Ga0495635_0058416 Ga0495635_0058416_488_1426 298
683 3300046665 Ga0495661_0011904 Ga0495661_0011904_1530_2531 298
684 3300046665 Ga0495661_0031644 Ga0495661_0031644_1123_2061 298
685 3300046665 Ga0495661_0071760 Ga0495661_0071760_345_1337 298
686 3300046665 Ga0495661_0094642 Ga0495661_0094642_98_1078 298
687 3300046675 Ga0495657_0086145 Ga0495657_0086145_177_1115 298
688 3300046678 Ga0495599_0089214 Ga0495599_0089214_586_1524 298
689 3300046679 Ga0495623_0012666 Ga0495623_0012666_2924_3925 298
690 3300046679 Ga0495623_0029794 Ga0495623_0029794_586_1524 298
691 3300046679 Ga0495623_0121569 Ga0495623_0121569_413_1351 298
692 3300046680 Ga0495646_0010083 Ga0495646_0010083_1527_2528 298
693 3300046680 Ga0495646_0021153 Ga0495646_0021153_1514_2506 298
694 3300046680 Ga0495646_0029670 Ga0495646_0029670_493_1431 298
695 3300046680 Ga0495646_0035385 Ga0495646_0035385_801_1739 298
696 3300046680 Ga0495646_0058263 Ga0495646_0058263_863_1801 298
697 3300046680 Ga0495646_0139746 Ga0495646_0139746_11_949 298
698 3300046684 Ga0495669_0026016 Ga0495669_0026016_394_1332 298
699 3300046684 Ga0495669_0077652 Ga0495669_0077652_330_1310 298
700 3300046689 Ga0495613_0013918 Ga0495613_0013918_1517_2518 298
701 3300046689 Ga0495613_0016988 Ga0495613_0016988_3956_4948 298
702 3300046689 Ga0495613_0269178 Ga0495613_0269178_143_1123 298
703 3300046690 Ga0495624_0005072 Ga0495624_0005072_5374_6375 298
704 3300046690 Ga0495624_0011219 Ga0495624_0011219_1661_2599 298
705 3300046690 Ga0495624_0011784 Ga0495624_0011784_649_1587 298
706 3300046690 Ga0495624_0064022 Ga0495624_0064022_770_1762 298
707 3300046691 Ga0495670_0043719 Ga0495670_0043719_442_1422 298
708 3300046691 Ga0495670_0073490 Ga0495670_0073490_729_1667 298
709 3300046692 Ga0495671_0010188 Ga0495671_0010188_3413_4351 298
710 3300046694 Ga0495649_0011823 Ga0495649_0011823_572_1510 298
711 3300046694 Ga0495649_0013874 Ga0495649_0013874_3247_4185 298
712 3300046794 Ga0495589_0007925 Ga0495589_0007925_2445_3383 298
713 3300046794 Ga0495589_0015460 Ga0495589_0015460_2401_3339 298
714 3300046794 Ga0495589_0016034 Ga0495589_0016034_1415_2353 298
715 3300046794 Ga0495589_0103082 Ga0495589_0103082_254_1246 298
716 3300046809 Ga0495600_0013023 Ga0495600_0013023_1519_2457 298
717 3300046809 Ga0495600_0026069 Ga0495600_0026069_2439_3431 298
718 3300047315 Ga0495581_0002940 Ga0495581_0002940_7144_8145 298
719 3300047315 Ga0495581_0005503 Ga0495581_0005503_1479_2417 298
720 3300047315 Ga0495581_0009878 Ga0495581_0009878_3414_4394 298
721 3300047317 Ga0495604_0013068 Ga0495604_0013068_3833_4771 298
722 3300047317 Ga0495604_0019673 Ga0495604_0019673_852_1853 298
723 3300047317 Ga0495604_0024834 Ga0495604_0024834_2787_3725 298
724 3300047317 Ga0495604_0072231 Ga0495604_0072231_526_1464 298
725 3300047317 Ga0495604_0194812 Ga0495604_0194812_185_1171 298
726 3300047319 Ga0495674_0008675 Ga0495674_0008675_8444_9382 298
727 3300047319 Ga0495674_0010569 Ga0495674_0010569_1527_2528 298
728 3300047319 Ga0495674_0021217 Ga0495674_0021217_3187_4191 298
729 3300047319 Ga0495674_0029278 Ga0495674_0029278_1480_2502 298
730 3300047319 Ga0495674_0359172 Ga0495674_0359172_18_956 298
731 3300047320 Ga0495672_0023709 Ga0495672_0023709_1166_2101 298
732 3300047320 Ga0495672_0033899 Ga0495672_0033899_1087_2025 298
733 3300047321 Ga0495676_0023336 Ga0495676_0023336_832_1833 298
734 3300047321 Ga0495676_0190340 Ga0495676_0190340_251_1243 298
735 3300047322 Ga0495680_0011744 Ga0495680_0011744_221_1213 298
736 3300047322 Ga0495680_0015810 Ga0495680_0015810_1524_2525 298
737 3300047322 Ga0495680_0024541 Ga0495680_0024541_3295_4233 298
738 3300047322 Ga0495680_0048303 Ga0495680_0048303_320_1258 298
739 3300047322 Ga0495680_0134447 Ga0495680_0134447_580_1560 298
740 3300047322 Ga0495680_0181230 Ga0495680_0181230_63_1001 298
741 3300047323 Ga0495683_0005588 Ga0495683_0005588_2147_3085 298
742 3300047323 Ga0495683_0005955 Ga0495683_0005955_2162_3154 298
743 3300047323 Ga0495683_0006679 Ga0495683_0006679_1948_2886 298
744 3300047323 Ga0495683_0068720 Ga0495683_0068720_424_1404 298
745 3300047443 Ga0495687_000032 Ga0495687_000032_210658_211596 298
746 3300047443 Ga0495687_012058 Ga0495687_012058_1674_2612 298
747 3300047443 Ga0495687_038596 Ga0495687_038596_168_1106 298
748 3300047444 Ga0495675_0006553 Ga0495675_0006553_5211_6149 298
749 3300047444 Ga0495675_0030790 Ga0495675_0030790_890_1882 298
750 3300047444 Ga0495675_0037162 Ga0495675_0037162_1714_2652 298
751 3300047444 Ga0495675_0061024 Ga0495675_0061024_63_1001 298
752 3300047444 Ga0495675_0091183 Ga0495675_0091183_56_994 298
753 3300047446 Ga0495679_000586 Ga0495679_000586_19526_20527 298
754 3300047446 Ga0495679_000669 Ga0495679_000669_13214_14152 298
755 3300047446 Ga0495679_004378 Ga0495679_004378_4004_4996 298
756 3300047469 Ga0495673_0026935 Ga0495673_0026935_616_1551 298
757 3300047470 Ga0495681_0039739 Ga0495681_0039739_903_1883 298
758 3300047470 Ga0495681_0101385 Ga0495681_0101385_253_1191 298
759 3300047472 Ga0495686_0000038 Ga0495686_0000038_78602_79537 298
760 3300047472 Ga0495686_0024032 Ga0495686_0024032_1431_2483 298
761 3300047673 Ga0495593_0008362 Ga0495593_0008362_4590_5582 298
762 3300047673 Ga0495593_0010775 Ga0495593_0010775_2764_3765 298
763 3300047673 Ga0495593_0013043 Ga0495593_0013043_513_1451 298
764 3300047673 Ga0495593_0016025 Ga0495593_0016025_2644_3582 298
765 3300047673 Ga0495593_0102908 Ga0495593_0102908_450_1388 298
766 3300048088 Ga0495602_0018226 Ga0495602_0018226_682_1620 298
767 3300048088 Ga0495602_0048561 Ga0495602_0048561_1334_2335 298
768 3300048088 Ga0495602_0072648 Ga0495602_0072648_747_1685 298
769 3300048089 Ga0495614_0000551 Ga0495614_0000551_12993_13994 298
770 3300048089 Ga0495614_0015930 Ga0495614_0015930_514_1452 298
771 3300048091 Ga0495626_0021860 Ga0495626_0021860_1405_2343 298
772 3300048903 Ga0496100_0056985 Ga0496100_0056985_442_1422 298
773 3300048903 Ga0496100_0100032 Ga0496100_0100032_229_1167 298
774 3300048903 Ga0496100_0428392 Ga0496100_0428392_26_964 298
775 3300048904 Ga0496101_0044838 Ga0496101_0044838_1550_2488 298
776 3300048904 Ga0496101_0116304 Ga0496101_0116304_998_1978 298
777 3300048904 Ga0496101_0180267 Ga0496101_0180267_37_975 298
778 3300048905 Ga0496102_0080921 Ga0496102_0080921_1528_2466 298
779 3300048906 Ga0496103_0024845 Ga0496103_0024845_68_1006 298
780 3300048906 Ga0496103_0033542 Ga0496103_0033542_43_1044 298
781 3300048906 Ga0496103_0067287 Ga0496103_0067287_925_1863 298
782 3300048907 Ga0496104_0119594 Ga0496104_0119594_652_1632 298
783 3300048907 Ga0496104_0205089 Ga0496104_0205089_228_1166 298
784 3300048908 Ga0496105_0019712 Ga0496105_0019712_1867_2805 298
785 3300048908 Ga0496105_0064690 Ga0496105_0064690_72_1052 298
786 3300048908 Ga0496105_0100867 Ga0496105_0100867_290_1228 298
787 3300048910 Ga0496107_0040742 Ga0496107_0040742_1683_2621 298
788 3300048910 Ga0496107_0041048 Ga0496107_0041048_1203_2141 298
789 3300048910 Ga0496107_0337470 Ga0496107_0337470_28_1008 298
790 3300048913 Ga0496110_0014636 Ga0496110_0014636_2317_3255 298
791 3300048913 Ga0496110_0170272 Ga0496110_0170272_527_1507 298
792 3300048915 Ga0496112_0058215 Ga0496112_0058215_1933_2871 298
793 3300048916 Ga0496113_0013680 Ga0496113_0013680_3584_4522 298
794 3300048917 Ga0496114_0012142 Ga0496114_0012142_3957_4937 298
795 3300048917 Ga0496114_0424892 Ga0496114_0424892_218_1156 298
796 3300048919 Ga0496116_0005753 Ga0496116_0005753_9939_10877 298
797 3300048919 Ga0496116_0041504 Ga0496116_0041504_1268_2209 298
798 3300048920 Ga0496117_0016433 Ga0496117_0016433_687_1688 298
799 3300048920 Ga0496117_0026535 Ga0496117_0026535_2090_3028 298
800 3300048920 Ga0496117_0085715 Ga0496117_0085715_949_1911 298
801 3300048920 Ga0496117_0155410 Ga0496117_0155410_286_1224 298
802 3300048921 Ga0496118_0005114 Ga0496118_0005114_11294_12256 298
803 3300048921 Ga0496118_0016258 Ga0496118_0016258_3952_4890 298
804 3300048921 Ga0496118_0022761 Ga0496118_0022761_1506_2507 298
805 3300048921 Ga0496118_0024552 Ga0496118_0024552_2945_3943 298
806 3300048921 Ga0496118_0071198 Ga0496118_0071198_820_1758 298
807 3300048921 Ga0496118_0099290 Ga0496118_0099290_461_1399 298
808 3300048924 Ga0496121_0008669 Ga0496121_0008669_8302_9249 298
809 3300048924 Ga0496121_0051898 Ga0496121_0051898_972_1910 298
810 3300048924 Ga0496121_0166407 Ga0496121_0166407_486_1424 298
811 3300048924 Ga0496121_0272172 Ga0496121_0272172_63_1004 298
812 3300048925 Ga0496122_0012379 Ga0496122_0012379_1708_2646 298
813 3300048927 Ga0496124_0038839 Ga0496124_0038839_1091_2029 298
814 3300048928 Ga0496125_0042957 Ga0496125_0042957_1706_2644 298
815 3300048929 Ga0496126_0000603 Ga0496126_0000603_56890_57888 298
816 3300048929 Ga0496126_0004105 Ga0496126_0004105_12461_13399 298
817 3300048929 Ga0496126_0014923 Ga0496126_0014923_5498_6436 298
818 3300048929 Ga0496126_0023952 Ga0496126_0023952_2655_3602 298
819 3300049459 Ga0495678_006109 Ga0495678_006109_3847_4785 298
820 3300049459 Ga0495678_067499 Ga0495678_067499_135_1073 298
821 3300049460 Ga0495682_0024930 Ga0495682_0024930_55_1047 298
822 3300049460 Ga0495682_0042308 Ga0495682_0042308_446_1384 298
823 3300049679 Ga0501249_011852 Ga0501249_011852_46_942 298
824 3300050492 nmdc:mga0yw44_21049_c1 nmdc:mga0yw44_21049_c1_2013_2936 298
825 3300053125 Ga0500618_005216 Ga0500618_005216_1402_2382 298
826 3300061719 Ga0466962_0008013 Ga0466962_0008013_969_1907 298
827 3300061719 Ga0466962_0009252 Ga0466962_0009252_1257_2195 298
828 3300061719 Ga0466962_0013511 Ga0466962_0013511_439_1374 298
829 iso_pu_bacteria 2501025501 2501070160 298
830 3300002987 JGI25159J45721_1027372 JGI25159J45721_10273721 299
831 3300003187 JGI25151J46595_10007385 JGI25151J46595_100073854 299
832 3300003771 Ga0055526_1014040 Ga0055526_10140403 299
833 3300003771 Ga0055526_1018128 Ga0055526_10181283 299
834 3300003773 Ga0055537_1003042 Ga0055537_10030423 299
835 3300003773 Ga0055537_1009743 Ga0055537_10097432 299
836 3300003775 Ga0055524_1000044 Ga0055524_1000044102 299
837 3300003775 Ga0055524_1000109 Ga0055524_100010986 299
838 3300003781 Ga0055536_1003791 Ga0055536_10037913 299
839 3300003784 Ga0055534_1005114 Ga0055534_10051143 299
840 3300003790 Ga0055528_1000287 Ga0055528_100028724 299
841 3300003791 Ga0055530_10002509 Ga0055530_100025095 299
842 3300003792 Ga0055540_1000013 Ga0055540_1000013242 299
843 3300003792 Ga0055540_1000116 Ga0055540_100011674 299
844 3300003792 Ga0055540_1000401 Ga0055540_100040125 299
845 3300003794 Ga0055531_10001209 Ga0055531_1000120912 299
846 3300003794 Ga0055531_10008229 Ga0055531_100082295 299
847 3300005439 Ga0070711_100112208 Ga0070711_1001122083 299
848 3300006195 Ga0075366_10105968 Ga0075366_101059681 299
849 3300006946 Ga0079104_1000001 Ga0079104_1000001294 299
850 3300021361 Ga0213872_10010842 Ga0213872_100108422 299
851 3300025245 Ga0207425_1001147 Ga0207425_10011478 299
852 3300025263 Ga0209565_1000200 Ga0209565_100020040 299
853 3300025263 Ga0209565_1007535 Ga0209565_10075352 299
854 3300025273 Ga0209673_1000009 Ga0209673_1000009469 299
855 3300025273 Ga0209673_1000012 Ga0209673_1000012370 299
856 3300025284 Ga0209130_1002100 Ga0209130_100210010 299
857 3300025291 Ga0209675_1000144 Ga0209675_100014434 299
858 3300025292 Ga0209676_1000051 Ga0209676_1000051234 299
859 3300025294 Ga0209025_1004306 Ga0209025_10043064 299
860 3300025294 Ga0209025_1013723 Ga0209025_10137234 299
