F496347

General Info

Members Datasets Scaffolds Average Seq Length
2071 772 1807 250

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100004306|Ga0070659_1000043064
Length 293
Sequence VLHPVASLAVLYWWLAVQPNPSFNAKRLAKIKDLRSKTKSNMRKPVIAGNWKMYKTLGEAVDTALSLKPLVANANHCEVVIAPVFTALKTVADRLEGSNIHVAGQDCATQNEEGAHTGEIAPFMLRDVGARYVIIGHSERRQFYGETDKTVNQKTKAALAAGLTAIVCVGESLEQRDQGNAQNVVGNQVTGGLVELTASDLDRIILAYEPVWAIGTGRTATPEQAQEMHAFIRRVFADRHSTEAAASVRVLYGGSVKPDNIAGLMGQGDIDGALVGGASLKAESFAEIVNFKR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
11 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
16 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
17 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
18 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
19 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
20 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
21 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
22 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
23 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
24 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
25 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
26 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
27 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
28 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
29 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
30 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
31 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
32 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
33 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
34 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
35 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
36 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
37 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
38 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
39 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
40 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
41 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
42 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
43 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
44 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
45 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
46 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
47 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
48 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
49 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
50 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
51 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
52 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
53 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
54 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
55 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
56 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
57 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
58 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
59 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
60 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
61 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
62 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
63 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
64 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
65 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
66 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
67 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
68 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
69 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
70 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
71 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
72 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
73 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
74 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
75 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
76 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
77 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
78 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
79 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
80 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
81 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
82 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
83 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
84 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
85 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
86 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
87 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
88 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
89 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
90 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
91 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
92 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
93 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
94 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
95 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
96 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
97 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
98 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
99 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
100 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
101 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
102 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
103 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
104 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
105 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
106 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
107 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
108 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
109 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
110 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
111 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
112 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
113 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
114 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
115 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
116 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
117 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
118 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
119 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
120 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
121 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
122 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
123 2904504865 Serratia marcescens 1822 Isolate Unclassified
124 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
125 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
126 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
127 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
128 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
129 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
130 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
131 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
132 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
133 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
134 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
135 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
136 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
137 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
138 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
139 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
140 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
141 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
142 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
143 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
144 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
145 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
146 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
147 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
148 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
149 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
150 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
151 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
152 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
153 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
154 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
155 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
156 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
157 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
158 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
159 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
160 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
161 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
162 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
163 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
164 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
165 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
166 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
167 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
168 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
169 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
170 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
171 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
172 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
173 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
174 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
175 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
176 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
177 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
178 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
179 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
180 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
181 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
182 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
183 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
184 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
185 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
186 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
187 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
188 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
189 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
190 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
191 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
192 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
193 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
194 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
195 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
196 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
197 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
198 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
199 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
200 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
201 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
202 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
203 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
204 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
205 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
206 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
207 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
208 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
209 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
210 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
211 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
212 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
213 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
214 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
215 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
216 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
217 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
218 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
219 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
220 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
221 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
222 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
223 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
224 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
225 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
226 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
227 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
228 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
229 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
230 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
231 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
232 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
233 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
234 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
235 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
236 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
237 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
238 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
239 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
240 3004167301 Mesorhizobium loti 582 Isolate Unclassified
241 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
242 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
243 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
244 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
245 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
246 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
247 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
248 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
249 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
250 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
251 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
252 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
253 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
254 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
255 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
256 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
257 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
258 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
259 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
260 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
261 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
262 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
263 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
264 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
265 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
266 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
267 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
268 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
269 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
270 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
271 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
272 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
273 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
274 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
275 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
276 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
277 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
278 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
279 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
280 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
281 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
282 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
283 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
284 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
285 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
286 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
287 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
288 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
289 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
290 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
291 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
292 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
293 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
294 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
295 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
296 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
297 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
298 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
299 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
300 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
301 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
302 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
303 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
304 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
305 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
306 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
307 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
308 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
309 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
310 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
311 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
312 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
313 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
314 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
315 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
316 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
317 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
318 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
319 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
320 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
321 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
322 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
323 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
324 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
325 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
326 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
327 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
328 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
329 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
330 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
331 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
332 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
333 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
334 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
335 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
336 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
337 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
338 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
339 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
340 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
341 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
342 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
343 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
344 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
345 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
346 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
347 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
348 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
349 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
350 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
351 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
352 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
353 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
354 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
355 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
356 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
357 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
358 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
359 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
360 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
361 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
362 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
363 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
364 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
365 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
366 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
367 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
368 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
369 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
370 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
371 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
372 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
373 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
374 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
375 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
376 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
377 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
378 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
379 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
380 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
381 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
382 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
383 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
384 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
385 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
386 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
387 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
388 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
389 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
390 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
391 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
392 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
393 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
394 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
395 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
396 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
397 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
398 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
399 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
400 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
401 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
402 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
403 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
404 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
405 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
406 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
407 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
408 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
409 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
410 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
411 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
412 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
413 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
414 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
415 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
417 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
418 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
421 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
422 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
424 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
425 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
426 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
489 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
490 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
494 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
495 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
496 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
497 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
499 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
500 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
501 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
502 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
503 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
504 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
505 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
506 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
507 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
508 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
512 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
513 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
514 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
515 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
516 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
517 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
518 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
519 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
520 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
521 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
522 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
523 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
524 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
525 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
526 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
527 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
528 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
529 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
530 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
531 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
532 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
533 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
534 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
535 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
536 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
537 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
538 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
539 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
542 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
543 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
544 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
545 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
546 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
547 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
548 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
549 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
550 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
551 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
552 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
553 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
554 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
555 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
556 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
557 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
558 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
559 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
560 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
561 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
562 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
563 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
564 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
565 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
566 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
567 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
568 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
569 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
570 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
571 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
572 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
573 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
574 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
575 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
576 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
577 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
578 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
579 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
580 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
581 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
582 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
583 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
584 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
585 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
586 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
587 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
588 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
589 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
590 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
591 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
592 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
593 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
594 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
595 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
596 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
597 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
598 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
599 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
600 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
601 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
602 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
603 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
604 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
605 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
606 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
607 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
608 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
609 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
610 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
611 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
612 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
613 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
614 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
615 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
616 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
617 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
618 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
619 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
620 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
621 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
622 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
623 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
624 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
625 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
626 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
627 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
628 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
629 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
630 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
631 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
632 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
633 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
634 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
635 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
636 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
637 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
638 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
639 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
640 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
641 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
642 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
643 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
644 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
645 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
646 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
647 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
648 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
649 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
650 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
651 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
652 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
653 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
654 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
655 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
656 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
657 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
658 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
659 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
660 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
661 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
662 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
663 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
664 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
665 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
666 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
667 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
668 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
669 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
670 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
672 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
674 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
675 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
676 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
677 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
678 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
679 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
680 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
681 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
682 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
683 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
684 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
685 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
686 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
687 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
688 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
689 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
690 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
691 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
692 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
693 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
694 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
695 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
696 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
697 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
698 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
699 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
700 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
701 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
702 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
703 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
704 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
705 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
706 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
707 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
708 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
709 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
710 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
711 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
712 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
713 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
714 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
715 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
716 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
717 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
718 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
719 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
720 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
721 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
722 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
723 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
724 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
725 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
726 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
727 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
728 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
729 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
730 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
731 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
732 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
733 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
734 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
735 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
736 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
737 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
738 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
739 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
740 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
741 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
742 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
743 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
744 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
745 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
746 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
747 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
748 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
749 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
750 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
751 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
752 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
753 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
754 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
755 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
756 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
757 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
758 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
759 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
760 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
761 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
762 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
763 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
764 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
765 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
766 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
767 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
768 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
769 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
770 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
771 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
772 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.62
Metatranscriptomes 0.63
Isolates 12.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 9.85
Rhizoplane 3.77
Rhizosphere 75.42
Stem 0
Stem Tuber 0.29
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000040 3300000532 Bacteria 8742
2 JGI24740J21852_10006921 3300001979 Bacteria 4655
3 JGI24739J22299_10049812 3300001989 Bacteria 1357
4 JGI24737J22298_10040690 3300001990 Bacteria 1426
5 JGI24735J21928_10015514 3300002067 Bacteria 2376
6 JGI24735J21928_10021675 3300002067 Bacteria 1960
7 JGI24750J21931_1014682 3300002070 Bacteria 1055
8 JGI24034J26672_10000026 3300002239 Bacteria 109498
9 JGI24751J29686_10000030 3300002459 Bacteria 92588
10 JGI25162J39368_1000075 3300002737 Bacteria 120760
11 JGI25157J39369_1000694 3300002741 Bacteria 18206
12 JGI25406J46586_10003840 3300003203 Bacteria 7021
13 JGI25406J46586_10059736 3300003203 Bacteria 1237
14 JGI25406J46586_10077736 3300003203 Bacteria 1025
15 JGI25165J46597_1000033 3300003214 Bacteria 293030
16 JGI25165J46597_1010963 3300003214 Bacteria 1307
17 rootH2_10077725 3300003320 Bacteria 4265
18 rootH2_10078133 3300003320 Bacteria 1155
19 rootH2_10198277 3300003320 Bacteria 4919
20 rootL2_10259676 3300003322 Bacteria 2900
21 rootH1_10005877 3300003323 Bacteria 4516
22 rootH1_10012091 3300003323 Bacteria 4371
23 JGI25160J50197_1002193 3300003354 Bacteria 9182
24 JGI25404J52841_10010830 3300003659 Bacteria 1962
25 Ga0055529_1001715 3300003763 Bacteria 5611
26 Ga0065165_1004344 3300005262 Bacteria 8892
27 Ga0065714_10064504 3300005288 Bacteria 46817
28 Ga0065704_10128089 3300005289 Bacteria 1667
29 Ga0065704_10139293 3300005289 Unclassified 1535
30 Ga0065704_10209631 3300005289 Bacteria 1114
31 Ga0065712_10067766 3300005290 Bacteria 46828
32 Ga0065712_10079152 3300005290 Bacteria 3253
33 Ga0065712_10120433 3300005290 Bacteria 1678
34 Ga0065712_10122253 3300005290 Unclassified 1654
35 Ga0065712_10182341 3300005290 Bacteria 1186
36 Ga0065715_10001956 3300005293 Bacteria 5504
37 Ga0065715_10022986 3300005293 Bacteria 1475
38 Ga0065715_10041779 3300005293 Bacteria 1617
39 Ga0065715_10089158 3300005293 Bacteria 13366
40 Ga0065715_10152536 3300005293 Bacteria 1712
41 Ga0065715_10188464 3300005293 Bacteria 1430
42 Ga0065715_10301965 3300005293 Bacteria 1039
43 Ga0065707_10195597 3300005295 Unclassified 1336
44 Ga0065707_10199019 3300005295 Bacteria 1320
45 Ga0065707_10237340 3300005295 Bacteria 1168
46 Ga0065707_10288125 3300005295 Bacteria 1031
47 Ga0070658_10001208 3300005327 Bacteria 22135
48 Ga0070658_10014417 3300005327 Bacteria 6343
49 Ga0070658_10056805 3300005327 Bacteria 3182
50 Ga0070676_10002075 3300005328 Bacteria 10197
51 Ga0070683_100001378 3300005329 Bacteria 18632
52 Ga0070683_100073796 3300005329 Bacteria 3185
53 Ga0070690_100000812 3300005330 Bacteria 15800
54 Ga0070690_100001011 3300005330 Bacteria 14383
55 Ga0070690_100001334 3300005330 Bacteria 12820
56 Ga0070690_100236242 3300005330 Bacteria 1287
57 Ga0070670_100002791 3300005331 Bacteria 14445
58 Ga0070670_100033283 3300005331 Bacteria 4440
59 Ga0070670_100133728 3300005331 Bacteria 2142
60 Ga0070670_100604021 3300005331 Bacteria 982
61 Ga0070677_10000526 3300005333 Bacteria 13130
62 Ga0070677_10152901 3300005333 Bacteria 1076
63 Ga0068869_100103722 3300005334 Unclassified 2155
64 Ga0068869_100143427 3300005334 Bacteria 1846
65 Ga0068869_100168917 3300005334 Bacteria 1708
66 Ga0068869_100250304 3300005334 Bacteria 1415
67 Ga0070666_10001337 3300005335 Bacteria 14951
68 Ga0070666_10018053 3300005335 Bacteria 4530
69 Ga0070666_10051188 3300005335 Bacteria 2780
70 Ga0070666_10088334 3300005335 Bacteria 2126
71 Ga0070680_100001985 3300005336 Bacteria 15054
72 Ga0070680_100010302 3300005336 Bacteria 7206
73 Ga0070680_100012770 3300005336 Bacteria 6531
74 Ga0070680_100326609 3300005336 Unclassified 1303
75 Ga0070682_100023706 3300005337 Bacteria 3645
76 Ga0070682_100029208 3300005337 Bacteria 3319
77 Ga0070682_100034027 3300005337 Bacteria 3100
78 Ga0068868_100001472 3300005338 Bacteria 16253
79 Ga0068868_100035781 3300005338 Bacteria 3840
80 Ga0068868_100039981 3300005338 Bacteria 3647
81 Ga0070660_100001829 3300005339 Bacteria 14621
82 Ga0070660_100005970 3300005339 Bacteria 8417
83 Ga0070660_100018548 3300005339 Bacteria 5086
84 Ga0070660_100042990 3300005339 Bacteria 3451
85 Ga0070660_100071913 3300005339 Bacteria 2701
86 Ga0070660_100111006 3300005339 Bacteria 2181
87 Ga0070689_100003426 3300005340 Bacteria 10550
88 Ga0070689_100040778 3300005340 Bacteria 3560
89 Ga0070689_100128362 3300005340 Bacteria 2031
90 Ga0070689_100440593 3300005340 Bacteria 1107
91 Ga0070691_10020783 3300005341 Bacteria 3034
92 Ga0070691_10041162 3300005341 Bacteria 2184
93 Ga0070691_10157322 3300005341 Bacteria 1169
94 Ga0070687_100000129 3300005343 Bacteria 26037
95 Ga0070687_100170001 3300005343 Unclassified 1297
96 Ga0070687_100271253 3300005343 Bacteria 1063
97 Ga0070661_100001499 3300005344 Bacteria 16227
98 Ga0070661_100004800 3300005344 Bacteria 9309
99 Ga0070661_100011435 3300005344 Bacteria 6183
100 Ga0070661_100020420 3300005344 Bacteria 4723
101 Ga0070661_100113963 3300005344 Bacteria 2021
102 Ga0070661_100340548 3300005344 Bacteria 1175
103 Ga0070692_10056376 3300005345 Unclassified 2057
104 Ga0070692_10078838 3300005345 Bacteria 1769
105 Ga0070668_100001092 3300005347 Bacteria 19121
106 Ga0070668_100020391 3300005347 Bacteria 5002
107 Ga0070668_100312028 3300005347 Bacteria 1322
108 Ga0070669_100001544 3300005353 Bacteria 16649
109 Ga0070669_100047892 3300005353 Bacteria 3119
110 Ga0070669_100066581 3300005353 Unclassified 2655
111 Ga0070669_100115061 3300005353 Bacteria 2045
112 Ga0070669_100321252 3300005353 Bacteria 1250
113 Ga0070669_100520740 3300005353 Bacteria 989
114 Ga0070675_100011835 3300005354 Bacteria 6836
115 Ga0070675_100116649 3300005354 Bacteria 2265
116 Ga0070675_100469098 3300005354 Bacteria 1131
117 Ga0070671_100001853 3300005355 Bacteria 16122
118 Ga0070671_100073369 3300005355 Bacteria 2858
119 Ga0070671_100089287 3300005355 Bacteria 2580
120 Ga0070671_100155199 3300005355 Bacteria 1934
121 Ga0070671_100228293 3300005355 Bacteria 1580
122 Ga0070674_100356481 3300005356 Bacteria 1183
123 Ga0070673_100082833 3300005364 Bacteria 2605
124 Ga0070673_100172015 3300005364 Bacteria 1849
125 Ga0070673_100272870 3300005364 Bacteria 1481
126 Ga0070673_100288759 3300005364 Bacteria 1441
127 Ga0070673_100351064 3300005364 Bacteria 1309
128 Ga0070673_100525780 3300005364 Bacteria 1072
129 Ga0070688_100000657 3300005365 Bacteria 17170
130 Ga0070688_100006128 3300005365 Bacteria 6395
131 Ga0070659_100002328 3300005366 Bacteria 13511
132 Ga0070659_100004306 3300005366 Bacteria 10162
133 Ga0070659_100013504 3300005366 Bacteria 6080
134 Ga0070659_100023287 3300005366 Bacteria 4738
135 Ga0070659_100081787 3300005366 Bacteria 2580
136 Ga0070659_100352857 3300005366 Bacteria 1234
137 Ga0070659_100608543 3300005366 Bacteria 939
138 Ga0070667_100003253 3300005367 Bacteria 13881
139 Ga0070667_100018342 3300005367 Bacteria 5803
140 Ga0070667_100134011 3300005367 Bacteria 2165
141 Ga0070667_100173995 3300005367 Bacteria 1901
142 Ga0070703_10058342 3300005406 Unclassified 1256
143 Ga0070709_10005740 3300005434 Bacteria 6730
144 Ga0070714_100380444 3300005435 Bacteria 1331
145 Ga0070710_10004618 3300005437 Bacteria 6510
146 Ga0070701_10011515 3300005438 Bacteria 3958
147 Ga0070701_10113763 3300005438 Bacteria 1515
148 Ga0070711_100078337 3300005439 Bacteria 2348
149 Ga0070711_100084992 3300005439 Bacteria 2265
150 Ga0070705_100001751 3300005440 Bacteria 11277
151 Ga0070705_100027907 3300005440 Bacteria 3086
152 Ga0070705_100067072 3300005440 Bacteria 2154
153 Ga0070705_100105070 3300005440 Bacteria 1792
154 Ga0070700_100000719 3300005441 Bacteria 16343
155 Ga0070700_100012018 3300005441 Bacteria 4812
156 Ga0070700_100020667 3300005441 Bacteria 3818
157 Ga0070700_100039705 3300005441 Bacteria 2877
158 Ga0070700_100062514 3300005441 Bacteria 2352
159 Ga0070700_100257511 3300005441 Unclassified 1255
160 Ga0070694_100006547 3300005444 Bacteria 7075
161 Ga0070694_100008855 3300005444 Bacteria 6165
162 Ga0070694_100044502 3300005444 Bacteria 2971
163 Ga0070694_100109337 3300005444 Bacteria 1967
164 Ga0070694_100201814 3300005444 Bacteria 1483
165 Ga0070694_100333469 3300005444 Bacteria 1171
166 Ga0070694_100381266 3300005444 Bacteria 1100
167 Ga0070708_100005855 3300005445 Bacteria 9764
168 Ga0070708_100137339 3300005445 Bacteria 2266
169 Ga0070708_100677381 3300005445 Bacteria 971
170 Ga0070663_100002023 3300005455 Bacteria 11326
171 Ga0070663_100005687 3300005455 Bacteria 7428
172 Ga0070663_100011762 3300005455 Bacteria 5508
173 Ga0070663_100048511 3300005455 Bacteria 3011
174 Ga0070663_100283642 3300005455 Bacteria 1320
175 Ga0070678_100001372 3300005456 Bacteria 12958
176 Ga0070678_100032969 3300005456 Bacteria 3591
177 Ga0070678_100531052 3300005456 Bacteria 1042
178 Ga0070662_100141147 3300005457 Bacteria 1867
179 Ga0070662_100180045 3300005457 Bacteria 1666
180 Ga0070681_10002315 3300005458 Bacteria 17415
181 Ga0070681_10003664 3300005458 Bacteria 14404
182 Ga0070681_10007845 3300005458 Bacteria 10437
183 Ga0070681_10010655 3300005458 Bacteria 9087
184 Ga0070681_10015116 3300005458 Bacteria 7678
185 Ga0070681_10018723 3300005458 Bacteria 6929