861 3300025295 Ga0209564_1000797 Ga0209564_100079736 299
862 3300025295 Ga0209564_1008441 Ga0209564_10084413 299
863 3300025298 Ga0209050_1000044 Ga0209050_1000044112 299
864 3300025299 Ga0209256_1000003 Ga0209256_1000003624 299
865 3300025299 Ga0209256_1000015 Ga0209256_1000015386 299
866 3300025302 Ga0207426_1005947 Ga0207426_10059473 299
867 3300025303 Ga0209051_1000022 Ga0209051_100002224 299
868 3300025303 Ga0209051_1000031 Ga0209051_1000031112 299
869 3300025304 Ga0209257_1000030 Ga0209257_1000030221 299
870 3300025304 Ga0209257_1000058 Ga0209257_1000058106 299
871 3300027111 Ga0209281_1000057 Ga0209281_100005725 299
872 3300031911 Ga0307412_10489779 Ga0307412_104897791 299
873 3300032002 Ga0307416_100119492 Ga0307416_1001194923 299
874 3300037471 Ga0395905_0034496 Ga0395905_0034496_2462_3367 299
875 3300039447 Ga0436361_0523338 Ga0436361_0523338_3185_4087 299
876 3300044712 Ga0453684_0064177 Ga0453684_0064177_2623_3531 299
877 3300046539 Ga0495621_0002266 Ga0495621_0002266_2545_3450 299
878 3300048917 Ga0496114_0020908 Ga0496114_0020908_1988_2890 299
879 3300048928 Ga0496125_0052356 Ga0496125_0052356_1711_2613 299
880 3300050493 nmdc:mga0k408_14765_c1 nmdc:mga0k408_14765_c1_2939_3847 299
881 3300050511 nmdc:mga08y16_473894_c1 nmdc:mga08y16_473894_c1_172_1077 299
882 3300001979 JGI24740J21852_10015733 JGI24740J21852_100157332 300
883 3300001979 JGI24740J21852_10022466 JGI24740J21852_100224662 300
884 3300001989 JGI24739J22299_10028600 JGI24739J22299_100286001 300
885 3300002704 JGI25155J39150_1000029 JGI25155J39150_100002934 300
886 3300002705 JGI25156J39149_1000062 JGI25156J39149_10000625 300
887 3300002705 JGI25156J39149_1000972 JGI25156J39149_10009724 300
888 3300002705 JGI25156J39149_1008324 JGI25156J39149_10083242 300
889 3300002738 JGI25154J39366_1000053 JGI25154J39366_100005375 300
890 3300002738 JGI25154J39366_1002519 JGI25154J39366_10025192 300
891 3300002739 JGI25158J39367_1006874 JGI25158J39367_10068741 300
892 3300002741 JGI25157J39369_1000046 JGI25157J39369_100004634 300
893 3300002741 JGI25157J39369_1000566 JGI25157J39369_100056622 300
894 3300002741 JGI25157J39369_1001869 JGI25157J39369_10018694 300
895 3300002773 JGI25152J39213_1003527 JGI25152J39213_10035274 300
896 3300002773 JGI25152J39213_1003641 JGI25152J39213_10036412 300
897 3300002773 JGI25152J39213_1009037 JGI25152J39213_10090372 300
898 3300002774 JGI25150J39212_1001665 JGI25150J39212_10016654 300
899 3300002774 JGI25150J39212_1008515 JGI25150J39212_10085152 300
900 3300002774 JGI25150J39212_1009459 JGI25150J39212_10094592 300
901 3300002987 JGI25159J45721_1004656 JGI25159J45721_10046561 300
902 3300002987 JGI25159J45721_1005158 JGI25159J45721_10051582 300
903 3300003187 JGI25151J46595_10000972 JGI25151J46595_1000097219 300
904 3300003187 JGI25151J46595_10011904 JGI25151J46595_100119043 300
905 3300003187 JGI25151J46595_10045112 JGI25151J46595_100451121 300
906 3300003316 rootH1_10002532 rootH1_100025323 300
907 3300003320 rootH2_10053797 rootH2_100537974 300
908 3300003322 rootL2_10123562 rootL2_101235622 300
909 3300003354 JGI25160J50197_1000253 JGI25160J50197_10002533 300
910 3300003354 JGI25160J50197_1007641 JGI25160J50197_10076412 300
911 3300003354 JGI25160J50197_1008079 JGI25160J50197_10080792 300
912 3300003374 JGI25161J50226_1000046 JGI25161J50226_100004685 300
913 3300003374 JGI25161J50226_1003803 JGI25161J50226_10038033 300
914 3300003578 Ga0006562J51391_1008696 Ga0006562J51391_10086962 300
915 3300003578 Ga0006562J51391_1089387 Ga0006562J51391_10893871 300
916 3300003752 Ga0055539_1000823 Ga0055539_10008234 300
917 3300003752 Ga0055539_1001731 Ga0055539_10017313 300
918 3300003756 Ga0055533_1000033 Ga0055533_1000033198 300
919 3300003759 Ga0055525_1000626 Ga0055525_100062610 300
920 3300003761 Ga0055535_1000729 Ga0055535_10007294 300
921 3300003761 Ga0055535_1001191 Ga0055535_10011914 300
922 3300003762 Ga0055542_1000051 Ga0055542_1000051131 300
923 3300003763 Ga0055529_1000486 Ga0055529_10004863 300
924 3300003763 Ga0055529_1000651 Ga0055529_100065115 300
925 3300003771 Ga0055526_1001406 Ga0055526_100140610 300
926 3300003773 Ga0055537_1002635 Ga0055537_10026354 300
927 3300003781 Ga0055536_1004594 Ga0055536_10045943 300
928 3300003781 Ga0055536_1006845 Ga0055536_10068454 300
929 3300003781 Ga0055536_1026835 Ga0055536_10268352 300
930 3300003781 Ga0055536_1033906 Ga0055536_10339062 300
931 3300003784 Ga0055534_1001210 Ga0055534_100121010 300
932 3300003784 Ga0055534_1002774 Ga0055534_10027744 300
933 3300003784 Ga0055534_1009933 Ga0055534_10099332 300
934 3300003790 Ga0055528_1006257 Ga0055528_10062574 300
935 3300003791 Ga0055530_10002335 Ga0055530_100023353 300
936 3300003792 Ga0055540_1002542 Ga0055540_100254210 300
937 3300003792 Ga0055540_1005647 Ga0055540_10056474 300
938 3300003792 Ga0055540_1012543 Ga0055540_10125432 300
939 3300003792 Ga0055540_1025044 Ga0055540_10250442 300
940 3300003794 Ga0055531_10003298 Ga0055531_100032983 300
941 3300004625 Ga0055543_1003087 Ga0055543_10030874 300
942 3300004625 Ga0055543_1004223 Ga0055543_10042234 300
943 3300005262 Ga0065165_1008862 Ga0065165_10088622 300
944 3300005262 Ga0065165_1011665 Ga0065165_10116654 300
945 3300005288 Ga0065714_10067070 Ga0065714_100670706 300
946 3300005289 Ga0065704_10000527 Ga0065704_1000052716 300
947 3300005289 Ga0065704_10174071 Ga0065704_101740711 300
948 3300005295 Ga0065707_10083566 Ga0065707_100835662 300
949 3300005295 Ga0065707_10100635 Ga0065707_101006353 300
950 3300005327 Ga0070658_10046742 Ga0070658_100467423 300
951 3300005327 Ga0070658_10061070 Ga0070658_100610702 300
952 3300005327 Ga0070658_10093402 Ga0070658_100934023 300
953 3300005327 Ga0070658_10118072 Ga0070658_101180722 300
954 3300005327 Ga0070658_10271628 Ga0070658_102716281 300
955 3300005327 Ga0070658_10327523 Ga0070658_103275231 300
956 3300005328 Ga0070676_10021471 Ga0070676_100214712 300
957 3300005328 Ga0070676_10027594 Ga0070676_100275942 300
958 3300005328 Ga0070676_10037269 Ga0070676_100372692 300
959 3300005329 Ga0070683_100012048 Ga0070683_1000120489 300
960 3300005330 Ga0070690_100045855 Ga0070690_1000458553 300
961 3300005330 Ga0070690_100073900 Ga0070690_1000739001 300
962 3300005331 Ga0070670_100011320 Ga0070670_1000113204 300
963 3300005331 Ga0070670_100016165 Ga0070670_1000161655 300
964 3300005331 Ga0070670_100059375 Ga0070670_1000593752 300
965 3300005331 Ga0070670_100305349 Ga0070670_1003053492 300
966 3300005331 Ga0070670_100370845 Ga0070670_1003708452 300
967 3300005331 Ga0070670_100385259 Ga0070670_1003852591 300
968 3300005333 Ga0070677_10003229 Ga0070677_100032293 300
969 3300005333 Ga0070677_10042814 Ga0070677_100428142 300
970 3300005333 Ga0070677_10066252 Ga0070677_100662523 300
971 3300005333 Ga0070677_10070070 Ga0070677_100700701 300
972 3300005333 Ga0070677_10111828 Ga0070677_101118281 300
973 3300005334 Ga0068869_100002073 Ga0068869_1000020732 300
974 3300005334 Ga0068869_100131563 Ga0068869_1001315632 300
975 3300005335 Ga0070666_10029875 Ga0070666_100298753 300
976 3300005335 Ga0070666_10140395 Ga0070666_101403952 300
977 3300005336 Ga0070680_100002568 Ga0070680_1000025684 300
978 3300005337 Ga0070682_100334982 Ga0070682_1003349821 300
979 3300005338 Ga0068868_100007829 Ga0068868_1000078295 300
980 3300005338 Ga0068868_100115494 Ga0068868_1001154942 300
981 3300005339 Ga0070660_100061236 Ga0070660_1000612362 300
982 3300005339 Ga0070660_100199745 Ga0070660_1001997452 300
983 3300005339 Ga0070660_100201185 Ga0070660_1002011852 300
984 3300005339 Ga0070660_100288579 Ga0070660_1002885792 300
985 3300005344 Ga0070661_100006151 Ga0070661_1000061513 300
986 3300005347 Ga0070668_100063892 Ga0070668_1000638923 300
987 3300005347 Ga0070668_100134279 Ga0070668_1001342792 300
988 3300005347 Ga0070668_100252674 Ga0070668_1002526742 300
989 3300005353 Ga0070669_100003192 Ga0070669_1000031924 300
990 3300005353 Ga0070669_100012209 Ga0070669_1000122094 300
991 3300005353 Ga0070669_100023682 Ga0070669_1000236823 300
992 3300005353 Ga0070669_100032424 Ga0070669_1000324244 300
993 3300005353 Ga0070669_100155548 Ga0070669_1001555482 300
994 3300005354 Ga0070675_100005810 Ga0070675_1000058104 300
995 3300005354 Ga0070675_100018991 Ga0070675_1000189912 300
996 3300005355 Ga0070671_100004694 Ga0070671_10000469411 300
997 3300005355 Ga0070671_100009086 Ga0070671_1000090866 300
998 3300005355 Ga0070671_100071354 Ga0070671_1000713542 300
999 3300005355 Ga0070671_100124330 Ga0070671_1001243302 300
1000 3300005355 Ga0070671_100211519 Ga0070671_1002115192 300
1001 3300005356 Ga0070674_100001665 Ga0070674_1000016653 300
1002 3300005356 Ga0070674_100002116 Ga0070674_1000021167 300
1003 3300005356 Ga0070674_100050016 Ga0070674_1000500163 300
1004 3300005356 Ga0070674_100054802 Ga0070674_1000548023 300
1005 3300005356 Ga0070674_100101111 Ga0070674_1001011112 300
1006 3300005364 Ga0070673_100019126 Ga0070673_1000191262 300
1007 3300005364 Ga0070673_100101876 Ga0070673_1001018762 300
1008 3300005364 Ga0070673_100117614 Ga0070673_1001176142 300
1009 3300005364 Ga0070673_100119195 Ga0070673_1001191952 300
1010 3300005364 Ga0070673_100203326 Ga0070673_1002033262 300
1011 3300005364 Ga0070673_100468047 Ga0070673_1004680472 300
1012 3300005366 Ga0070659_100008597 Ga0070659_1000085972 300
1013 3300005366 Ga0070659_100033840 Ga0070659_1000338403 300
1014 3300005367 Ga0070667_100010447 Ga0070667_1000104474 300
1015 3300005367 Ga0070667_100019372 Ga0070667_1000193725 300
1016 3300005367 Ga0070667_100021857 Ga0070667_1000218576 300
1017 3300005367 Ga0070667_100036235 Ga0070667_1000362351 300
1018 3300005367 Ga0070667_100100233 Ga0070667_1001002333 300
1019 3300005367 Ga0070667_100126515 Ga0070667_1001265152 300
1020 3300005441 Ga0070700_100053384 Ga0070700_1000533843 300
1021 3300005445 Ga0070708_100213156 Ga0070708_1002131562 300
1022 3300005445 Ga0070708_100560270 Ga0070708_1005602701 300
1023 3300005455 Ga0070663_100000198 Ga0070663_10000019814 300
1024 3300005455 Ga0070663_100090772 Ga0070663_1000907722 300
1025 3300005455 Ga0070663_100353108 Ga0070663_1003531081 300
1026 3300005456 Ga0070678_100000674 Ga0070678_1000006744 300
1027 3300005456 Ga0070678_100054892 Ga0070678_1000548922 300
1028 3300005456 Ga0070678_100067241 Ga0070678_1000672413 300
1029 3300005456 Ga0070678_100073277 Ga0070678_1000732772 300
1030 3300005456 Ga0070678_100075770 Ga0070678_1000757703 300
1031 3300005456 Ga0070678_100099681 Ga0070678_1000996812 300
1032 3300005456 Ga0070678_100299072 Ga0070678_1002990722 300
1033 3300005456 Ga0070678_100632315 Ga0070678_1006323151 300
1034 3300005457 Ga0070662_100001463 Ga0070662_10000146314 300
1035 3300005457 Ga0070662_100024144 Ga0070662_1000241441 300
1036 3300005457 Ga0070662_100078143 Ga0070662_1000781431 300
1037 3300005457 Ga0070662_100123845 Ga0070662_1001238451 300
1038 3300005459 Ga0068867_100001272 Ga0068867_1000012726 300
1039 3300005459 Ga0068867_100006011 Ga0068867_1000060114 300
1040 3300005459 Ga0068867_100013864 Ga0068867_1000138644 300
1041 3300005459 Ga0068867_100014758 Ga0068867_1000147582 300
1042 3300005459 Ga0068867_100056970 Ga0068867_1000569702 300
1043 3300005459 Ga0068867_100102328 Ga0068867_1001023283 300
1044 3300005459 Ga0068867_100104602 Ga0068867_1001046021 300
1045 3300005467 Ga0070706_100001272 Ga0070706_1000012724 300
1046 3300005467 Ga0070706_100137603 Ga0070706_1001376033 300