186 Ga0070681_10051872 3300005458 Bacteria 4091
187 Ga0070681_10166545 3300005458 Bacteria 2126
188 Ga0070681_10348936 3300005458 Bacteria 1390
189 Ga0068867_100006387 3300005459 Bacteria 8330
190 Ga0068867_100013233 3300005459 Bacteria 5844
191 Ga0068867_100074453 3300005459 Unclassified 2545
192 Ga0068867_100257362 3300005459 Bacteria 1422
193 Ga0070685_10001416 3300005466 Bacteria 12577
194 Ga0070685_10004344 3300005466 Bacteria 7153
195 Ga0070685_10082845 3300005466 Bacteria 1926
196 Ga0070706_100000125 3300005467 Bacteria 94689
197 Ga0070706_100008529 3300005467 Bacteria 9554
198 Ga0070706_100210603 3300005467 Bacteria 1815
199 Ga0070706_100565234 3300005467 Bacteria 1058
200 Ga0070707_100003600 3300005468 Bacteria 14608
201 Ga0070707_100011087 3300005468 Bacteria 8394
202 Ga0070707_100012513 3300005468 Bacteria 7925
203 Ga0070707_100260130 3300005468 Bacteria 1688
204 Ga0070707_100304531 3300005468 Unclassified 1548
205 Ga0070707_100430159 3300005468 Unclassified 1280
206 Ga0070698_100005037 3300005471 Bacteria 14476
207 Ga0070698_100006865 3300005471 Bacteria 12329
208 Ga0070698_100008229 3300005471 Bacteria 11282
209 Ga0070699_100000352 3300005518 Bacteria 44680
210 Ga0070699_100000880 3300005518 Bacteria 27937
211 Ga0070699_100004094 3300005518 Bacteria 12885
212 Ga0070699_100111738 3300005518 Bacteria 2399
213 Ga0070679_100000587 3300005530 Bacteria 30801
214 Ga0070679_100008410 3300005530 Bacteria 9712
215 Ga0070679_100011201 3300005530 Bacteria 8547
216 Ga0070679_100077077 3300005530 Bacteria 3322
217 Ga0070684_100043562 3300005535 Bacteria 3876
218 Ga0070684_100059847 3300005535 Bacteria 3331
219 Ga0070684_100533696 3300005535 Bacteria 1088
220 Ga0070697_100031128 3300005536 Bacteria 4289
221 Ga0070697_100055838 3300005536 Bacteria 3212
222 Ga0070697_100153616 3300005536 Bacteria 1941
223 Ga0068853_100003665 3300005539 Bacteria 11782
224 Ga0068853_100003943 3300005539 Bacteria 11396
225 Ga0068853_100027252 3300005539 Bacteria 4800
226 Ga0068853_100040630 3300005539 Bacteria 3969
227 Ga0068853_100051948 3300005539 Bacteria 3530
228 Ga0068853_100093101 3300005539 Bacteria 2652
229 Ga0068853_100163691 3300005539 Bacteria 2009
230 Ga0068853_100170360 3300005539 Bacteria 1969
231 Ga0070672_100000867 3300005543 Bacteria 18097
232 Ga0070672_100016594 3300005543 Bacteria 5276
233 Ga0070672_100042656 3300005543 Bacteria 3493
234 Ga0070672_100197393 3300005543 Bacteria 1682
235 Ga0070672_100560480 3300005543 Bacteria 993
236 Ga0070672_100656057 3300005543 Unclassified 917
237 Ga0070686_100004310 3300005544 Bacteria 7831
238 Ga0070686_100006195 3300005544 Bacteria 6640
239 Ga0070686_100022101 3300005544 Bacteria 3786
240 Ga0070686_100142294 3300005544 Bacteria 1671
241 Ga0070686_100221860 3300005544 Bacteria 1366
242 Ga0070695_100008518 3300005545 Bacteria 6087
243 Ga0070695_100053158 3300005545 Bacteria 2604
244 Ga0070695_100267266 3300005545 Bacteria 1251
245 Ga0070695_100510046 3300005545 Unclassified 931
246 Ga0070696_100040295 3300005546 Bacteria 3225
247 Ga0070696_100514153 3300005546 Bacteria 954
248 Ga0070696_100693071 3300005546 Bacteria 830
249 Ga0070693_100020755 3300005547 Bacteria 3470
250 Ga0070693_100030719 3300005547 Bacteria 2939
251 Ga0070693_100052530 3300005547 Bacteria 2337
252 Ga0070693_100070706 3300005547 Bacteria 2054
253 Ga0070665_100010998 3300005548 Bacteria 9149
254 Ga0070665_100018974 3300005548 Bacteria 6900
255 Ga0070665_100023145 3300005548 Bacteria 6257
256 Ga0070665_100024444 3300005548 Bacteria 6084
257 Ga0070665_100046320 3300005548 Bacteria 4369
258 Ga0070665_100263305 3300005548 Bacteria 1725
259 Ga0070665_100283231 3300005548 Bacteria 1659
260 Ga0070665_100350250 3300005548 Bacteria 1482
261 Ga0070665_100553282 3300005548 Bacteria 1163
262 Ga0070704_100000897 3300005549 Bacteria 14913
263 Ga0070704_100054755 3300005549 Bacteria 2824
264 Ga0070704_100096074 3300005549 Bacteria 2221
265 Ga0070704_100134808 3300005549 Bacteria 1919
266 Ga0070704_100161122 3300005549 Bacteria 1774
267 Ga0070704_100325872 3300005549 Bacteria 1289
268 Ga0070704_100605301 3300005549 Bacteria 963
269 Ga0068855_100003374 3300005563 Bacteria 19561
270 Ga0068855_100004501 3300005563 Bacteria 17027
271 Ga0068855_100018186 3300005563 Bacteria 8443
272 Ga0068855_100037556 3300005563 Bacteria 5759
273 Ga0068855_100089580 3300005563 Bacteria 3552
274 Ga0068855_100108358 3300005563 Bacteria 3190
275 Ga0068855_100151181 3300005563 Bacteria 2640
276 Ga0068855_100240449 3300005563 Bacteria 2023
277 Ga0068855_100250783 3300005563 Bacteria 1974
278 Ga0068855_100802958 3300005563 Bacteria 1000
279 Ga0068855_100926808 3300005563 Bacteria 919
280 Ga0070664_100000070 3300005564 Bacteria 63788
281 Ga0070664_100001934 3300005564 Bacteria 16649
282 Ga0070664_100017132 3300005564 Bacteria 5948
283 Ga0070664_100026866 3300005564 Bacteria 4780
284 Ga0070664_100047571 3300005564 Bacteria 3624
285 Ga0068857_100003654 3300005577 Bacteria 12893
286 Ga0068857_100004680 3300005577 Bacteria 11592
287 Ga0068857_100033566 3300005577 Bacteria 4539
288 Ga0068857_100037853 3300005577 Bacteria 4274
289 Ga0068857_100061463 3300005577 Bacteria 3337
290 Ga0068854_100001002 3300005578 Bacteria 17023
291 Ga0068854_100010067 3300005578 Bacteria 6124
292 Ga0068854_100046307 3300005578 Bacteria 3096
293 Ga0068854_100103155 3300005578 Bacteria 2141
294 Ga0068854_100253706 3300005578 Unclassified 1406
295 Ga0068856_100005597 3300005614 Bacteria 12362
296 Ga0068856_100021359 3300005614 Bacteria 6293
297 Ga0068856_100216883 3300005614 Bacteria 1929
298 Ga0068856_100312957 3300005614 Bacteria 1588
299 Ga0068856_100341639 3300005614 Bacteria 1515
300 Ga0068856_100526334 3300005614 Bacteria 1203
301 Ga0070702_100017673 3300005615 Bacteria 3684
302 Ga0070702_100033498 3300005615 Bacteria 2825
303 Ga0070702_100060385 3300005615 Bacteria 2204
304 Ga0070702_100252847 3300005615 Bacteria 1195
305 Ga0070702_100308007 3300005615 Bacteria 1098
306 Ga0068852_100001511 3300005616 Bacteria 15733
307 Ga0068852_100006048 3300005616 Bacteria 8718
308 Ga0068852_100065307 3300005616 Bacteria 3174
309 Ga0068852_100232089 3300005616 Bacteria 1759
310 Ga0068852_100241597 3300005616 Bacteria 1726
311 Ga0068852_100399548 3300005616 Bacteria 1352
312 Ga0068852_100662403 3300005616 Bacteria 1052
313 Ga0068852_100672893 3300005616 Bacteria 1044
314 Ga0068859_100009084 3300005617 Bacteria 10038
315 Ga0068859_100022162 3300005617 Bacteria 6369
316 Ga0068859_100027560 3300005617 Bacteria 5698
317 Ga0068859_100029327 3300005617 Bacteria 5521
318 Ga0068859_100050914 3300005617 Bacteria 4162
319 Ga0068859_100059991 3300005617 Bacteria 3833
320 Ga0068859_100102105 3300005617 Bacteria 2925
321 Ga0068859_100169710 3300005617 Bacteria 2262
322 Ga0068859_100355574 3300005617 Bacteria 1560
323 Ga0068864_100003320 3300005618 Bacteria 13297
324 Ga0068864_100014922 3300005618 Bacteria 6455
325 Ga0068864_100024719 3300005618 Bacteria 5054
326 Ga0068864_100035972 3300005618 Bacteria 4218
327 Ga0068864_100040419 3300005618 Bacteria 3990
328 Ga0068864_100178664 3300005618 Bacteria 1939
329 Ga0068864_100246022 3300005618 Bacteria 1658
330 Ga0068864_100676324 3300005618 Unclassified 1007
331 Ga0068866_10000167 3300005718 Bacteria 30374
332 Ga0068861_100001113 3300005719 Bacteria 16659
333 Ga0068861_100020275 3300005719 Bacteria 4758
334 Ga0068861_100340958 3300005719 Bacteria 1311
335 Ga0068861_100558303 3300005719 Bacteria 1044
336 Ga0068851_10000382 3300005834 Bacteria 20035
337 Ga0068851_10010828 3300005834 Bacteria 4262
338 Ga0068851_10062572 3300005834 Bacteria 1909
339 Ga0068863_100002882 3300005841 Bacteria 17031
340 Ga0068863_100080336 3300005841 Unclassified 3088
341 Ga0068863_100208714 3300005841 Bacteria 1880
342 Ga0068863_100264213 3300005841 Bacteria 1664
343 Ga0068858_100005307 3300005842 Bacteria 12636
344 Ga0068858_100006538 3300005842 Bacteria 11336
345 Ga0068858_100018581 3300005842 Bacteria 6510
346 Ga0068858_100041680 3300005842 Bacteria 4257
347 Ga0068858_100049299 3300005842 Bacteria 3900
348 Ga0068858_100059043 3300005842 Bacteria 3545
349 Ga0068858_100206719 3300005842 Unclassified 1857
350 Ga0068858_100275829 3300005842 Bacteria 1601
351 Ga0068860_100007853 3300005843 Bacteria 10650
352 Ga0068860_100011324 3300005843 Bacteria 8789
353 Ga0068860_100019352 3300005843 Bacteria 6604
354 Ga0068860_100030361 3300005843 Bacteria 5198
355 Ga0068860_100061705 3300005843 Bacteria 3561
356 Ga0068860_100243218 3300005843 Bacteria 1751
357 Ga0068862_100014640 3300005844 Bacteria 6515
358 Ga0068862_100080071 3300005844 Bacteria 2832
359 Ga0068862_100095635 3300005844 Bacteria 2592
360 Ga0068862_100156570 3300005844 Bacteria 2031
361 Ga0068862_100655808 3300005844 Bacteria 1013
362 Ga0068862_100860223 3300005844 Bacteria 889
363 Ga0081455_10017929 3300005937 Bacteria 6765
364 Ga0081540_1000138 3300005983 Bacteria 76659
365 Ga0081540_1000640 3300005983 Bacteria 33222
366 Ga0081540_1001923 3300005983 Bacteria 17413
367 Ga0081540_1003393 3300005983 Bacteria 12631
368 Ga0081540_1017951 3300005983 Bacteria 4359
369 Ga0081540_1093371 3300005983 Bacteria 1318
370 Ga0081539_10000110 3300005985 Bacteria 190555
371 Ga0081539_10001757 3300005985 Bacteria 34548
372 Ga0081539_10005290 3300005985 Bacteria 13293
373 Ga0081539_10006601 3300005985 Bacteria 11020
374 Ga0081539_10016624 3300005985 Bacteria 5235
375 Ga0070717_10038368 3300006028 Bacteria 3893
376 Ga0070717_10114601 3300006028 Bacteria 2303
377 Ga0075365_10003274 3300006038 Bacteria 8304
378 Ga0075365_10005800 3300006038 Bacteria 6706
379 Ga0075365_10009956 3300006038 Bacteria 5505
380 Ga0075368_10010236 3300006042 Bacteria 3386
381 Ga0075363_100040656 3300006048 Bacteria 2451
382 Ga0075364_10027328 3300006051 Bacteria 3644
383 Ga0070715_10000063 3300006163 Bacteria 34937
384 Ga0070716_100078021 3300006173 Bacteria 1968
385 Ga0070716_100116535 3300006173 Bacteria 1665
386 Ga0075362_10008752 3300006177 Bacteria 3888
387 Ga0075362_10018996 3300006177 Bacteria 2853
388 Ga0075367_10017171 3300006178 Bacteria 3967
389 Ga0075367_10026146 3300006178 Bacteria 3307
390 Ga0075367_10070535 3300006178 Bacteria 2101
391 Ga0075367_10090436 3300006178 Bacteria 1862
392 Ga0075369_10003352 3300006186 Bacteria 5823
393 Ga0075369_10105201 3300006186 Bacteria 1268
394 Ga0097621_100000449 3300006237 Bacteria 28814
395 Ga0097621_100259045 3300006237 Bacteria 1525
396 Ga0097621_100273719 3300006237 Bacteria 1484
397 Ga0075370_10023704 3300006353 Bacteria 3383
398 Ga0068871_100001759 3300006358 Bacteria 14597
399 Ga0068871_100064226 3300006358 Bacteria 3005
400 Ga0068871_100314906 3300006358 Bacteria 1376
401 Ga0068871_100376467 3300006358 Bacteria 1260
402 Ga0075428_100009001 3300006844 Bacteria 11076
403 Ga0075428_100047133 3300006844 Bacteria 4734
404 Ga0075428_100049375 3300006844 Bacteria 4616
405 Ga0075428_100065603 3300006844 Bacteria 3976
406 Ga0075428_100185233 3300006844 Bacteria 2253
407 Ga0075428_100287649 3300006844 Bacteria 1768
408 Ga0075430_100076170 3300006846 Bacteria 2811
409 Ga0075430_100080323 3300006846 Bacteria 2732
410 Ga0075430_100518947 3300006846 Bacteria 983
411 Ga0075431_100000392 3300006847 Bacteria 35161
412 Ga0075431_100001188 3300006847 Bacteria 23484
413 Ga0075433_10008826 3300006852 Bacteria 8041
414 Ga0075433_10044089 3300006852 Bacteria 3875
415 Ga0075433_10045889 3300006852 Unclassified 3799
416 Ga0075433_10062021 3300006852 Bacteria 3274
417 Ga0075433_10118535 3300006852 Bacteria 2349
418 Ga0075433_10176928 3300006852 Bacteria 1899
419 Ga0075434_100004782 3300006871 Bacteria 12262
420 Ga0075434_100019404 3300006871 Bacteria 6580
421 Ga0075434_100020621 3300006871 Bacteria 6397
422 Ga0075434_100035585 3300006871 Bacteria 4923
423 Ga0075434_100110623 3300006871 Bacteria 2758
424 Ga0075434_100120201 3300006871 Bacteria 2642
425 Ga0075434_100217845 3300006871 Bacteria 1929
426 Ga0075434_100240687 3300006871 Bacteria 1829
427 Ga0075434_100277852 3300006871 Bacteria 1694
428 Ga0075429_100124879 3300006880 Bacteria 2251
429 Ga0075429_100295766 3300006880 Unclassified 1417
430 Ga0075429_100395773 3300006880 Unclassified 1210
431 Ga0068865_100002359 3300006881 Bacteria 11142
432 Ga0068865_100024668 3300006881 Bacteria 3947
433 Ga0068865_100141872 3300006881 Bacteria 1812
434 Ga0068865_100365257 3300006881 Bacteria 1173
435 Ga0075436_100001175 3300006914 Bacteria 17759
436 Ga0097620_100009084 3300006931 Bacteria 10038
437 Ga0097620_100022163 3300006931 Bacteria 6369
438 Ga0097620_100027559 3300006931 Bacteria 5698
439 Ga0097620_100029326 3300006931 Bacteria 5521
440 Ga0097620_100050908 3300006931 Bacteria 4162
441 Ga0097620_100059986 3300006931 Bacteria 3833
442 Ga0097620_100102107 3300006931 Bacteria 2925
443 Ga0097620_100169714 3300006931 Bacteria 2262
444 Ga0097620_100355571 3300006931 Bacteria 1560
445 Ga0079104_1000209 3300006946 Bacteria 81844
446 Ga0075435_100009611 3300007076 Bacteria 7018
447 Ga0099794_10003880 3300007265 Bacteria 5788
448 Ga0105251_10056175 3300009011 Bacteria 1864
449 Ga0105244_10000145 3300009036 Bacteria 73760
450 Ga0105250_10000127 3300009092 Bacteria 66039
451 Ga0105240_10007255 3300009093 Bacteria 16136
452 Ga0105240_10021381 3300009093 Bacteria 8606
453 Ga0105240_10062851 3300009093 Bacteria 4621
454 Ga0105240_10094300 3300009093 Bacteria 3651
455 Ga0105240_10122464 3300009093 Bacteria 3130
456 Ga0105240_10134066 3300009093 Bacteria 2967
457 Ga0105240_10142856 3300009093 Bacteria 2860
458 Ga0105240_10158004 3300009093 Bacteria 2695
459 Ga0105240_10162374 3300009093 Bacteria 2653
460 Ga0105240_10189757 3300009093 Bacteria 2417
461 Ga0105240_10478093 3300009093 Bacteria 1389
462 Ga0105240_10769101 3300009093 Bacteria 1046
463 Ga0111539_10000358 3300009094 Bacteria 56148
464 Ga0111539_10059338 3300009094 Bacteria 4537
465 Ga0111539_10076099 3300009094 Bacteria 3952
466 Ga0111539_10112739 3300009094 Bacteria 3190
467 Ga0111539_10310035 3300009094 Bacteria 1836
468 Ga0111539_10351792 3300009094 Bacteria 1715
469 Ga0111539_10375944 3300009094 Bacteria 1654
470 Ga0105245_10003941 3300009098 Bacteria 13204
471 Ga0105245_10107745 3300009098 Bacteria 2587
472 Ga0105245_10487140 3300009098 Bacteria 1247
473 Ga0105245_10668767 3300009098 Bacteria 1070
474 Ga0105247_10000047 3300009101 Bacteria 151385
475 Ga0105247_10000680 3300009101 Bacteria 26882
476 Ga0105247_10001044 3300009101 Bacteria 20780
477 Ga0105247_10063001 3300009101 Bacteria 2301
478 Ga0105247_10093410 3300009101 Bacteria 1912
479 Ga0105247_10103760 3300009101 Bacteria 1821
480 Ga0114129_10005694 3300009147 Bacteria 17649
481 Ga0114129_10070556 3300009147 Bacteria 4872
482 Ga0114129_10281624 3300009147 Bacteria 2221
483 Ga0114129_10313848 3300009147 Bacteria 2086
484 Ga0114129_10473193 3300009147 Unclassified 1640
485 Ga0114129_10481150 3300009147 Bacteria 1624
486 Ga0114129_10514193 3300009147 Unclassified 1562
487 Ga0114129_10610367 3300009147 Bacteria 1412
488 Ga0114129_10759767 3300009147 Bacteria 1240
489 Ga0105243_10000027 3300009148 Bacteria 191224
490 Ga0105243_10000474 3300009148 Bacteria 41200
491 Ga0105243_10007357 3300009148 Bacteria 8465
492 Ga0105243_10025565 3300009148 Bacteria 4514
493 Ga0105243_10046747 3300009148 Bacteria 3406
494 Ga0105243_10147343 3300009148 Bacteria 2016
495 Ga0105243_10378635 3300009148 Bacteria 1308
496 Ga0105243_10410071 3300009148 Bacteria 1261
497 Ga0105241_10000690 3300009174 Bacteria 25453
498 Ga0105241_10050218 3300009174 Bacteria 3178
499 Ga0105241_10070341 3300009174 Bacteria 2715
500 Ga0105241_10072947 3300009174 Bacteria 2669
501 Ga0105241_10102582 3300009174 Bacteria 2277
502 Ga0105241_10294902 3300009174 Bacteria 1390
503 Ga0105241_10298249 3300009174 Bacteria 1382
504 Ga0105241_10585830 3300009174 Bacteria 1006
505 Ga0105242_10000038 3300009176 Bacteria 90379
506 Ga0105242_10000107 3300009176 Bacteria 59805
507 Ga0105242_10001950 3300009176 Bacteria 16240
508 Ga0105242_10005047 3300009176 Bacteria 10192
509 Ga0105242_10028561 3300009176 Bacteria 4443
510 Ga0105242_10123128 3300009176 Bacteria 2229
511 Ga0105242_10160011 3300009176 Bacteria 1970
512 Ga0105248_10003364 3300009177 Bacteria 17776
513 Ga0105248_10020227 3300009177 Bacteria 7373
514 Ga0105248_10028561 3300009177 Bacteria 6215
515 Ga0105248_10032857 3300009177 Bacteria 5797
516 Ga0105248_10071202 3300009177 Bacteria 3905
517 Ga0105248_10169319 3300009177 Bacteria 2462
518 Ga0105248_10250961 3300009177 Bacteria 1992
519 Ga0105248_10321545 3300009177 Bacteria 1742
520 Ga0105237_10000829 3300009545 Bacteria 42345
521 Ga0105237_10003821 3300009545 Bacteria 17702
522 Ga0105237_10033099 3300009545 Bacteria 5236
523 Ga0105237_10045544 3300009545 Bacteria 4414
524 Ga0105237_10047386 3300009545 Bacteria 4321
525 Ga0105237_10059203 3300009545 Bacteria 3832
526 Ga0105237_10099103 3300009545 Bacteria 2906
527 Ga0105237_10246404 3300009545 Bacteria 1789
528 Ga0105237_10258032 3300009545 Bacteria 1745
529 Ga0105238_10001511 3300009551 Bacteria 23281
530 Ga0105238_10021004 3300009551 Bacteria 6652
531 Ga0105238_10027120 3300009551 Bacteria 5839
532 Ga0105238_10058950 3300009551 Bacteria 3847
533 Ga0105238_10141237 3300009551 Bacteria 2385
534 Ga0105238_10240618 3300009551 Bacteria 1787
535 Ga0105238_10625288 3300009551 Bacteria 1086
536 Ga0105238_10770149 3300009551 Bacteria 977
537 Ga0105249_10000113 3300009553 Bacteria 108613
538 Ga0105249_10001390 3300009553 Bacteria 21177
539 Ga0105249_10001767 3300009553 Bacteria 18831
540 Ga0105249_10022829 3300009553 Bacteria 5609
541 Ga0105249_10490726 3300009553 Bacteria 1272
542 Ga0105239_10000857 3300010375 Bacteria 43236
543 Ga0105239_10003469 3300010375 Bacteria 19288
544 Ga0105239_10049011 3300010375 Bacteria 4631
545 Ga0105239_10060038 3300010375 Bacteria 4173
546 Ga0105239_10076176 3300010375 Bacteria 3689
547 Ga0105239_10165419 3300010375 Bacteria 2473
548 Ga0105239_10241798 3300010375 Bacteria 2026
549 Ga0105239_10887796 3300010375 Bacteria 1023
550 Ga0105246_10001442 3300011119 Bacteria 14078
551 Ga0105246_10073632 3300011119 Bacteria 2412
552 Ga0105246_10086527 3300011119 Bacteria 2247
553 Ga0105246_10280360 3300011119 Bacteria 1337
554 Ga0105246_10319732 3300011119 Unclassified 1261
555 Ga0157373_10003881 3300013100 Bacteria 11298
556 Ga0157373_10018812 3300013100 Bacteria 5027
557 Ga0157373_10044566 3300013100 Bacteria 3166
558 Ga0157373_10044616 3300013100 Bacteria 3165
559 Ga0157373_10186683 3300013100 Bacteria 1460
560 Ga0157371_10000858 3300013102 Bacteria 34677
561 Ga0157371_10310404 3300013102 Bacteria 1143
562 Ga0157371_10317708 3300013102 Bacteria 1130
563 Ga0157370_10001310 3300013104 Bacteria 31043
564 Ga0157370_10066474 3300013104 Bacteria 3410
565 Ga0157370_10084349 3300013104 Bacteria 2986
566 Ga0157370_10104065 3300013104 Bacteria 2657
567 Ga0157370_10193563 3300013104 Bacteria 1887
568 Ga0157369_10002570 3300013105 Bacteria 21720
569 Ga0157369_10007844 3300013105 Bacteria 12281
570 Ga0157369_10065636 3300013105 Bacteria 3906
571 Ga0157369_10070649 3300013105 Bacteria 3750
572 Ga0157369_10125796 3300013105 Bacteria 2718
573 Ga0157369_10196245 3300013105 Bacteria 2120
574 Ga0157374_10002021 3300013296 Bacteria 17019
575 Ga0157374_10913170 3300013296 Bacteria 896
576 Ga0157378_10000048 3300013297 Bacteria 104914
577 Ga0157378_10001435 3300013297 Bacteria 21473
578 Ga0157378_10005648 3300013297 Bacteria 10955
579 Ga0157378_10025656 3300013297 Bacteria 5189
580 Ga0157378_10113691 3300013297 Bacteria 2486
581 Ga0157378_10229130 3300013297 Bacteria 1770
582 Ga0157378_10381753 3300013297 Bacteria 1384
583 Ga0157378_10528555 3300013297 Bacteria 1182
584 Ga0157378_10645347 3300013297 Bacteria 1074
585 Ga0163162_10000023 3300013306 Bacteria 193395
586 Ga0163162_10001226 3300013306 Bacteria 23960
587 Ga0163162_10051608 3300013306 Bacteria 4127
588 Ga0163162_10053079 3300013306 Bacteria 4073
589 Ga0163162_10108278 3300013306 Bacteria 2875
590 Ga0163162_10148629 3300013306 Bacteria 2460
591 Ga0163162_10203558 3300013306 Bacteria 2109
592 Ga0163162_10208523 3300013306 Bacteria 2083
593 Ga0163162_10216899 3300013306 Bacteria 2043
594 Ga0163162_10658561 3300013306 Bacteria 1170
595 Ga0157372_10006136 3300013307 Bacteria 12772
596 Ga0157372_10068693 3300013307 Bacteria 3984
597 Ga0157372_10286185 3300013307 Unclassified 1917
598 Ga0157372_10494190 3300013307 Bacteria 1427
599 Ga0157372_11515511 3300013307 Bacteria 772
600 Ga0157375_10002065 3300013308 Bacteria 17352
601 Ga0157375_10006519 3300013308 Bacteria 10158
602 Ga0157375_10048768 3300013308 Bacteria 4145
603 Ga0157375_10124856 3300013308 Unclassified 2687
604 Ga0157375_10245995 3300013308 Bacteria 1949
605 Ga0157375_10254236 3300013308 Bacteria 1918
606 Ga0157375_10348662 3300013308 Bacteria 1646
607 Ga0163163_10000156 3300014325 Bacteria 70968
608 Ga0163163_10054400 3300014325 Bacteria 3954
609 Ga0163163_10073729 3300014325 Bacteria 3404
610 Ga0163163_10304950 3300014325 Bacteria 1645
611 Ga0163163_10377167 3300014325 Unclassified 1476
612 Ga0163163_10776315 3300014325 Bacteria 1022
613 Ga0157380_10001458 3300014326 Bacteria 15474
614 Ga0157380_10012266 3300014326 Bacteria 6210
615 Ga0157380_10029038 3300014326 Bacteria 4225
616 Ga0157380_10039177 3300014326 Bacteria 3684
617 Ga0157380_10040754 3300014326 Bacteria 3620
618 Ga0157380_10053569 3300014326 Bacteria 3199
619 Ga0157380_10284365 3300014326 Bacteria 1515
620 Ga0157380_10322233 3300014326 Bacteria 1433
621 Ga0157377_10001610 3300014745 Bacteria 9828
622 Ga0157377_10050432 3300014745 Bacteria 2344
623 Ga0157379_10056062 3300014968 Bacteria 3522
624 Ga0157379_10105838 3300014968 Bacteria 2525
625 Ga0157379_10123869 3300014968 Bacteria 2326
626 Ga0157379_10153851 3300014968 Bacteria 2074
627 Ga0157379_10162021 3300014968 Bacteria 2019
628 Ga0157376_10032402 3300014969 Bacteria 4197
629 Ga0157376_10054345 3300014969 Bacteria 3338
630 Ga0157376_10124275 3300014969 Bacteria 2292
631 Ga0157376_10147821 3300014969 Bacteria 2116
632 Ga0157376_10159828 3300014969 Bacteria 2041
633 Ga0157376_11005865 3300014969 Bacteria 856
634 Ga0182006_1023433 3300015261 Bacteria 2557
635 Ga0182007_10030676 3300015262 Bacteria 1835
636 Ga0182007_10056709 3300015262 Unclassified 1286
637 Ga0163161_10017220 3300017792 Bacteria 5055
638 Ga0163161_10025332 3300017792 Bacteria 4198
639 Ga0163161_10059173 3300017792 Bacteria 2786
640 Ga0163161_10159882 3300017792 Bacteria 1717
641 Ga0163161_10174310 3300017792 Bacteria 1646
642 Ga0163161_10231857 3300017792 Bacteria 1433
643 Ga0163161_10337928 3300017792 Bacteria 1194
644 Ga0163161_10355781 3300017792 Bacteria 1165
645 Ga0213873_10062851 3300021358 Bacteria 1008
646 Ga0213874_10021966 3300021377 Bacteria 1765
647 Ga0213874_10023511 3300021377 Bacteria 1720
648 Ga0213876_10000043 3300021384 Bacteria 162257
649 Ga0213876_10000283 3300021384 Bacteria 46166
650 Ga0213876_10000541 3300021384 Bacteria 28477
651 Ga0213876_10000580 3300021384 Bacteria 27228
652 Ga0213876_10059369 3300021384 Bacteria 2019
653 Ga0213876_10123628 3300021384 Bacteria 1374
654 Ga0213876_10297933 3300021384 Bacteria 857
655 Ga0213875_10000276 3300021388 Bacteria 50734
656 Ga0213875_10005719 3300021388 Bacteria 6623
657 Ga0213875_10007545 3300021388 Bacteria 5607
658 Ga0213875_10073977 3300021388 Bacteria 1590
659 Ga0213875_10091254 3300021388 Unclassified 1421
660 Ga0213875_10119755 3300021388 Bacteria 1230
661 Ga0213875_10165417 3300021388 Unclassified 1038
662 Ga0213871_10002403 3300021441 Bacteria 3436
663 Ga0224712_10012148 3300022467 Bacteria 2699
664 Ga0224572_1007204 3300024225 Bacteria 2032
665 Ga0207672_1000156 3300025223 Bacteria 9398
666 Ga0209646_1019801 3300025246 Bacteria 977
667 Ga0209026_1000002 3300025250 Bacteria 1136158
668 Ga0209677_100440 3300025253 Bacteria 24115
669 Ga0209148_1000072 3300025254 Bacteria 325292
670 Ga0209148_1008001 3300025254 Bacteria 2154
671 Ga0209759_1000146 3300025256 Bacteria 121497
672 Ga0209233_1000027 3300025261 Bacteria 652089
673 Ga0209233_1000297 3300025261 Bacteria 61773
674 Ga0209233_1004351 3300025261 Bacteria 4834
675 Ga0209455_1000133 3300025272 Bacteria 155670
676 Ga0209455_1009471 3300025272 Bacteria 2556
677 Ga0209675_1001307 3300025291 Bacteria 14774
678 Ga0209758_1012195 3300025297 Bacteria 4843
679 Ga0209758_1024001 3300025297 Bacteria 2734
680 Ga0209256_1002428 3300025299 Bacteria 15246
681 Ga0207697_10001372 3300025315 Bacteria 13331
682 Ga0207697_10029948 3300025315 Bacteria 2228
683 Ga0207697_10129407 3300025315 Bacteria 1090
684 Ga0207656_10000298 3300025321 Bacteria 17134
685 Ga0207656_10005843 3300025321 Bacteria 4384
686 Ga0207656_10032171 3300025321 Bacteria 2178
687 Ga0207696_1000134 3300025711 Bacteria 130099
688 Ga0207655_1000298 3300025728 Bacteria 74953
689 Ga0207653_10000400 3300025885 Bacteria 19184
690 Ga0207682_10000214 3300025893 Bacteria 26263
691 Ga0207692_10008338 3300025898 Bacteria 4285
692 Ga0207642_10000260 3300025899 Bacteria 15834
693 Ga0207710_10000001 3300025900 Bacteria 1797433
694 Ga0207710_10002316 3300025900 Bacteria 8893
695 Ga0207710_10002769 3300025900 Bacteria 8015
696 Ga0207710_10050509 3300025900 Bacteria 1866
697 Ga0207688_10000836 3300025901 Bacteria 15457
698 Ga0207688_10045664 3300025901 Bacteria 2444
699 Ga0207688_10074619 3300025901 Bacteria 1929
700 Ga0207680_10001615 3300025903 Bacteria 10655
701 Ga0207680_10004606 3300025903 Bacteria 6544
702 Ga0207680_10070356 3300025903 Bacteria 2165
703 Ga0207647_10001682 3300025904 Bacteria 17032
704 Ga0207647_10004899 3300025904 Bacteria 9879
705 Ga0207647_10009697 3300025904 Bacteria 6832
706 Ga0207647_10021671 3300025904 Bacteria 4285
707 Ga0207647_10081547 3300025904 Bacteria 1938
708 Ga0207685_10000041 3300025905 Bacteria 57491
709 Ga0207645_10000251 3300025907 Bacteria 44805
710 Ga0207645_10002159 3300025907 Bacteria 15722
711 Ga0207645_10189759 3300025907 Bacteria 1350
712 Ga0207643_10000176 3300025908 Bacteria 43543
713 Ga0207643_10067989 3300025908 Bacteria 2046
714 Ga0207705_10011075 3300025909 Bacteria 6538
715 Ga0207705_10015184 3300025909 Bacteria 5534
716 Ga0207705_10029984 3300025909 Bacteria 3880
717 Ga0207705_10043327 3300025909 Bacteria 3233
718 Ga0207705_10066183 3300025909 Bacteria 2613
719 Ga0207705_10135850 3300025909 Bacteria 1833
720 Ga0207705_10139696 3300025909 Bacteria 1808
721 Ga0207684_10000130 3300025910 Bacteria 137931
722 Ga0207684_10001792 3300025910 Bacteria 22526
723 Ga0207684_10107705 3300025910 Bacteria 2384
724 Ga0207684_10131173 3300025910 Bacteria 2151
725 Ga0207684_10165352 3300025910 Bacteria 1906
726 Ga0207654_10001318 3300025911 Bacteria 13235
727 Ga0207654_10017455 3300025911 Bacteria 3752
728 Ga0207654_10020733 3300025911 Bacteria 3489
729 Ga0207654_10115339 3300025911 Bacteria 1678
730 Ga0207654_10284014 3300025911 Bacteria 1120
731 Ga0207707_10000577 3300025912 Bacteria 37232
732 Ga0207707_10013845 3300025912 Bacteria 7034
733 Ga0207707_10027146 3300025912 Bacteria 5006
734 Ga0207707_10038041 3300025912 Bacteria 4204
735 Ga0207707_10057171 3300025912 Bacteria 3395
736 Ga0207707_10072545 3300025912 Bacteria 3001
737 Ga0207707_10135112 3300025912 Bacteria 2156
738 Ga0207707_10151696 3300025912 Bacteria 2026
739 Ga0207695_10000011 3300025913 Bacteria 910221
740 Ga0207695_10004415 3300025913 Bacteria 19212
741 Ga0207695_10011746 3300025913 Bacteria 10577
742 Ga0207695_10051889 3300025913 Bacteria 4302
743 Ga0207695_10076795 3300025913 Bacteria 3394
744 Ga0207695_10128836 3300025913 Bacteria 2489
745 Ga0207695_10205545 3300025913 Bacteria 1882
746 Ga0207695_10291348 3300025913 Bacteria 1524
747 Ga0207695_10316714 3300025913 Bacteria 1450
748 Ga0207695_10328574 3300025913 Bacteria 1418
749 Ga0207695_10411011 3300025913 Bacteria 1238
750 Ga0207695_10666506 3300025913 Bacteria 921
751 Ga0207671_10002285 3300025914 Bacteria 20737
752 Ga0207671_10009012 3300025914 Bacteria 8392
753 Ga0207671_10012933 3300025914 Bacteria 6680
754 Ga0207671_10030414 3300025914 Bacteria 4027
755 Ga0207671_10216238 3300025914 Bacteria 1500
756 Ga0207671_10256790 3300025914 Bacteria 1375
757 Ga0207671_10363776 3300025914 Bacteria 1148
758 Ga0207671_10609738 3300025914 Bacteria 870
759 Ga0207663_10082208 3300025916 Bacteria 2112
760 Ga0207660_10004634 3300025917 Bacteria 8962
761 Ga0207660_10013164 3300025917 Bacteria 5416
762 Ga0207660_10037192 3300025917 Bacteria 3390
763 Ga0207660_10118160 3300025917 Bacteria 2005
764 Ga0207660_10314999 3300025917 Unclassified 1248
765 Ga0207660_10416795 3300025917 Bacteria 1083
766 Ga0207662_10000146 3300025918 Bacteria 34142
767 Ga0207662_10043744 3300025918 Bacteria 2642
768 Ga0207662_10046470 3300025918 Bacteria 2568
769 Ga0207662_10176936 3300025918 Bacteria 1371
770 Ga0207657_10003084 3300025919 Bacteria 17826
771 Ga0207657_10012251 3300025919 Bacteria 8472
772 Ga0207657_10022391 3300025919 Bacteria 5913
773 Ga0207657_10022630 3300025919 Bacteria 5875
774 Ga0207657_10173175 3300025919 Bacteria 1748
775 Ga0207657_10273208 3300025919 Bacteria 1343
776 Ga0207649_10000907 3300025920 Bacteria 18679
777 Ga0207649_10001001 3300025920 Bacteria 17489
778 Ga0207649_10003509 3300025920 Bacteria 8570
779 Ga0207649_10053105 3300025920 Bacteria 2517
780 Ga0207652_10010606 3300025921 Bacteria 7417
781 Ga0207652_10043700 3300025921 Bacteria 3815
782 Ga0207652_10068600 3300025921 Bacteria 3077
783 Ga0207652_10075441 3300025921 Bacteria 2939
784 Ga0207652_10104189 3300025921 Bacteria 2509
785 Ga0207646_10004552 3300025922 Bacteria 15002
786 Ga0207646_10004920 3300025922 Bacteria 14288
787 Ga0207646_10149616 3300025922 Bacteria 2105
788 Ga0207646_10251620 3300025922 Bacteria 1596
789 Ga0207646_10269196 3300025922 Bacteria 1540
790 Ga0207681_10001125 3300025923 Bacteria 17320
791 Ga0207681_10009832 3300025923 Bacteria 5850
792 Ga0207681_10014548 3300025923 Bacteria 4893
793 Ga0207681_10284649 3300025923 Bacteria 1303
794 Ga0207681_10292495 3300025923 Bacteria 1286
795 Ga0207694_10001152 3300025924 Bacteria 22948
796 Ga0207694_10002336 3300025924 Bacteria 15508
797 Ga0207694_10022362 3300025924 Bacteria 4796
798 Ga0207694_10028283 3300025924 Bacteria 4274
799 Ga0207694_10071691 3300025924 Bacteria 2707
800 Ga0207694_10405997 3300025924 Bacteria 1133
801 Ga0207650_10000010 3300025925 Bacteria 454110
802 Ga0207650_10001243 3300025925 Bacteria 18523
803 Ga0207650_10603065 3300025925 Bacteria 923
804 Ga0207659_10000831 3300025926 Bacteria 18326
805 Ga0207687_10015252 3300025927 Bacteria 5035
806 Ga0207687_10268305 3300025927 Bacteria 1363
807 Ga0207687_10323474 3300025927 Bacteria 1249
808 Ga0207687_10324228 3300025927 Bacteria 1248
809 Ga0207687_10345839 3300025927 Bacteria 1210
810 Ga0207700_10014164 3300025928 Bacteria 5217
811 Ga0207644_10000285 3300025931 Bacteria 33388
812 Ga0207644_10001068 3300025931 Bacteria 17518
813 Ga0207644_10080345 3300025931 Unclassified 2408
814 Ga0207644_10109564 3300025931 Bacteria 2086
815 Ga0207644_10268626 3300025931 Bacteria 1366
816 Ga0207690_10002228 3300025932 Bacteria 11822
817 Ga0207690_10011176 3300025932 Bacteria 5358
818 Ga0207690_10036252 3300025932 Bacteria 3192
819 Ga0207690_10045184 3300025932 Bacteria 2908
820 Ga0207690_10275600 3300025932 Bacteria 1308
821 Ga0207706_10032261 3300025933 Bacteria 4665
822 Ga0207706_10166685 3300025933 Bacteria 1936
823 Ga0207706_10211548 3300025933 Bacteria 1700
824 Ga0207706_10263151 3300025933 Bacteria 1505
825 Ga0207706_10313566 3300025933 Bacteria 1365
826 Ga0207686_10000008 3300025934 Bacteria 245575
827 Ga0207686_10000463 3300025934 Bacteria 26873
828 Ga0207686_10009014 3300025934 Bacteria 5401
829 Ga0207686_10016548 3300025934 Bacteria 4139
830 Ga0207686_10053520 3300025934 Bacteria 2524
831 Ga0207686_10312709 3300025934 Bacteria 1171
832 Ga0207709_10000025 3300025935 Bacteria 364795
833 Ga0207709_10000493 3300025935 Bacteria 35663
834 Ga0207709_10001939 3300025935 Bacteria 13588
835 Ga0207709_10003815 3300025935 Bacteria 8847
836 Ga0207709_10035958 3300025935 Bacteria 2932
837 Ga0207709_10190844 3300025935 Bacteria 1455
838 Ga0207670_10000695 3300025936 Bacteria 17783
839 Ga0207670_10004103 3300025936 Bacteria 7799
840 Ga0207670_10064713 3300025936 Bacteria 2507
841 Ga0207670_10115390 3300025936 Bacteria 1942
842 Ga0207670_10152603 3300025936 Bacteria 1716
843 Ga0207669_10000390 3300025937 Bacteria 19429
844 Ga0207704_10000842 3300025938 Bacteria 13606
845 Ga0207704_10087011 3300025938 Bacteria 2040
846 Ga0207704_10094645 3300025938 Bacteria 1973
847 Ga0207704_10761095 3300025938 Bacteria 806
848 Ga0207665_10013886 3300025939 Bacteria 5296
849 Ga0207665_10253016 3300025939 Bacteria 1302
850 Ga0207691_10000371 3300025940 Bacteria 45123
851 Ga0207691_10046619 3300025940 Bacteria 3981
852 Ga0207691_10066790 3300025940 Bacteria 3253
853 Ga0207691_10272142 3300025940 Bacteria 1458
854 Ga0207691_10286898 3300025940 Bacteria 1416
855 Ga0207711_10000513 3300025941 Bacteria 39782
856 Ga0207711_10006144 3300025941 Bacteria 10148
857 Ga0207711_10008004 3300025941 Bacteria 8842
858 Ga0207711_10017397 3300025941 Bacteria 5973
859 Ga0207711_10077141 3300025941 Bacteria 2904
860 Ga0207711_10095914 3300025941 Bacteria 2617
861 Ga0207711_10195015 3300025941 Bacteria 1847
862 Ga0207689_10002310 3300025942 Bacteria 17860
863 Ga0207689_10022079 3300025942 Bacteria 5352
864 Ga0207689_10027470 3300025942 Bacteria 4763
865 Ga0207689_10047194 3300025942 Bacteria 3558
866 Ga0207689_10094886 3300025942 Bacteria 2450
867 Ga0207689_10098748 3300025942 Bacteria 2399
868 Ga0207689_10149553 3300025942 Bacteria 1925
869 Ga0207689_10226814 3300025942 Unclassified 1544
870 Ga0207689_10309475 3300025942 Bacteria 1310
871 Ga0207661_10002789 3300025944 Bacteria 12046
872 Ga0207661_10386847 3300025944 Bacteria 1267
873 Ga0207679_10000102 3300025945 Bacteria 70199
874 Ga0207679_10000425 3300025945 Bacteria 30008
875 Ga0207679_10026299 3300025945 Bacteria 4011
876 Ga0207679_10239496 3300025945 Bacteria 1537
877 Ga0207679_10311808 3300025945 Bacteria 1360
878 Ga0207679_10348756 3300025945 Bacteria 1290
879 Ga0207679_10419024 3300025945 Bacteria 1181
880 Ga0207667_10006351 3300025949 Bacteria 14330
881 Ga0207667_10010676 3300025949 Bacteria 10720
882 Ga0207667_10017409 3300025949 Bacteria 8089
883 Ga0207667_10086548 3300025949 Bacteria 3243
884 Ga0207667_10093626 3300025949 Bacteria 3103
885 Ga0207667_10133566 3300025949 Bacteria 2556
886 Ga0207667_10195728 3300025949 Bacteria 2074
887 Ga0207667_10272149 3300025949 Bacteria 1731
888 Ga0207651_10000093 3300025960 Bacteria 39865
889 Ga0207651_10001385 3300025960 Bacteria 10984
890 Ga0207651_10125775 3300025960 Bacteria 1953
891 Ga0207651_10132730 3300025960 Bacteria 1909
892 Ga0207712_10000408 3300025961 Bacteria 36889
893 Ga0207712_10001464 3300025961 Bacteria 16101
894 Ga0207712_10171804 3300025961 Bacteria 1695
895 Ga0207712_10196151 3300025961 Bacteria 1597
896 Ga0207712_10224990 3300025961 Bacteria 1502
897 Ga0207712_10287102 3300025961 Bacteria 1345
898 Ga0207668_10000060 3300025972 Bacteria 89732
899 Ga0207668_10000798 3300025972 Bacteria 19311
900 Ga0207668_10279507 3300025972 Bacteria 1368
901 Ga0207640_10000598 3300025981 Bacteria 21453
902 Ga0207640_10007397 3300025981 Bacteria 6061
903 Ga0207640_10099808 3300025981 Bacteria 2032
904 Ga0207640_10126128 3300025981 Bacteria 1843
905 Ga0207640_10139361 3300025981 Bacteria 1766
906 Ga0207640_10242125 3300025981 Bacteria 1394
907 Ga0207640_10396827 3300025981 Bacteria 1122
908 Ga0207658_10001648 3300025986 Bacteria 17064
909 Ga0207658_10016124 3300025986 Bacteria 5133
910 Ga0207658_10023732 3300025986 Bacteria 4284
911 Ga0207658_10025324 3300025986 Bacteria 4154
912 Ga0207658_10036943 3300025986 Bacteria 3505
913 Ga0207658_10577090 3300025986 Bacteria 1008
914 Ga0207677_10000456 3300026023 Bacteria 27537
915 Ga0207677_10051529 3300026023 Bacteria 2791
916 Ga0207677_10201657 3300026023 Bacteria 1582
917 Ga0207703_10000384 3300026035 Bacteria 47335
918 Ga0207703_10000867 3300026035 Bacteria 29660
919 Ga0207703_10045116 3300026035 Bacteria 3545
920 Ga0207703_10050255 3300026035 Bacteria 3374
921 Ga0207703_10285496 3300026035 Bacteria 1500
922 Ga0207703_10473076 3300026035 Bacteria 1173
923 Ga0207639_10003324 3300026041 Bacteria 10825
924 Ga0207639_10004761 3300026041 Bacteria 9144
925 Ga0207639_10012411 3300026041 Bacteria 5931
926 Ga0207639_10014309 3300026041 Bacteria 5576
927 Ga0207639_10750963 3300026041 Bacteria 907
928 Ga0207678_10000100 3300026067 Bacteria 70537
929 Ga0207678_10002390 3300026067 Bacteria 17041
930 Ga0207678_10010485 3300026067 Bacteria 8138
931 Ga0207678_10040568 3300026067 Bacteria 4037
932 Ga0207678_10047821 3300026067 Bacteria 3699
933 Ga0207678_10446371 3300026067 Bacteria 1124
934 Ga0207678_10561183 3300026067 Bacteria 999
935 Ga0207708_10001694 3300026075 Bacteria 16322
936 Ga0207708_10023885 3300026075 Bacteria 4623
937 Ga0207708_10028396 3300026075 Bacteria 4237
938 Ga0207708_10085114 3300026075 Bacteria 2432
939 Ga0207708_10102988 3300026075 Bacteria 2211
940 Ga0207708_10153194 3300026075 Bacteria 1817
941 Ga0207702_10003152 3300026078 Bacteria 15271
942 Ga0207702_10167061 3300026078 Bacteria 2014
943 Ga0207702_10181949 3300026078 Bacteria 1936
944 Ga0207702_10243222 3300026078 Bacteria 1687
945 Ga0207702_10305491 3300026078 Bacteria 1511
946 Ga0207702_10705024 3300026078 Bacteria 995
947 Ga0207641_10001449 3300026088 Bacteria 23273
948 Ga0207641_10057795 3300026088 Bacteria 3300
949 Ga0207641_10083361 3300026088 Bacteria 2780
950 Ga0207641_10115170 3300026088 Bacteria 2390
951 Ga0207641_10209104 3300026088 Bacteria 1803
952 Ga0207641_10359365 3300026088 Bacteria 1390
953 Ga0207648_10002737 3300026089 Bacteria 18733
954 Ga0207648_10008878 3300026089 Bacteria 9676
955 Ga0207648_10065955 3300026089 Bacteria 3157
956 Ga0207648_10173974 3300026089 Bacteria 1904
957 Ga0207648_10206900 3300026089 Bacteria 1741
958 Ga0207648_10303271 3300026089 Bacteria 1433
959 Ga0207648_10738430 3300026089 Bacteria 914
960 Ga0207676_10001221 3300026095 Bacteria 19155
961 Ga0207676_10019238 3300026095 Bacteria 4978
962 Ga0207676_10024955 3300026095 Bacteria 4431
963 Ga0207676_10032052 3300026095 Bacteria 3957
964 Ga0207676_10313320 3300026095 Bacteria 1437
965 Ga0207676_10725031 3300026095 Bacteria 965
966 Ga0207674_10000671 3300026116 Bacteria 44489
967 Ga0207674_10002399 3300026116 Bacteria 23688
968 Ga0207674_10029109 3300026116 Bacteria 5821
969 Ga0207674_10088526 3300026116 Bacteria 3089
970 Ga0207674_10153778 3300026116 Bacteria 2256
971 Ga0207674_10164935 3300026116 Bacteria 2169
972 Ga0207674_10174661 3300026116 Bacteria 2101
973 Ga0207674_10266209 3300026116 Bacteria 1661
974 Ga0207674_10568106 3300026116 Bacteria 1096
975 Ga0207675_100001958 3300026118 Bacteria 20583
976 Ga0207675_100002014 3300026118 Bacteria 20259
977 Ga0207675_100012425 3300026118 Bacteria 7956
978 Ga0207675_100143234 3300026118 Bacteria 2271
979 Ga0207675_100447650 3300026118 Bacteria 1279
980 Ga0207675_100637354 3300026118 Bacteria 1071
981 Ga0207683_10000375 3300026121 Bacteria 41120
982 Ga0207683_10021422 3300026121 Bacteria 5534
983 Ga0207683_10087003 3300026121 Bacteria 2779
984 Ga0207683_10130809 3300026121 Bacteria 2257
985 Ga0207683_10341395 3300026121 Bacteria 1373
986 Ga0207683_10680892 3300026121 Bacteria 953
987 Ga0207698_10000755 3300026142 Bacteria 18774
988 Ga0207698_10008764 3300026142 Bacteria 6415
989 Ga0207698_10021968 3300026142 Bacteria 4423
990 Ga0207698_10142014 3300026142 Bacteria 2070
991 Ga0207698_10400789 3300026142 Bacteria 1311
992 Ga0207698_10599607 3300026142 Bacteria 1086
993 Ga0207698_10795302 3300026142 Bacteria 948
994 Ga0209281_1000580 3300027111 Bacteria 43078
995 Ga0209588_1109662 3300027671 Unclassified 887
996 Ga0209813_10039879 3300027866 Bacteria 1425
997 Ga0207428_10013505 3300027907 Bacteria 7131
998 Ga0207428_10425070 3300027907 Bacteria 971
999 Ga0268266_10002601 3300028379 Bacteria 19127
1000 Ga0268266_10176790 3300028379 Bacteria 1941
1001 Ga0268266_10334851 3300028379 Bacteria 1419
1002 Ga0268266_10705925 3300028379 Bacteria 972
1003 Ga0268265_10001155 3300028380 Bacteria 23203
1004 Ga0268265_10041099 3300028380 Bacteria 3419
1005 Ga0268265_10087003 3300028380 Bacteria 2485
1006 Ga0268265_10132990 3300028380 Bacteria 2071
1007 Ga0268265_10837196 3300028380 Bacteria 899
1008 Ga0268264_10000938 3300028381 Bacteria 30247
1009 Ga0268264_10006852 3300028381 Bacteria 9564
1010 Ga0268264_10013722 3300028381 Bacteria 6670
1011 Ga0268264_10048036 3300028381 Bacteria 3549
1012 Ga0268264_10059751 3300028381 Unclassified 3194
1013 Ga0268264_10095284 3300028381 Bacteria 2575
1014 Ga0268264_10176763 3300028381 Bacteria 1935
1015 Ga0268264_10317674 3300028381 Bacteria 1471
1016 Ga0268264_10410677 3300028381 Bacteria 1303
1017 Ga0265337_1011859 3300028556 Bacteria 2987
1018 Ga0265337_1027974 3300028556 Bacteria 1696
1019 Ga0265326_10002848 3300028558 Bacteria 5776
1020 Ga0265319_1002530 3300028563 Bacteria 9901
1021 Ga0265319_1027664 3300028563 Bacteria 2008
1022 Ga0265334_10002924 3300028573 Bacteria 7831
1023 Ga0265334_10064086 3300028573 Bacteria 1381
1024 Ga0265318_10000015 3300028577 Bacteria 187234
1025 Ga0265318_10001067 3300028577 Bacteria 17279
1026 Ga0265318_10107796 3300028577 Bacteria 1024
1027 Ga0265322_10039179 3300028654 Unclassified 1348
1028 Ga0265336_10096874 3300028666 Bacteria 879
1029 Ga0265338_10001151 3300028800 Bacteria 43728
1030 Ga0265338_10020696 3300028800 Bacteria 6904
1031 Ga0265338_10023976 3300028800 Bacteria 6250
1032 Ga0265338_10035877 3300028800 Bacteria 4755
1033 Ga0265338_10128359 3300028800 Bacteria 2007
1034 Ga0265338_10133069 3300028800 Bacteria 1960
1035 Ga0265338_10327454 3300028800 Bacteria 1107
1036 Ga0265762_1004498 3300030760 Bacteria 2495
1037 Ga0265762_1008314 3300030760 Unclassified 1846
1038 Ga0265765_1005577 3300030879 Bacteria 1321
1039 Ga0265760_10034992 3300031090 Bacteria 1486
1040 Ga0265328_10079421 3300031239 Bacteria 1209
1041 Ga0265320_10017283 3300031240 Bacteria 4011
1042 Ga0265320_10079449 3300031240 Bacteria 1533
1043 Ga0265320_10081828 3300031240 Bacteria 1506
1044 Ga0265320_10215209 3300031240 Bacteria 856
1045 Ga0265325_10001084 3300031241 Bacteria 19604
1046 Ga0265325_10089163 3300031241 Bacteria 1523
1047 Ga0265325_10098895 3300031241 Bacteria 1430
1048 Ga0265325_10188254 3300031241 Bacteria 958
1049 Ga0265340_10003394 3300031247 Bacteria 8994
1050 Ga0265340_10089159 3300031247 Bacteria 1444
1051 Ga0265340_10144329 3300031247 Bacteria 1088
1052 Ga0265339_10000685 3300031249 Bacteria 26127
1053 Ga0265339_10007974 3300031249 Bacteria 6792
1054 Ga0265339_10015979 3300031249 Bacteria 4485
1055 Ga0265339_10032527 3300031249 Bacteria 2941
1056 Ga0265339_10040343 3300031249 Bacteria 2595
1057 Ga0265339_10223758 3300031249 Bacteria 919
1058 Ga0265331_10000102 3300031250 Bacteria 115584
1059 Ga0265331_10033783 3300031250 Bacteria 2528
1060 Ga0265316_10022216 3300031344 Bacteria 5357
1061 Ga0265316_10082428 3300031344 Unclassified 2464
1062 Ga0265316_10086431 3300031344 Bacteria 2397
1063 Ga0265316_10143833 3300031344 Bacteria 1790
1064 Ga0265316_10173427 3300031344 Bacteria 1608
1065 Ga0265316_10240214 3300031344 Unclassified 1332
1066 Ga0307408_100089283 3300031548 Bacteria 2323
1067 Ga0265313_10000865 3300031595 Bacteria 30547
1068 Ga0307508_10196223 3300031616 Bacteria 1620
1069 Ga0316575_10001077 3300031665 Bacteria 8500
1070 Ga0316575_10011041 3300031665 Bacteria 3333
1071 Ga0316575_10050339 3300031665 Bacteria 1659
1072 Ga0316575_10165460 3300031665 Bacteria 915
1073 Ga0316579_10038435 3300031691 Bacteria 2213
1074 Ga0316579_10091232 3300031691 Bacteria 1455
1075 Ga0265314_10000258 3300031711 Bacteria 77755
1076 Ga0265314_10060363 3300031711 Bacteria 2588
1077 Ga0265314_10114059 3300031711 Bacteria 1712
1078 Ga0265314_10161977 3300031711 Bacteria 1360
1079 Ga0265314_10310288 3300031711 Bacteria 881
1080 Ga0265342_10001056 3300031712 Bacteria 26936
1081 Ga0265342_10007754 3300031712 Bacteria 7812
1082 Ga0265342_10035673 3300031712 Bacteria 3043
1083 Ga0265342_10165782 3300031712 Bacteria 1219
1084 Ga0265342_10238253 3300031712 Unclassified 975
1085 Ga0316576_10001112 3300031727 Bacteria 14055
1086 Ga0316576_10033327 3300031727 Bacteria 3665
1087 Ga0316576_10083745 3300031727 Bacteria 2370
1088 Ga0316576_10099442 3300031727 Bacteria 2173
1089 Ga0316576_10143290 3300031727 Bacteria 1799
1090 Ga0316576_10248342 3300031727 Bacteria 1336
1091 Ga0316578_10011768 3300031728 Bacteria 4593
1092 Ga0316578_10044301 3300031728 Bacteria 2588
1093 Ga0316578_10054356 3300031728 Bacteria 2348
1094 Ga0316578_10129128 3300031728 Bacteria 1520
1095 Ga0316578_10186846 3300031728 Bacteria 1248
1096 Ga0316578_10230492 3300031728 Bacteria 1112
1097 Ga0307405_10102765 3300031731 Bacteria 1920
1098 Ga0316577_10008546 3300031733 Bacteria 5492
1099 Ga0316577_10014688 3300031733 Bacteria 4302
1100 Ga0316577_10020005 3300031733 Bacteria 3708
1101 Ga0316577_10038969 3300031733 Bacteria 2659
1102 Ga0307413_10157747 3300031824 Bacteria 1590
1103 Ga0307413_10167609 3300031824 Bacteria 1551
1104 Ga0307410_10147722 3300031852 Bacteria 1746
1105 Ga0307410_10181137 3300031852 Bacteria 1595
1106 Ga0307410_10222037 3300031852 Bacteria 1454
1107 Ga0307410_10435769 3300031852 Bacteria 1066
1108 Ga0307406_10031996 3300031901 Bacteria 3207
1109 Ga0307406_10170919 3300031901 Bacteria 1573
1110 Ga0307409_100109755 3300031995 Bacteria 2310
1111 Ga0307409_100394241 3300031995 Bacteria 1320
1112 Ga0307409_100395838 3300031995 Bacteria 1318
1113 Ga0307416_100243039 3300032002 Bacteria 1746
1114 Ga0307414_10008080 3300032004 Bacteria 5944
1115 Ga0307414_10299504 3300032004 Bacteria 1360
1116 Ga0307411_10120154 3300032005 Bacteria 1899
1117 Ga0307411_10423843 3300032005 Bacteria 1106
1118 Ga0307415_100033995 3300032126 Bacteria 3314
1119 Ga0307415_100510014 3300032126 Unclassified 1053
1120 Ga0316583_10007407 3300032133 Bacteria 3951
1121 Ga0316585_10019994 3300032137 Bacteria 2046
1122 Ga0316593_10005355 3300032168 Bacteria 3376
1123 Ga0316593_10010568 3300032168 Bacteria 2651
1124 Ga0316593_10013111 3300032168 Bacteria 2447
1125 Ga0316593_10020510 3300032168 Bacteria 2056
1126 Ga0316593_10057683 3300032168 Bacteria 1322
1127 Ga0316593_10062211 3300032168 Bacteria 1278
1128 Ga0316596_1011731 3300033541 Bacteria 2147
1129 Ga0316596_1024299 3300033541 Bacteria 1556
1130 Ga0373930_0011932 3300034816 Bacteria 1576
1131 Ga0373941_0001589 3300035115 Bacteria 4830
1132 Ga0373941_0037090 3300035115 Bacteria 1486
1133 Ga0373945_0033785 3300035116 Bacteria 1820
1134 Ga0373956_0387337 3300035119 Bacteria 667
1135 Ga0373943_0049967 3300035170 Bacteria 2054
1136 Ga0373946_0093571 3300035171 Bacteria 1336
1137 Ga0316574_0000439 3300035398 Bacteria 16537
1138 Ga0316574_0017026 3300035398 Bacteria 4244
1139 Ga0316574_0100775 3300035398 Bacteria 1848
1140 Ga0373931_0040463 3300035691 Bacteria 2446
1141 Ga0373931_0068199 3300035691 Bacteria 1935
1142 Ga0373935_0037988 3300035692 Bacteria 3013
1143 Ga0373935_0052142 3300035692 Bacteria 2600
1144 Ga0373927_0044672 3300035695 Bacteria 2866
1145 Ga0373937_0005450 3300036401 Bacteria 10892
1146 Ga0373937_0047707 3300036401 Bacteria 3920
1147 Ga0373937_0547774 3300036401 Bacteria 1099
1148 Ga0316582_0020619 3300036647 Bacteria 3880
1149 Ga0316582_0025596 3300036647 Bacteria 3545
1150 Ga0316582_0053359 3300036647 Bacteria 2571
1151 Ga0316582_0148054 3300036647 Bacteria 1586
1152 Ga0316582_0318950 3300036647 Bacteria 1068
1153 Ga0316582_0388358 3300036647 Bacteria 961
1154 Ga0316584_0001402 3300036712 Bacteria 14393
1155 Ga0316584_0003289 3300036712 Bacteria 10458
1156 Ga0316584_0003840 3300036712 Bacteria 9850
1157 Ga0316584_0003883 3300036712 Bacteria 9806
1158 Ga0316584_0011924 3300036712 Bacteria 6123
1159 Ga0316584_0023348 3300036712 Bacteria 4519
1160 Ga0316584_0023535 3300036712 Bacteria 4499
1161 Ga0316584_0195144 3300036712 Bacteria 1496
1162 Ga0316584_0562059 3300036712 Bacteria 795
1163 Ga0373925_0207428 3300037068 Bacteria 1560
1164 Ga0373925_0222760 3300037068 Bacteria 1506
1165 Ga0395899_0012908 3300037312 Bacteria 6393
1166 Ga0395899_0070048 3300037312 Bacteria 2567
1167 Ga0395899_0486162 3300037312 Bacteria 803
1168 Ga0395900_0025391 3300037418 Bacteria 6066
1169 Ga0395900_0140129 3300037418 Bacteria 2477
1170 Ga0395900_0181520 3300037418 Bacteria 2138
1171 Ga0395900_0196989 3300037418 Bacteria 2040
1172 Ga0395900_0415781 3300037418 Bacteria 1306
1173 Ga0395900_0733914 3300037418 Bacteria 919
1174 Ga0395900_0836032 3300037418 Bacteria 847
1175 Ga0395898_0080689 3300037466 Bacteria 3137
1176 Ga0395898_0125664 3300037466 Bacteria 2457
1177 Ga0395898_0162225 3300037466 Bacteria 2138
1178 Ga0395898_0193157 3300037466 Bacteria 1945
1179 Ga0395898_0636552 3300037466 Bacteria 1009
1180 Ga0395905_0000911 3300037471 Bacteria 38191
1181 Ga0395905_0006827 3300037471 Bacteria 11423
1182 Ga0395905_0008081 3300037471 Bacteria 10392
1183 Ga0395905_0040992 3300037471 Bacteria 4344
1184 Ga0395905_0052360 3300037471 Bacteria 3821
1185 Ga0395905_0171218 3300037471 Bacteria 2040
1186 Ga0395905_0227978 3300037471 Bacteria 1742
1187 Ga0395905_0299862 3300037471 Bacteria 1494
1188 Ga0395905_0316347 3300037471 Bacteria 1450
1189 Ga0395905_0860694 3300037471 Bacteria 809
1190 Ga0316581_0004894 3300037588 Bacteria 3450
1191 Ga0316581_0018084 3300037588 Bacteria 2043
1192 Ga0436364_0003086 3300037853 Bacteria 2692
1193 Ga0436364_0079644 3300037853 Bacteria 315114
1194 Ga0436364_0207864 3300037853 Bacteria 4093
1195 Ga0436364_0310410 3300037853 Bacteria 6647
1196 Ga0436364_0374781 3300037853 Bacteria 2708