1047 3300005468 Ga0070707_100266756 Ga0070707_1002667562 300
1048 3300005471 Ga0070698_100051994 Ga0070698_1000519942 300
1049 3300005530 Ga0070679_100019495 Ga0070679_1000194951 300
1050 3300005535 Ga0070684_100013947 Ga0070684_1000139477 300
1051 3300005535 Ga0070684_100138708 Ga0070684_1001387083 300
1052 3300005539 Ga0068853_100007636 Ga0068853_1000076363 300
1053 3300005539 Ga0068853_100042442 Ga0068853_1000424422 300
1054 3300005539 Ga0068853_100076302 Ga0068853_1000763022 300
1055 3300005539 Ga0068853_100250860 Ga0068853_1002508602 300
1056 3300005543 Ga0070672_100000561 Ga0070672_1000005613 300
1057 3300005543 Ga0070672_100000591 Ga0070672_10000059115 300
1058 3300005543 Ga0070672_100025794 Ga0070672_1000257942 300
1059 3300005543 Ga0070672_100108817 Ga0070672_1001088172 300
1060 3300005543 Ga0070672_100120116 Ga0070672_1001201161 300
1061 3300005543 Ga0070672_100131068 Ga0070672_1001310682 300
1062 3300005547 Ga0070693_100025519 Ga0070693_1000255194 300
1063 3300005548 Ga0070665_100002855 Ga0070665_1000028554 300
1064 3300005548 Ga0070665_100083138 Ga0070665_1000831383 300
1065 3300005548 Ga0070665_100117101 Ga0070665_1001171012 300
1066 3300005548 Ga0070665_100276259 Ga0070665_1002762592 300
1067 3300005548 Ga0070665_100298079 Ga0070665_1002980792 300
1068 3300005563 Ga0068855_100069778 Ga0068855_1000697782 300
1069 3300005563 Ga0068855_100082007 Ga0068855_1000820074 300
1070 3300005563 Ga0068855_100235056 Ga0068855_1002350563 300
1071 3300005563 Ga0068855_100261708 Ga0068855_1002617082 300
1072 3300005564 Ga0070664_100007606 Ga0070664_1000076063 300
1073 3300005564 Ga0070664_100060838 Ga0070664_1000608383 300
1074 3300005564 Ga0070664_100067936 Ga0070664_1000679362 300
1075 3300005564 Ga0070664_100224281 Ga0070664_1002242812 300
1076 3300005577 Ga0068857_100040571 Ga0068857_1000405712 300
1077 3300005577 Ga0068857_100171631 Ga0068857_1001716312 300
1078 3300005578 Ga0068854_100008427 Ga0068854_1000084274 300
1079 3300005578 Ga0068854_100053557 Ga0068854_1000535572 300
1080 3300005578 Ga0068854_100102894 Ga0068854_1001028943 300
1081 3300005578 Ga0068854_100198262 Ga0068854_1001982622 300
1082 3300005578 Ga0068854_100411045 Ga0068854_1004110451 300
1083 3300005614 Ga0068856_100046079 Ga0068856_1000460794 300
1084 3300005614 Ga0068856_100063805 Ga0068856_1000638053 300
1085 3300005614 Ga0068856_100091026 Ga0068856_1000910264 300
1086 3300005614 Ga0068856_100259273 Ga0068856_1002592732 300
1087 3300005615 Ga0070702_100016039 Ga0070702_1000160392 300
1088 3300005616 Ga0068852_100025539 Ga0068852_1000255394 300
1089 3300005616 Ga0068852_100045366 Ga0068852_1000453663 300
1090 3300005616 Ga0068852_100121065 Ga0068852_1001210652 300
1091 3300005616 Ga0068852_100126681 Ga0068852_1001266812 300
1092 3300005616 Ga0068852_100217318 Ga0068852_1002173183 300
1093 3300005617 Ga0068859_100016209 Ga0068859_1000162098 300
1094 3300005617 Ga0068859_100055113 Ga0068859_1000551132 300
1095 3300005617 Ga0068859_100068068 Ga0068859_1000680685 300
1096 3300005617 Ga0068859_100143965 Ga0068859_1001439653 300
1097 3300005618 Ga0068864_100010993 Ga0068864_1000109938 300
1098 3300005618 Ga0068864_100016150 Ga0068864_1000161504 300
1099 3300005618 Ga0068864_100088984 Ga0068864_1000889842 300
1100 3300005618 Ga0068864_100134287 Ga0068864_1001342872 300
1101 3300005718 Ga0068866_10008734 Ga0068866_100087344 300
1102 3300005718 Ga0068866_10067113 Ga0068866_100671132 300
1103 3300005718 Ga0068866_10122085 Ga0068866_101220852 300
1104 3300005719 Ga0068861_100056611 Ga0068861_1000566113 300
1105 3300005719 Ga0068861_100154985 Ga0068861_1001549852 300
1106 3300005834 Ga0068851_10004731 Ga0068851_100047316 300
1107 3300005834 Ga0068851_10008664 Ga0068851_100086643 300
1108 3300005834 Ga0068851_10012104 Ga0068851_100121043 300
1109 3300005834 Ga0068851_10043047 Ga0068851_100430472 300
1110 3300005834 Ga0068851_10131107 Ga0068851_101311071 300
1111 3300005840 Ga0068870_10002620 Ga0068870_100026205 300
1112 3300005840 Ga0068870_10059276 Ga0068870_100592763 300
1113 3300005841 Ga0068863_100098241 Ga0068863_1000982412 300
1114 3300005841 Ga0068863_100182376 Ga0068863_1001823761 300
1115 3300005841 Ga0068863_100266706 Ga0068863_1002667062 300
1116 3300005842 Ga0068858_100108008 Ga0068858_1001080082 300
1117 3300005843 Ga0068860_100000384 Ga0068860_10000038413 300
1118 3300005843 Ga0068860_100030965 Ga0068860_1000309654 300
1119 3300005844 Ga0068862_100006573 Ga0068862_1000065734 300
1120 3300005844 Ga0068862_100020286 Ga0068862_1000202862 300
1121 3300005844 Ga0068862_100036236 Ga0068862_1000362362 300
1122 3300005844 Ga0068862_100061392 Ga0068862_1000613922 300
1123 3300006038 Ga0075365_10003706 Ga0075365_100037063 300
1124 3300006038 Ga0075365_10102901 Ga0075365_101029012 300
1125 3300006042 Ga0075368_10004563 Ga0075368_100045632 300
1126 3300006042 Ga0075368_10034026 Ga0075368_100340263 300
1127 3300006042 Ga0075368_10061925 Ga0075368_100619252 300
1128 3300006042 Ga0075368_10082457 Ga0075368_100824572 300
1129 3300006048 Ga0075363_100010419 Ga0075363_1000104193 300
1130 3300006048 Ga0075363_100012621 Ga0075363_1000126214 300
1131 3300006048 Ga0075363_100021176 Ga0075363_1000211762 300
1132 3300006051 Ga0075364_10027705 Ga0075364_100277052 300
1133 3300006051 Ga0075364_10028255 Ga0075364_100282555 300
1134 3300006051 Ga0075364_10085223 Ga0075364_100852232 300
1135 3300006051 Ga0075364_10134422 Ga0075364_101344222 300
1136 3300006058 Ga0075432_10001571 Ga0075432_100015713 300
1137 3300006058 Ga0075432_10011559 Ga0075432_100115594 300
1138 3300006058 Ga0075432_10011753 Ga0075432_100117533 300
1139 3300006177 Ga0075362_10018876 Ga0075362_100188762 300
1140 3300006177 Ga0075362_10034529 Ga0075362_100345292 300
1141 3300006177 Ga0075362_10043673 Ga0075362_100436732 300
1142 3300006177 Ga0075362_10074067 Ga0075362_100740672 300
1143 3300006177 Ga0075362_10077023 Ga0075362_100770232 300
1144 3300006178 Ga0075367_10041612 Ga0075367_100416122 300
1145 3300006178 Ga0075367_10091504 Ga0075367_100915042 300
1146 3300006178 Ga0075367_10111162 Ga0075367_101111622 300
1147 3300006178 Ga0075367_10145160 Ga0075367_101451602 300
1148 3300006186 Ga0075369_10003511 Ga0075369_100035115 300
1149 3300006195 Ga0075366_10001740 Ga0075366_100017403 300
1150 3300006195 Ga0075366_10004822 Ga0075366_100048222 300
1151 3300006195 Ga0075366_10014446 Ga0075366_100144465 300
1152 3300006195 Ga0075366_10018110 Ga0075366_100181101 300
1153 3300006195 Ga0075366_10029438 Ga0075366_100294381 300
1154 3300006195 Ga0075366_10032029 Ga0075366_100320293 300
1155 3300006195 Ga0075366_10038850 Ga0075366_100388503 300
1156 3300006195 Ga0075366_10064550 Ga0075366_100645503 300
1157 3300006195 Ga0075366_10072162 Ga0075366_100721622 300
1158 3300006195 Ga0075366_10123749 Ga0075366_101237492 300
1159 3300006195 Ga0075366_10154790 Ga0075366_101547902 300
1160 3300006195 Ga0075366_10279340 Ga0075366_102793401 300
1161 3300006237 Ga0097621_100016477 Ga0097621_1000164772 300
1162 3300006237 Ga0097621_100040372 Ga0097621_1000403724 300
1163 3300006237 Ga0097621_100102002 Ga0097621_1001020024 300
1164 3300006237 Ga0097621_100115507 Ga0097621_1001155072 300
1165 3300006237 Ga0097621_100245721 Ga0097621_1002457212 300
1166 3300006353 Ga0075370_10000655 Ga0075370_100006551 300
1167 3300006353 Ga0075370_10001068 Ga0075370_1000106812 300
1168 3300006353 Ga0075370_10001217 Ga0075370_100012172 300
1169 3300006353 Ga0075370_10002553 Ga0075370_100025538 300
1170 3300006353 Ga0075370_10004950 Ga0075370_100049507 300
1171 3300006353 Ga0075370_10009932 Ga0075370_100099324 300
1172 3300006353 Ga0075370_10010373 Ga0075370_100103732 300
1173 3300006353 Ga0075370_10018767 Ga0075370_100187672 300
1174 3300006353 Ga0075370_10020440 Ga0075370_100204402 300
1175 3300006353 Ga0075370_10023793 Ga0075370_100237933 300
1176 3300006353 Ga0075370_10043697 Ga0075370_100436972 300
1177 3300006353 Ga0075370_10062020 Ga0075370_100620202 300
1178 3300006353 Ga0075370_10068570 Ga0075370_100685702 300
1179 3300006353 Ga0075370_10164498 Ga0075370_101644981 300
1180 3300006358 Ga0068871_100006832 Ga0068871_1000068329 300
1181 3300006358 Ga0068871_100011233 Ga0068871_1000112333 300
1182 3300006358 Ga0068871_100056045 Ga0068871_1000560453 300
1183 3300006358 Ga0068871_100058756 Ga0068871_1000587563 300
1184 3300006358 Ga0068871_100076780 Ga0068871_1000767802 300
1185 3300006358 Ga0068871_100275789 Ga0068871_1002757892 300
1186 3300006844 Ga0075428_100065550 Ga0075428_1000655502 300
1187 3300006846 Ga0075430_100017776 Ga0075430_1000177762 300
1188 3300006846 Ga0075430_100034176 Ga0075430_1000341763 300
1189 3300006847 Ga0075431_100043158 Ga0075431_1000431583 300
1190 3300006847 Ga0075431_100109237 Ga0075431_1001092371 300
1191 3300006880 Ga0075429_100001780 Ga0075429_1000017805 300
1192 3300006880 Ga0075429_100202144 Ga0075429_1002021443 300
1193 3300006881 Ga0068865_100027004 Ga0068865_1000270044 300
1194 3300006881 Ga0068865_100174076 Ga0068865_1001740761 300
1195 3300006881 Ga0068865_100232553 Ga0068865_1002325531 300
1196 3300006881 Ga0068865_100404320 Ga0068865_1004043202 300
1197 3300006931 Ga0097620_100016209 Ga0097620_1000162098 300
1198 3300006931 Ga0097620_100055112 Ga0097620_1000551124 300
1199 3300006931 Ga0097620_100068066 Ga0097620_1000680665 300
1200 3300006931 Ga0097620_100143961 Ga0097620_1001439613 300
1201 3300006948 Ga0099826_10029246 Ga0099826_100292462 300
1202 3300009036 Ga0105244_10004162 Ga0105244_100041622 300
1203 3300009036 Ga0105244_10166434 Ga0105244_101664341 300
1204 3300009092 Ga0105250_10000024 Ga0105250_10000024148 300
1205 3300009093 Ga0105240_10026040 Ga0105240_100260403 300
1206 3300009093 Ga0105240_10040696 Ga0105240_100406965 300
1207 3300009093 Ga0105240_10045918 Ga0105240_100459184 300
1208 3300009093 Ga0105240_10070914 Ga0105240_100709143 300
1209 3300009093 Ga0105240_10156609 Ga0105240_101566092 300
1210 3300009093 Ga0105240_10209237 Ga0105240_102092372 300
1211 3300009094 Ga0111539_10060338 Ga0111539_100603383 300
1212 3300009094 Ga0111539_10271886 Ga0111539_102718862 300
1213 3300009098 Ga0105245_10034605 Ga0105245_100346054 300
1214 3300009098 Ga0105245_10093165 Ga0105245_100931652 300
1215 3300009147 Ga0114129_10140897 Ga0114129_101408975 300
1216 3300009147 Ga0114129_10461854 Ga0114129_104618543 300
1217 3300009148 Ga0105243_10000717 Ga0105243_100007175 300
1218 3300009148 Ga0105243_10004194 Ga0105243_1000419412 300
1219 3300009148 Ga0105243_10007467 Ga0105243_100074678 300
1220 3300009148 Ga0105243_10026229 Ga0105243_100262294 300
1221 3300009148 Ga0105243_10480087 Ga0105243_104800872 300
1222 3300009148 Ga0105243_10515124 Ga0105243_105151242 300
1223 3300009174 Ga0105241_10074922 Ga0105241_100749222 300
1224 3300009174 Ga0105241_10214144 Ga0105241_102141442 300
1225 3300009174 Ga0105241_10241412 Ga0105241_102414122 300
1226 3300009174 Ga0105241_10397525 Ga0105241_103975252 300
1227 3300009176 Ga0105242_10028593 Ga0105242_100285934 300
1228 3300009176 Ga0105242_10493595 Ga0105242_104935951 300
1229 3300009177 Ga0105248_10001281 Ga0105248_100012812 300
1230 3300009177 Ga0105248_10008736 Ga0105248_100087364 300
1231 3300009177 Ga0105248_10049405 Ga0105248_100494053 300
1232 3300009177 Ga0105248_10131583 Ga0105248_101315832 300
1233 3300009545 Ga0105237_10000556 Ga0105237_1000055630 300
1234 3300009545 Ga0105237_10058752 Ga0105237_100587523 300
1235 3300009545 Ga0105237_10068926 Ga0105237_100689261 300
1236 3300009545 Ga0105237_10108013 Ga0105237_101080133 300
1237 3300009551 Ga0105238_10027640 Ga0105238_100276406 300
1238 3300009553 Ga0105249_10139237 Ga0105249_101392373 300
1239 3300009553 Ga0105249_10173475 Ga0105249_101734753 300
1240 3300010375 Ga0105239_10038650 Ga0105239_100386504 300
1241 3300010375 Ga0105239_10040258 Ga0105239_100402584 300
1242 3300010375 Ga0105239_10279324 Ga0105239_102793242 300
1243 3300010375 Ga0105239_10291649 Ga0105239_102916492 300
1244 3300011119 Ga0105246_10101314 Ga0105246_101013142 300
1245 3300012502 Ga0157347_1001810 Ga0157347_10018102 300
1246 3300013100 Ga0157373_10015071 Ga0157373_100150715 300
1247 3300013100 Ga0157373_10034332 Ga0157373_100343322 300
1248 3300013102 Ga0157371_10047269 Ga0157371_100472692 300
1249 3300013102 Ga0157371_10271892 Ga0157371_102718921 300
1250 3300013104 Ga0157370_10008219 Ga0157370_1000821912 300
1251 3300013104 Ga0157370_10118160 Ga0157370_101181602 300
1252 3300013104 Ga0157370_10297234 Ga0157370_102972342 300
1253 3300013105 Ga0157369_10010962 Ga0157369_100109629 300
1254 3300013105 Ga0157369_10231818 Ga0157369_102318182 300
1255 3300013105 Ga0157369_10295049 Ga0157369_102950492 300
1256 3300013296 Ga0157374_10056243 Ga0157374_100562433 300
1257 3300013296 Ga0157374_10116117 Ga0157374_101161173 300
1258 3300013296 Ga0157374_10213959 Ga0157374_102139593 300
1259 3300013297 Ga0157378_10073496 Ga0157378_100734963 300
1260 3300013297 Ga0157378_10394175 Ga0157378_103941752 300
1261 3300013297 Ga0157378_10424204 Ga0157378_104242042 300
1262 3300013306 Ga0163162_10023858 Ga0163162_100238582 300
1263 3300013306 Ga0163162_10100990 Ga0163162_101009903 300
1264 3300013306 Ga0163162_10161062 Ga0163162_101610622 300
1265 3300013306 Ga0163162_10271740 Ga0163162_102717401 300
1266 3300013306 Ga0163162_10648168 Ga0163162_106481681 300
1267 3300013307 Ga0157372_10014393 Ga0157372_100143939 300
1268 3300013307 Ga0157372_10026578 Ga0157372_100265783 300
1269 3300013307 Ga0157372_10089270 Ga0157372_100892702 300
1270 3300013307 Ga0157372_10136120 Ga0157372_101361204 300
1271 3300013308 Ga0157375_10033306 Ga0157375_100333064 300
1272 3300013308 Ga0157375_10041692 Ga0157375_100416924 300
1273 3300013308 Ga0157375_10052470 Ga0157375_100524704 300
1274 3300013308 Ga0157375_10170908 Ga0157375_101709082 300
1275 3300013308 Ga0157375_10201713 Ga0157375_102017133 300
1276 3300013308 Ga0157375_10248624 Ga0157375_102486241 300
1277 3300013308 Ga0157375_10269486 Ga0157375_102694862 300
1278 3300013308 Ga0157375_10431467 Ga0157375_104314672 300
1279 3300013308 Ga0157375_10508267 Ga0157375_105082672 300
1280 3300014325 Ga0163163_10615525 Ga0163163_106155252 300
1281 3300014326 Ga0157380_10010786 Ga0157380_100107863 300
1282 3300014326 Ga0157380_10028519 Ga0157380_100285193 300
1283 3300014326 Ga0157380_10058160 Ga0157380_100581602 300
1284 3300014326 Ga0157380_10142114 Ga0157380_101421142 300
1285 3300014497 Ga0182008_10001216 Ga0182008_1000121618 300
1286 3300014497 Ga0182008_10002832 Ga0182008_100028323 300
1287 3300014497 Ga0182008_10051879 Ga0182008_100518792 300
1288 3300014745 Ga0157377_10000032 Ga0157377_1000003273 300
1289 3300014745 Ga0157377_10009578 Ga0157377_100095784 300
1290 3300014745 Ga0157377_10083182 Ga0157377_100831823 300
1291 3300014968 Ga0157379_10000140 Ga0157379_1000014041 300
1292 3300014968 Ga0157379_10030694 Ga0157379_100306944 300
1293 3300014968 Ga0157379_10040091 Ga0157379_100400914 300
1294 3300014968 Ga0157379_10080472 Ga0157379_100804722 300
1295 3300014969 Ga0157376_10029344 Ga0157376_100293445 300
1296 3300014969 Ga0157376_10231648 Ga0157376_102316482 300
1297 3300015261 Ga0182006_1000937 Ga0182006_100093717 300
1298 3300015261 Ga0182006_1024117 Ga0182006_10241171 300
1299 3300015261 Ga0182006_1052009 Ga0182006_10520092 300
1300 3300015261 Ga0182006_1099398 Ga0182006_10993981 300
1301 3300015262 Ga0182007_10013833 Ga0182007_100138332 300
1302 3300015265 Ga0182005_1014889 Ga0182005_10148892 300
1303 3300015683 Ga0183362_10003 Ga0183362_10003852 300
1304 3300017792 Ga0163161_10000564 Ga0163161_100005642 300
1305 3300017792 Ga0163161_10003519 Ga0163161_100035192 300
1306 3300017792 Ga0163161_10080802 Ga0163161_100808022 300
1307 3300017792 Ga0163161_10166430 Ga0163161_101664301 300
1308 3300025206 Ga0209435_100003 Ga0209435_100003246 300
1309 3300025208 Ga0209436_109565 Ga0209436_1095652 300
1310 3300025226 Ga0209674_100064 Ga0209674_10006450 300
1311 3300025228 Ga0209672_101715 Ga0209672_1017154 300
1312 3300025229 Ga0209147_100972 Ga0209147_1009726 300
1313 3300025230 Ga0209563_100099 Ga0209563_10009950 300
1314 3300025231 Ga0207427_101233 Ga0207427_1012332 300
1315 3300025242 Ga0209258_100132 Ga0209258_100132130 300
1316 3300025242 Ga0209258_100319 Ga0209258_1003194 300
1317 3300025242 Ga0209258_103186 Ga0209258_1031863 300
1318 3300025245 Ga0207425_1000663 Ga0207425_100066317 300
1319 3300025245 Ga0207425_1000860 Ga0207425_100086010 300
1320 3300025245 Ga0207425_1006555 Ga0207425_10065553 300
1321 3300025245 Ga0207425_1011205 Ga0207425_10112053 300
1322 3300025246 Ga0209646_1000008 Ga0209646_1000008246 300
1323 3300025246 Ga0209646_1000060 Ga0209646_1000060194 300
1324 3300025250 Ga0209026_1000007 Ga0209026_1000007246 300
1325 3300025250 Ga0209026_1000049 Ga0209026_1000049192 300
1326 3300025253 Ga0209677_100331 Ga0209677_10033125 300
1327 3300025253 Ga0209677_101713 Ga0209677_1017135 300
1328 3300025253 Ga0209677_104963 Ga0209677_1049632 300
1329 3300025254 Ga0209148_1000007 Ga0209148_10000071215 300
1330 3300025256 Ga0209759_1000026 Ga0209759_100002634 300
1331 3300025256 Ga0209759_1000272 Ga0209759_100027223 300
1332 3300025256 Ga0209759_1000994 Ga0209759_100099418 300
1333 3300025256 Ga0209759_1004232 Ga0209759_10042324 300
1334 3300025256 Ga0209759_1009438 Ga0209759_10094383 300
1335 3300025256 Ga0209759_1010952 Ga0209759_10109524 300
1336 3300025258 Ga0209129_1000084 Ga0209129_10000842 300
1337 3300025258 Ga0209129_1000342 Ga0209129_100034225 300
1338 3300025258 Ga0209129_1004856 Ga0209129_10048563 300
1339 3300025258 Ga0209129_1008280 Ga0209129_10082803 300
1340 3300025258 Ga0209129_1009416 Ga0209129_10094162 300
1341 3300025263 Ga0209565_1000169 Ga0209565_10001693 300
1342 3300025263 Ga0209565_1000364 Ga0209565_10003642 300
1343 3300025263 Ga0209565_1000456 Ga0209565_10004562 300
1344 3300025263 Ga0209565_1000559 Ga0209565_10005593 300
1345 3300025263 Ga0209565_1014946 Ga0209565_10149462 300
1346 3300025272 Ga0209455_1000157 Ga0209455_100015743 300
1347 3300025273 Ga0209673_1000114 Ga0209673_10001143 300
1348 3300025273 Ga0209673_1000916 Ga0209673_100091635 300
1349 3300025273 Ga0209673_1003435 Ga0209673_100343510 300
1350 3300025273 Ga0209673_1024843 Ga0209673_10248432 300
1351 3300025273 Ga0209673_1044124 Ga0209673_10441241 300
1352 3300025284 Ga0209130_1000064 Ga0209130_100006485 300
1353 3300025284 Ga0209130_1000621 Ga0209130_10006212 300
1354 3300025284 Ga0209130_1001722 Ga0209130_10017222 300
1355 3300025284 Ga0209130_1003661 Ga0209130_10036614 300
1356 3300025291 Ga0209675_1000062 Ga0209675_10000623 300
1357 3300025291 Ga0209675_1001396 Ga0209675_10013968 300
1358 3300025291 Ga0209675_1001454 Ga0209675_10014542 300
1359 3300025291 Ga0209675_1002861 Ga0209675_10028613 300
1360 3300025291 Ga0209675_1006470 Ga0209675_10064702 300
1361 3300025292 Ga0209676_1000817 Ga0209676_100081735 300
1362 3300025292 Ga0209676_1000999 Ga0209676_100099930 300
1363 3300025292 Ga0209676_1001040 Ga0209676_10010403 300
1364 3300025292 Ga0209676_1004639 Ga0209676_10046394 300
1365 3300025292 Ga0209676_1006824 Ga0209676_10068245 300
1366 3300025292 Ga0209676_1020602 Ga0209676_10206021 300
1367 3300025292 Ga0209676_1025777 Ga0209676_10257772 300
1368 3300025294 Ga0209025_1000678 Ga0209025_100067822 300
1369 3300025294 Ga0209025_1000719 Ga0209025_100071913 300
1370 3300025294 Ga0209025_1000861 Ga0209025_10008614 300
1371 3300025294 Ga0209025_1005452 Ga0209025_100545210 300
1372 3300025294 Ga0209025_1005522 Ga0209025_10055222 300
1373 3300025294 Ga0209025_1019670 Ga0209025_10196702 300
1374 3300025294 Ga0209025_1045314 Ga0209025_10453142 300
1375 3300025295 Ga0209564_1000136 Ga0209564_100013656 300
1376 3300025295 Ga0209564_1001058 Ga0209564_100105830 300
1377 3300025295 Ga0209564_1001096 Ga0209564_100109630 300
1378 3300025297 Ga0209758_1000045 Ga0209758_1000045345 300
1379 3300025297 Ga0209758_1000275 Ga0209758_10002755 300
1380 3300025297 Ga0209758_1000754 Ga0209758_100075414 300
1381 3300025297 Ga0209758_1005541 Ga0209758_100554110 300
1382 3300025297 Ga0209758_1012521 Ga0209758_10125213 300
1383 3300025298 Ga0209050_1000052 Ga0209050_10000524 300
1384 3300025298 Ga0209050_1002554 Ga0209050_100255414 300
1385 3300025298 Ga0209050_1009392 Ga0209050_10093923 300
1386 3300025298 Ga0209050_1010791 Ga0209050_10107912 300
1387 3300025298 Ga0209050_1014302 Ga0209050_10143022 300
1388 3300025298 Ga0209050_1026814 Ga0209050_10268142 300
1389 3300025299 Ga0209256_1000206 Ga0209256_100020645 300
1390 3300025299 Ga0209256_1000239 Ga0209256_10002392 300
1391 3300025299 Ga0209256_1020997 Ga0209256_10209971 300
1392 3300025299 Ga0209256_1039080 Ga0209256_10390801 300
1393 3300025302 Ga0207426_1000049 Ga0207426_1000049181 300
1394 3300025302 Ga0207426_1000086 Ga0207426_10000863 300
1395 3300025302 Ga0207426_1000116 Ga0207426_100011662 300
1396 3300025302 Ga0207426_1000346 Ga0207426_10003462 300
1397 3300025303 Ga0209051_1000015 Ga0209051_1000015450 300
1398 3300025303 Ga0209051_1000420 Ga0209051_100042050 300
1399 3300025303 Ga0209051_1000617 Ga0209051_100061729 300
1400 3300025303 Ga0209051_1000824 Ga0209051_10008243 300
1401 3300025303 Ga0209051_1001151 Ga0209051_100115123 300
1402 3300025303 Ga0209051_1002289 Ga0209051_10022893 300
1403 3300025303 Ga0209051_1005082 Ga0209051_10050822 300
1404 3300025303 Ga0209051_1007105 Ga0209051_10071055 300
1405 3300025303 Ga0209051_1024938 Ga0209051_10249382 300
1406 3300025304 Ga0209257_1000037 Ga0209257_1000037295 300
1407 3300025304 Ga0209257_1000977 Ga0209257_100097723 300
1408 3300025304 Ga0209257_1001416 Ga0209257_100141617 300
1409 3300025304 Ga0209257_1004064 Ga0209257_10040642 300
1410 3300025304 Ga0209257_1008578 Ga0209257_10085783 300
1411 3300025304 Ga0209257_1009671 Ga0209257_10096714 300
1412 3300025304 Ga0209257_1021120 Ga0209257_10211202 300
1413 3300025315 Ga0207697_10012806 Ga0207697_100128064 300
1414 3300025321 Ga0207656_10005042 Ga0207656_100050423 300
1415 3300025321 Ga0207656_10008795 Ga0207656_100087954 300
1416 3300025321 Ga0207656_10011307 Ga0207656_100113072 300
1417 3300025321 Ga0207656_10026909 Ga0207656_100269092 300
1418 3300025711 Ga0207696_1000096 Ga0207696_100009613 300
1419 3300025728 Ga0207655_1001268 Ga0207655_100126810 300
1420 3300025893 Ga0207682_10005710 Ga0207682_100057104 300
1421 3300025893 Ga0207682_10008702 Ga0207682_100087022 300
1422 3300025893 Ga0207682_10024155 Ga0207682_100241552 300
1423 3300025893 Ga0207682_10055603 Ga0207682_100556032 300
1424 3300025893 Ga0207682_10070595 Ga0207682_100705952 300
1425 3300025893 Ga0207682_10121627 Ga0207682_101216272 300
1426 3300025899 Ga0207642_10127325 Ga0207642_101273252 300
1427 3300025901 Ga0207688_10263125 Ga0207688_102631252 300
1428 3300025903 Ga0207680_10048049 Ga0207680_100480494 300