1197 Ga0436364_0517934 3300037853 Bacteria 2665
1198 Ga0436364_0545736 3300037853 Bacteria 12413
1199 Ga0436364_0598581 3300037853 Bacteria 1322
1200 Ga0436364_0635932 3300037853 Bacteria 1196
1201 Ga0436364_0653298 3300037853 Bacteria 1171
1202 Ga0436364_0935450 3300037853 Unclassified 2024
1203 Ga0436364_1040205 3300037853 Bacteria 1666
1204 Ga0436364_1113697 3300037853 Bacteria 5886
1205 Ga0436364_1161322 3300037853 Bacteria 4503
1206 Ga0436364_1291049 3300037853 Bacteria 3015
1207 Ga0436364_1366309 3300037853 Bacteria 1860
1208 Ga0395901_0006071 3300038443 Bacteria 12242
1209 Ga0395901_0094751 3300038443 Bacteria 3128
1210 Ga0395901_0109329 3300038443 Bacteria 2902
1211 Ga0395901_0205365 3300038443 Bacteria 2064
1212 Ga0395901_0695327 3300038443 Bacteria 1015
1213 Ga0400484_42049 3300038725 Bacteria 3922
1214 Ga0400490_04614 3300038726 Bacteria 12566
1215 Ga0400490_13335 3300038726 Bacteria 8774
1216 Ga0400486_07680 3300038742 Bacteria 16080
1217 Ga0400483_195000 3300039062 Bacteria 103610
1218 Ga0400483_278927 3300039062 Bacteria 1901
1219 Ga0436365_0227260 3300039437 Bacteria 4977
1220 Ga0436365_0283204 3300039437 Bacteria 28751
1221 Ga0436365_0421852 3300039437 Bacteria 162876
1222 Ga0436365_0426125 3300039437 Bacteria 1963
1223 Ga0436365_0847170 3300039437 Bacteria 1144
1224 Ga0436365_0935686 3300039437 Bacteria 2770
1225 Ga0436365_0994234 3300039437 Bacteria 49963
1226 Ga0436365_1114212 3300039437 Bacteria 2342
1227 Ga0436365_1132500 3300039437 Bacteria 1715
1228 Ga0436365_1397674 3300039437 Bacteria 2110
1229 Ga0436365_1422517 3300039437 Bacteria 874
1230 Ga0436365_1595370 3300039437 Bacteria 63808
1231 Ga0436365_1779432 3300039437 Bacteria 5390
1232 Ga0436360_0295164 3300039438 Bacteria 14242
1233 Ga0436360_0355578 3300039438 Bacteria 1182
1234 Ga0436360_0413033 3300039438 Bacteria 1384
1235 Ga0436360_0459232 3300039438 Bacteria 3214
1236 Ga0436360_0587385 3300039438 Bacteria 965
1237 Ga0436361_0073402 3300039447 Bacteria 1508
1238 Ga0436363_0096334 3300039450 Bacteria 850
1239 Ga0436363_0162148 3300039450 Bacteria 3683
1240 Ga0436363_0171561 3300039450 Bacteria 925
1241 Ga0436363_0222055 3300039450 Bacteria 2207
1242 Ga0436363_0516425 3300039450 Bacteria 5850
1243 Ga0436363_0550052 3300039450 Bacteria 837
1244 Ga0436363_0849922 3300039450 Bacteria 1309
1245 Ga0436362_0315526 3300039453 Bacteria 1702
1246 Ga0436362_0605469 3300039453 Bacteria 2595
1247 Ga0436362_0735076 3300039453 Bacteria 999
1248 Ga0436362_0764253 3300039453 Bacteria 1191
1249 Ga0436362_0808991 3300039453 Bacteria 4956
1250 Ga0439433_0080256 3300041999 Bacteria 793
1251 Ga0439448_0015703 3300042005 Bacteria 2297
1252 Ga0439458_0072768 3300042157 Bacteria 869
1253 Ga0439458_0126685 3300042157 Bacteria 675
1254 Ga0439434_0082002 3300042435 Bacteria 1024
1255 Ga0451577_0001956 3300042876 Bacteria 25985
1256 Ga0451577_0121152 3300042876 Bacteria 2343
1257 Ga0451577_0175909 3300042876 Bacteria 1929
1258 Ga0451577_0446006 3300042876 Bacteria 1175
1259 Ga0451577_0710005 3300042876 Bacteria 910
1260 Ga0451577_0737711 3300042876 Bacteria 891
1261 Ga0466969_0006535 3300044656 Bacteria 6203
1262 Ga0466972_0086629 3300044658 Bacteria 1488
1263 Ga0453683_0000118 3300044673 Bacteria 117158
1264 Ga0453683_0000280 3300044673 Bacteria 66926
1265 Ga0453683_0000891 3300044673 Bacteria 28627
1266 Ga0453683_0001047 3300044673 Bacteria 25702
1267 Ga0453683_0005938 3300044673 Bacteria 8425
1268 Ga0453683_0027559 3300044673 Bacteria 3602
1269 Ga0453683_0075393 3300044673 Bacteria 2112
1270 Ga0453683_0150042 3300044673 Bacteria 1473
1271 Ga0453683_0256609 3300044673 Bacteria 1115
1272 Ga0466966_0007455 3300044684 Bacteria 7256
1273 Ga0466963_0075224 3300044694 Bacteria 2279
1274 Ga0453684_0000829 3300044712 Bacteria 104404
1275 Ga0453684_0005096 3300044712 Bacteria 26493
1276 Ga0453684_0022082 3300044712 Bacteria 9465
1277 Ga0453684_0028475 3300044712 Bacteria 7967
1278 Ga0453684_0050873 3300044712 Bacteria 5442
1279 Ga0453684_0052888 3300044712 Bacteria 5305
1280 Ga0453684_0064823 3300044712 Bacteria 4663
1281 Ga0453684_0073587 3300044712 Bacteria 4306
1282 Ga0453684_0080822 3300044712 Bacteria 4057
1283 Ga0453684_0084451 3300044712 Bacteria 3948
1284 Ga0453684_0178157 3300044712 Bacteria 2498
1285 Ga0453684_0196101 3300044712 Bacteria 2358
1286 Ga0453684_0231434 3300044712 Bacteria 2133
1287 Ga0453684_0291175 3300044712 Bacteria 1859
1288 Ga0453684_0360342 3300044712 Bacteria 1637
1289 Ga0453684_0523887 3300044712 Bacteria 1309
1290 Ga0466971_0010408 3300044719 Bacteria 4064
1291 Ga0466968_0211427 3300044735 Bacteria 911
1292 Ga0466970_0237370 3300044765 Bacteria 1020
1293 Ga0466957_0001594 3300044842 Bacteria 11920
1294 Ga0466957_0178423 3300044842 Bacteria 1386
1295 Ga0466959_0007114 3300045049 Bacteria 7828
1296 Ga0466959_0015161 3300045049 Bacteria 5614
1297 Ga0451576_0000001 3300045051 Bacteria 1802108
1298 Ga0451576_0000019 3300045051 Bacteria 545863
1299 Ga0451576_0000213 3300045051 Bacteria 144536
1300 Ga0451576_0001202 3300045051 Bacteria 46283
1301 Ga0451576_0012429 3300045051 Bacteria 9562
1302 Ga0451576_0016088 3300045051 Bacteria 8263
1303 Ga0451576_0024883 3300045051 Bacteria 6460
1304 Ga0451576_0036606 3300045051 Bacteria 5201
1305 Ga0451576_0094400 3300045051 Bacteria 3111
1306 Ga0451576_0170485 3300045051 Bacteria 2272
1307 Ga0451576_0775981 3300045051 Bacteria 1007
1308 Ga0451576_0875787 3300045051 Bacteria 942
1309 Ga0451576_1066620 3300045051 Bacteria 846
1310 Ga0466958_0004041 3300045836 Bacteria 7691
1311 Ga0466958_0010957 3300045836 Bacteria 5094
1312 Ga0466967_0061444 3300045976 Bacteria 3333
1313 Ga0466967_0353804 3300045976 Bacteria 1422
1314 Ga0495627_000443 3300046453 Bacteria 36101
1315 Ga0495592_0044537 3300046454 Unclassified 3315
1316 Ga0495603_0047372 3300046455 Bacteria 2560
1317 Ga0495629_0235070 3300046459 Bacteria 1263
1318 Ga0495580_0193675 3300046472 Bacteria 1402
1319 Ga0495662_0193291 3300046476 Unclassified 1003
1320 Ga0495584_0011661 3300046491 Bacteria 4499
1321 Ga0495583_0000020 3300046506 Bacteria 296185
1322 Ga0495606_0037111 3300046507 Bacteria 3311
1323 Ga0495608_0027558 3300046511 Bacteria 3865
1324 Ga0495610_0040933 3300046512 Bacteria 2330
1325 Ga0495618_0202566 3300046514 Bacteria 1256
1326 Ga0495628_0288816 3300046516 Bacteria 1216
1327 Ga0495630_0560077 3300046517 Unclassified 876
1328 Ga0495632_0015594 3300046519 Bacteria 4250
1329 Ga0495643_0080866 3300046522 Bacteria 1690
1330 Ga0495648_0101400 3300046524 Bacteria 1588
1331 Ga0495640_0400802 3300046533 Bacteria 842
1332 Ga0495598_0007838 3300046537 Bacteria 2466
1333 Ga0495621_0005527 3300046539 Bacteria 3636
1334 Ga0495597_0048524 3300046542 Bacteria 1878
1335 Ga0495645_0200046 3300046543 Bacteria 1356
1336 Ga0495622_0002426 3300046557 Bacteria 9051
1337 Ga0495633_0152475 3300046558 Bacteria 1067
1338 Ga0495668_0209532 3300046616 Bacteria 1067
1339 Ga0495625_0026301 3300046660 Bacteria 4399
1340 Ga0495625_0403083 3300046660 Bacteria 854
1341 Ga0495599_0259220 3300046678 Bacteria 1057
1342 Ga0495658_0429262 3300046683 Bacteria 843
1343 Ga0495669_0030631 3300046684 Bacteria 2362
1344 Ga0495669_0158264 3300046684 Bacteria 1074
1345 Ga0495670_0000265 3300046691 Bacteria 24414
1346 Ga0495604_0187267 3300047317 Bacteria 1444
1347 Ga0495636_0111664 3300047318 Bacteria 1203
1348 Ga0495672_0071022 3300047320 Bacteria 1971
1349 Ga0495683_0053018 3300047323 Bacteria 2023
1350 Ga0495681_0011264 3300047470 Bacteria 5340
1351 Ga0495684_0144711 3300047471 Bacteria 1781
1352 Ga0495686_0170494 3300047472 Bacteria 1266
1353 Ga0495593_0041920 3300047673 Bacteria 2459
1354 Ga0495593_0066861 3300047673 Bacteria 1872
1355 Ga0495602_0014256 3300048088 Bacteria 8076
1356 Ga0496100_0039379 3300048903 Bacteria 3002
1357 Ga0496100_0064222 3300048903 Bacteria 2428
1358 Ga0496100_0136829 3300048903 Bacteria 1731
1359 Ga0496100_0142886 3300048903 Bacteria 1698
1360 Ga0496101_0005585 3300048904 Bacteria 8030
1361 Ga0496101_0016841 3300048904 Bacteria 4947
1362 Ga0496101_0113614 3300048904 Bacteria 2041
1363 Ga0496101_0138124 3300048904 Bacteria 1856
1364 Ga0496102_0002747 3300048905 Bacteria 15004
1365 Ga0496102_0005255 3300048905 Bacteria 10995
1366 Ga0496102_0033196 3300048905 Bacteria 4637
1367 Ga0496102_0131609 3300048905 Bacteria 2342
1368 Ga0496102_0260303 3300048905 Bacteria 1636
1369 Ga0496102_0331589 3300048905 Bacteria 1433
1370 Ga0496103_0002057 3300048906 Bacteria 12872
1371 Ga0496103_0020842 3300048906 Bacteria 3941
1372 Ga0496103_0027204 3300048906 Bacteria 3464
1373 Ga0496104_0010951 3300048907 Bacteria 8114
1374 Ga0496104_0017799 3300048907 Bacteria 6479
1375 Ga0496104_0094192 3300048907 Bacteria 2865
1376 Ga0496104_0149079 3300048907 Bacteria 2246
1377 Ga0496104_0306260 3300048907 Bacteria 1501
1378 Ga0496104_0351283 3300048907 Bacteria 1387
1379 Ga0496104_0890781 3300048907 Bacteria 795
1380 Ga0496105_0008864 3300048908 Bacteria 7837
1381 Ga0496105_0044390 3300048908 Bacteria 3666
1382 Ga0496105_0172825 3300048908 Bacteria 1771
1383 Ga0496105_0268040 3300048908 Bacteria 1380
1384 Ga0496106_0004676 3300048909 Bacteria 10151
1385 Ga0496106_0005250 3300048909 Bacteria 9599
1386 Ga0496106_0020957 3300048909 Bacteria 4850
1387 Ga0496106_0069286 3300048909 Bacteria 2692
1388 Ga0496106_0133009 3300048909 Bacteria 1952
1389 Ga0496106_0177142 3300048909 Bacteria 1692
1390 Ga0496107_0001506 3300048910 Bacteria 14468
1391 Ga0496107_0006946 3300048910 Bacteria 7801
1392 Ga0496107_0055141 3300048910 Bacteria 2871
1393 Ga0496107_0062331 3300048910 Bacteria 2701
1394 Ga0496107_0128403 3300048910 Bacteria 1871
1395 Ga0496107_0236291 3300048910 Bacteria 1360
1396 Ga0496108_0013562 3300048911 Bacteria 6651
1397 Ga0496108_0032831 3300048911 Bacteria 4311
1398 Ga0496108_0037537 3300048911 Bacteria 4036
1399 Ga0496108_0076730 3300048911 Bacteria 2825
1400 Ga0496108_0098113 3300048911 Bacteria 2497
1401 Ga0496108_0299570 3300048911 Bacteria 1400
1402 Ga0496109_0006013 3300048912 Bacteria 10195
1403 Ga0496109_0020848 3300048912 Bacteria 5791
1404 Ga0496109_0027322 3300048912 Bacteria 5093
1405 Ga0496109_0116835 3300048912 Bacteria 2483
1406 Ga0496109_0151170 3300048912 Bacteria 2174
1407 Ga0496109_0164906 3300048912 Bacteria 2077
1408 Ga0496109_0533397 3300048912 Bacteria 1107
1409 Ga0496110_0042694 3300048913 Bacteria 3958
1410 Ga0496110_0087569 3300048913 Bacteria 2781
1411 Ga0496110_0116341 3300048913 Bacteria 2407
1412 Ga0496110_0168117 3300048913 Bacteria 1989
1413 Ga0496110_0638853 3300048913 Bacteria 964
1414 Ga0496111_0000242 3300048914 Bacteria 26131
1415 Ga0496111_0028631 3300048914 Bacteria 3949
1416 Ga0496112_0001235 3300048915 Bacteria 19294
1417 Ga0496112_0025166 3300048915 Bacteria 5712
1418 Ga0496112_0031568 3300048915 Bacteria 5140
1419 Ga0496112_0031888 3300048915 Bacteria 5114
1420 Ga0496112_0332913 3300048915 Bacteria 1462
1421 Ga0496112_0456462 3300048915 Bacteria 1215
1422 Ga0496112_0583431 3300048915 Bacteria 1050
1423 Ga0496113_0287318 3300048916 Bacteria 1315
1424 Ga0496114_0036337 3300048917 Bacteria 4072
1425 Ga0496114_0173980 3300048917 Bacteria 1877
1426 Ga0496114_0205853 3300048917 Bacteria 1725
1427 Ga0496114_0303375 3300048917 Bacteria 1410
1428 Ga0496115_0052518 3300048918 Bacteria 3270
1429 Ga0496115_0087400 3300048918 Bacteria 2544
1430 Ga0496117_0003941 3300048920 Bacteria 16793
1431 Ga0496118_0002145 3300048921 Bacteria 27524
1432 Ga0496118_0084428 3300048921 Bacteria 2215
1433 Ga0496119_0003925 3300048922 Bacteria 15085
1434 Ga0496119_0020238 3300048922 Bacteria 4861
1435 Ga0496119_0080829 3300048922 Bacteria 1874
1436 Ga0496119_0103005 3300048922 Bacteria 1599
1437 Ga0496119_0105036 3300048922 Bacteria 1578
1438 Ga0496119_0199427 3300048922 Bacteria 1037
1439 Ga0496120_0008156 3300048923 Bacteria 7682
1440 Ga0496120_0102441 3300048923 Bacteria 1510
1441 Ga0496121_0000009 3300048924 Bacteria 836971
1442 Ga0496121_0000751 3300048924 Bacteria 59594
1443 Ga0496121_0065751 3300048924 Bacteria 2948
1444 Ga0496121_0269258 3300048924 Bacteria 1172
1445 Ga0496122_0000025 3300048925 Bacteria 362915
1446 Ga0496122_0034633 3300048925 Bacteria 4128
1447 Ga0496122_0098694 3300048925 Bacteria 1960
1448 Ga0496123_0000054 3300048926 Bacteria 234046
1449 Ga0496123_0030694 3300048926 Bacteria 3928
1450 Ga0496124_0036426 3300048927 Bacteria 4291
1451 Ga0496124_0048353 3300048927 Bacteria 3635
1452 Ga0496124_0080967 3300048927 Bacteria 2671
1453 Ga0496125_0043147 3300048928 Bacteria 3833
1454 Ga0496125_0047369 3300048928 Bacteria 3596
1455 Ga0496125_0188098 3300048928 Bacteria 1367
1456 Ga0496126_0073247 3300048929 Bacteria 3045
1457 Ga0496126_0201568 3300048929 Bacteria 1680
1458 Ga0501293_007669 3300049516 Unclassified 897
1459 Ga0501296_002969 3300049519 Bacteria 1800
1460 Ga0501297_011866 3300049520 Bacteria 1006
1461 Ga0501298_005636 3300049521 Bacteria 2016
1462 Ga0501299_002465 3300049522 Bacteria 2562
1463 Ga0501031_0005703 3300049568 Bacteria 8115
1464 Ga0501031_0049069 3300049568 Bacteria 2750
1465 Ga0501031_0103948 3300049568 Bacteria 1854
1466 Ga0501031_0261108 3300049568 Bacteria 1125
1467 Ga0501031_0262297 3300049568 Bacteria 1122
1468 Ga0501032_0000064 3300049569 Bacteria 91971
1469 Ga0501032_0001600 3300049569 Bacteria 18059
1470 Ga0501032_0025086 3300049569 Bacteria 4110
1471 Ga0501032_0031757 3300049569 Bacteria 3620
1472 Ga0501032_0032937 3300049569 Bacteria 3551
1473 Ga0501032_0068479 3300049569 Bacteria 2369
1474 Ga0501032_0235317 3300049569 Bacteria 1191
1475 Ga0501032_0489339 3300049569 Bacteria 786
1476 Ga0501033_0000286 3300049570 Bacteria 48628
1477 Ga0501033_0002532 3300049570 Bacteria 15473
1478 Ga0501033_0016268 3300049570 Bacteria 5633
1479 Ga0501033_0020977 3300049570 Bacteria 4934
1480 Ga0501033_0045254 3300049570 Bacteria 3275
1481 Ga0501033_0088657 3300049570 Bacteria 2264
1482 Ga0501033_0093339 3300049570 Bacteria 2201
1483 Ga0501033_0116907 3300049570 Bacteria 1937
1484 Ga0501033_0143786 3300049570 Bacteria 1724
1485 Ga0501033_0192474 3300049570 Bacteria 1459
1486 Ga0501033_0206863 3300049570 Bacteria 1400
1487 Ga0501034_0000097 3300049571 Bacteria 161027
1488 Ga0501034_0000174 3300049571 Bacteria 119615
1489 Ga0501034_0002221 3300049571 Bacteria 23948
1490 Ga0501034_0002380 3300049571 Bacteria 22851
1491 Ga0501034_0022346 3300049571 Bacteria 6446
1492 Ga0501034_0024404 3300049571 Bacteria 6151
1493 Ga0501034_0076402 3300049571 Bacteria 3356
1494 Ga0501034_0083319 3300049571 Bacteria 3200
1495 Ga0501034_0107639 3300049571 Bacteria 2779
1496 Ga0501034_0120131 3300049571 Bacteria 2614
1497 Ga0501034_0134238 3300049571 Bacteria 2457
1498 Ga0501034_0220435 3300049571 Bacteria 1849
1499 Ga0501034_0233815 3300049571 Bacteria 1786
1500 Ga0501034_0243812 3300049571 Bacteria 1742
1501 Ga0501034_0254534 3300049571 Bacteria 1700
1502 Ga0501034_0270112 3300049571 Bacteria 1642
1503 Ga0501034_0592451 3300049571 Bacteria 1015
1504 Ga0501034_0610149 3300049571 Bacteria 996
1505 Ga0501034_0668045 3300049571 Bacteria 939
1506 Ga0501036_0004998 3300049572 Bacteria 10727
1507 Ga0501036_0054187 3300049572 Bacteria 3397
1508 Ga0501036_0077234 3300049572 Bacteria 2817
1509 Ga0501036_0182860 3300049572 Bacteria 1764
1510 Ga0501036_0298455 3300049572 Bacteria 1348
1511 Ga0501036_0488418 3300049572 Bacteria 1025
1512 Ga0501036_0820233 3300049572 Bacteria 765
1513 Ga0501037_0000118 3300049573 Bacteria 73584
1514 Ga0501037_0006091 3300049573 Bacteria 8816
1515 Ga0501037_0053085 3300049573 Bacteria 2964
1516 Ga0501037_0136640 3300049573 Bacteria 1756
1517 Ga0501037_0155025 3300049573 Bacteria 1635
1518 Ga0501037_0204238 3300049573 Bacteria 1395
1519 Ga0501037_0483499 3300049573 Bacteria 841
1520 Ga0501038_0000031 3300049574 Bacteria 132231
1521 Ga0501038_0003995 3300049574 Bacteria 13696
1522 Ga0501038_0007946 3300049574 Bacteria 9775
1523 Ga0501038_0028402 3300049574 Bacteria 4971
1524 Ga0501038_0041630 3300049574 Bacteria 4005
1525 Ga0501038_0041926 3300049574 Bacteria 3989
1526 Ga0501038_0157169 3300049574 Bacteria 1850
1527 Ga0501038_0165500 3300049574 Bacteria 1794
1528 Ga0501038_0316604 3300049574 Bacteria 1221
1529 Ga0501038_0498346 3300049574 Bacteria 931
1530 Ga0501039_0000057 3300049575 Bacteria 89756
1531 Ga0501039_0017563 3300049575 Bacteria 5488
1532 Ga0501039_0041392 3300049575 Bacteria 3559
1533 Ga0501039_0047324 3300049575 Bacteria 3324
1534 Ga0501039_0216886 3300049575 Bacteria 1504
1535 Ga0501040_0001144 3300049576 Bacteria 16848
1536 Ga0501040_0189556 3300049576 Bacteria 1459
1537 Ga0501041_0042622 3300049577 Bacteria 2759
1538 Ga0501043_0000048 3300049579 Bacteria 109146
1539 Ga0501043_0054965 3300049579 Bacteria 3128
1540 Ga0501043_0072840 3300049579 Bacteria 2698
1541 Ga0501043_0103181 3300049579 Bacteria 2241
1542 Ga0501043_0133472 3300049579 Bacteria 1946
1543 Ga0501043_0156188 3300049579 Bacteria 1784
1544 Ga0501043_0164505 3300049579 Bacteria 1732
1545 Ga0501043_0238183 3300049579 Bacteria 1404
1546 Ga0501043_0569552 3300049579 Bacteria 839
1547 Ga0501046_0010968 3300049580 Bacteria 7770
1548 Ga0501046_0014309 3300049580 Bacteria 6699
1549 Ga0501046_0026372 3300049580 Bacteria 4747
1550 Ga0501046_0051871 3300049580 Bacteria 3235
1551 Ga0501046_0204766 3300049580 Bacteria 1467
1552 Ga0501046_0338445 3300049580 Bacteria 1094
1553 Ga0501046_0368610 3300049580 Bacteria 1041
1554 Ga0501046_0401988 3300049580 Bacteria 989
1555 Ga0501047_0003748 3300049581 Bacteria 14320
1556 Ga0501047_0008494 3300049581 Bacteria 9687
1557 Ga0501047_0048076 3300049581 Bacteria 4120
1558 Ga0501047_0054470 3300049581 Bacteria 3869
1559 Ga0501047_0062229 3300049581 Bacteria 3600
1560 Ga0501047_0069524 3300049581 Bacteria 3390
1561 Ga0501047_0152583 3300049581 Bacteria 2185
1562 Ga0501047_0186826 3300049581 Bacteria 1937
1563 Ga0501047_0252256 3300049581 Bacteria 1613
1564 Ga0501047_0317678 3300049581 Bacteria 1398
1565 Ga0501047_0442731 3300049581 Bacteria 1129
1566 Ga0501047_0458236 3300049581 Bacteria 1104
1567 Ga0501047_0478199 3300049581 Bacteria 1073
1568 Ga0501047_0514213 3300049581 Bacteria 1023
1569 Ga0501047_0591718 3300049581 Bacteria 931
1570 Ga0501048_0030793 3300049582 Bacteria 3883
1571 Ga0501048_0057459 3300049582 Bacteria 2759
1572 Ga0501048_0125816 3300049582 Bacteria 1812
1573 Ga0501048_0186831 3300049582 Bacteria 1469
1574 Ga0501067_0027568 3300049583 Bacteria 3148
1575 Ga0501067_0051142 3300049583 Bacteria 2291
1576 Ga0501067_0097648 3300049583 Bacteria 1631
1577 Ga0501067_0121329 3300049583 Bacteria 1454
1578 Ga0501067_0189576 3300049583 Bacteria 1145
1579 Ga0501067_0242958 3300049583 Bacteria 1002
1580 Ga0501067_0351840 3300049583 Bacteria 821
1581 Ga0501068_0035832 3300049584 Bacteria 2963
1582 Ga0501068_0065095 3300049584 Bacteria 2218
1583 Ga0501068_0085297 3300049584 Bacteria 1943
1584 Ga0501068_0095279 3300049584 Bacteria 1840
1585 Ga0501068_0294420 3300049584 Bacteria 1038
1586 Ga0501069_0020534 3300049585 Bacteria 3579
1587 Ga0501069_0047390 3300049585 Bacteria 2385
1588 Ga0501069_0248398 3300049585 Bacteria 1038
1589 Ga0501070_0029009 3300049586 Bacteria 4640
1590 Ga0501070_0029317 3300049586 Bacteria 4615
1591 Ga0501070_0039424 3300049586 Bacteria 3940
1592 Ga0501070_0051500 3300049586 Bacteria 3417
1593 Ga0501070_0052146 3300049586 Bacteria 3396
1594 Ga0501070_0087469 3300049586 Bacteria 2579
1595 Ga0501070_0318144 3300049586 Bacteria 1266
1596 Ga0501071_0032763 3300049587 Bacteria 3691
1597 Ga0501071_0039321 3300049587 Bacteria 3384
1598 Ga0501071_0181489 3300049587 Bacteria 1577
1599 Ga0501071_0222043 3300049587 Unclassified 1422
1600 Ga0501072_0109972 3300049588 Bacteria 2193
1601 Ga0501072_0110278 3300049588 Bacteria 2190
1602 Ga0501072_0308239 3300049588 Bacteria 1259
1603 Ga0501072_0496817 3300049588 Bacteria 965
1604 Ga0501072_0582490 3300049588 Bacteria 883
1605 Ga0501073_0014781 3300049589 Bacteria 5668
1606 Ga0501073_0020495 3300049589 Bacteria 4768
1607 Ga0501073_0089425 3300049589 Bacteria 2140
1608 Ga0501073_0090002 3300049589 Bacteria 2133
1609 Ga0501073_0108511 3300049589 Bacteria 1926
1610 Ga0501073_0458198 3300049589 Bacteria 881
1611 Ga0501073_0531311 3300049589 Bacteria 813
1612 Ga0501074_0013095 3300049590 Bacteria 6029
1613 Ga0501074_0023939 3300049590 Bacteria 4437
1614 Ga0501074_0024895 3300049590 Bacteria 4348
1615 Ga0501074_0057774 3300049590 Bacteria 2795
1616 Ga0501074_0081104 3300049590 Bacteria 2326
1617 Ga0501075_0005167 3300049591 Bacteria 8933
1618 Ga0501075_0028092 3300049591 Bacteria 4150
1619 Ga0501076_0006377 3300049592 Bacteria 8557
1620 Ga0501076_0191194 3300049592 Bacteria 1670
1621 Ga0501076_0321462 3300049592 Bacteria 1269
1622 Ga0501077_0009579 3300049593 Bacteria 6022
1623 Ga0501077_0098052 3300049593 Bacteria 1858
1624 Ga0501202_023766 3300049652 Unclassified 1239
1625 Ga0501202_039277 3300049652 Bacteria 1017
1626 Ga0501217_081826 3300049661 Bacteria 895
1627 Ga0501223_001670 3300049663 Bacteria 5094
1628 Ga0501233_006769 3300049668 Bacteria 2163
1629 Ga0501235_003437 3300049669 Bacteria 3425
1630 Ga0501235_016642 3300049669 Bacteria 1626
1631 Ga0501249_042551 3300049679 Unclassified 1033
1632 Ga0501255_020100 3300049684 Bacteria 857
1633 Ga0501261_013782 3300049690 Bacteria 1100
1634 Ga0501225_0001550 3300049705 Bacteria 7211
1635 Ga0501225_0044761 3300049705 Bacteria 1225
1636 Ga0501234_002639 3300049707 Bacteria 2824
1637 Ga0501079_0007423 3300049741 Bacteria 8295
1638 Ga0501079_0035953 3300049741 Bacteria 3814
1639 Ga0501079_0059738 3300049741 Bacteria 2941
1640 Ga0501079_0201938 3300049741 Bacteria 1553
1641 Ga0501079_0244124 3300049741 Bacteria 1403
1642 Ga0501079_0410660 3300049741 Bacteria 1062
1643 Ga0501080_0008721 3300049742 Bacteria 9208
1644 Ga0501080_0009091 3300049742 Bacteria 9042
1645 Ga0501080_0009451 3300049742 Bacteria 8893
1646 Ga0501080_0051261 3300049742 Bacteria 3840
1647 Ga0501080_0069725 3300049742 Bacteria 3270
1648 Ga0501080_0115442 3300049742 Bacteria 2489
1649 Ga0501080_0127479 3300049742 Bacteria 2356
1650 Ga0501080_0156121 3300049742 Bacteria 2108
1651 Ga0501080_0284471 3300049742 Bacteria 1502
1652 Ga0501081_0001736 3300049743 Bacteria 13518
1653 Ga0501081_0023556 3300049743 Bacteria 4127
1654 Ga0501081_0149491 3300049743 Bacteria 1677
1655 Ga0501083_0044651 3300049744 Bacteria 2999
1656 Ga0501083_0049244 3300049744 Bacteria 2840
1657 Ga0501083_0063763 3300049744 Bacteria 2457
1658 Ga0501083_0243283 3300049744 Bacteria 1171
1659 Ga0501083_0288918 3300049744 Bacteria 1066
1660 Ga0501083_0429998 3300049744 Bacteria 859
1661 Ga0501270_007195 3300049767 Bacteria 1369
1662 Ga0501283_000325 3300049779 Bacteria 6309
1663 Ga0501035_0000118 3300049822 Bacteria 95482
1664 Ga0501035_0003976 3300049822 Bacteria 14088
1665 Ga0501035_0030120 3300049822 Bacteria 4948
1666 Ga0501035_0059706 3300049822 Bacteria 3396
1667 Ga0501035_0083249 3300049822 Bacteria 2823
1668 Ga0501035_0096309 3300049822 Bacteria 2600
1669 Ga0501035_0105131 3300049822 Bacteria 2475
1670 Ga0501035_0290401 3300049822 Bacteria 1380
1671 Ga0501035_0344252 3300049822 Bacteria 1248
1672 Ga0501044_0000504 3300049823 Bacteria 47543
1673 Ga0501044_0021869 3300049823 Bacteria 6819
1674 Ga0501044_0056387 3300049823 Bacteria 4034
1675 Ga0501044_0076395 3300049823 Bacteria 3399
1676 Ga0501044_0079183 3300049823 Bacteria 3330
1677 Ga0501044_0103067 3300049823 Bacteria 2868
1678 Ga0501044_0165513 3300049823 Bacteria 2185
1679 Ga0501044_0172041 3300049823 Bacteria 2137
1680 Ga0501044_0213873 3300049823 Bacteria 1881
1681 Ga0501044_0235427 3300049823 Bacteria 1777
1682 Ga0501044_0265553 3300049823 Bacteria 1654
1683 Ga0501044_0299120 3300049823 Bacteria 1538
1684 Ga0501044_0318935 3300049823 Bacteria 1479
1685 Ga0501044_0441433 3300049823 Bacteria 1209
1686 Ga0501044_0589506 3300049823 Bacteria 1005
1687 Ga0501045_0004800 3300049824 Bacteria 9340
1688 Ga0501045_0473744 3300049824 Bacteria 930
1689 Ga0501226_005037 3300049853 Bacteria 1515
1690 nmdc:mga03n38_226150_c1 3300050490 Bacteria 979
1691 nmdc:mga03n38_35806_c1 3300050490 Bacteria 2130
1692 nmdc:mga00v17_276191_c1 3300050491 Bacteria 1091
1693 nmdc:mga0yw44_18283_c1 3300050492 Bacteria 3834
1694 nmdc:mga0yw44_21084_c1 3300050492 Bacteria 3630
1695 nmdc:mga0yw44_398199_c1 3300050492 Bacteria 931
1696 nmdc:mga06z11_27303_c1 3300050494 Bacteria 2728
1697 nmdc:mga04h51_19968_c1 3300050495 Bacteria 1994
1698 nmdc:mga07m45_12880_c1 3300050496 Bacteria 3603
1699 nmdc:mga07m45_20065_c1 3300050496 Bacteria 3628
1700 nmdc:mga05p37_115286_c1 3300050507 Bacteria 3303
1701 nmdc:mga05p37_1172521_c1 3300050507 Bacteria 797
1702 nmdc:mga05p37_285757_c1 3300050507 Bacteria 1965
1703 nmdc:mga05p37_300144_c1 3300050507 Unclassified 1909
1704 nmdc:mga05p37_31141_c1 3300050507 Bacteria 6515
1705 nmdc:mga05p37_317055_c1 3300050507 Bacteria 1846