1429 3300025904 Ga0207647_10000188 Ga0207647_1000018840 300
1430 3300025907 Ga0207645_10000171 Ga0207645_1000017124 300
1431 3300025907 Ga0207645_10012472 Ga0207645_100124724 300
1432 3300025907 Ga0207645_10020233 Ga0207645_100202334 300
1433 3300025907 Ga0207645_10027182 Ga0207645_100271824 300
1434 3300025907 Ga0207645_10074239 Ga0207645_100742393 300
1435 3300025908 Ga0207643_10005722 Ga0207643_100057223 300
1436 3300025908 Ga0207643_10029190 Ga0207643_100291902 300
1437 3300025909 Ga0207705_10119706 Ga0207705_101197062 300
1438 3300025910 Ga0207684_10020776 Ga0207684_100207764 300
1439 3300025910 Ga0207684_10117918 Ga0207684_101179182 300
1440 3300025912 Ga0207707_10103935 Ga0207707_101039352 300
1441 3300025913 Ga0207695_10023457 Ga0207695_100234574 300
1442 3300025913 Ga0207695_10049567 Ga0207695_100495672 300
1443 3300025913 Ga0207695_10281641 Ga0207695_102816411 300
1444 3300025914 Ga0207671_10022653 Ga0207671_100226534 300
1445 3300025914 Ga0207671_10143827 Ga0207671_101438272 300
1446 3300025914 Ga0207671_10269900 Ga0207671_102699001 300
1447 3300025917 Ga0207660_10031458 Ga0207660_100314584 300
1448 3300025917 Ga0207660_10057840 Ga0207660_100578403 300
1449 3300025919 Ga0207657_10052515 Ga0207657_100525153 300
1450 3300025919 Ga0207657_10101416 Ga0207657_101014162 300
1451 3300025919 Ga0207657_10142845 Ga0207657_101428452 300
1452 3300025920 Ga0207649_10003359 Ga0207649_100033596 300
1453 3300025920 Ga0207649_10111584 Ga0207649_101115842 300
1454 3300025921 Ga0207652_10036056 Ga0207652_100360562 300
1455 3300025922 Ga0207646_10029822 Ga0207646_100298222 300
1456 3300025923 Ga0207681_10001755 Ga0207681_1000175513 300
1457 3300025923 Ga0207681_10008014 Ga0207681_100080145 300
1458 3300025923 Ga0207681_10038931 Ga0207681_100389312 300
1459 3300025923 Ga0207681_10086351 Ga0207681_100863512 300
1460 3300025924 Ga0207694_10046172 Ga0207694_100461722 300
1461 3300025925 Ga0207650_10000149 Ga0207650_1000014934 300
1462 3300025925 Ga0207650_10003696 Ga0207650_100036964 300
1463 3300025925 Ga0207650_10027122 Ga0207650_100271222 300
1464 3300025925 Ga0207650_10158731 Ga0207650_101587313 300
1465 3300025925 Ga0207650_10300731 Ga0207650_103007312 300
1466 3300025926 Ga0207659_10001112 Ga0207659_1000111214 300
1467 3300025926 Ga0207659_10034567 Ga0207659_100345674 300
1468 3300025926 Ga0207659_10319205 Ga0207659_103192051 300
1469 3300025927 Ga0207687_10079496 Ga0207687_100794962 300
1470 3300025927 Ga0207687_10171809 Ga0207687_101718091 300
1471 3300025927 Ga0207687_10249285 Ga0207687_102492852 300
1472 3300025931 Ga0207644_10029239 Ga0207644_100292396 300
1473 3300025931 Ga0207644_10059566 Ga0207644_100595662 300
1474 3300025931 Ga0207644_10137604 Ga0207644_101376042 300
1475 3300025932 Ga0207690_10010413 Ga0207690_100104135 300
1476 3300025933 Ga0207706_10000327 Ga0207706_1000032732 300
1477 3300025933 Ga0207706_10001200 Ga0207706_1000120016 300
1478 3300025933 Ga0207706_10008543 Ga0207706_100085439 300
1479 3300025933 Ga0207706_10068765 Ga0207706_100687653 300
1480 3300025933 Ga0207706_10184799 Ga0207706_101847991 300
1481 3300025933 Ga0207706_10228177 Ga0207706_102281771 300
1482 3300025933 Ga0207706_10232922 Ga0207706_102329221 300
1483 3300025933 Ga0207706_10327239 Ga0207706_103272391 300
1484 3300025934 Ga0207686_10099402 Ga0207686_100994022 300
1485 3300025935 Ga0207709_10000572 Ga0207709_1000057229 300
1486 3300025935 Ga0207709_10001051 Ga0207709_100010511 300
1487 3300025935 Ga0207709_10001477 Ga0207709_1000147713 300
1488 3300025937 Ga0207669_10002372 Ga0207669_100023722 300
1489 3300025937 Ga0207669_10027664 Ga0207669_100276642 300
1490 3300025937 Ga0207669_10048839 Ga0207669_100488392 300
1491 3300025937 Ga0207669_10052751 Ga0207669_100527513 300
1492 3300025937 Ga0207669_10127489 Ga0207669_101274892 300
1493 3300025937 Ga0207669_10352608 Ga0207669_103526082 300
1494 3300025938 Ga0207704_10050525 Ga0207704_100505252 300
1495 3300025938 Ga0207704_10134655 Ga0207704_101346552 300
1496 3300025938 Ga0207704_10155859 Ga0207704_101558592 300
1497 3300025940 Ga0207691_10000362 Ga0207691_1000036220 300
1498 3300025940 Ga0207691_10000559 Ga0207691_1000055937 300
1499 3300025940 Ga0207691_10004379 Ga0207691_1000437915 300
1500 3300025940 Ga0207691_10019231 Ga0207691_100192315 300
1501 3300025940 Ga0207691_10027591 Ga0207691_100275914 300
1502 3300025940 Ga0207691_10079792 Ga0207691_100797922 300
1503 3300025940 Ga0207691_10115396 Ga0207691_101153962 300
1504 3300025940 Ga0207691_10118941 Ga0207691_101189412 300
1505 3300025940 Ga0207691_10175577 Ga0207691_101755772 300
1506 3300025941 Ga0207711_10003826 Ga0207711_100038264 300
1507 3300025941 Ga0207711_10013604 Ga0207711_100136043 300
1508 3300025941 Ga0207711_10013970 Ga0207711_100139702 300
1509 3300025941 Ga0207711_10169069 Ga0207711_101690692 300
1510 3300025942 Ga0207689_10005832 Ga0207689_1000583210 300
1511 3300025942 Ga0207689_10067737 Ga0207689_100677372 300
1512 3300025942 Ga0207689_10090342 Ga0207689_100903422 300
1513 3300025942 Ga0207689_10190466 Ga0207689_101904662 300
1514 3300025944 Ga0207661_10066729 Ga0207661_100667292 300
1515 3300025944 Ga0207661_10361611 Ga0207661_103616112 300
1516 3300025945 Ga0207679_10009139 Ga0207679_100091395 300
1517 3300025945 Ga0207679_10043650 Ga0207679_100436501 300
1518 3300025945 Ga0207679_10054904 Ga0207679_100549042 300
1519 3300025949 Ga0207667_10094881 Ga0207667_100948813 300
1520 3300025960 Ga0207651_10014266 Ga0207651_100142664 300
1521 3300025960 Ga0207651_10026206 Ga0207651_100262062 300
1522 3300025960 Ga0207651_10032202 Ga0207651_100322022 300
1523 3300025960 Ga0207651_10188987 Ga0207651_101889872 300
1524 3300025960 Ga0207651_10255739 Ga0207651_102557391 300
1525 3300025960 Ga0207651_10444250 Ga0207651_104442501 300
1526 3300025961 Ga0207712_10014991 Ga0207712_100149912 300
1527 3300025981 Ga0207640_10040930 Ga0207640_100409303 300
1528 3300025981 Ga0207640_10154648 Ga0207640_101546481 300
1529 3300025986 Ga0207658_10009698 Ga0207658_100096983 300
1530 3300025986 Ga0207658_10042580 Ga0207658_100425802 300
1531 3300025986 Ga0207658_10156322 Ga0207658_101563222 300
1532 3300025986 Ga0207658_10232227 Ga0207658_102322272 300
1533 3300026023 Ga0207677_10007425 Ga0207677_100074254 300
1534 3300026023 Ga0207677_10203959 Ga0207677_102039592 300
1535 3300026035 Ga0207703_10009460 Ga0207703_100094606 300
1536 3300026035 Ga0207703_10065016 Ga0207703_100650163 300
1537 3300026035 Ga0207703_10457216 Ga0207703_104572161 300
1538 3300026041 Ga0207639_10105221 Ga0207639_101052212 300
1539 3300026041 Ga0207639_10122643 Ga0207639_101226432 300
1540 3300026067 Ga0207678_10000684 Ga0207678_1000068416 300
1541 3300026067 Ga0207678_10007290 Ga0207678_1000729011 300
1542 3300026067 Ga0207678_10072411 Ga0207678_100724112 300
1543 3300026067 Ga0207678_10127354 Ga0207678_101273541 300
1544 3300026075 Ga0207708_10112931 Ga0207708_101129313 300
1545 3300026075 Ga0207708_10140717 Ga0207708_101407173 300
1546 3300026078 Ga0207702_10000395 Ga0207702_1000039537 300
1547 3300026078 Ga0207702_10022131 Ga0207702_100221312 300
1548 3300026078 Ga0207702_10080989 Ga0207702_100809893 300
1549 3300026078 Ga0207702_10255805 Ga0207702_102558052 300
1550 3300026078 Ga0207702_10375834 Ga0207702_103758341 300
1551 3300026088 Ga0207641_10046333 Ga0207641_100463332 300
1552 3300026088 Ga0207641_10060193 Ga0207641_100601933 300
1553 3300026088 Ga0207641_10793408 Ga0207641_107934081 300
1554 3300026089 Ga0207648_10000450 Ga0207648_1000045037 300
1555 3300026089 Ga0207648_10000790 Ga0207648_100007904 300
1556 3300026089 Ga0207648_10001193 Ga0207648_1000119322 300
1557 3300026089 Ga0207648_10013992 Ga0207648_100139927 300
1558 3300026089 Ga0207648_10027644 Ga0207648_100276442 300
1559 3300026089 Ga0207648_10053938 Ga0207648_100539381 300
1560 3300026089 Ga0207648_10080605 Ga0207648_100806051 300
1561 3300026089 Ga0207648_10165453 Ga0207648_101654532 300
1562 3300026095 Ga0207676_10011836 Ga0207676_100118364 300
1563 3300026095 Ga0207676_10015722 Ga0207676_100157225 300
1564 3300026095 Ga0207676_10068636 Ga0207676_100686362 300
1565 3300026095 Ga0207676_10163267 Ga0207676_101632673 300
1566 3300026095 Ga0207676_10357594 Ga0207676_103575942 300
1567 3300026116 Ga0207674_10003791 Ga0207674_1000379118 300
1568 3300026116 Ga0207674_10131495 Ga0207674_101314953 300
1569 3300026116 Ga0207674_10202043 Ga0207674_102020432 300
1570 3300026116 Ga0207674_10280038 Ga0207674_102800382 300
1571 3300026116 Ga0207674_10573705 Ga0207674_105737052 300
1572 3300026118 Ga0207675_100000186 Ga0207675_10000018626 300
1573 3300026118 Ga0207675_100001873 Ga0207675_10000187319 300
1574 3300026118 Ga0207675_100007853 Ga0207675_1000078534 300
1575 3300026118 Ga0207675_100033459 Ga0207675_1000334594 300
1576 3300026118 Ga0207675_100158376 Ga0207675_1001583763 300
1577 3300026121 Ga0207683_10001421 Ga0207683_100014219 300
1578 3300026121 Ga0207683_10038660 Ga0207683_100386603 300
1579 3300026121 Ga0207683_10101575 Ga0207683_101015752 300
1580 3300026121 Ga0207683_10120483 Ga0207683_101204832 300
1581 3300026121 Ga0207683_10178346 Ga0207683_101783462 300
1582 3300026121 Ga0207683_10207870 Ga0207683_102078701 300
1583 3300026121 Ga0207683_10213200 Ga0207683_102132001 300
1584 3300026121 Ga0207683_10313587 Ga0207683_103135872 300
1585 3300026142 Ga0207698_10042409 Ga0207698_100424092 300
1586 3300026142 Ga0207698_10048807 Ga0207698_100488072 300
1587 3300026142 Ga0207698_10112785 Ga0207698_101127852 300
1588 3300026142 Ga0207698_10166172 Ga0207698_101661722 300
1589 3300026142 Ga0207698_10246750 Ga0207698_102467502 300
1590 3300027111 Ga0209281_1031074 Ga0209281_10310741 300
1591 3300027395 Ga0209996_1002892 Ga0209996_10028922 300
1592 3300027526 Ga0209968_1001737 Ga0209968_10017372 300
1593 3300027617 Ga0210002_1001738 Ga0210002_10017382 300
1594 3300027665 Ga0209983_1000360 Ga0209983_10003604 300
1595 3300027666 Ga0209282_1000832 Ga0209282_10008323 300
1596 3300027695 Ga0209966_1000138 Ga0209966_10001385 300
1597 3300027717 Ga0209998_10000686 Ga0209998_100006868 300
1598 3300027717 Ga0209998_10009329 Ga0209998_100093291 300
1599 3300027866 Ga0209813_10021556 Ga0209813_100215562 300
1600 3300027876 Ga0209974_10000459 Ga0209974_1000045910 300
1601 3300027876 Ga0209974_10001528 Ga0209974_100015286 300
1602 3300027907 Ga0207428_10139944 Ga0207428_101399442 300
1603 3300028379 Ga0268266_10028422 Ga0268266_100284224 300
1604 3300028379 Ga0268266_10072619 Ga0268266_100726193 300
1605 3300028379 Ga0268266_10159186 Ga0268266_101591862 300
1606 3300028379 Ga0268266_10182421 Ga0268266_101824213 300
1607 3300028379 Ga0268266_10244102 Ga0268266_102441022 300
1608 3300028380 Ga0268265_10006473 Ga0268265_100064738 300
1609 3300028380 Ga0268265_10017660 Ga0268265_100176603 300
1610 3300028380 Ga0268265_10048239 Ga0268265_100482393 300
1611 3300028380 Ga0268265_10142528 Ga0268265_101425281 300
1612 3300028380 Ga0268265_10164701 Ga0268265_101647013 300
1613 3300028381 Ga0268264_10002327 Ga0268264_1000232716 300
1614 3300028381 Ga0268264_10007640 Ga0268264_100076409 300
1615 3300028381 Ga0268264_10130336 Ga0268264_101303361 300
1616 3300028381 Ga0268264_10274119 Ga0268264_102741192 300
1617 3300028573 Ga0265334_10000038 Ga0265334_1000003867 300
1618 3300028573 Ga0265334_10028236 Ga0265334_100282363 300
1619 3300028666 Ga0265336_10000040 Ga0265336_1000004085 300
1620 3300028786 Ga0307517_10002864 Ga0307517_100028644 300
1621 3300028786 Ga0307517_10084727 Ga0307517_100847271 300
1622 3300028786 Ga0307517_10148095 Ga0307517_101480952 300
1623 3300028794 Ga0307515_10000278 Ga0307515_1000027837 300
1624 3300028794 Ga0307515_10001613 Ga0307515_1000161347 300
1625 3300028794 Ga0307515_10001625 Ga0307515_1000162510 300
1626 3300028794 Ga0307515_10003475 Ga0307515_1000347528 300
1627 3300028794 Ga0307515_10005665 Ga0307515_100056654 300
1628 3300028794 Ga0307515_10031234 Ga0307515_1003123411 300
1629 3300028794 Ga0307515_10031933 Ga0307515_100319338 300
1630 3300028794 Ga0307515_10217032 Ga0307515_102170321 300
1631 3300029957 Ga0265324_10009599 Ga0265324_100095992 300
1632 3300029957 Ga0265324_10018631 Ga0265324_100186312 300
1633 3300030522 Ga0307512_10020320 Ga0307512_100203203 300
1634 3300030522 Ga0307512_10132583 Ga0307512_101325832 300
1635 3300030522 Ga0307512_10195570 Ga0307512_101955701 300
1636 3300030731 Ga0316177_1053509 Ga0316177_10535094 300
1637 3300030733 Ga0314311_1052885 Ga0314311_10528852 300
1638 3300030735 Ga0316178_1008540 Ga0316178_10085403 300
1639 3300030744 Ga0316181_1130612 Ga0316181_11306124 300
1640 3300030745 Ga0316182_1433267 Ga0316182_14332673 300
1641 3300031247 Ga0265340_10020106 Ga0265340_100201062 300
1642 3300031250 Ga0265331_10075722 Ga0265331_100757222 300
1643 3300031251 Ga0265327_10000178 Ga0265327_1000017887 300
1644 3300031251 Ga0265327_10010623 Ga0265327_100106234 300
1645 3300031251 Ga0265327_10063393 Ga0265327_100633932 300
1646 3300031344 Ga0265316_10000180 Ga0265316_1000018052 300
1647 3300031456 Ga0307513_10000008 Ga0307513_10000008242 300
1648 3300031456 Ga0307513_10000441 Ga0307513_1000044150 300
1649 3300031456 Ga0307513_10025212 Ga0307513_100252122 300
1650 3300031456 Ga0307513_10036901 Ga0307513_100369012 300
1651 3300031456 Ga0307513_10044997 Ga0307513_100449972 300
1652 3300031456 Ga0307513_10132842 Ga0307513_101328423 300
1653 3300031456 Ga0307513_10147842 Ga0307513_101478422 300
1654 3300031456 Ga0307513_10185660 Ga0307513_101856602 300
1655 3300031507 Ga0307509_10000991 Ga0307509_1000099154 300
1656 3300031507 Ga0307509_10091612 Ga0307509_100916123 300
1657 3300031507 Ga0307509_10115853 Ga0307509_101158532 300
1658 3300031507 Ga0307509_10150965 Ga0307509_101509652 300
1659 3300031507 Ga0307509_10169857 Ga0307509_101698573 300
1660 3300031548 Ga0307408_100129551 Ga0307408_1001295512 300
1661 3300031548 Ga0307408_100158453 Ga0307408_1001584531 300
1662 3300031548 Ga0307408_100190791 Ga0307408_1001907912 300
1663 3300031548 Ga0307408_100242045 Ga0307408_1002420451 300
1664 3300031548 Ga0307408_100352232 Ga0307408_1003522322 300
1665 3300031595 Ga0265313_10000102 Ga0265313_100001023 300
1666 3300031616 Ga0307508_10000043 Ga0307508_1000004399 300
1667 3300031616 Ga0307508_10008769 Ga0307508_100087696 300
1668 3300031649 Ga0307514_10000850 Ga0307514_1000085010 300
1669 3300031649 Ga0307514_10002962 Ga0307514_1000296210 300
1670 3300031649 Ga0307514_10051575 Ga0307514_100515753 300
1671 3300031649 Ga0307514_10143879 Ga0307514_101438791 300
1672 3300031649 Ga0307514_10227969 Ga0307514_102279691 300
1673 3300031665 Ga0316575_10016586 Ga0316575_100165862 300
1674 3300031727 Ga0316576_10003443 Ga0316576_100034439 300
1675 3300031727 Ga0316576_10291199 Ga0316576_102911992 300
1676 3300031730 Ga0307516_10000419 Ga0307516_1000041943 300
1677 3300031730 Ga0307516_10000953 Ga0307516_1000095331 300
1678 3300031730 Ga0307516_10017660 Ga0307516_100176604 300
1679 3300031730 Ga0307516_10052978 Ga0307516_100529782 300
1680 3300031730 Ga0307516_10079661 Ga0307516_100796614 300
1681 3300031730 Ga0307516_10098376 Ga0307516_100983763 300
1682 3300031730 Ga0307516_10258669 Ga0307516_102586692 300
1683 3300031731 Ga0307405_10006234 Ga0307405_100062345 300
1684 3300031731 Ga0307405_10022793 Ga0307405_100227933 300
1685 3300031731 Ga0307405_10049995 Ga0307405_100499953 300
1686 3300031731 Ga0307405_10159967 Ga0307405_101599673 300
1687 3300031733 Ga0316577_10031841 Ga0316577_100318412 300
1688 3300031824 Ga0307413_10024560 Ga0307413_100245603 300
1689 3300031824 Ga0307413_10026162 Ga0307413_100261622 300
1690 3300031852 Ga0307410_10009498 Ga0307410_100094982 300
1691 3300031852 Ga0307410_10037404 Ga0307410_100374044 300
1692 3300031852 Ga0307410_10363856 Ga0307410_103638561 300
1693 3300031901 Ga0307406_10006447 Ga0307406_100064473 300
1694 3300031901 Ga0307406_10019188 Ga0307406_100191882 300
1695 3300031903 Ga0307407_10147861 Ga0307407_101478612 300
1696 3300031911 Ga0307412_10012422 Ga0307412_100124222 300
1697 3300031911 Ga0307412_10089609 Ga0307412_100896092 300
1698 3300031911 Ga0307412_10148863 Ga0307412_101488632 300
1699 3300031911 Ga0307412_10323309 Ga0307412_103233092 300
1700 3300031995 Ga0307409_100003205 Ga0307409_1000032057 300
1701 3300031995 Ga0307409_100005035 Ga0307409_1000050352 300
1702 3300031995 Ga0307409_100091270 Ga0307409_1000912702 300
1703 3300031995 Ga0307409_100137407 Ga0307409_1001374072 300
1704 3300032002 Ga0307416_100012555 Ga0307416_1000125554 300
1705 3300032002 Ga0307416_100018314 Ga0307416_1000183142 300
1706 3300032002 Ga0307416_100049793 Ga0307416_1000497932 300
1707 3300032002 Ga0307416_100086625 Ga0307416_1000866252 300
1708 3300032002 Ga0307416_100087583 Ga0307416_1000875832 300
1709 3300032002 Ga0307416_100119263 Ga0307416_1001192632 300
1710 3300032002 Ga0307416_100356653 Ga0307416_1003566532 300
1711 3300032004 Ga0307414_10017945 Ga0307414_100179452 300
1712 3300032005 Ga0307411_10031809 Ga0307411_100318093 300
1713 3300032005 Ga0307411_10079139 Ga0307411_100791392 300
1714 3300032005 Ga0307411_10254896 Ga0307411_102548962 300
1715 3300032005 Ga0307411_10290230 Ga0307411_102902301 300
1716 3300032126 Ga0307415_100003949 Ga0307415_1000039496 300
1717 3300032126 Ga0307415_100024845 Ga0307415_1000248452 300
1718 3300032126 Ga0307415_100053110 Ga0307415_1000531102 300
1719 3300032133 Ga0316583_10035785 Ga0316583_100357851 300
1720 3300032137 Ga0316585_10012534 Ga0316585_100125342 300
1721 3300032139 Ga0316580_10010417 Ga0316580_100104172 300
1722 3300033179 Ga0307507_10039242 Ga0307507_100392423 300
1723 3300034816 Ga0373930_0014021 Ga0373930_0014021_446_1351 300
1724 3300035086 Ga0373934_0099337 Ga0373934_0099337_243_1148 300
1725 3300035113 Ga0373936_0091216 Ga0373936_0091216_160_1065 300
1726 3300035172 Ga0373955_0017537 Ga0373955_0017537_964_1869 300
1727 3300035207 Ga0373942_0011463 Ga0373942_0011463_479_1384 300
1728 3300035398 Ga0316574_0000259 Ga0316574_0000259_13012_13944 300
1729 3300035398 Ga0316574_0210229 Ga0316574_0210229_281_1216 300
1730 3300035410 Ga0373924_0081314 Ga0373924_0081314_11_919 300
1731 3300035691 Ga0373931_0008764 Ga0373931_0008764_3111_4016 300
1732 3300035691 Ga0373931_0011924 Ga0373931_0011924_1598_2503 300
1733 3300035692 Ga0373935_0208350 Ga0373935_0208350_68_973 300
1734 3300035692 Ga0373935_0313957 Ga0373935_0313957_60_965 300
1735 3300035695 Ga0373927_0078949 Ga0373927_0078949_200_1108 300
1736 3300035724 Ga0373933_0098498 Ga0373933_0098498_761_1666 300
1737 3300035725 Ga0373947_0097465 Ga0373947_0097465_422_1327 300
1738 3300035725 Ga0373947_0291770 Ga0373947_0291770_71_979 300
1739 3300036401 Ga0373937_0089120 Ga0373937_0089120_1176_2081 300
1740 3300036401 Ga0373937_0229489 Ga0373937_0229489_49_954 300
1741 3300036401 Ga0373937_0269447 Ga0373937_0269447_16_948 300
1742 3300036647 Ga0316582_0078283 Ga0316582_0078283_878_1813 300
1743 3300036647 Ga0316582_0178454 Ga0316582_0178454_359_1291 300
1744 3300036712 Ga0316584_0032131 Ga0316584_0032131_1015_1950 300
1745 3300036712 Ga0316584_0225816 Ga0316584_0225816_213_1145 300
1746 3300037068 Ga0373925_0001792 Ga0373925_0001792_5902_6810 300
1747 3300037068 Ga0373925_0077160 Ga0373925_0077160_364_1284 300
1748 3300037068 Ga0373925_0189554 Ga0373925_0189554_91_996 300
1749 3300037418 Ga0395900_0000617 Ga0395900_0000617_46246_47160 300
1750 3300037466 Ga0395898_0006191 Ga0395898_0006191_136_1050 300
1751 3300037466 Ga0395898_0089327 Ga0395898_0089327_630_1535 300
1752 3300037471 Ga0395905_0037897 Ga0395905_0037897_2403_3311 300
1753 3300037471 Ga0395905_0040013 Ga0395905_0040013_2555_3463 300
1754 3300038443 Ga0395901_0001180 Ga0395901_0001180_10661_11566 300
1755 3300038443 Ga0395901_0146573 Ga0395901_0146573_70_975 300
1756 3300039437 Ga0436365_1244488 Ga0436365_1244488_3500_4405 300
1757 3300039447 Ga0436361_0148040 Ga0436361_0148040_1741_2646 300
1758 3300041404 Ga0439436_0002666 Ga0439436_0002666_1087_1989 300
1759 3300041404 Ga0439436_0004111 Ga0439436_0004111_3230_4132 300
1760 3300041405 Ga0439438_017758 Ga0439438_017758_615_1517 300
1761 3300041406 Ga0439439_0004613 Ga0439439_0004613_1124_2026 300
1762 3300041407 Ga0439447_031999 Ga0439447_031999_119_1021 300
1763 3300041411 Ga0439466_0008984 Ga0439466_0008984_697_1599 300
1764 3300041411 Ga0439466_0013895 Ga0439466_0013895_135_1037 300
1765 3300041411 Ga0439466_0023634 Ga0439466_0023634_256_1158 300
1766 3300041413 Ga0439465_0000423 Ga0439465_0000423_8110_9012 300
1767 3300041413 Ga0439465_0046201 Ga0439465_0046201_55_957 300
1768 3300041463 Ga0451804_0097016 Ga0451804_0097016_103_1008 300
1769 3300041997 Ga0439431_0002666 Ga0439431_0002666_2320_3222 300
1770 3300041999 Ga0439433_0004604 Ga0439433_0004604_384_1292 300
1771 3300041999 Ga0439433_0009084 Ga0439433_0009084_1054_1956 300
1772 3300041999 Ga0439433_0017947 Ga0439433_0017947_266_1168 300
1773 3300042002 Ga0439442_002618 Ga0439442_002618_1156_2058 300
1774 3300042002 Ga0439442_007450 Ga0439442_007450_217_1119 300
1775 3300042004 Ga0439445_0001349 Ga0439445_0001349_1102_2004 300
1776 3300042004 Ga0439445_0009382 Ga0439445_0009382_427_1329 300
1777 3300042006 Ga0439432_005010 Ga0439432_005010_23_925 300
1778 3300042006 Ga0439432_008828 Ga0439432_008828_1664_2566 300
1779 3300042007 Ga0439449_0006421 Ga0439449_0006421_824_1726 300
1780 3300042007 Ga0439449_0020974 Ga0439449_0020974_521_1423 300
1781 3300042010 Ga0439452_005776 Ga0439452_005776_862_1764 300
1782 3300042012 Ga0439455_0040424 Ga0439455_0040424_129_1037 300
1783 3300042014 Ga0439457_003844 Ga0439457_003844_141_1043 300
1784 3300042014 Ga0439457_005538 Ga0439457_005538_1457_2359 300
1785 3300042015 Ga0439462_0005972 Ga0439462_0005972_1061_1963 300
1786 3300042015 Ga0439462_0008820 Ga0439462_0008820_707_1609 300
1787 3300042015 Ga0439462_0015867 Ga0439462_0015867_12_926 300
1788 3300042115 Ga0450911_001624 Ga0450911_001624_1626_2528 300
1789 3300042121 Ga0450919_004441 Ga0450919_004441_27_929 300
1790 3300042125 Ga0450923_004932 Ga0450923_004932_340_1242 300
1791 3300042128 Ga0450897_001376 Ga0450897_001376_287_1189 300
1792 3300042131 Ga0450894_009746 Ga0450894_009746_257_1159 300
1793 3300042134 Ga0450898_013925 Ga0450898_013925_306_1208 300
1794 3300042145 Ga0450906_005055 Ga0450906_005055_175_1077 300
1795 3300042156 Ga0439446_0004291 Ga0439446_0004291_1076_1978 300
1796 3300042156 Ga0439446_0007197 Ga0439446_0007197_936_1838 300
1797 3300042435 Ga0439434_0005803 Ga0439434_0005803_1555_2457 300
1798 3300042435 Ga0439434_0020316 Ga0439434_0020316_1044_1946 300
1799 3300042876 Ga0451577_0020219 Ga0451577_0020219_2061_2966 300
1800 3300042876 Ga0451577_0027448 Ga0451577_0027448_1421_2353 300
1801 3300042876 Ga0451577_0058212 Ga0451577_0058212_1127_2059 300