1706 nmdc:mga05p37_329514_c1 3300050507 Bacteria 1804
1707 nmdc:mga05p37_486728_c1 3300050507 Bacteria 1419
1708 nmdc:mga05p37_734563_c1 3300050507 Unclassified 1091
1709 nmdc:mga09592_23768_c1 3300050508 Bacteria 5063
1710 nmdc:mga0qj67_72848_c1 3300050509 Bacteria 2743
1711 nmdc:mga06r32_12560_c1 3300050510 Bacteria 7647
1712 nmdc:mga06r32_433336_c1 3300050510 Bacteria 1295
1713 nmdc:mga06r32_976_c1 3300050510 Bacteria 25615
1714 nmdc:mga08y16_1009107_c1 3300050511 Bacteria 812
1715 nmdc:mga08y16_226482_c1 3300050511 Bacteria 1935
1716 nmdc:mga08y16_278776_c1 3300050511 Bacteria 1725
1717 nmdc:mga08y16_292919_c1 3300050511 Bacteria 1678
1718 nmdc:mga08y16_72419_c1 3300050511 Bacteria 3591
1719 nmdc:mga08y16_75051_c1 3300050511 Bacteria 3525
1720 nmdc:mga08y16_86150_c1 3300050511 Bacteria 3274
1721 nmdc:mga0n895_129906_c1 3300050512 Bacteria 2544
1722 nmdc:mga0n895_141334_c1 3300050512 Bacteria 2436
1723 nmdc:mga0n895_226829_c1 3300050512 Bacteria 1896
1724 nmdc:mga0n895_240226_c1 3300050512 Bacteria 1838
1725 nmdc:mga0n895_2522_c1 3300050512 Bacteria 14348
1726 nmdc:mga0n895_594604_c1 3300050512 Bacteria 1109
1727 nmdc:mga0n895_89055_c1 3300050512 Unclassified 3087
1728 nmdc:mga0rr50_10031_c1 3300050513 Bacteria 5259
1729 nmdc:mga0rr50_137562_c1 3300050513 Bacteria 1962
1730 nmdc:mga0rr50_169_c1 3300050513 Bacteria 34726
1731 nmdc:mga08x19_26_c1 3300050514 Bacteria 228913
1732 nmdc:mga0a205_132190_c1 3300050515 Bacteria 1977
1733 nmdc:mga0a205_289709_c1 3300050515 Bacteria 1512
1734 nmdc:mga0a205_323773_c1 3300050515 Bacteria 1412
1735 nmdc:mga0a205_347774_c1 3300050515 Unclassified 1350
1736 nmdc:mga0a205_460169_c1 3300050515 Bacteria 1132
1737 nmdc:mga0a205_72336_c1 3300050515 Bacteria 3331
1738 nmdc:mga0a205_84763_c1 3300050515 Bacteria 3061
1739 Ga0495601_0000235 3300053077 Bacteria 29620
1740 Ga0500610_0168365 3300053079 Bacteria 1084
1741 Ga0500635_0000302 3300053080 Bacteria 17373
1742 Ga0500635_0001280 3300053080 Bacteria 6005
1743 Ga0495655_0011188 3300053083 Bacteria 1795
1744 Ga0495595_0017221 3300053084 Bacteria 3108
1745 Ga0495619_0035488 3300053085 Bacteria 3243
1746 Ga0495619_0117877 3300053085 Bacteria 1818
1747 Ga0495619_0351034 3300053085 Bacteria 1020
1748 Ga0500578_0140706 3300053086 Bacteria 1509
1749 Ga0500647_0026024 3300053091 Bacteria 2758
1750 Ga0500651_0016713 3300053093 Bacteria 4515
1751 Ga0500566_0041234 3300053094 Bacteria 2667
1752 Ga0500641_0003377 3300053096 Bacteria 5646
1753 Ga0500641_0005166 3300053096 Bacteria 4626
1754 Ga0500562_003232 3300053108 Bacteria 4071
1755 Ga0500593_000013 3300053117 Bacteria 59669
1756 Ga0500595_006840 3300053119 Bacteria 4798
1757 Ga0500608_000573 3300053122 Bacteria 13643
1758 Ga0500614_001562 3300053123 Bacteria 5419
1759 Ga0500618_002996 3300053125 Bacteria 6010
1760 Ga0500618_003083 3300053125 Bacteria 5893
1761 Ga0500618_036011 3300053125 Bacteria 1147
1762 Ga0500655_015690 3300053133 Bacteria 1391
1763 Ga0500559_0084876 3300053136 Bacteria 1444
1764 Ga0500559_0182351 3300053136 Bacteria 989
1765 Ga0500564_158915 3300053138 Bacteria 958
1766 Ga0500573_0000008 3300053140 Bacteria 237795
1767 Ga0500573_0077380 3300053140 Bacteria 1893
1768 Ga0500577_0006420 3300053142 Bacteria 3244
1769 Ga0500577_0025434 3300053142 Bacteria 2003
1770 Ga0500616_0000250 3300053153 Bacteria 83271
1771 Ga0500616_0000797 3300053153 Bacteria 36110
1772 Ga0500616_0004513 3300053153 Bacteria 9885
1773 Ga0500616_0032743 3300053153 Bacteria 2840
1774 Ga0500620_000225 3300053155 Bacteria 11219
1775 Ga0500620_107336 3300053155 Bacteria 977
1776 Ga0500622_0037248 3300053156 Bacteria 2541
1777 Ga0500627_0095586 3300053158 Bacteria 1331
1778 Ga0500638_166041 3300053162 Bacteria 966
1779 Ga0500639_040789 3300053163 Bacteria 2443
1780 Ga0500636_0010526 3300053177 Bacteria 5399
1781 Ga0500637_0010845 3300053178 Bacteria 4688
1782 Ga0500637_0187572 3300053178 Bacteria 1182
1783 Ga0500625_088391 3300053729 Bacteria 1333
1784 Ga0500645_022384 3300053730 Bacteria 1944
1785 Ga0500645_069379 3300053730 Bacteria 1013
1786 Ga0500596_003174 3300053735 Bacteria 3155
1787 Ga0501084_0000137 3300054114 Bacteria 55092
1788 Ga0501084_0001317 3300054114 Bacteria 19557
1789 Ga0501084_0016901 3300054114 Bacteria 6064
1790 Ga0501084_0023706 3300054114 Bacteria 5118
1791 Ga0501084_0036990 3300054114 Bacteria 4078
1792 Ga0501084_0061753 3300054114 Bacteria 3137
1793 Ga0501084_0226380 3300054114 Bacteria 1578
1794 Ga0501084_0240168 3300054114 Bacteria 1529
1795 Ga0501084_0425019 3300054114 Unclassified 1123
1796 Ga0501084_0514318 3300054114 Bacteria 1012
1797 Ga0501082_0004024 3300060353 Bacteria 12827
1798 Ga0501082_0006081 3300060353 Bacteria 10477
1799 Ga0501082_0015392 3300060353 Bacteria 6582
1800 Ga0501082_0100996 3300060353 Bacteria 2495
1801 Ga0501082_0388232 3300060353 Bacteria 1218
1802 Ga0501082_0721415 3300060353 Bacteria 872
1803 Ga0466962_0005568 3300061719 Bacteria 6045
1804 Ga0466962_0005965 3300061719 Bacteria 5852
1805 Ga0466962_0063868 3300061719 Bacteria 1758
1806 Ga0530510_0003542 3300061734 Bacteria 10748
1807 Ga0530510_0007842 3300061734 Bacteria 7446

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0152583 Ga0501047_0152583_309_1064 200
2 3300049823 Ga0501044_0318935 Ga0501044_0318935_347_1102 200
3 3300005548 Ga0070665_100046320 Ga0070665_1000463202 202
4 3300037853 Ga0436364_0635932 Ga0436364_0635932_22_633 202
5 3300049587 Ga0501071_0222043 Ga0501071_0222043_35_643 202
6 iso_pu_bacteria 2922130491 2922137271 205
7 3300025901 Ga0207688_10045664 Ga0207688_100456643 206
8 3300005327 Ga0070658_10001208 Ga0070658_100012088 208
9 3300005336 Ga0070680_100001985 Ga0070680_1000019857 208
10 3300005458 Ga0070681_10003664 Ga0070681_100036645 208
11 3300005530 Ga0070679_100011201 Ga0070679_1000112017 208
12 3300005563 Ga0068855_100018186 Ga0068855_1000181866 208
13 3300009093 Ga0105240_10062851 Ga0105240_100628512 208
14 3300025909 Ga0207705_10066183 Ga0207705_100661833 208
15 3300025912 Ga0207707_10072545 Ga0207707_100725452 208
16 3300025913 Ga0207695_10205545 Ga0207695_102055452 208
17 3300025917 Ga0207660_10013164 Ga0207660_100131642 208
18 3300025949 Ga0207667_10133566 Ga0207667_101335663 208
19 3300026067 Ga0207678_10561183 Ga0207678_105611831 208
20 3300025942 Ga0207689_10098748 Ga0207689_100987483 211
21 3300025919 Ga0207657_10012251 Ga0207657_100122514 213
22 3300026116 Ga0207674_10164935 Ga0207674_101649352 213
23 3300035119 Ga0373956_0387337 Ga0373956_0387337_14_655 213
24 3300042157 Ga0439458_0126685 Ga0439458_0126685_19_660 213
25 iso_pu_bacteria 2878774303 2878778322 213
26 3300003354 JGI25160J50197_1002193 JGI25160J50197_10021933 214
27 3300005366 Ga0070659_100023287 Ga0070659_1000232872 214
28 3300005458 Ga0070681_10018723 Ga0070681_100187233 214
29 3300005539 Ga0068853_100040630 Ga0068853_1000406305 214
30 3300005563 Ga0068855_100037556 Ga0068855_1000375564 214
31 3300005577 Ga0068857_100037853 Ga0068857_1000378533 214
32 3300025909 Ga0207705_10011075 Ga0207705_100110753 214
33 3300025912 Ga0207707_10057171 Ga0207707_100571712 214
34 3300025917 Ga0207660_10004634 Ga0207660_100046344 214
35 3300025921 Ga0207652_10068600 Ga0207652_100686002 214
36 3300025949 Ga0207667_10017409 Ga0207667_100174096 214
37 3300037471 Ga0395905_0000911 Ga0395905_0000911_20129_20896 214
38 3300049568 Ga0501031_0261108 Ga0501031_0261108_281_1027 214
39 3300049569 Ga0501032_0031757 Ga0501032_0031757_2848_3594 214
40 3300049570 Ga0501033_0016268 Ga0501033_0016268_1795_2541 214
41 3300049571 Ga0501034_0107639 Ga0501034_0107639_1833_2579 214
42 3300049571 Ga0501034_0233815 Ga0501034_0233815_483_1229 214
43 3300049571 Ga0501034_0592451 Ga0501034_0592451_254_1000 214
44 3300049574 Ga0501038_0041926 Ga0501038_0041926_1639_2385 214
45 3300049581 Ga0501047_0008494 Ga0501047_0008494_302_1048 214
46 3300049581 Ga0501047_0317678 Ga0501047_0317678_603_1349 214
47 3300049586 Ga0501070_0052146 Ga0501070_0052146_2134_2880 214
48 3300049822 Ga0501035_0059706 Ga0501035_0059706_195_941 214
49 iso_pu_bacteria 2922185730 2922186504 214
50 3300045051 Ga0451576_0875787 Ga0451576_0875787_18_665 215
51 3300048922 Ga0496119_0199427 Ga0496119_0199427_352_1026 216
52 3300049741 Ga0501079_0244124 Ga0501079_0244124_12_680 216
53 3300050492 nmdc:mga0yw44_398199_c1 nmdc:mga0yw44_398199_c1_231_902 216
54 3300005563 Ga0068855_100089580 Ga0068855_1000895802 217
55 3300005614 Ga0068856_100341639 Ga0068856_1003416392 217
56 3300025949 Ga0207667_10086548 Ga0207667_100865482 217
57 3300026078 Ga0207702_10305491 Ga0207702_103054912 217
58 3300031247 Ga0265340_10089159 Ga0265340_100891592 217
59 3300031249 Ga0265339_10007974 Ga0265339_100079743 217
60 3300031249 Ga0265339_10040343 Ga0265339_100403432 217
61 3300003214 JGI25165J46597_1010963 JGI25165J46597_10109631 218
62 3300005518 Ga0070699_100000352 Ga0070699_10000035232 218
63 3300005563 Ga0068855_100151181 Ga0068855_1001511812 218
64 3300013100 Ga0157373_10044566 Ga0157373_100445664 218
65 3300013104 Ga0157370_10193563 Ga0157370_101935632 218
66 3300025254 Ga0209148_1008001 Ga0209148_10080012 218
67 3300025261 Ga0209233_1004351 Ga0209233_10043512 218
68 3300025272 Ga0209455_1009471 Ga0209455_10094711 218
69 3300035692 Ga0373935_0052142 Ga0373935_0052142_1045_1818 218
70 3300035695 Ga0373927_0044672 Ga0373927_0044672_1725_2498 218
71 3300037418 Ga0395900_0025391 Ga0395900_0025391_3315_4073 218
72 3300037418 Ga0395900_0836032 Ga0395900_0836032_71_829 218
73 3300047323 Ga0495683_0053018 Ga0495683_0053018_1167_1928 218
74 3300049570 Ga0501033_0206863 Ga0501033_0206863_582_1334 218
75 3300049569 Ga0501032_0489339 Ga0501032_0489339_91_765 219
76 3300049582 Ga0501048_0057459 Ga0501048_0057459_2069_2743 219
77 3300049592 Ga0501076_0321462 Ga0501076_0321462_585_1259 219
78 3300053096 Ga0500641_0003377 Ga0500641_0003377_2124_2879 219
79 3300005364 Ga0070673_100525780 Ga0070673_1005257802 220
80 3300005843 Ga0068860_100007853 Ga0068860_1000078533 220
81 3300025938 Ga0207704_10761095 Ga0207704_107610951 220
82 3300025960 Ga0207651_10132730 Ga0207651_101327301 220
83 3300025986 Ga0207658_10023732 Ga0207658_100237322 220
84 3300028381 Ga0268264_10006852 Ga0268264_100068523 220
85 3300031727 Ga0316576_10099442 Ga0316576_100994423 220
86 3300033541 Ga0316596_1024299 Ga0316596_10242993 220
87 3300035116 Ga0373945_0033785 Ga0373945_0033785_201_956 220
88 3300037418 Ga0395900_0415781 Ga0395900_0415781_379_1128 220
89 3300037471 Ga0395905_0006827 Ga0395905_0006827_7500_8249 220
90 3300039450 Ga0436363_0171561 Ga0436363_0171561_74_859 220
91 3300046455 Ga0495603_0047372 Ga0495603_0047372_1760_2515 220
92 iso_pu_bacteria 2987673487 2987677347 220
93 3300005328 Ga0070676_10002075 Ga0070676_100020755 221
94 3300005347 Ga0070668_100020391 Ga0070668_1000203911 221
95 3300005353 Ga0070669_100047892 Ga0070669_1000478922 221
96 3300005459 Ga0068867_100006387 Ga0068867_1000063872 221
97 3300005617 Ga0068859_100029327 Ga0068859_1000293275 221
98 3300006881 Ga0068865_100024668 Ga0068865_1000246683 221
99 3300006931 Ga0097620_100029326 Ga0097620_1000293265 221
100 3300025907 Ga0207645_10002159 Ga0207645_100021599 221
101 3300025923 Ga0207681_10009832 Ga0207681_100098324 221
102 3300025940 Ga0207691_10066790 Ga0207691_100667903 221
103 3300025942 Ga0207689_10094886 Ga0207689_100948863 221
104 3300025972 Ga0207668_10000060 Ga0207668_1000006025 221
105 3300025986 Ga0207658_10016124 Ga0207658_100161245 221
106 3300026089 Ga0207648_10002737 Ga0207648_100027372 221
107 3300026121 Ga0207683_10130809 Ga0207683_101308093 221
108 3300028379 Ga0268266_10334851 Ga0268266_103348511 221
109 3300041999 Ga0439433_0080256 Ga0439433_0080256_88_777 221
110 3300005445 Ga0070708_100005855 Ga0070708_1000058556 222
111 3300025981 Ga0207640_10099808 Ga0207640_100998083 222
112 3300035692 Ga0373935_0037988 Ga0373935_0037988_2041_2796 222
113 3300036401 Ga0373937_0005450 Ga0373937_0005450_5458_6204 222
114 3300039450 Ga0436363_0550052 Ga0436363_0550052_68_817 222
115 3300048088 Ga0495602_0014256 Ga0495602_0014256_4809_5555 222
116 3300053163 Ga0500639_040789 Ga0500639_040789_48_803 222
117 iso_pu_bacteria 2979793036 2979797597 222
118 3300006846 Ga0075430_100080323 Ga0075430_1000803231 223
119 3300006847 Ga0075431_100000392 Ga0075431_10000039213 223
120 3300028577 Ga0265318_10000015 Ga0265318_1000001575 223
121 3300031241 Ga0265325_10188254 Ga0265325_101882541 223
122 3300039438 Ga0436360_0413033 Ga0436360_0413033_363_1145 223
123 3300046512 Ga0495610_0040933 Ga0495610_0040933_810_1571 223
124 3300049581 Ga0501047_0458236 Ga0501047_0458236_223_969 223
125 3300049583 Ga0501067_0051142 Ga0501067_0051142_1383_2129 223
126 3300050508 nmdc:mga09592_23768_c1 nmdc:mga09592_23768_c1_3746_4468 223
127 3300050509 nmdc:mga0qj67_72848_c1 nmdc:mga0qj67_72848_c1_1854_2576 223
128 3300050510 nmdc:mga06r32_976_c1 nmdc:mga06r32_976_c1_12687_13409 223
129 3300054114 Ga0501084_0000137 Ga0501084_0000137_11257_11979 223
130 3300060353 Ga0501082_0388232 Ga0501082_0388232_87_809 223
131 3300013307 Ga0157372_11515511 Ga0157372_115155111 224
132 3300025299 Ga0209256_1002428 Ga0209256_10024284 224
133 3300028800 Ga0265338_10035877 Ga0265338_100358774 224
134 3300031249 Ga0265339_10015979 Ga0265339_100159794 224
135 3300031711 Ga0265314_10114059 Ga0265314_101140593 224
136 3300031901 Ga0307406_10170919 Ga0307406_101709192 224
137 3300036401 Ga0373937_0047707 Ga0373937_0047707_1345_2094 224
138 3300046453 Ga0495627_000443 Ga0495627_000443_32030_32791 224
139 3300046506 Ga0495583_0000020 Ga0495583_0000020_185655_186428 224
140 3300046543 Ga0495645_0200046 Ga0495645_0200046_38_787 224
141 3300046678 Ga0495599_0259220 Ga0495599_0259220_95_844 224
142 3300049593 Ga0501077_0098052 Ga0501077_0098052_969_1739 224
143 3300049742 Ga0501080_0127479 Ga0501080_0127479_1638_2330 224
144 3300006028 Ga0070717_10114601 Ga0070717_101146012 225
145 3300037068 Ga0373925_0222760 Ga0373925_0222760_266_1054 225
146 3300037312 Ga0395899_0070048 Ga0395899_0070048_46_816 225
147 3300037853 Ga0436364_0517934 Ga0436364_0517934_458_1192 225
148 3300045976 Ga0466967_0353804 Ga0466967_0353804_525_1259 225
149 3300003322 rootL2_10259676 rootL2_102596762 226
150 3300009098 Ga0105245_10487140 Ga0105245_104871402 226
151 3300025927 Ga0207687_10345839 Ga0207687_103458392 226
152 3300031665 Ga0316575_10011041 Ga0316575_100110414 226
153 3300036401 Ga0373937_0547774 Ga0373937_0547774_280_1068 226
154 3300049587 Ga0501071_0039321 Ga0501071_0039321_1376_2149 226
155 3300049741 Ga0501079_0059738 Ga0501079_0059738_358_1131 226
156 3300049743 Ga0501081_0149491 Ga0501081_0149491_803_1576 226
157 3300053117 Ga0500593_000013 Ga0500593_000013_9137_9874 226
158 3300053133 Ga0500655_015690 Ga0500655_015690_370_1095 226
159 3300054114 Ga0501084_0023706 Ga0501084_0023706_475_1248 226
160 3300025941 Ga0207711_10095914 Ga0207711_100959143 227
161 3300049589 Ga0501073_0531311 Ga0501073_0531311_59_781 227
162 3300049591 Ga0501075_0005167 Ga0501075_0005167_2601_3365 227
163 3300049592 Ga0501076_0006377 Ga0501076_0006377_2836_3600 227
164 3300049593 Ga0501077_0009579 Ga0501077_0009579_2649_3413 227
165 3300049741 Ga0501079_0007423 Ga0501079_0007423_2031_2795 227
166 3300049743 Ga0501081_0023556 Ga0501081_0023556_1093_1857 227
167 3300049744 Ga0501083_0429998 Ga0501083_0429998_43_807 227
168 3300054114 Ga0501084_0016901 Ga0501084_0016901_2494_3258 227
169 3300060353 Ga0501082_0015392 Ga0501082_0015392_1881_2645 227
170 3300005364 Ga0070673_100351064 Ga0070673_1003510642 228
171 3300005435 Ga0070714_100380444 Ga0070714_1003804442 228
172 3300025939 Ga0207665_10013886 Ga0207665_100138864 228
173 3300028800 Ga0265338_10327454 Ga0265338_103274541 228
174 3300039453 Ga0436362_0315526 Ga0436362_0315526_840_1589 228
175 3300046533 Ga0495640_0400802 Ga0495640_0400802_36_773 228
176 3300047317 Ga0495604_0187267 Ga0495604_0187267_295_1068 228
177 3300047471 Ga0495684_0144711 Ga0495684_0144711_286_1023 228
178 3300048922 Ga0496119_0003925 Ga0496119_0003925_5560_6297 228
179 3300049583 Ga0501067_0121329 Ga0501067_0121329_157_903 228
180 3300049589 Ga0501073_0108511 Ga0501073_0108511_969_1715 228
181 3300049590 Ga0501074_0024895 Ga0501074_0024895_3201_3947 228
182 3300049742 Ga0501080_0008721 Ga0501080_0008721_3119_3865 228
183 3300049744 Ga0501083_0044651 Ga0501083_0044651_1613_2359 228
184 3300054114 Ga0501084_0061753 Ga0501084_0061753_1281_2027 228
185 3300060353 Ga0501082_0006081 Ga0501082_0006081_1614_2360 228
186 iso_pu_bacteria 2834578030 2834578651 228
187 3300053153 Ga0500616_0000250 Ga0500616_0000250_6171_6944 229
188 iso_pu_bacteria 2713897090 2715500121 229
189 iso_pu_bacteria 2917554339 2917557072 229
190 iso_pu_bacteria 3000017691 3000018694 229
191 3300005331 Ga0070670_100033283 Ga0070670_1000332832 230
192 3300005563 Ga0068855_100926808 Ga0068855_1009268082 230
193 3300005616 Ga0068852_100662403 Ga0068852_1006624031 230
194 3300005844 Ga0068862_100014640 Ga0068862_1000146402 230
195 3300005985 Ga0081539_10016624 Ga0081539_100166244 230
196 3300009177 Ga0105248_10020227 Ga0105248_100202275 230
197 3300025941 Ga0207711_10017397 Ga0207711_100173974 230
198 3300028577 Ga0265318_10107796 Ga0265318_101077961 230
199 3300028800 Ga0265338_10001151 Ga0265338_1000115146 230
200 3300031240 Ga0265320_10079449 Ga0265320_100794492 230
201 3300031247 Ga0265340_10003394 Ga0265340_100033944 230
202 3300031616 Ga0307508_10196223 Ga0307508_101962232 230
203 3300038443 Ga0395901_0205365 Ga0395901_0205365_910_1653 230
204 3300046522 Ga0495643_0080866 Ga0495643_0080866_560_1303 230
205 3300046557 Ga0495622_0002426 Ga0495622_0002426_2139_2882 230
206 3300046684 Ga0495669_0030631 Ga0495669_0030631_538_1281 230
207 3300047320 Ga0495672_0071022 Ga0495672_0071022_273_1016 230
208 3300047673 Ga0495593_0041920 Ga0495593_0041920_728_1471 230
209 3300048905 Ga0496102_0131609 Ga0496102_0131609_900_1643 230
210 3300048906 Ga0496103_0027204 Ga0496103_0027204_1153_1896 230
211 3300048907 Ga0496104_0010951 Ga0496104_0010951_1415_2191 230
212 3300048908 Ga0496105_0044390 Ga0496105_0044390_799_1575 230
213 3300048912 Ga0496109_0533397 Ga0496109_0533397_13_762 230
214 3300048921 Ga0496118_0084428 Ga0496118_0084428_609_1352 230
215 3300048922 Ga0496119_0020238 Ga0496119_0020238_990_1733 230
216 3300048924 Ga0496121_0000009 Ga0496121_0000009_27601_28344 230
217 3300049571 Ga0501034_0610149 Ga0501034_0610149_41_787 230
218 3300049579 Ga0501043_0054965 Ga0501043_0054965_1748_2494 230
219 3300049581 Ga0501047_0252256 Ga0501047_0252256_846_1589 230
220 3300049584 Ga0501068_0294420 Ga0501068_0294420_261_1007 230
221 3300049586 Ga0501070_0318144 Ga0501070_0318144_415_1161 230
222 3300049589 Ga0501073_0020495 Ga0501073_0020495_2547_3293 230
223 3300049742 Ga0501080_0009451 Ga0501080_0009451_1855_2601 230
224 3300049744 Ga0501083_0243283 Ga0501083_0243283_151_897 230
225 3300049823 Ga0501044_0235427 Ga0501044_0235427_142_888 230
226 3300053080 Ga0500635_0000302 Ga0500635_0000302_2185_2928 230
227 3300053080 Ga0500635_0001280 Ga0500635_0001280_4744_5493 230
228 3300053086 Ga0500578_0140706 Ga0500578_0140706_39_785 230
229 3300053091 Ga0500647_0026024 Ga0500647_0026024_1772_2515 230
230 3300053093 Ga0500651_0016713 Ga0500651_0016713_1271_2014 230
231 3300053094 Ga0500566_0041234 Ga0500566_0041234_850_1593 230
232 3300053119 Ga0500595_006840 Ga0500595_006840_3725_4468 230
233 3300053122 Ga0500608_000573 Ga0500608_000573_12174_12917 230
234 3300053123 Ga0500614_001562 Ga0500614_001562_3709_4452 230
235 3300053136 Ga0500559_0084876 Ga0500559_0084876_310_1053 230
236 3300053136 Ga0500559_0182351 Ga0500559_0182351_188_937 230
237 3300053138 Ga0500564_158915 Ga0500564_158915_175_918 230
238 3300053140 Ga0500573_0077380 Ga0500573_0077380_606_1361 230
239 3300053142 Ga0500577_0025434 Ga0500577_0025434_886_1635 230
240 3300053162 Ga0500638_166041 Ga0500638_166041_130_873 230
241 3300053177 Ga0500636_0010526 Ga0500636_0010526_2749_3492 230
242 3300053178 Ga0500637_0010845 Ga0500637_0010845_3179_3922 230
243 3300053178 Ga0500637_0187572 Ga0500637_0187572_393_1136 230
244 3300053729 Ga0500625_088391 Ga0500625_088391_98_841 230
245 3300053735 Ga0500596_003174 Ga0500596_003174_2390_3133 230
246 iso_pu_bacteria 2558860983 2561468298 230
247 iso_pu_bacteria 2791355253 2793281495 230
248 iso_pu_bacteria 2841859092 2841859422 230
249 iso_pu_bacteria 2842515876 2842516206 230
250 iso_pu_bacteria 2869169390 2869170140 230
251 iso_pu_bacteria 2924710171 2924713233 230
252 3300003320 rootH2_10077725 rootH2_100777252 231
253 3300003320 rootH2_10078133 rootH2_100781331 231
254 3300003320 rootH2_10198277 rootH2_101982773 231
255 3300003323 rootH1_10005877 rootH1_100058775 231
256 3300003323 rootH1_10012091 rootH1_100120911 231
257 3300005354 Ga0070675_100469098 Ga0070675_1004690981 231
258 3300005468 Ga0070707_100012513 Ga0070707_1000125133 231
259 3300005614 Ga0068856_100216883 Ga0068856_1002168833 231
260 3300009093 Ga0105240_10478093 Ga0105240_104780932 231
261 3300009093 Ga0105240_10769101 Ga0105240_107691011 231
262 3300009174 Ga0105241_10585830 Ga0105241_105858302 231
263 3300009177 Ga0105248_10250961 Ga0105248_102509612 231
264 3300009545 Ga0105237_10246404 Ga0105237_102464042 231
265 3300009551 Ga0105238_10141237 Ga0105238_101412372 231
266 3300010375 Ga0105239_10049011 Ga0105239_100490116 231
267 3300013104 Ga0157370_10066474 Ga0157370_100664742 231
268 3300014326 Ga0157380_10284365 Ga0157380_102843652 231
269 3300014968 Ga0157379_10162021 Ga0157379_101620212 231
270 3300024225 Ga0224572_1007204 Ga0224572_10072042 231
271 3300025913 Ga0207695_10328574 Ga0207695_103285742 231
272 3300025914 Ga0207671_10216238 Ga0207671_102162382 231
273 3300025922 Ga0207646_10251620 Ga0207646_102516202 231
274 3300025924 Ga0207694_10071691 Ga0207694_100716912 231
275 3300026078 Ga0207702_10167061 Ga0207702_101670613 231
276 3300026121 Ga0207683_10680892 Ga0207683_106808921 231
277 3300037471 Ga0395905_0008081 Ga0395905_0008081_7882_8634 231
278 3300037471 Ga0395905_0316347 Ga0395905_0316347_14_730 231
279 3300038443 Ga0395901_0109329 Ga0395901_0109329_1174_1923 231
280 3300044656 Ga0466969_0006535 Ga0466969_0006535_2766_3518 231
281 3300044684 Ga0466966_0007455 Ga0466966_0007455_3259_4011 231
282 3300044694 Ga0466963_0075224 Ga0466963_0075224_665_1417 231
283 3300044719 Ga0466971_0010408 Ga0466971_0010408_2530_3282 231
284 3300044842 Ga0466957_0001594 Ga0466957_0001594_2558_3304 231
285 3300045049 Ga0466959_0007114 Ga0466959_0007114_4682_5434 231
286 3300045049 Ga0466959_0015161 Ga0466959_0015161_2107_2853 231
287 3300045836 Ga0466958_0004041 Ga0466958_0004041_2599_3351 231
288 3300045836 Ga0466958_0010957 Ga0466958_0010957_2062_2808 231
289 3300049568 Ga0501031_0262297 Ga0501031_0262297_226_969 231
290 3300049571 Ga0501034_0254534 Ga0501034_0254534_164_907 231
291 3300049580 Ga0501046_0401988 Ga0501046_0401988_150_902 231
292 3300049581 Ga0501047_0054470 Ga0501047_0054470_587_1369 231
293 3300050515 nmdc:mga0a205_347774_c1 nmdc:mga0a205_347774_c1_554_1300 231
294 3300053730 Ga0500645_022384 Ga0500645_022384_397_1176 231
295 3300061719 Ga0466962_0005568 Ga0466962_0005568_2508_3260 231
296 3300061719 Ga0466962_0005965 Ga0466962_0005965_2522_3268 231
297 iso_pu_bacteria 2894817345 2894818949 231
298 iso_pu_bacteria 2919679072 2919680938 231
299 iso_pu_bacteria 8054563764 8054565037 231
300 3300001979 JGI24740J21852_10006921 JGI24740J21852_100069212 232
301 3300002067 JGI24735J21928_10015514 JGI24735J21928_100155142 232
302 3300002067 JGI24735J21928_10021675 JGI24735J21928_100216752 232
303 3300005329 Ga0070683_100073796 Ga0070683_1000737963 232
304 3300005330 Ga0070690_100236242 Ga0070690_1002362422 232
305 3300005331 Ga0070670_100133728 Ga0070670_1001337282 232
306 3300005331 Ga0070670_100604021 Ga0070670_1006040211 232
307 3300005334 Ga0068869_100250304 Ga0068869_1002503042 232
308 3300005335 Ga0070666_10018053 Ga0070666_100180534 232
309 3300005336 Ga0070680_100012770 Ga0070680_1000127707 232
310 3300005337 Ga0070682_100034027 Ga0070682_1000340272 232
311 3300005339 Ga0070660_100042990 Ga0070660_1000429904 232
312 3300005339 Ga0070660_100111006 Ga0070660_1001110063 232
313 3300005340 Ga0070689_100440593 Ga0070689_1004405931 232
314 3300005341 Ga0070691_10020783 Ga0070691_100207832 232
315 3300005344 Ga0070661_100011435 Ga0070661_1000114355 232
316 3300005344 Ga0070661_100020420 Ga0070661_1000204205 232
317 3300005344 Ga0070661_100113963 Ga0070661_1001139632 232
318 3300005354 Ga0070675_100116649 Ga0070675_1001166493 232
319 3300005356 Ga0070674_100356481 Ga0070674_1003564811 232
320 3300005366 Ga0070659_100013504 Ga0070659_1000135044 232
321 3300005366 Ga0070659_100081787 Ga0070659_1000817873 232
322 3300005366 Ga0070659_100608543 Ga0070659_1006085431 232
323 3300005455 Ga0070663_100011762 Ga0070663_1000117624 232