1802 3300042876 Ga0451577_0519119 Ga0451577_0519119_77_1009 300
1803 3300044656 Ga0466969_0000013 Ga0466969_0000013_109657_110565 300
1804 3300044656 Ga0466969_0012997 Ga0466969_0012997_975_1880 300
1805 3300044656 Ga0466969_0017510 Ga0466969_0017510_2096_3004 300
1806 3300044658 Ga0466972_0006888 Ga0466972_0006888_1697_2605 300
1807 3300044683 Ga0466965_0003102 Ga0466965_0003102_606_1511 300
1808 3300044683 Ga0466965_0063128 Ga0466965_0063128_800_1708 300
1809 3300044684 Ga0466966_0018138 Ga0466966_0018138_1149_2054 300
1810 3300044684 Ga0466966_0057982 Ga0466966_0057982_1038_1946 300
1811 3300044693 Ga0466961_0021899 Ga0466961_0021899_2061_2966 300
1812 3300044693 Ga0466961_0053993 Ga0466961_0053993_1452_2474 300
1813 3300044693 Ga0466961_0098985 Ga0466961_0098985_86_994 300
1814 3300044694 Ga0466963_0004173 Ga0466963_0004173_3041_3958 300
1815 3300044706 Ga0466964_0004584 Ga0466964_0004584_1542_2459 300
1816 3300044706 Ga0466964_0006456 Ga0466964_0006456_888_1793 300
1817 3300044706 Ga0466964_0022376 Ga0466964_0022376_162_1070 300
1818 3300044712 Ga0453684_0094337 Ga0453684_0094337_248_1180 300
1819 3300044712 Ga0453684_0471873 Ga0453684_0471873_295_1227 300
1820 3300044719 Ga0466971_0001432 Ga0466971_0001432_1033_1938 300
1821 3300044735 Ga0466968_0001837 Ga0466968_0001837_184_1092 300
1822 3300044735 Ga0466968_0044066 Ga0466968_0044066_604_1509 300
1823 3300044765 Ga0466970_0014926 Ga0466970_0014926_713_1618 300
1824 3300044765 Ga0466970_0176655 Ga0466970_0176655_223_1131 300
1825 3300044842 Ga0466957_0018632 Ga0466957_0018632_2454_3359 300
1826 3300044842 Ga0466957_0023435 Ga0466957_0023435_2316_3233 300
1827 3300044842 Ga0466957_0042464 Ga0466957_0042464_1167_2072 300
1828 3300044901 Ga0466960_0015378 Ga0466960_0015378_1946_2854 300
1829 3300045049 Ga0466959_0014340 Ga0466959_0014340_2642_3550 300
1830 3300045049 Ga0466959_0026132 Ga0466959_0026132_888_1793 300
1831 3300045049 Ga0466959_0026878 Ga0466959_0026878_2388_3296 300
1832 3300045051 Ga0451576_0005316 Ga0451576_0005316_11095_12027 300
1833 3300045051 Ga0451576_0125631 Ga0451576_0125631_1441_2346 300
1834 3300045051 Ga0451576_0141532 Ga0451576_0141532_705_1610 300
1835 3300045836 Ga0466958_0004646 Ga0466958_0004646_1795_2712 300
1836 3300045836 Ga0466958_0023471 Ga0466958_0023471_332_1237 300
1837 3300045836 Ga0466958_0051558 Ga0466958_0051558_126_1043 300
1838 3300045976 Ga0466967_0038188 Ga0466967_0038188_1705_2622 300
1839 3300045976 Ga0466967_0118948 Ga0466967_0118948_568_1473 300
1840 3300046453 Ga0495627_004659 Ga0495627_004659_3450_4352 300
1841 3300046454 Ga0495592_0000083 Ga0495592_0000083_16777_17682 300
1842 3300046459 Ga0495629_0032324 Ga0495629_0032324_2480_3385 300
1843 3300046460 Ga0495638_0028380 Ga0495638_0028380_2439_3341 300
1844 3300046460 Ga0495638_0035464 Ga0495638_0035464_1378_2283 300
1845 3300046471 Ga0495650_0010780 Ga0495650_0010780_1632_2537 300
1846 3300046475 Ga0495639_0050169 Ga0495639_0050169_890_1795 300
1847 3300046475 Ga0495639_0122795 Ga0495639_0122795_189_1091 300
1848 3300046492 Ga0495585_0033696 Ga0495585_0033696_500_1405 300
1849 3300046501 Ga0495607_0001295 Ga0495607_0001295_6461_7495 300
1850 3300046506 Ga0495583_0000046 Ga0495583_0000046_12648_13553 300
1851 3300046506 Ga0495583_0098639 Ga0495583_0098639_312_1214 300
1852 3300046507 Ga0495606_0009903 Ga0495606_0009903_3644_4549 300
1853 3300046512 Ga0495610_0063688 Ga0495610_0063688_656_1561 300
1854 3300046512 Ga0495610_0079448 Ga0495610_0079448_121_1026 300
1855 3300046512 Ga0495610_0100862 Ga0495610_0100862_306_1208 300
1856 3300046513 Ga0495616_0010949 Ga0495616_0010949_3073_3975 300
1857 3300046515 Ga0495620_0022789 Ga0495620_0022789_538_1440 300
1858 3300046517 Ga0495630_0196255 Ga0495630_0196255_377_1282 300
1859 3300046518 Ga0495631_0009290 Ga0495631_0009290_2718_3620 300
1860 3300046519 Ga0495632_0025195 Ga0495632_0025195_200_1108 300
1861 3300046519 Ga0495632_0030573 Ga0495632_0030573_1044_1949 300
1862 3300046520 Ga0495637_0007657 Ga0495637_0007657_2790_3692 300
1863 3300046520 Ga0495637_0041700 Ga0495637_0041700_653_1555 300
1864 3300046528 Ga0495642_0022273 Ga0495642_0022273_1448_2353 300
1865 3300046528 Ga0495642_0043843 Ga0495642_0043843_358_1260 300
1866 3300046530 Ga0495654_0011924 Ga0495654_0011924_1400_2302 300
1867 3300046530 Ga0495654_0058531 Ga0495654_0058531_237_1139 300
1868 3300046530 Ga0495654_0060787 Ga0495654_0060787_313_1215 300
1869 3300046543 Ga0495645_0218080 Ga0495645_0218080_72_1004 300
1870 3300046615 Ga0495656_0000093 Ga0495656_0000093_2597_3499 300
1871 3300046615 Ga0495656_0139776 Ga0495656_0139776_150_1052 300
1872 3300046616 Ga0495668_0035385 Ga0495668_0035385_297_1199 300
1873 3300046660 Ga0495625_0006471 Ga0495625_0006471_8054_8956 300
1874 3300046660 Ga0495625_0021959 Ga0495625_0021959_3928_4833 300
1875 3300046660 Ga0495625_0025834 Ga0495625_0025834_2721_3626 300
1876 3300046660 Ga0495625_0045681 Ga0495625_0045681_1151_2059 300
1877 3300046660 Ga0495625_0065022 Ga0495625_0065022_1392_2297 300
1878 3300046663 Ga0495635_0149873 Ga0495635_0149873_414_1319 300
1879 3300046665 Ga0495661_0102836 Ga0495661_0102836_668_1570 300
1880 3300046674 Ga0495588_0100652 Ga0495588_0100652_320_1222 300
1881 3300046680 Ga0495646_0180125 Ga0495646_0180125_99_1004 300
1882 3300046681 Ga0495647_0008552 Ga0495647_0008552_1343_2248 300
1883 3300046681 Ga0495647_0051411 Ga0495647_0051411_445_1350 300
1884 3300046683 Ga0495658_0026326 Ga0495658_0026326_1443_2348 300
1885 3300046683 Ga0495658_0032199 Ga0495658_0032199_611_1516 300
1886 3300046683 Ga0495658_0152022 Ga0495658_0152022_139_1047 300
1887 3300046683 Ga0495658_0202880 Ga0495658_0202880_45_950 300
1888 3300046684 Ga0495669_0019731 Ga0495669_0019731_336_1241 300
1889 3300046689 Ga0495613_0068051 Ga0495613_0068051_1324_2229 300
1890 3300046690 Ga0495624_0043778 Ga0495624_0043778_1145_2050 300
1891 3300046690 Ga0495624_0099729 Ga0495624_0099729_297_1199 300
1892 3300046692 Ga0495671_0142773 Ga0495671_0142773_245_1150 300
1893 3300046694 Ga0495649_0015693 Ga0495649_0015693_949_1854 300
1894 3300046794 Ga0495589_0015293 Ga0495589_0015293_1158_2063 300
1895 3300046810 Ga0495660_0020091 Ga0495660_0020091_589_1494 300
1896 3300046810 Ga0495660_0177360 Ga0495660_0177360_12_914 300
1897 3300047321 Ga0495676_0058404 Ga0495676_0058404_299_1204 300
1898 3300047322 Ga0495680_0277956 Ga0495680_0277956_203_1108 300
1899 3300047443 Ga0495687_001691 Ga0495687_001691_325_1230 300
1900 3300047443 Ga0495687_014297 Ga0495687_014297_1305_2210 300
1901 3300047471 Ga0495684_0141066 Ga0495684_0141066_20_925 300
1902 3300047472 Ga0495686_0013865 Ga0495686_0013865_2520_3425 300
1903 3300047673 Ga0495593_0042652 Ga0495593_0042652_41_943 300
1904 3300047673 Ga0495593_0136877 Ga0495593_0136877_233_1138 300
1905 3300048090 Ga0495615_0010353 Ga0495615_0010353_18_920 300
1906 3300048903 Ga0496100_0073144 Ga0496100_0073144_555_1460 300
1907 3300048904 Ga0496101_0040006 Ga0496101_0040006_1980_2882 300
1908 3300048904 Ga0496101_0093358 Ga0496101_0093358_1321_2223 300
1909 3300048904 Ga0496101_0104306 Ga0496101_0104306_606_1511 300
1910 3300048905 Ga0496102_0006345 Ga0496102_0006345_8006_8908 300
1911 3300048905 Ga0496102_0089590 Ga0496102_0089590_1459_2364 300
1912 3300048905 Ga0496102_0192350 Ga0496102_0192350_512_1414 300
1913 3300048906 Ga0496103_0073280 Ga0496103_0073280_1215_2117 300
1914 3300048907 Ga0496104_0035333 Ga0496104_0035333_1056_1958 300
1915 3300048907 Ga0496104_0320354 Ga0496104_0320354_360_1265 300
1916 3300048908 Ga0496105_0012736 Ga0496105_0012736_2945_3847 300
1917 3300048909 Ga0496106_0026341 Ga0496106_0026341_1609_2514 300
1918 3300048909 Ga0496106_0241980 Ga0496106_0241980_41_946 300
1919 3300048910 Ga0496107_0010890 Ga0496107_0010890_2963_3868 300
1920 3300048911 Ga0496108_0079212 Ga0496108_0079212_222_1127 300
1921 3300048911 Ga0496108_0090556 Ga0496108_0090556_1640_2545 300
1922 3300048911 Ga0496108_0198980 Ga0496108_0198980_248_1153 300
1923 3300048911 Ga0496108_0230820 Ga0496108_0230820_395_1303 300
1924 3300048911 Ga0496108_0296491 Ga0496108_0296491_249_1184 300
1925 3300048912 Ga0496109_0007893 Ga0496109_0007893_3553_4458 300
1926 3300048912 Ga0496109_0064946 Ga0496109_0064946_846_1754 300
1927 3300048912 Ga0496109_0310104 Ga0496109_0310104_198_1103 300
1928 3300048912 Ga0496109_0313764 Ga0496109_0313764_236_1138 300
1929 3300048912 Ga0496109_0457294 Ga0496109_0457294_247_1152 300
1930 3300048912 Ga0496109_0589928 Ga0496109_0589928_32_967 300
1931 3300048913 Ga0496110_0051156 Ga0496110_0051156_1847_2752 300
1932 3300048913 Ga0496110_0073005 Ga0496110_0073005_1076_1984 300
1933 3300048913 Ga0496110_0196810 Ga0496110_0196810_637_1539 300
1934 3300048914 Ga0496111_0026659 Ga0496111_0026659_676_1581 300
1935 3300048914 Ga0496111_0043172 Ga0496111_0043172_615_1517 300
1936 3300048915 Ga0496112_0004682 Ga0496112_0004682_2877_3785 300
1937 3300048915 Ga0496112_0181380 Ga0496112_0181380_772_1677 300
1938 3300048917 Ga0496114_0069722 Ga0496114_0069722_631_1536 300
1939 3300048917 Ga0496114_0105423 Ga0496114_0105423_162_1067 300
1940 3300048917 Ga0496114_0171809 Ga0496114_0171809_395_1297 300
1941 3300048919 Ga0496116_0022942 Ga0496116_0022942_2582_3484 300
1942 3300048919 Ga0496116_0045870 Ga0496116_0045870_1176_2078 300
1943 3300048920 Ga0496117_0024976 Ga0496117_0024976_3344_4246 300
1944 3300048920 Ga0496117_0035962 Ga0496117_0035962_151_1053 300
1945 3300048920 Ga0496117_0055689 Ga0496117_0055689_1161_2063 300
1946 3300048921 Ga0496118_0015312 Ga0496118_0015312_1353_2255 300
1947 3300048922 Ga0496119_0044606 Ga0496119_0044606_1039_1941 300
1948 3300048924 Ga0496121_0013013 Ga0496121_0013013_4363_5265 300
1949 3300048924 Ga0496121_0038682 Ga0496121_0038682_1355_2257 300
1950 3300048924 Ga0496121_0053661 Ga0496121_0053661_1476_2384 300
1951 3300048924 Ga0496121_0090236 Ga0496121_0090236_41_943 300
1952 3300048925 Ga0496122_0009581 Ga0496122_0009581_5032_5934 300
1953 3300048926 Ga0496123_0000117 Ga0496123_0000117_7852_8754 300
1954 3300048926 Ga0496123_0023016 Ga0496123_0023016_2623_3525 300
1955 3300048926 Ga0496123_0117252 Ga0496123_0117252_167_1069 300
1956 3300048927 Ga0496124_0022614 Ga0496124_0022614_3015_3923 300
1957 3300048927 Ga0496124_0026014 Ga0496124_0026014_292_1194 300
1958 3300048927 Ga0496124_0043950 Ga0496124_0043950_960_1862 300
1959 3300048927 Ga0496124_0158444 Ga0496124_0158444_580_1482 300
1960 3300048927 Ga0496124_0254458 Ga0496124_0254458_134_1036 300
1961 3300048928 Ga0496125_0005319 Ga0496125_0005319_1667_2569 300
1962 3300048928 Ga0496125_0007743 Ga0496125_0007743_8817_9725 300
1963 3300048928 Ga0496125_0019479 Ga0496125_0019479_1321_2223 300
1964 3300048928 Ga0496125_0032186 Ga0496125_0032186_2547_3449 300
1965 3300048928 Ga0496125_0045868 Ga0496125_0045868_1391_2293 300
1966 3300048928 Ga0496125_0117315 Ga0496125_0117315_648_1550 300
1967 3300048928 Ga0496125_0228260 Ga0496125_0228260_225_1133 300
1968 3300048928 Ga0496125_0287660 Ga0496125_0287660_14_916 300
1969 3300048929 Ga0496126_0126065 Ga0496126_0126065_1277_2179 300
1970 3300048929 Ga0496126_0128364 Ga0496126_0128364_329_1231 300
1971 3300049579 Ga0501043_0024039 Ga0501043_0024039_1790_2695 300
1972 3300049580 Ga0501046_0031102 Ga0501046_0031102_1267_2172 300
1973 3300049581 Ga0501047_0000081 Ga0501047_0000081_106084_106989 300
1974 3300049582 Ga0501048_0000437 Ga0501048_0000437_25538_26443 300
1975 3300049683 Ga0501253_004485 Ga0501253_004485_714_1619 300
1976 3300049744 Ga0501083_0261266 Ga0501083_0261266_73_978 300
1977 3300049758 Ga0501241_029115 Ga0501241_029115_115_1017 300
1978 3300049763 Ga0501266_001508 Ga0501266_001508_1465_2370 300
1979 3300049822 Ga0501035_0089561 Ga0501035_0089561_963_1880 300
1980 3300050489 nmdc:mga03683_38269_c1 nmdc:mga03683_38269_c1_151_1053 300
1981 3300050489 nmdc:mga03683_54218_c1 nmdc:mga03683_54218_c1_664_1566 300
1982 3300050490 nmdc:mga03n38_16354_c1 nmdc:mga03n38_16354_c1_1747_2649 300
1983 3300050490 nmdc:mga03n38_30797_c1 nmdc:mga03n38_30797_c1_975_1877 300
1984 3300050490 nmdc:mga03n38_40034_c1 nmdc:mga03n38_40034_c1_871_1776 300
1985 3300050490 nmdc:mga03n38_7921_c1 nmdc:mga03n38_7921_c1_703_1608 300
1986 3300050491 nmdc:mga00v17_56127_c1 nmdc:mga00v17_56127_c1_1072_1977 300
1987 3300050491 nmdc:mga00v17_58310_c1 nmdc:mga00v17_58310_c1_1098_2003 300
1988 3300050491 nmdc:mga00v17_76948_c1 nmdc:mga00v17_76948_c1_534_1436 300
1989 3300050492 nmdc:mga0yw44_27186_c1 nmdc:mga0yw44_27186_c1_213_1115 300
1990 3300050492 nmdc:mga0yw44_76991_c1 nmdc:mga0yw44_76991_c1_350_1255 300
1991 3300050493 nmdc:mga0k408_102881_c1 nmdc:mga0k408_102881_c1_670_1572 300
1992 3300050493 nmdc:mga0k408_106608_c1 nmdc:mga0k408_106608_c1_504_1415 300
1993 3300050493 nmdc:mga0k408_11020_c1 nmdc:mga0k408_11020_c1_2777_3682 300
1994 3300050493 nmdc:mga0k408_120148_c1 nmdc:mga0k408_120148_c1_447_1352 300
1995 3300050493 nmdc:mga0k408_15277_c1 nmdc:mga0k408_15277_c1_1101_2006 300
1996 3300050493 nmdc:mga0k408_158278_c1 nmdc:mga0k408_158278_c1_71_976 300
1997 3300050493 nmdc:mga0k408_178034_c1 nmdc:mga0k408_178034_c1_285_1193 300
1998 3300050493 nmdc:mga0k408_180_c1 nmdc:mga0k408_180_c1_30203_31108 300
1999 3300050493 nmdc:mga0k408_1901_c1 nmdc:mga0k408_1901_c1_423_1328 300
2000 3300050493 nmdc:mga0k408_23223_c1 nmdc:mga0k408_23223_c1_141_1049 300
2001 3300050493 nmdc:mga0k408_295857_c1 nmdc:mga0k408_295857_c1_33_938 300
2002 3300050493 nmdc:mga0k408_65204_c1 nmdc:mga0k408_65204_c1_825_1748 300
2003 3300050493 nmdc:mga0k408_84308_c1 nmdc:mga0k408_84308_c1_759_1661 300
2004 3300050494 nmdc:mga06z11_103636_c1 nmdc:mga06z11_103636_c1_333_1238 300
2005 3300050494 nmdc:mga06z11_207030_c1 nmdc:mga06z11_207030_c1_221_1126 300
2006 3300050494 nmdc:mga06z11_230060_c1 nmdc:mga06z11_230060_c1_70_978 300
2007 3300050494 nmdc:mga06z11_83259_c1 nmdc:mga06z11_83259_c1_52_960 300
2008 3300050495 nmdc:mga04h51_27958_c1 nmdc:mga04h51_27958_c1_143_1045 300
2009 3300050496 nmdc:mga07m45_1080_c2 nmdc:mga07m45_1080_c2_7109_8014 300
2010 3300050496 nmdc:mga07m45_137244_c1 nmdc:mga07m45_137244_c1_385_1287 300
2011 3300050496 nmdc:mga07m45_14573_c1 nmdc:mga07m45_14573_c1_465_1370 300
2012 3300050496 nmdc:mga07m45_16829_c1 nmdc:mga07m45_16829_c1_1686_2591 300
2013 3300050496 nmdc:mga07m45_189577_c1 nmdc:mga07m45_189577_c1_201_1106 300
2014 3300050496 nmdc:mga07m45_202571_c1 nmdc:mga07m45_202571_c1_124_1032 300
2015 3300050496 nmdc:mga07m45_31773_c1 nmdc:mga07m45_31773_c1_367_1269 300
2016 3300050496 nmdc:mga07m45_38713_c1 nmdc:mga07m45_38713_c1_911_1813 300
2017 3300050496 nmdc:mga07m45_39928_c1 nmdc:mga07m45_39928_c1_591_1493 300
2018 3300050496 nmdc:mga07m45_44985_c1 nmdc:mga07m45_44985_c1_693_1595 300
2019 3300050496 nmdc:mga07m45_4613_c1 nmdc:mga07m45_4613_c1_17_922 300
2020 3300050496 nmdc:mga07m45_56660_c1 nmdc:mga07m45_56660_c1_863_1765 300
2021 3300050496 nmdc:mga07m45_5876_c1 nmdc:mga07m45_5876_c1_4613_5515 300
2022 3300050496 nmdc:mga07m45_7867_c1 nmdc:mga07m45_7867_c1_4106_5011 300
2023 3300050496 nmdc:mga07m45_8525_c1 nmdc:mga07m45_8525_c1_3081_3983 300
2024 3300050496 nmdc:mga07m45_96921_c1 nmdc:mga07m45_96921_c1_694_1596 300
2025 3300050496 nmdc:mga07m45_99997_c1 nmdc:mga07m45_99997_c1_197_1105 300
2026 3300050507 nmdc:mga05p37_118730_c1 nmdc:mga05p37_118730_c1_1467_2399 300
2027 3300050507 nmdc:mga05p37_122733_c1 nmdc:mga05p37_122733_c1_516_1424 300
2028 3300050508 nmdc:mga09592_11912_c1 nmdc:mga09592_11912_c1_2360_3265 300
2029 3300050509 nmdc:mga0qj67_20345_c1 nmdc:mga0qj67_20345_c1_1896_2801 300
2030 3300050509 nmdc:mga0qj67_6586_c1 nmdc:mga0qj67_6586_c1_3513_4445 300
2031 3300050510 nmdc:mga06r32_8110_c1 nmdc:mga06r32_8110_c1_6579_7511 300
2032 3300050511 nmdc:mga08y16_33703_c1 nmdc:mga08y16_33703_c1_555_1487 300
2033 3300050516 nmdc:mga0sz30_138823_c1 nmdc:mga0sz30_138823_c1_125_1033 300
2034 3300053079 Ga0500610_0017443 Ga0500610_0017443_230_1132 300
2035 3300053080 Ga0500635_0002933 Ga0500635_0002933_2581_3486 300
2036 3300053084 Ga0495595_0053991 Ga0495595_0053991_99_1004 300
2037 3300053086 Ga0500578_0005345 Ga0500578_0005345_5959_6864 300
2038 3300053087 Ga0500643_033823 Ga0500643_033823_548_1450 300
2039 3300053088 Ga0500644_0034829 Ga0500644_0034829_595_1500 300
2040 3300053088 Ga0500644_0041826 Ga0500644_0041826_597_1499 300
2041 3300053090 Ga0500646_0006795 Ga0500646_0006795_1725_2630 300
2042 3300053092 Ga0500583_0069455 Ga0500583_0069455_356_1261 300
2043 3300053093 Ga0500651_0001184 Ga0500651_0001184_2116_3018 300
2044 3300053093 Ga0500651_0105421 Ga0500651_0105421_28_933 300
2045 3300053094 Ga0500566_0042570 Ga0500566_0042570_1218_2120 300
2046 3300053096 Ga0500641_0033526 Ga0500641_0033526_656_1558 300
2047 3300053096 Ga0500641_0157497 Ga0500641_0157497_47_949 300
2048 3300053108 Ga0500562_009775 Ga0500562_009775_858_1760 300
2049 3300053110 Ga0500571_010204 Ga0500571_010204_1243_2145 300
2050 3300053116 Ga0500592_002516 Ga0500592_002516_682_1584 300
2051 3300053117 Ga0500593_004248 Ga0500593_004248_1294_2196 300
2052 3300053117 Ga0500593_005007 Ga0500593_005007_2935_3837 300
2053 3300053118 Ga0500594_0002887 Ga0500594_0002887_404_1309 300
2054 3300053121 Ga0500607_004076 Ga0500607_004076_7849_8751 300
2055 3300053122 Ga0500608_052891 Ga0500608_052891_19_924 300
2056 3300053125 Ga0500618_024938 Ga0500618_024938_506_1408 300
2057 3300053129 Ga0500628_013528 Ga0500628_013528_401_1306 300
2058 3300053130 Ga0500642_0032245 Ga0500642_0032245_580_1485 300
2059 3300053131 Ga0500652_001096 Ga0500652_001096_527_1432 300
2060 3300053131 Ga0500652_061228 Ga0500652_061228_382_1287 300
2061 3300053133 Ga0500655_000973 Ga0500655_000973_1197_2099 300
2062 3300053133 Ga0500655_003694 Ga0500655_003694_190_1095 300
2063 3300053134 Ga0500658_0014450 Ga0500658_0014450_624_1526 300
2064 3300053134 Ga0500658_0014484 Ga0500658_0014484_606_1508 300
2065 3300053136 Ga0500559_0000019 Ga0500559_0000019_68940_69845 300
2066 3300053136 Ga0500559_0006560 Ga0500559_0006560_2573_3475 300
2067 3300053136 Ga0500559_0008187 Ga0500559_0008187_1081_1983 300
2068 3300053136 Ga0500559_0040403 Ga0500559_0040403_1000_1902 300
2069 3300053136 Ga0500559_0056979 Ga0500559_0056979_704_1606 300
2070 3300053138 Ga0500564_065220 Ga0500564_065220_549_1454 300
2071 3300053138 Ga0500564_074841 Ga0500564_074841_521_1426 300
2072 3300053139 Ga0500568_0004052 Ga0500568_0004052_5854_6756 300
2073 3300053139 Ga0500568_0019868 Ga0500568_0019868_543_1448 300
2074 3300053139 Ga0500568_0049311 Ga0500568_0049311_536_1441 300
2075 3300053139 Ga0500568_0053770 Ga0500568_0053770_425_1330 300
2076 3300053141 Ga0500574_003820 Ga0500574_003820_14_916 300
2077 3300053153 Ga0500616_0008283 Ga0500616_0008283_2079_2981 300
2078 3300053154 Ga0500619_000136 Ga0500619_000136_2917_3828 300
2079 3300053156 Ga0500622_0000279 Ga0500622_0000279_50626_51531 300
2080 3300053156 Ga0500622_0001954 Ga0500622_0001954_8457_9362 300
2081 3300053156 Ga0500622_0115321 Ga0500622_0115321_88_993 300
2082 3300053157 Ga0500624_003773 Ga0500624_003773_730_1632 300
2083 3300053158 Ga0500627_0030706 Ga0500627_0030706_939_1841 300
2084 3300053162 Ga0500638_032571 Ga0500638_032571_41_943 300
2085 3300053177 Ga0500636_0009113 Ga0500636_0009113_855_1760 300
2086 3300053177 Ga0500636_0092456 Ga0500636_0092456_411_1316 300
2087 3300053724 Ga0500570_078721 Ga0500570_078721_356_1261 300
2088 3300053724 Ga0500570_108423 Ga0500570_108423_50_958 300
2089 3300053729 Ga0500625_112485 Ga0500625_112485_202_1104 300
2090 3300053730 Ga0500645_002482 Ga0500645_002482_6697_7599 300
2091 3300053730 Ga0500645_002742 Ga0500645_002742_5827_6729 300
2092 3300053730 Ga0500645_006573 Ga0500645_006573_699_1604 300
2093 3300053739 Ga0500587_001577 Ga0500587_001577_271_1179 300
2094 3300055283 Ga0500661_008532 Ga0500661_008532_447_1349 300
2095 3300059424 Ga0590075_023637 Ga0590075_023637_263_1171 300
2096 3300059426 Ga0590077_030573 Ga0590077_030573_194_1102 300
2097 3300060353 Ga0501082_0221316 Ga0501082_0221316_109_1014 300
2098 3300061719 Ga0466962_0002133 Ga0466962_0002133_5807_6712 300
2099 3300061719 Ga0466962_0014733 Ga0466962_0014733_1333_2241 300
2100 3300046543 Ga0495645_0081219 Ga0495645_0081219_155_1060 301
2101 3300046680 Ga0495646_0204939 Ga0495646_0204939_76_981 301
2102 3300049571 Ga0501034_0411784 Ga0501034_0411784_249_1157 301
2103 3300049573 Ga0501037_0055390 Ga0501037_0055390_525_1433 301
2104 3300049823 Ga0501044_0300475 Ga0501044_0300475_287_1195 301
2105 3300042876 Ga0451577_0084426 Ga0451577_0084426_1291_2256 302
2106 3300045051 Ga0451576_0306196 Ga0451576_0306196_152_1117 302
2107 2162886007 SwRhRL2b_contig_2000172 SwRhRL2b_0737.00001010 303
2108 3300005289 Ga0065704_10158325 Ga0065704_101583252 303
2109 3300048925 Ga0496122_0042948 Ga0496122_0042948_1131_2042 303
2110 3300048926 Ga0496123_0044858 Ga0496123_0044858_1506_2417 303
2111 3300048928 Ga0496125_0002451 Ga0496125_0002451_623_1534 303
2112 3300048929 Ga0496126_0029295 Ga0496126_0029295_2618_3529 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

57

333

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b1o-assembly1.cif.gz_A structure of burkholderia thailandensis nucleoside kinase (bthnk) in ligand-free form 0.9616 3 297
3b1q-assembly3.cif.gz_C structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with inosine 0.957 3 300
3b1q-assembly3.cif.gz_E structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with inosine 0.954 3 300
3b1q-assembly2.cif.gz_D structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with inosine 0.9521 3 300
3b1q-assembly1.cif.gz_F structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with inosine 0.9504 3 300
ID Description Score Start End Superfamily
3b1rD00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9203 3 299 3.40.1190.20
3b1rD00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8999 3 299 3.40.1190.20
2c4eA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8798 2 303 3.40.1190.20
2c4eA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8629 2 303 3.40.1190.20
3go6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8441 2 302 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A847VJP9-F1-model_v4 Carbohydrate kinase family protein 0.9798 154 298 GO:0006796
GO:0016301
AF-A0A5C7RP17-F1-model_v4 Carbohydrate kinase family protein 0.9677 111 297 GO:0006796
GO:0016301
AF-A0A3C1NAS9-F1-model_v4 Carbohydrate kinase family protein 0.9578 40 302 GO:0006796
GO:0016301
AF-A0A847HSV7-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.9466 1 123 GO:0006796
GO:0016301
AF-A0A847VJP9-F1-model_v4 Carbohydrate kinase family protein 0.9414 154 298 GO:0006796
GO:0016301

Feature Viewer

pLDDT pTM Quality
94.79 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map