324 3300005458 Ga0070681_10348936 Ga0070681_103489361 232
325 3300005459 Ga0068867_100013233 Ga0068867_1000132334 232
326 3300005466 Ga0070685_10082845 Ga0070685_100828452 232
327 3300005535 Ga0070684_100043562 Ga0070684_1000435622 232
328 3300005539 Ga0068853_100051948 Ga0068853_1000519484 232
329 3300005543 Ga0070672_100042656 Ga0070672_1000426563 232
330 3300005548 Ga0070665_100018974 Ga0070665_1000189744 232
331 3300005548 Ga0070665_100023145 Ga0070665_1000231455 232
332 3300005564 Ga0070664_100017132 Ga0070664_1000171322 232
333 3300005577 Ga0068857_100061463 Ga0068857_1000614632 232
334 3300005578 Ga0068854_100010067 Ga0068854_1000100673 232
335 3300005578 Ga0068854_100103155 Ga0068854_1001031552 232
336 3300005614 Ga0068856_100021359 Ga0068856_1000213595 232
337 3300005615 Ga0070702_100060385 Ga0070702_1000603852 232
338 3300005616 Ga0068852_100006048 Ga0068852_1000060484 232
339 3300005616 Ga0068852_100065307 Ga0068852_1000653073 232
340 3300005617 Ga0068859_100027560 Ga0068859_1000275606 232
341 3300005844 Ga0068862_100860223 Ga0068862_1008602231 232
342 3300005937 Ga0081455_10017929 Ga0081455_100179292 232
343 3300005983 Ga0081540_1003393 Ga0081540_10033935 232
344 3300005983 Ga0081540_1017951 Ga0081540_10179512 232
345 3300006177 Ga0075362_10018996 Ga0075362_100189962 232
346 3300006237 Ga0097621_100273719 Ga0097621_1002737192 232
347 3300006358 Ga0068871_100376467 Ga0068871_1003764672 232
348 3300006871 Ga0075434_100217845 Ga0075434_1002178454 232
349 3300006931 Ga0097620_100027559 Ga0097620_1000275591 232
350 3300009093 Ga0105240_10142856 Ga0105240_101428562 232
351 3300009093 Ga0105240_10189757 Ga0105240_101897572 232
352 3300009101 Ga0105247_10103760 Ga0105247_101037602 232
353 3300009174 Ga0105241_10072947 Ga0105241_100729472 232
354 3300009545 Ga0105237_10047386 Ga0105237_100473862 232
355 3300009551 Ga0105238_10058950 Ga0105238_100589504 232
356 3300009551 Ga0105238_10240618 Ga0105238_102406182 232
357 3300010375 Ga0105239_10000857 Ga0105239_100008579 232
358 3300013104 Ga0157370_10084349 Ga0157370_100843494 232
359 3300013105 Ga0157369_10070649 Ga0157369_100706495 232
360 3300013306 Ga0163162_10148629 Ga0163162_101486293 232
361 3300013307 Ga0157372_10068693 Ga0157372_100686932 232
362 3300014325 Ga0163163_10776315 Ga0163163_107763151 232
363 3300014969 Ga0157376_10147821 Ga0157376_101478214 232
364 3300014969 Ga0157376_10159828 Ga0157376_101598282 232
365 3300021388 Ga0213875_10005719 Ga0213875_100057194 232
366 3300021441 Ga0213871_10002403 Ga0213871_100024032 232
367 3300025291 Ga0209675_1001307 Ga0209675_10013072 232
368 3300025315 Ga0207697_10029948 Ga0207697_100299482 232
369 3300025321 Ga0207656_10032171 Ga0207656_100321712 232
370 3300025900 Ga0207710_10050509 Ga0207710_100505092 232
371 3300025901 Ga0207688_10074619 Ga0207688_100746191 232
372 3300025904 Ga0207647_10004899 Ga0207647_100048993 232
373 3300025909 Ga0207705_10029984 Ga0207705_100299843 232
374 3300025909 Ga0207705_10139696 Ga0207705_101396962 232
375 3300025911 Ga0207654_10115339 Ga0207654_101153393 232
376 3300025913 Ga0207695_10051889 Ga0207695_100518893 232
377 3300025914 Ga0207671_10030414 Ga0207671_100304144 232
378 3300025917 Ga0207660_10037192 Ga0207660_100371923 232
379 3300025917 Ga0207660_10416795 Ga0207660_104167951 232
380 3300025919 Ga0207657_10022630 Ga0207657_100226302 232
381 3300025919 Ga0207657_10273208 Ga0207657_102732082 232
382 3300025920 Ga0207649_10003509 Ga0207649_100035098 232
383 3300025920 Ga0207649_10053105 Ga0207649_100531054 232
384 3300025924 Ga0207694_10028283 Ga0207694_100282832 232
385 3300025925 Ga0207650_10603065 Ga0207650_106030651 232
386 3300025932 Ga0207690_10036252 Ga0207690_100362522 232
387 3300025933 Ga0207706_10032261 Ga0207706_100322614 232
388 3300025942 Ga0207689_10149553 Ga0207689_101495533 232
389 3300025945 Ga0207679_10026299 Ga0207679_100262994 232
390 3300025949 Ga0207667_10006351 Ga0207667_100063514 232
391 3300025960 Ga0207651_10001385 Ga0207651_100013856 232
392 3300025981 Ga0207640_10007397 Ga0207640_100073976 232
393 3300025981 Ga0207640_10126128 Ga0207640_101261282 232
394 3300025986 Ga0207658_10577090 Ga0207658_105770902 232
395 3300026041 Ga0207639_10012411 Ga0207639_100124114 232
396 3300026041 Ga0207639_10014309 Ga0207639_100143093 232
397 3300026067 Ga0207678_10040568 Ga0207678_100405682 232
398 3300026067 Ga0207678_10047821 Ga0207678_100478212 232
399 3300026078 Ga0207702_10181949 Ga0207702_101819491 232
400 3300026089 Ga0207648_10008878 Ga0207648_100088786 232
401 3300026116 Ga0207674_10029109 Ga0207674_100291092 232
402 3300026121 Ga0207683_10087003 Ga0207683_100870032 232
403 3300026142 Ga0207698_10008764 Ga0207698_100087644 232
404 3300026142 Ga0207698_10021968 Ga0207698_100219684 232
405 3300028380 Ga0268265_10837196 Ga0268265_108371961 232
406 3300028556 Ga0265337_1011859 Ga0265337_10118593 232
407 3300030760 Ga0265762_1008314 Ga0265762_10083142 232
408 3300031247 Ga0265340_10144329 Ga0265340_101443291 232
409 3300032005 Ga0307411_10423843 Ga0307411_104238432 232
410 3300035691 Ga0373931_0040463 Ga0373931_0040463_421_1173 232
411 3300037312 Ga0395899_0012908 Ga0395899_0012908_1772_2524 232
412 3300037466 Ga0395898_0080689 Ga0395898_0080689_2028_2792 232
413 3300037466 Ga0395898_0125664 Ga0395898_0125664_1558_2310 232
414 3300037471 Ga0395905_0171218 Ga0395905_0171218_401_1156 232
415 3300037853 Ga0436364_0310410 Ga0436364_0310410_2987_3736 232
416 3300039438 Ga0436360_0295164 Ga0436360_0295164_9968_10702 232
417 3300039450 Ga0436363_0849922 Ga0436363_0849922_102_869 232
418 3300046491 Ga0495584_0011661 Ga0495584_0011661_18_773 232
419 3300046519 Ga0495632_0015594 Ga0495632_0015594_693_1451 232
420 3300046537 Ga0495598_0007838 Ga0495598_0007838_71_826 232
421 3300046539 Ga0495621_0005527 Ga0495621_0005527_673_1428 232
422 3300046558 Ga0495633_0152475 Ga0495633_0152475_154_909 232
423 3300046684 Ga0495669_0158264 Ga0495669_0158264_222_977 232
424 3300046691 Ga0495670_0000265 Ga0495670_0000265_21176_21931 232
425 3300048903 Ga0496100_0064222 Ga0496100_0064222_966_1739 232
426 3300048905 Ga0496102_0002747 Ga0496102_0002747_232_1005 232
427 3300048907 Ga0496104_0017799 Ga0496104_0017799_3453_4226 232
428 3300048907 Ga0496104_0149079 Ga0496104_0149079_297_1052 232
429 3300048908 Ga0496105_0008864 Ga0496105_0008864_3625_4398 232
430 3300048909 Ga0496106_0004676 Ga0496106_0004676_703_1476 232
431 3300048910 Ga0496107_0006946 Ga0496107_0006946_4007_4780 232
432 3300048911 Ga0496108_0013562 Ga0496108_0013562_4344_5117 232
433 3300048911 Ga0496108_0299570 Ga0496108_0299570_50_823 232
434 3300048912 Ga0496109_0020848 Ga0496109_0020848_3460_4233 232
435 3300048912 Ga0496109_0027322 Ga0496109_0027322_1520_2293 232
436 3300048913 Ga0496110_0042694 Ga0496110_0042694_1616_2389 232
437 3300048913 Ga0496110_0087569 Ga0496110_0087569_439_1212 232
438 3300048914 Ga0496111_0028631 Ga0496111_0028631_1617_2390 232
439 3300048915 Ga0496112_0025166 Ga0496112_0025166_1069_1842 232
440 3300048915 Ga0496112_0031888 Ga0496112_0031888_1504_2277 232
441 3300048916 Ga0496113_0287318 Ga0496113_0287318_432_1205 232
442 3300048917 Ga0496114_0205853 Ga0496114_0205853_967_1701 232
443 3300048924 Ga0496121_0269258 Ga0496121_0269258_349_1101 232
444 3300049570 Ga0501033_0002532 Ga0501033_0002532_10273_11022 232
445 3300049570 Ga0501033_0192474 Ga0501033_0192474_267_1016 232
446 3300049571 Ga0501034_0002380 Ga0501034_0002380_7786_8535 232
447 3300049583 Ga0501067_0242958 Ga0501067_0242958_17_859 232
448 3300049585 Ga0501069_0248398 Ga0501069_0248398_196_945 232
449 3300049742 Ga0501080_0156121 Ga0501080_0156121_806_1555 232
450 3300049822 Ga0501035_0030120 Ga0501035_0030120_3068_3823 232
451 3300049823 Ga0501044_0000504 Ga0501044_0000504_23257_24006 232
452 3300049823 Ga0501044_0079183 Ga0501044_0079183_2515_3294 232
453 3300049823 Ga0501044_0213873 Ga0501044_0213873_395_1144 232
454 3300049823 Ga0501044_0265553 Ga0501044_0265553_276_1025 232
455 3300053085 Ga0495619_0035488 Ga0495619_0035488_15_764 232
456 3300053096 Ga0500641_0005166 Ga0500641_0005166_1622_2374 232
457 3300053108 Ga0500562_003232 Ga0500562_003232_3062_3793 232
458 3300053140 Ga0500573_0000008 Ga0500573_0000008_85155_85895 232
459 3300053156 Ga0500622_0037248 Ga0500622_0037248_1296_2027 232
460 3300061719 Ga0466962_0063868 Ga0466962_0063868_212_976 232
461 iso_pu_bacteria 2522572158 2523107326 232
462 iso_pu_bacteria 2524023228 2524536916 232
463 iso_pu_bacteria 2884960567 2884965065 232
464 iso_pu_bacteria 2908739725 2908743378 232
465 iso_pu_bacteria 2935630451 2935633614 232
466 iso_pu_bacteria 8006933436 8006941435 232
467 iso_pu_bacteria 8006973647 8006981148 232
468 3300005439 Ga0070711_100078337 Ga0070711_1000783372 233
469 3300005440 Ga0070705_100105070 Ga0070705_1001050702 233
470 3300005445 Ga0070708_100677381 Ga0070708_1006773811 233
471 3300005456 Ga0070678_100531052 Ga0070678_1005310521 233
472 3300005563 Ga0068855_100802958 Ga0068855_1008029582 233
473 3300005614 Ga0068856_100005597 Ga0068856_1000055977 233
474 3300006038 Ga0075365_10005800 Ga0075365_100058005 233
475 3300006048 Ga0075363_100040656 Ga0075363_1000406562 233
476 3300006051 Ga0075364_10027328 Ga0075364_100273283 233
477 3300006178 Ga0075367_10017171 Ga0075367_100171711 233
478 3300006186 Ga0075369_10003352 Ga0075369_100033525 233
479 3300006847 Ga0075431_100001188 Ga0075431_10000118814 233
480 3300009147 Ga0114129_10005694 Ga0114129_1000569414 233
481 3300009147 Ga0114129_10281624 Ga0114129_102816242 233
482 3300025904 Ga0207647_10081547 Ga0207647_100815472 233
483 3300026075 Ga0207708_10102988 Ga0207708_101029881 233
484 3300027907 Ga0207428_10425070 Ga0207428_104250701 233
485 3300031249 Ga0265339_10223758 Ga0265339_102237581 233
486 3300031711 Ga0265314_10060363 Ga0265314_100603632 233
487 3300031712 Ga0265342_10035673 Ga0265342_100356732 233
488 3300031852 Ga0307410_10181137 Ga0307410_101811372 233
489 3300031995 Ga0307409_100109755 Ga0307409_1001097552 233
490 3300032005 Ga0307411_10120154 Ga0307411_101201542 233
491 3300035115 Ga0373941_0001589 Ga0373941_0001589_356_1111 233
492 3300044735 Ga0466968_0211427 Ga0466968_0211427_63_824 233
493 3300046459 Ga0495629_0235070 Ga0495629_0235070_210_968 233
494 3300046514 Ga0495618_0202566 Ga0495618_0202566_325_1083 233
495 3300047673 Ga0495593_0066861 Ga0495593_0066861_31_789 233
496 3300048904 Ga0496101_0016841 Ga0496101_0016841_1260_2018 233
497 3300048911 Ga0496108_0032831 Ga0496108_0032831_235_993 233
498 3300048923 Ga0496120_0102441 Ga0496120_0102441_532_1311 233
499 3300049568 Ga0501031_0005703 Ga0501031_0005703_611_1372 233
500 3300049568 Ga0501031_0049069 Ga0501031_0049069_1525_2280 233
501 3300049568 Ga0501031_0103948 Ga0501031_0103948_330_1043 233
502 3300049569 Ga0501032_0000064 Ga0501032_0000064_19752_20513 233
503 3300049569 Ga0501032_0025086 Ga0501032_0025086_202_957 233
504 3300049569 Ga0501032_0032937 Ga0501032_0032937_1648_2403 233
505 3300049570 Ga0501033_0000286 Ga0501033_0000286_14914_15675 233
506 3300049570 Ga0501033_0020977 Ga0501033_0020977_1793_2548 233
507 3300049570 Ga0501033_0045254 Ga0501033_0045254_496_1251 233
508 3300049570 Ga0501033_0088657 Ga0501033_0088657_642_1355 233
509 3300049570 Ga0501033_0143786 Ga0501033_0143786_20_772 233
510 3300049571 Ga0501034_0000097 Ga0501034_0000097_148048_148803 233
511 3300049571 Ga0501034_0000174 Ga0501034_0000174_24346_25107 233
512 3300049571 Ga0501034_0024404 Ga0501034_0024404_1560_2312 233
513 3300049571 Ga0501034_0668045 Ga0501034_0668045_33_788 233
514 3300049572 Ga0501036_0004998 Ga0501036_0004998_6889_7644 233
515 3300049572 Ga0501036_0182860 Ga0501036_0182860_357_1112 233
516 3300049572 Ga0501036_0298455 Ga0501036_0298455_151_903 233
517 3300049572 Ga0501036_0820233 Ga0501036_0820233_14_730 233
518 3300049573 Ga0501037_0000118 Ga0501037_0000118_7635_8396 233
519 3300049573 Ga0501037_0053085 Ga0501037_0053085_1177_1932 233
520 3300049573 Ga0501037_0136640 Ga0501037_0136640_107_859 233
521 3300049574 Ga0501038_0000031 Ga0501038_0000031_131407_132168 233
522 3300049574 Ga0501038_0041630 Ga0501038_0041630_474_1226 233
523 3300049574 Ga0501038_0157169 Ga0501038_0157169_33_788 233
524 3300049574 Ga0501038_0165500 Ga0501038_0165500_840_1553 233
525 3300049574 Ga0501038_0498346 Ga0501038_0498346_144_899 233
526 3300049575 Ga0501039_0000057 Ga0501039_0000057_17537_18298 233
527 3300049575 Ga0501039_0041392 Ga0501039_0041392_2466_3218 233
528 3300049575 Ga0501039_0047324 Ga0501039_0047324_1085_1840 233
529 3300049575 Ga0501039_0216886 Ga0501039_0216886_126_881 233
530 3300049576 Ga0501040_0001144 Ga0501040_0001144_6054_6767 233
531 3300049577 Ga0501041_0042622 Ga0501041_0042622_1923_2636 233
532 3300049579 Ga0501043_0000048 Ga0501043_0000048_24346_25107 233
533 3300049579 Ga0501043_0133472 Ga0501043_0133472_773_1486 233
534 3300049579 Ga0501043_0569552 Ga0501043_0569552_33_788 233
535 3300049580 Ga0501046_0010968 Ga0501046_0010968_5904_6617 233
536 3300049580 Ga0501046_0026372 Ga0501046_0026372_3571_4326 233
537 3300049580 Ga0501046_0204766 Ga0501046_0204766_318_1079 233
538 3300049581 Ga0501047_0003748 Ga0501047_0003748_2289_3041 233
539 3300049581 Ga0501047_0062229 Ga0501047_0062229_2655_3410 233
540 3300049581 Ga0501047_0069524 Ga0501047_0069524_1149_1904 233
541 3300049581 Ga0501047_0514213 Ga0501047_0514213_144_899 233
542 3300049581 Ga0501047_0591718 Ga0501047_0591718_33_788 233
543 3300049582 Ga0501048_0186831 Ga0501048_0186831_190_942 233
544 3300049583 Ga0501067_0027568 Ga0501067_0027568_578_1333 233
545 3300049583 Ga0501067_0097648 Ga0501067_0097648_794_1549 233
546 3300049583 Ga0501067_0189576 Ga0501067_0189576_147_899 233
547 3300049584 Ga0501068_0065095 Ga0501068_0065095_969_1724 233
548 3300049584 Ga0501068_0085297 Ga0501068_0085297_254_1009 233
549 3300049584 Ga0501068_0095279 Ga0501068_0095279_40_792 233
550 3300049585 Ga0501069_0020534 Ga0501069_0020534_1186_1941 233
551 3300049586 Ga0501070_0029009 Ga0501070_0029009_520_1275 233
552 3300049586 Ga0501070_0029317 Ga0501070_0029317_3121_3876 233
553 3300049587 Ga0501071_0032763 Ga0501071_0032763_958_1713 233
554 3300049588 Ga0501072_0109972 Ga0501072_0109972_1316_2071 233
555 3300049588 Ga0501072_0496817 Ga0501072_0496817_169_921 233
556 3300049588 Ga0501072_0582490 Ga0501072_0582490_80_832 233
557 3300049589 Ga0501073_0090002 Ga0501073_0090002_1084_1836 233
558 3300049590 Ga0501074_0013095 Ga0501074_0013095_1371_2126 233
559 3300049590 Ga0501074_0023939 Ga0501074_0023939_2703_3458 233
560 3300049591 Ga0501075_0028092 Ga0501075_0028092_2656_3369 233
561 3300049741 Ga0501079_0035953 Ga0501079_0035953_2270_3025 233
562 3300049741 Ga0501079_0201938 Ga0501079_0201938_239_994 233
563 3300049742 Ga0501080_0009091 Ga0501080_0009091_7737_8489 233
564 3300049742 Ga0501080_0051261 Ga0501080_0051261_117_830 233
565 3300049742 Ga0501080_0284471 Ga0501080_0284471_604_1359 233
566 3300049743 Ga0501081_0001736 Ga0501081_0001736_5954_6667 233
567 3300049744 Ga0501083_0288918 Ga0501083_0288918_156_908 233
568 3300049822 Ga0501035_0000118 Ga0501035_0000118_82068_82829 233
569 3300049822 Ga0501035_0096309 Ga0501035_0096309_470_1225 233
570 3300049822 Ga0501035_0344252 Ga0501035_0344252_202_957 233
571 3300049823 Ga0501044_0021869 Ga0501044_0021869_5799_6560 233
572 3300049823 Ga0501044_0056387 Ga0501044_0056387_1000_1752 233
573 3300049823 Ga0501044_0165513 Ga0501044_0165513_1344_2099 233
574 3300049823 Ga0501044_0299120 Ga0501044_0299120_131_886 233
575 3300049824 Ga0501045_0004800 Ga0501045_0004800_2326_3039 233
576 3300049824 Ga0501045_0473744 Ga0501045_0473744_29_817 233
577 3300050490 nmdc:mga03n38_226150_c1 nmdc:mga03n38_226150_c1_116_871 233
578 3300050491 nmdc:mga00v17_276191_c1 nmdc:mga00v17_276191_c1_193_948 233
579 3300050492 nmdc:mga0yw44_21084_c1 nmdc:mga0yw44_21084_c1_2732_3487 233
580 3300050494 nmdc:mga06z11_27303_c1 nmdc:mga06z11_27303_c1_1135_1890 233
581 3300050507 nmdc:mga05p37_1172521_c1 nmdc:mga05p37_1172521_c1_34_747 233
582 3300050507 nmdc:mga05p37_31141_c1 nmdc:mga05p37_31141_c1_5569_6324 233
583 3300050510 nmdc:mga06r32_12560_c1 nmdc:mga06r32_12560_c1_3705_4418 233
584 3300050511 nmdc:mga08y16_1009107_c1 nmdc:mga08y16_1009107_c1_11_724 233
585 3300053085 Ga0495619_0351034 Ga0495619_0351034_297_1010 233
586 3300053153 Ga0500616_0032743 Ga0500616_0032743_343_1098 233
587 3300053730 Ga0500645_069379 Ga0500645_069379_214_969 233
588 3300054114 Ga0501084_0001317 Ga0501084_0001317_14806_15519 233
589 3300054114 Ga0501084_0036990 Ga0501084_0036990_1126_1881 233
590 3300054114 Ga0501084_0240168 Ga0501084_0240168_471_1226 233
591 3300060353 Ga0501082_0004024 Ga0501082_0004024_5330_6043 233
592 3300060353 Ga0501082_0100996 Ga0501082_0100996_1185_1937 233
593 3300061734 Ga0530510_0003542 Ga0530510_0003542_5789_6502 233
594 iso_pu_bacteria 2828305725 2828309680 233
595 3300001989 JGI24739J22299_10049812 JGI24739J22299_100498122 234
596 3300002741 JGI25157J39369_1000694 JGI25157J39369_10006943 234
597 3300003214 JGI25165J46597_1000033 JGI25165J46597_1000033184 234
598 3300003763 Ga0055529_1001715 Ga0055529_10017151 234
599 3300005262 Ga0065165_1004344 Ga0065165_10043447 234
600 3300005289 Ga0065704_10128089 Ga0065704_101280892 234
601 3300005336 Ga0070680_100010302 Ga0070680_1000103027 234
602 3300005337 Ga0070682_100023706 Ga0070682_1000237062 234
603 3300005339 Ga0070660_100005970 Ga0070660_1000059708 234
604 3300005339 Ga0070660_100018548 Ga0070660_1000185483 234
605 3300005339 Ga0070660_100071913 Ga0070660_1000719133 234
606 3300005341 Ga0070691_10041162 Ga0070691_100411623 234
607 3300005341 Ga0070691_10157322 Ga0070691_101573222 234
608 3300005366 Ga0070659_100352857 Ga0070659_1003528571 234
609 3300005444 Ga0070694_100044502 Ga0070694_1000445021 234
610 3300005455 Ga0070663_100005687 Ga0070663_1000056876 234
611 3300005455 Ga0070663_100283642 Ga0070663_1002836422 234
612 3300005456 Ga0070678_100032969 Ga0070678_1000329694 234
613 3300005458 Ga0070681_10010655 Ga0070681_100106556 234
614 3300005458 Ga0070681_10015116 Ga0070681_100151165 234
615 3300005539 Ga0068853_100003665 Ga0068853_1000036656 234
616 3300005539 Ga0068853_100027252 Ga0068853_1000272521 234
617 3300005545 Ga0070695_100053158 Ga0070695_1000531583 234
618 3300005547 Ga0070693_100052530 Ga0070693_1000525302 234
619 3300005548 Ga0070665_100010998 Ga0070665_1000109982 234
620 3300005548 Ga0070665_100024444 Ga0070665_1000244444 234
621 3300005548 Ga0070665_100263305 Ga0070665_1002633053 234
622 3300005548 Ga0070665_100350250 Ga0070665_1003502501 234
623 3300005548 Ga0070665_100553282 Ga0070665_1005532821 234
624 3300005563 Ga0068855_100108358 Ga0068855_1001083582 234
625 3300005563 Ga0068855_100240449 Ga0068855_1002404491 234
626 3300005614 Ga0068856_100312957 Ga0068856_1003129571 234
627 3300005614 Ga0068856_100526334 Ga0068856_1005263342 234
628 3300005616 Ga0068852_100232089 Ga0068852_1002320891 234
629 3300005616 Ga0068852_100241597 Ga0068852_1002415971 234
630 3300005842 Ga0068858_100018581 Ga0068858_1000185812 234
631 3300005983 Ga0081540_1093371 Ga0081540_10933711 234
632 3300006038 Ga0075365_10003274 Ga0075365_100032741 234
633 3300006178 Ga0075367_10070535 Ga0075367_100705351 234
634 3300006178 Ga0075367_10090436 Ga0075367_100904362 234
635 3300006186 Ga0075369_10105201 Ga0075369_101052011 234
636 3300006353 Ga0075370_10023704 Ga0075370_100237043 234
637 3300006844 Ga0075428_100065603 Ga0075428_1000656033 234
638 3300006871 Ga0075434_100004782 Ga0075434_10000478210 234
639 3300006871 Ga0075434_100120201 Ga0075434_1001202012 234
640 3300006946 Ga0079104_1000209 Ga0079104_100020938 234
641 3300009093 Ga0105240_10122464 Ga0105240_101224642 234
642 3300009093 Ga0105240_10162374 Ga0105240_101623742 234
643 3300009174 Ga0105241_10050218 Ga0105241_100502181 234
644 3300009174 Ga0105241_10102582 Ga0105241_101025823 234
645 3300009545 Ga0105237_10033099 Ga0105237_100330991 234
646 3300009545 Ga0105237_10045544 Ga0105237_100455442 234
647 3300009545 Ga0105237_10059203 Ga0105237_100592033 234
648 3300009545 Ga0105237_10099103 Ga0105237_100991031 234
649 3300009551 Ga0105238_10021004 Ga0105238_100210043 234
650 3300009551 Ga0105238_10027120 Ga0105238_100271203 234
651 3300009551 Ga0105238_10625288 Ga0105238_106252881 234
652 3300009551 Ga0105238_10770149 Ga0105238_107701491 234
653 3300010375 Ga0105239_10076176 Ga0105239_100761764 234
654 3300010375 Ga0105239_10165419 Ga0105239_101654192 234
655 3300010375 Ga0105239_10887796 Ga0105239_108877961 234
656 3300013100 Ga0157373_10186683 Ga0157373_101866832 234
657 3300013104 Ga0157370_10104065 Ga0157370_101040652 234
658 3300013105 Ga0157369_10065636 Ga0157369_100656363 234
659 3300013105 Ga0157369_10125796 Ga0157369_101257962 234
660 3300014325 Ga0163163_10304950 Ga0163163_103049502 234
661 3300014968 Ga0157379_10056062 Ga0157379_100560625 234
662 3300014969 Ga0157376_10054345 Ga0157376_100543455 234
663 3300015261 Ga0182006_1023433 Ga0182006_10234332 234
664 3300015262 Ga0182007_10030676 Ga0182007_100306762 234
665 3300017792 Ga0163161_10159882 Ga0163161_101598822 234
666 3300017792 Ga0163161_10355781 Ga0163161_103557812 234
667 3300021384 Ga0213876_10059369 Ga0213876_100593692 234
668 3300025246 Ga0209646_1019801 Ga0209646_10198011 234
669 3300025250 Ga0209026_1000002 Ga0209026_1000002710 234
670 3300025253 Ga0209677_100440 Ga0209677_1004407 234
671 3300025254 Ga0209148_1000072 Ga0209148_1000072142 234
672 3300025256 Ga0209759_1000146 Ga0209759_100014640 234
673 3300025261 Ga0209233_1000027 Ga0209233_1000027480 234
674 3300025261 Ga0209233_1000297 Ga0209233_100029755 234
675 3300025272 Ga0209455_1000133 Ga0209455_1000133143 234
676 3300025297 Ga0209758_1012195 Ga0209758_10121953 234
677 3300025297 Ga0209758_1024001 Ga0209758_10240013 234
678 3300025904 Ga0207647_10009697 Ga0207647_100096972 234
679 3300025909 Ga0207705_10135850 Ga0207705_101358502 234
680 3300025911 Ga0207654_10017455 Ga0207654_100174554 234
681 3300025911 Ga0207654_10020733 Ga0207654_100207333 234
682 3300025912 Ga0207707_10027146 Ga0207707_100271465 234
683 3300025912 Ga0207707_10135112 Ga0207707_101351122 234
684 3300025913 Ga0207695_10000011 Ga0207695_10000011461 234
685 3300025913 Ga0207695_10076795 Ga0207695_100767952 234
686 3300025913 Ga0207695_10128836 Ga0207695_101288361 234
687 3300025913 Ga0207695_10316714 Ga0207695_103167142 234
688 3300025913 Ga0207695_10411011 Ga0207695_104110112 234
689 3300025913 Ga0207695_10666506 Ga0207695_106665061 234
690 3300025914 Ga0207671_10012933 Ga0207671_100129336 234
691 3300025914 Ga0207671_10363776 Ga0207671_103637762 234
692 3300025919 Ga0207657_10022391 Ga0207657_100223912 234
693 3300025919 Ga0207657_10173175 Ga0207657_101731752 234
694 3300025924 Ga0207694_10002336 Ga0207694_1000233612 234
695 3300025924 Ga0207694_10022362 Ga0207694_100223623 234
696 3300025924 Ga0207694_10405997 Ga0207694_104059971 234
697 3300025932 Ga0207690_10011176 Ga0207690_100111766 234
698 3300025949 Ga0207667_10195728 Ga0207667_101957283 234
699 3300025949 Ga0207667_10272149 Ga0207667_102721491 234
700 3300026041 Ga0207639_10003324 Ga0207639_100033249 234
701 3300026041 Ga0207639_10750963 Ga0207639_107509631 234
702 3300026067 Ga0207678_10000100 Ga0207678_1000010032 234
703 3300026078 Ga0207702_10243222 Ga0207702_102432222 234
704 3300026078 Ga0207702_10705024 Ga0207702_107050241 234
705 3300026116 Ga0207674_10088526 Ga0207674_100885262 234
706 3300026116 Ga0207674_10153778 Ga0207674_101537781 234
707 3300026116 Ga0207674_10174661 Ga0207674_101746611 234
708 3300026121 Ga0207683_10021422 Ga0207683_100214224 234
709 3300026142 Ga0207698_10142014 Ga0207698_101420142 234
710 3300026142 Ga0207698_10599607 Ga0207698_105996071 234
711 3300027111 Ga0209281_1000580 Ga0209281_100058045 234
712 3300028379 Ga0268266_10176790 Ga0268266_101767902 234
713 3300028379 Ga0268266_10705925 Ga0268266_107059251 234
714 3300031239 Ga0265328_10079421 Ga0265328_100794212 234
715 3300031241 Ga0265325_10089163 Ga0265325_100891631 234
716 3300031241 Ga0265325_10098895 Ga0265325_100988951 234
717 3300031249 Ga0265339_10032527 Ga0265339_100325272 234
718 3300031344 Ga0265316_10143833 Ga0265316_101438332 234
719 3300031711 Ga0265314_10310288 Ga0265314_103102881 234
720 3300036712 Ga0316584_0195144 Ga0316584_0195144_325_1095 234
721 3300037312 Ga0395899_0486162 Ga0395899_0486162_61_786 234
722 3300037418 Ga0395900_0181520 Ga0395900_0181520_1093_1818 234
723 3300037418 Ga0395900_0733914 Ga0395900_0733914_64_831 234
724 3300037466 Ga0395898_0162225 Ga0395898_0162225_1227_1994 234
725 3300037471 Ga0395905_0052360 Ga0395905_0052360_2353_3078 234
726 3300037471 Ga0395905_0227978 Ga0395905_0227978_538_1305 234
727 3300037471 Ga0395905_0299862 Ga0395905_0299862_13_738 234
728 3300037471 Ga0395905_0860694 Ga0395905_0860694_17_742 234
729 3300037853 Ga0436364_0374781 Ga0436364_0374781_1709_2473 234
730 3300038443 Ga0395901_0006071 Ga0395901_0006071_4961_5686 234
731 3300038443 Ga0395901_0094751 Ga0395901_0094751_2233_3000 234
732 3300038443 Ga0395901_0695327 Ga0395901_0695327_90_857 234
733 3300039437 Ga0436365_0227260 Ga0436365_0227260_3824_4561 234
734 3300039437 Ga0436365_0426125 Ga0436365_0426125_1043_1801 234
735 3300039438 Ga0436360_0355578 Ga0436360_0355578_151_909 234
736 3300044658 Ga0466972_0086629 Ga0466972_0086629_36_803 234
737 3300044765 Ga0466970_0237370 Ga0466970_0237370_36_803 234
738 3300044842 Ga0466957_0178423 Ga0466957_0178423_634_1362 234
739 3300045976 Ga0466967_0061444 Ga0466967_0061444_1540_2340 234
740 3300046507 Ga0495606_0037111 Ga0495606_0037111_979_1749 234
741 3300046616 Ga0495668_0209532 Ga0495668_0209532_152_919 234
742 3300047318 Ga0495636_0111664 Ga0495636_0111664_455_1183 234
743 3300047472 Ga0495686_0170494 Ga0495686_0170494_409_1200 234
744 3300048903 Ga0496100_0039379 Ga0496100_0039379_2051_2809 234
745 3300048903 Ga0496100_0136829 Ga0496100_0136829_296_1066 234
746 3300048903 Ga0496100_0142886 Ga0496100_0142886_814_1584 234
747 3300048904 Ga0496101_0005585 Ga0496101_0005585_3911_4636 234
748 3300048904 Ga0496101_0113614 Ga0496101_0113614_314_1084 234
749 3300048904 Ga0496101_0138124 Ga0496101_0138124_717_1487 234
750 3300048905 Ga0496102_0033196 Ga0496102_0033196_2260_2985 234
751 3300048905 Ga0496102_0331589 Ga0496102_0331589_548_1318 234
752 3300048906 Ga0496103_0002057 Ga0496103_0002057_3507_4232 234
753 3300048906 Ga0496103_0020842 Ga0496103_0020842_2391_3161 234
754 3300048907 Ga0496104_0094192 Ga0496104_0094192_1358_2083 234
755 3300048907 Ga0496104_0306260 Ga0496104_0306260_562_1329 234
756 3300048907 Ga0496104_0351283 Ga0496104_0351283_608_1366 234
757 3300048908 Ga0496105_0268040 Ga0496105_0268040_193_951 234
758 3300048909 Ga0496106_0020957 Ga0496106_0020957_153_878 234
759 3300048909 Ga0496106_0177142 Ga0496106_0177142_585_1343 234
760 3300048910 Ga0496107_0001506 Ga0496107_0001506_10577_11302 234
761 3300048910 Ga0496107_0055141 Ga0496107_0055141_1783_2541 234
762 3300048912 Ga0496109_0116835 Ga0496109_0116835_755_1513 234
763 3300048912 Ga0496109_0151170 Ga0496109_0151170_702_1457 234
764 3300048913 Ga0496110_0116341 Ga0496110_0116341_1308_2066 234
765 3300048913 Ga0496110_0168117 Ga0496110_0168117_545_1384 234
766 3300048914 Ga0496111_0000242 Ga0496111_0000242_10939_11778 234
767 3300048915 Ga0496112_0031568 Ga0496112_0031568_2511_3281 234
768 3300048917 Ga0496114_0036337 Ga0496114_0036337_2879_3604 234
769 3300048917 Ga0496114_0303375 Ga0496114_0303375_311_1069 234
770 3300048918 Ga0496115_0052518 Ga0496115_0052518_2372_3097 234
771 3300048918 Ga0496115_0087400 Ga0496115_0087400_1619_2389 234
772 3300048920 Ga0496117_0003941 Ga0496117_0003941_2721_3491 234
773 3300048921 Ga0496118_0002145 Ga0496118_0002145_24701_25471 234
774 3300048922 Ga0496119_0080829 Ga0496119_0080829_319_1044 234
775 3300048922 Ga0496119_0103005 Ga0496119_0103005_303_1073 234
776 3300048922 Ga0496119_0105036 Ga0496119_0105036_788_1558 234
777 3300048923 Ga0496120_0008156 Ga0496120_0008156_2802_3527 234
778 3300048924 Ga0496121_0000751 Ga0496121_0000751_17822_18601 234
779 3300048924 Ga0496121_0065751 Ga0496121_0065751_659_1438 234
780 3300048925 Ga0496122_0000025 Ga0496122_0000025_57675_58484 234
781 3300048925 Ga0496122_0034633 Ga0496122_0034633_2503_3273 234
782 3300048925 Ga0496122_0098694 Ga0496122_0098694_570_1409 234
783 3300048926 Ga0496123_0000054 Ga0496123_0000054_212664_213473 234
784 3300048926 Ga0496123_0030694 Ga0496123_0030694_1872_2711 234
785 3300048927 Ga0496124_0036426 Ga0496124_0036426_2251_3090 234
786 3300048927 Ga0496124_0048353 Ga0496124_0048353_2142_2921 234
787 3300048927 Ga0496124_0080967 Ga0496124_0080967_1779_2588 234
788 3300048928 Ga0496125_0043147 Ga0496125_0043147_1163_1930 234
789 3300048928 Ga0496125_0047369 Ga0496125_0047369_1931_2701 234
790 3300048928 Ga0496125_0188098 Ga0496125_0188098_17_745 234
791 3300048929 Ga0496126_0073247 Ga0496126_0073247_1040_1810 234
792 3300048929 Ga0496126_0201568 Ga0496126_0201568_806_1576 234
793 3300049570 Ga0501033_0116907 Ga0501033_0116907_231_995 234
794 3300049572 Ga0501036_0488418 Ga0501036_0488418_208_972 234
795 3300049573 Ga0501037_0204238 Ga0501037_0204238_506_1270 234
796 3300049579 Ga0501043_0103181 Ga0501043_0103181_29_751 234
797 3300049579 Ga0501043_0156188 Ga0501043_0156188_207_971 234
798 3300049579 Ga0501043_0238183 Ga0501043_0238183_64_828 234
799 3300049581 Ga0501047_0186826 Ga0501047_0186826_254_1018 234
800 3300049583 Ga0501067_0351840 Ga0501067_0351840_36_800 234
801 3300049585 Ga0501069_0047390 Ga0501069_0047390_401_1165 234
802 3300049586 Ga0501070_0039424 Ga0501070_0039424_2072_2836 234
803 3300049586 Ga0501070_0051500 Ga0501070_0051500_2383_3147 234
804 3300049586 Ga0501070_0087469 Ga0501070_0087469_1558_2322 234
805 3300049587 Ga0501071_0181489 Ga0501071_0181489_563_1327 234
806 3300049590 Ga0501074_0057774 Ga0501074_0057774_1841_2605 234
807 3300049742 Ga0501080_0069725 Ga0501080_0069725_2474_3238 234
808 3300049822 Ga0501035_0003976 Ga0501035_0003976_6410_7174 234
809 3300049823 Ga0501044_0076395 Ga0501044_0076395_188_952 234
810 3300049823 Ga0501044_0172041 Ga0501044_0172041_818_1558 234
811 3300050492 nmdc:mga0yw44_18283_c1 nmdc:mga0yw44_18283_c1_2375_3145 234
812 3300050496 nmdc:mga07m45_12880_c1 nmdc:mga07m45_12880_c1_1070_1840 234
813 3300050512 nmdc:mga0n895_2522_c1 nmdc:mga0n895_2522_c1_6613_7335 234
814 3300053083 Ga0495655_0011188 Ga0495655_0011188_988_1767 234
815 3300053125 Ga0500618_002996 Ga0500618_002996_3353_4144 234
816 3300053125 Ga0500618_003083 Ga0500618_003083_2755_3525 234
817 3300053153 Ga0500616_0004513 Ga0500616_0004513_794_1564 234
818 3300054114 Ga0501084_0226380 Ga0501084_0226380_188_952 234
819 3300060353 Ga0501082_0721415 Ga0501082_0721415_55_819 234
820 iso_pu_bacteria 2503198000 2503202330 234
821 iso_pu_bacteria 2509276018 2509370432 234
822 iso_pu_bacteria 2510065059 2510317396 234
823 iso_pu_bacteria 2512875016 2512930770 234
824 iso_pu_bacteria 2512875024 2512958499 234
825 iso_pu_bacteria 2513237090 2513609818 234
826 iso_pu_bacteria 2513237164 2514035088 234
827 iso_pu_bacteria 2588253730 2588516432 234
828 iso_pu_bacteria 2599185236 2599720883 234
829 iso_pu_bacteria 2599185301 2599940040 234
830 iso_pu_bacteria 2643221595 2643988106 234
831 iso_pu_bacteria 2643221627 2644155281 234
832 iso_pu_bacteria 2687453392 2688599312 234
833 iso_pu_bacteria 2690316117 2692316460 234
834 iso_pu_bacteria 2693429783 2694632106 234
835 iso_pu_bacteria 2693429784 2694634487 234
836 iso_pu_bacteria 2756170246 2756675784 234
837 iso_pu_bacteria 2791355082 2792581223 234
838 iso_pu_bacteria 2791355091 2792623229 234
839 iso_pu_bacteria 2791355092 2792626993 234
840 iso_pu_bacteria 2791355123 2792745993 234
841 iso_pu_bacteria 2821123053 2821127798 234
842 iso_pu_bacteria 2838736955 2838738222 234
843 iso_pu_bacteria 2841840854 2841841408 234
844 iso_pu_bacteria 2842140634 2842141186 234
845 iso_pu_bacteria 2844002411 2844006554 234
846 iso_pu_bacteria 2844009547 2844014595 234
847 iso_pu_bacteria 2847417321 2847418474 234
848 iso_pu_bacteria 2847670302 2847670720 234
849 iso_pu_bacteria 2847686936 2847693055 234
850 iso_pu_bacteria 2848992105 2848993452 234
851 iso_pu_bacteria 2855872281 2855873363 234
852 iso_pu_bacteria 2856314179 2856316176 234
853 iso_pu_bacteria 2856320880 2856325988 234
854 iso_pu_bacteria 2856328259 2856330435 234
855 iso_pu_bacteria 2856334872 2856340521 234
856 iso_pu_bacteria 2856364286 2856368938 234
857 iso_pu_bacteria 2857349434 2857349514 234
858 iso_pu_bacteria 2857367948 2857370737 234
859 iso_pu_bacteria 2857531043 2857534461 234
860 iso_pu_bacteria 2869234852 2869239750 234
861 iso_pu_bacteria 2869242130 2869248441 234
862 iso_pu_bacteria 2869249662 2869250070 234
863 iso_pu_bacteria 2869256925 2869258256 234
864 iso_pu_bacteria 2869264136 2869270969 234
865 iso_pu_bacteria 2869271264 2869272585 234
866 iso_pu_bacteria 2869278585 2869278745 234
867 iso_pu_bacteria 2869285874 2869291457 234
868 iso_pu_bacteria 2871429161 2871433737 234
869 iso_pu_bacteria 2871435913 2871442259 234
870 iso_pu_bacteria 2871451962 2871455440 234
871 iso_pu_bacteria 2871459585 2871461625 234
872 iso_pu_bacteria 2871481445 2871484452 234
873 iso_pu_bacteria 2871495908 2871500638 234
874 iso_pu_bacteria 2874102143 2874103493 234
875 iso_pu_bacteria 2874109183 2874116192 234
876 iso_pu_bacteria 2874116593 2874117189 234
877 iso_pu_bacteria 2874131515 2874133731 234
878 iso_pu_bacteria 2874139085 2874145330 234
879 iso_pu_bacteria 2874146452 2874153314 234
880 iso_pu_bacteria 2874155637 2874160579 234
881 iso_pu_bacteria 2874162495 2874165777 234
882 iso_pu_bacteria 2874168670 2874176346 234
883 iso_pu_bacteria 2876363079 2876365559 234
884 iso_pu_bacteria 2876377896 2876384962 234
885 iso_pu_bacteria 2876386047 2876391333 234
886 iso_pu_bacteria 2876392853 2876395080 234
887 iso_pu_bacteria 2876399893 2876403161 234
888 iso_pu_bacteria 2876406927 2876412434 234
889 iso_pu_bacteria 2876413966 2876419605 234
890 iso_pu_bacteria 2876420981 2876425387 234
891 iso_pu_bacteria 2878035449 2878041500 234
892 iso_pu_bacteria 2878730984 2878737053 234
893 iso_pu_bacteria 2878738818 2878743578 234
894 iso_pu_bacteria 2878745973 2878751348 234
895 iso_pu_bacteria 2878760144 2878764727 234
896 iso_pu_bacteria 2878767105 2878771828 234
897 iso_pu_bacteria 2878781027 2878787922 234
898 iso_pu_bacteria 2881147464 2881152749 234
899 iso_pu_bacteria 2881161766 2881168447 234
900 iso_pu_bacteria 2885305155 2885310422 234
901 iso_pu_bacteria 2885326080 2885331659 234
902 iso_pu_bacteria 2885334103 2885338486 234
903 iso_pu_bacteria 2888337043 2888340263 234
904 iso_pu_bacteria 2888350351 2888356690 234
905 iso_pu_bacteria 2889010040 2889011566 234
906 iso_pu_bacteria 2889016732 2889023328 234
907 iso_pu_bacteria 2903448605 2903455725 234
908 iso_pu_bacteria 2903492973 2903501864 234
909 iso_pu_bacteria 2903513507 2903517899 234
910 iso_pu_bacteria 2903521522 2903522915 234
911 iso_pu_bacteria 2903528002 2903533105 234
912 iso_pu_bacteria 2903540706 2903545451 234
913 iso_pu_bacteria 2904659560 2904661711 234
914 iso_pu_bacteria 2906308376 2906313265 234
915 iso_pu_bacteria 2906321335 2906325976 234
916 iso_pu_bacteria 2906328253 2906335164 234
917 iso_pu_bacteria 2906363423 2906368027 234
918 iso_pu_bacteria 2906370794 2906375860 234
919 iso_pu_bacteria 2906378014 2906379095 234
920 iso_pu_bacteria 2906386501 2906389644 234
921 iso_pu_bacteria 2906393657 2906397538 234
922 iso_pu_bacteria 2906401398 2906405968 234
923 iso_pu_bacteria 2906408224 2906412756 234
924 iso_pu_bacteria 2906414383 2906416313 234
925 iso_pu_bacteria 2922151315 2922153453 234
926 iso_pu_bacteria 2922158528 2922164208 234
927 iso_pu_bacteria 2922172374 2922174153 234
928 iso_pu_bacteria 2922178524 2922182209 234
929 iso_pu_bacteria 2924718760 2924726342 234
930 iso_pu_bacteria 2924726620 2924728209 234
931 iso_pu_bacteria 2924733363 2924735925 234
932 iso_pu_bacteria 2924741084 2924746576 234
933 iso_pu_bacteria 2924776078 2924781390 234
934 iso_pu_bacteria 2937813078 2937820585 234
935 iso_pu_bacteria 2937848649 2937853856 234
936 iso_pu_bacteria 2937861824 2937864342 234
937 iso_pu_bacteria 2937877337 2937879101 234
938 iso_pu_bacteria 2937891427 2937898304 234
939 iso_pu_bacteria 2937972304 2937975153 234
940 iso_pu_bacteria 2937980651 2937985267 234
941 iso_pu_bacteria 2937994558 2937999301 234
942 iso_pu_bacteria 2958034702 2958034861 234
943 iso_pu_bacteria 2958041894 2958043010 234
944 iso_pu_bacteria 2958064165 2958067105 234
945 iso_pu_bacteria 2958084443 2958086275 234
946 iso_pu_bacteria 2958100919 2958104572 234
947 iso_pu_bacteria 2958108152 2958109233 234
948 iso_pu_bacteria 2958115193 2958122358 234
949 iso_pu_bacteria 2958122699 2958129193 234
950 iso_pu_bacteria 2958130278 2958135856 234
951 iso_pu_bacteria 2958144490 2958151130 234
952 iso_pu_bacteria 2958158011 2958161519 234
953 iso_pu_bacteria 2958165035 2958169775 234
954 iso_pu_bacteria 2958172287 2958177564 234
955 iso_pu_bacteria 2958179912 2958185323 234
956 iso_pu_bacteria 2961077736 2961083590 234
957 iso_pu_bacteria 2961114664 2961116864 234
958 iso_pu_bacteria 2961136820 2961143907 234
959 iso_pu_bacteria 2961163497 2961168235 234
960 iso_pu_bacteria 2961183825 2961187387 234
961 iso_pu_bacteria 2963644680 2963648456 234
962 iso_pu_bacteria 2965018300 2965023054 234
963 iso_pu_bacteria 2965025482 2965029412 234
964 iso_pu_bacteria 2965032056 2965036658 234
965 iso_pu_bacteria 2965040258 2965045426 234
966 iso_pu_bacteria 2965047637 2965051761 234
967 iso_pu_bacteria 2965062239 2965068400 234
968 iso_pu_bacteria 2965119406 2965122262 234
969 iso_pu_bacteria 2968016561 2968017730 234
970 iso_pu_bacteria 2968083720 2968084970 234
971 iso_pu_bacteria 2968091066 2968091901 234
972 iso_pu_bacteria 2968097103 2968099405 234
973 iso_pu_bacteria 2968110612 2968112771 234
974 iso_pu_bacteria 2968117919 2968122993 234
975 iso_pu_bacteria 2968128360 2968129962 234
976 iso_pu_bacteria 2968138860 2968140158 234
977 iso_pu_bacteria 2968171901 2968176635 234
978 iso_pu_bacteria 2970469710 2970472095 234
979 iso_pu_bacteria 2970489779 2970495933 234
980 iso_pu_bacteria 2970510686 2970516441 234
981 iso_pu_bacteria 2970532167 2970535548 234
982 iso_pu_bacteria 2970547951 2970548212 234
983 iso_pu_bacteria 2970554993 2970559574 234
984 iso_pu_bacteria 2970593180 2970593341 234
985 iso_pu_bacteria 2970619444 2970624037 234
986 iso_pu_bacteria 2970627176 2970633962 234
987 iso_pu_bacteria 2977843712 2977848883 234
988 iso_pu_bacteria 2977851361 2977851986 234
989 iso_pu_bacteria 2977858184 2977861855 234
990 iso_pu_bacteria 2977864932 2977867554 234
991 iso_pu_bacteria 2977872689 2977877940 234
992 iso_pu_bacteria 2977898635 2977906076 234
993 iso_pu_bacteria 2977915119 2977917864 234
994 iso_pu_bacteria 2977922695 2977928986 234
995 iso_pu_bacteria 2977935797 2977941519 234
996 iso_pu_bacteria 2977942078 2977947047 234
997 iso_pu_bacteria 2977950692 2977957422 234
998 iso_pu_bacteria 2977957713 2977958780 234
999 iso_pu_bacteria 2977971508 2977978591 234
1000 iso_pu_bacteria 2979710463 2979711814 234
1001 iso_pu_bacteria 2979742915 2979752058 234
1002 iso_pu_bacteria 2979764755 2979769689 234
1003 iso_pu_bacteria 2979772303 2979777917 234
1004 iso_pu_bacteria 2979779861 2979786103 234
1005 iso_pu_bacteria 2987636660 2987645421 234
1006 iso_pu_bacteria 2987645492 2987649830 234
1007 iso_pu_bacteria 2987652177 2987658290 234
1008 iso_pu_bacteria 2987659509 2987664249 234
1009 iso_pu_bacteria 2996341866 2996348394 234
1010 iso_pu_bacteria 2996348954 2996351027 234
1011 iso_pu_bacteria 2996386984 2996392675 234
1012 iso_pu_bacteria 3003930520 3003933368 234
1013 iso_pu_bacteria 3004167301 3004169703 234
1014 iso_pu_bacteria 3004188549 3004193304 234
1015 iso_pu_bacteria 3004203850 3004206328 234
1016 iso_pu_bacteria 3004239961 3004241853 234
1017 iso_pu_bacteria 3004248173 3004254174 234
1018 iso_pu_bacteria 3004268573 3004275307 234
1019 iso_pu_bacteria 3004275668 3004277725 234
1020 iso_pu_bacteria 3004289098 3004296135 234
1021 iso_pu_bacteria 3004334049 3004340875 234
1022 iso_pu_bacteria 637000159 637073816 234
1023 iso_pu_bacteria 649633066 649873817 234
1024 iso_pu_bacteria 8004300914 8004304783 234
1025 iso_pu_bacteria 8004361976 8004366751 234
1026 iso_pu_bacteria 8004387939 8004393988 234
1027 iso_pu_bacteria 8004445564 8004447230 234
1028 iso_pu_bacteria 8004640170 8004646830 234
1029 iso_pu_bacteria 8004703790 8004713792 234
1030 iso_pu_bacteria 8004714634 8004719521 234
1031 iso_pu_bacteria 8004727605 8004730442 234
1032 iso_pu_bacteria 8049293176 8049294366 234
1033 3300005364 Ga0070673_100272870 Ga0070673_1002728702 235
1034 3300005367 Ga0070667_100134011 Ga0070667_1001340112 235
1035 3300006038 Ga0075365_10009956 Ga0075365_100099562 235
1036 3300006042 Ga0075368_10010236 Ga0075368_100102362 235
1037 3300006177 Ga0075362_10008752 Ga0075362_100087524 235
1038 3300006178 Ga0075367_10026146 Ga0075367_100261462 235
1039 3300009148 Ga0105243_10046747 Ga0105243_100467473 235
1040 3300021358 Ga0213873_10062851 Ga0213873_100628511 235
1041 3300021377 Ga0213874_10021966 Ga0213874_100219662 235
1042 3300021384 Ga0213876_10000580 Ga0213876_1000058020 235
1043 3300026067 Ga0207678_10446371 Ga0207678_104463712 235
1044 3300027866 Ga0209813_10039879 Ga0209813_100398792 235
1045 3300039437 Ga0436365_0994234 Ga0436365_0994234_19290_20060 235
1046 3300039450 Ga0436363_0162148 Ga0436363_0162148_248_1018 235
1047 3300039450 Ga0436363_0516425 Ga0436363_0516425_4698_5468 235
1048 3300039453 Ga0436362_0605469 Ga0436362_0605469_993_1763 235
1049 3300039453 Ga0436362_0764253 Ga0436362_0764253_67_837 235
1050 3300046524 Ga0495648_0101400 Ga0495648_0101400_675_1466 235
1051 3300046542 Ga0495597_0048524 Ga0495597_0048524_801_1571 235
1052 3300046660 Ga0495625_0026301 Ga0495625_0026301_3439_4209 235
1053 3300046660 Ga0495625_0403083 Ga0495625_0403083_35_805 235
1054 3300050490 nmdc:mga03n38_35806_c1 nmdc:mga03n38_35806_c1_710_1480 235
1055 3300050495 nmdc:mga04h51_19968_c1 nmdc:mga04h51_19968_c1_725_1495 235
1056 3300050496 nmdc:mga07m45_20065_c1 nmdc:mga07m45_20065_c1_2742_3512 235
1057 3300050515 nmdc:mga0a205_323773_c1 nmdc:mga0a205_323773_c1_528_1286 235
1058 3300053079 Ga0500610_0168365 Ga0500610_0168365_201_971 235
1059 3300053125 Ga0500618_036011 Ga0500618_036011_132_923 235
1060 3300053155 Ga0500620_000225 Ga0500620_000225_2832_3602 235
1061 3300053155 Ga0500620_107336 Ga0500620_107336_48_818 235
1062 3300053158 Ga0500627_0095586 Ga0500627_0095586_470_1240 235
1063 iso_pu_bacteria 2643221551 2643775671 235
1064 iso_pu_bacteria 2643221555 2643794118 235
1065 iso_pu_bacteria 2818991461 2819688596 235
1066 iso_pu_bacteria 2924762789 2924768866 235
1067 iso_pu_bacteria 2937822353 2937827171 235
1068 iso_pu_bacteria 2987666974 2987670544 235
1069 3300005290 Ga0065712_10120433 Ga0065712_101204332 236
1070 3300031995 Ga0307409_100394241 Ga0307409_1003942412 236
1071 3300044712 Ga0453684_0005096 Ga0453684_0005096_12132_12878 236
1072 3300002737 JGI25162J39368_1000075 JGI25162J39368_100007539 237
1073 3300005434 Ga0070709_10005740 Ga0070709_100057402 237
1074 3300005437 Ga0070710_10004618 Ga0070710_100046182 237
1075 3300005530 Ga0070679_100008410 Ga0070679_1000084107 237
1076 3300009036 Ga0105244_10000145 Ga0105244_1000014535 237
1077 3300009092 Ga0105250_10000127 Ga0105250_1000012730 237
1078 3300013104 Ga0157370_10001310 Ga0157370_100013109 237
1079 3300025711 Ga0207696_1000134 Ga0207696_100013432 237
1080 3300025728 Ga0207655_1000298 Ga0207655_100029836 237
1081 3300025898 Ga0207692_10008338 Ga0207692_100083383 237
1082 3300025912 Ga0207707_10013845 Ga0207707_1001384510 237
1083 3300025921 Ga0207652_10104189 Ga0207652_101041892 237
1084 3300025928 Ga0207700_10014164 Ga0207700_100141641 237
1085 3300031344 Ga0265316_10082428 Ga0265316_100824282 237
1086 3300031665 Ga0316575_10001077 Ga0316575_100010771 237
1087 3300031727 Ga0316576_10033327 Ga0316576_100333274 237
1088 3300031727 Ga0316576_10248342 Ga0316576_102483421 237
1089 3300031728 Ga0316578_10054356 Ga0316578_100543563 237
1090 3300036712 Ga0316584_0023348 Ga0316584_0023348_1051_1803 237
1091 3300042876 Ga0451577_0001956 Ga0451577_0001956_14271_15017 237
1092 3300044712 Ga0453684_0028475 Ga0453684_0028475_3043_3789 237
1093 3300044712 Ga0453684_0291175 Ga0453684_0291175_966_1712 237
1094 3300047470 Ga0495681_0011264 Ga0495681_0011264_2116_2886 237
1095 3300049571 Ga0501034_0083319 Ga0501034_0083319_2250_3029 237
1096 iso_pu_bacteria 2537561728 2538427084 237
1097 iso_pu_bacteria 2706794495 2707100829 237
1098 iso_pu_bacteria 2852103415 2852104164 237
1099 iso_pu_bacteria 2854601825 2854604223 237
1100 iso_pu_bacteria 2855195626 2855199189 237
1101 iso_pu_bacteria 2858466076 2858468106 237
1102 iso_pu_bacteria 2871272651 2871276570 237
1103 iso_pu_bacteria 2871282230 2871284836 237
1104 iso_pu_bacteria 2900051742 2900055063 237
1105 iso_pu_bacteria 2904504865 2904509211 237
1106 3300005549 Ga0070704_100096074 Ga0070704_1000960741 238
1107 3300005844 Ga0068862_100095635 Ga0068862_1000956353 238
1108 3300006844 Ga0075428_100287649 Ga0075428_1002876492 238
1109 3300009094 Ga0111539_10059338 Ga0111539_100593383 238
1110 3300009147 Ga0114129_10313848 Ga0114129_103138482 238
1111 3300013105 Ga0157369_10007844 Ga0157369_100078449 238
1112 3300013308 Ga0157375_10124856 Ga0157375_101248563 238
1113 3300014326 Ga0157380_10029038 Ga0157380_100290381 238
1114 3300021388 Ga0213875_10007545 Ga0213875_100075453 238
1115 3300025911 Ga0207654_10284014 Ga0207654_102840141 238
1116 3300025927 Ga0207687_10323474 Ga0207687_103234741 238
1117 3300026089 Ga0207648_10738430 Ga0207648_107384301 238
1118 3300026118 Ga0207675_100143234 Ga0207675_1001432342 238
1119 3300028380 Ga0268265_10087003 Ga0268265_100870033 238
1120 3300028556 Ga0265337_1027974 Ga0265337_10279742 238
1121 3300028558 Ga0265326_10002848 Ga0265326_100028485 238
1122 3300028563 Ga0265319_1002530 Ga0265319_10025307 238
1123 3300028563 Ga0265319_1027664 Ga0265319_10276643 238
1124 3300028573 Ga0265334_10002924 Ga0265334_100029245 238
1125 3300028573 Ga0265334_10064086 Ga0265334_100640862 238
1126 3300028577 Ga0265318_10001067 Ga0265318_100010676 238
1127 3300028654 Ga0265322_10039179 Ga0265322_100391792 238
1128 3300028666 Ga0265336_10096874 Ga0265336_100968741 238
1129 3300028800 Ga0265338_10023976 Ga0265338_100239762 238
1130 3300028800 Ga0265338_10128359 Ga0265338_101283592 238
1131 3300028800 Ga0265338_10133069 Ga0265338_101330692 238
1132 3300031240 Ga0265320_10081828 Ga0265320_100818282 238
1133 3300031240 Ga0265320_10215209 Ga0265320_102152091 238
1134 3300031344 Ga0265316_10022216 Ga0265316_100222166 238
1135 3300031344 Ga0265316_10173427 Ga0265316_101734272 238
1136 3300031711 Ga0265314_10161977 Ga0265314_101619771 238
1137 3300031712 Ga0265342_10007754 Ga0265342_100077546 238
1138 3300031712 Ga0265342_10165782 Ga0265342_101657821 238
1139 3300031728 Ga0316578_10186846 Ga0316578_101868462 238
1140 3300031733 Ga0316577_10020005 Ga0316577_100200055 238
1141 3300032133 Ga0316583_10007407 Ga0316583_100074072 238
1142 3300032168 Ga0316593_10013111 Ga0316593_100131114 238
1143 3300034816 Ga0373930_0011932 Ga0373930_0011932_708_1442 238
1144 3300035170 Ga0373943_0049967 Ga0373943_0049967_745_1506 238
1145 3300035398 Ga0316574_0000439 Ga0316574_0000439_615_1370 238
1146 3300035691 Ga0373931_0068199 Ga0373931_0068199_555_1271 238
1147 3300036647 Ga0316582_0318950 Ga0316582_0318950_220_981 238
1148 3300036712 Ga0316584_0011924 Ga0316584_0011924_3850_4605 238
1149 3300037588 Ga0316581_0004894 Ga0316581_0004894_2387_3142 238
1150 3300038725 Ga0400484_42049 Ga0400484_42049_2160_2912 238
1151 3300038726 Ga0400490_13335 Ga0400490_13335_248_1000 238
1152 3300039062 Ga0400483_278927 Ga0400483_278927_494_1243 238
1153 3300042876 Ga0451577_0710005 Ga0451577_0710005_46_762 238
1154 3300044673 Ga0453683_0000118 Ga0453683_0000118_31689_32405 238
1155 3300044673 Ga0453683_0075393 Ga0453683_0075393_863_1612 238
1156 3300044712 Ga0453684_0000829 Ga0453684_0000829_68686_69435 238
1157 3300044712 Ga0453684_0050873 Ga0453684_0050873_89_838 238
1158 3300044712 Ga0453684_0073587 Ga0453684_0073587_388_1137 238
1159 3300044712 Ga0453684_0080822 Ga0453684_0080822_640_1356 238
1160 3300044712 Ga0453684_0084451 Ga0453684_0084451_698_1468 238
1161 3300044712 Ga0453684_0196101 Ga0453684_0196101_1628_2344 238
1162 3300044712 Ga0453684_0523887 Ga0453684_0523887_151_900 238
1163 3300045051 Ga0451576_0000001 Ga0451576_0000001_31701_32417 238
1164 3300045051 Ga0451576_0000019 Ga0451576_0000019_340128_340877 238
1165 3300045051 Ga0451576_0000213 Ga0451576_0000213_71691_72440 238
1166 3300045051 Ga0451576_0016088 Ga0451576_0016088_4308_5072 238
1167 3300045051 Ga0451576_1066620 Ga0451576_1066620_65_829 238
1168 3300046454 Ga0495592_0044537 Ga0495592_0044537_370_1152 238
1169 3300046476 Ga0495662_0193291 Ga0495662_0193291_23_805 238
1170 3300046516 Ga0495628_0288816 Ga0495628_0288816_130_912 238
1171 3300046517 Ga0495630_0560077 Ga0495630_0560077_55_837 238
1172 3300048911 Ga0496108_0098113 Ga0496108_0098113_540_1334 238
1173 3300048912 Ga0496109_0164906 Ga0496109_0164906_851_1645 238
1174 3300049572 Ga0501036_0054187 Ga0501036_0054187_2184_2939 238
1175 3300049576 Ga0501040_0189556 Ga0501040_0189556_218_973 238
1176 3300049582 Ga0501048_0030793 Ga0501048_0030793_425_1180 238
1177 3300049592 Ga0501076_0191194 Ga0501076_0191194_170_925 238
1178 3300049741 Ga0501079_0410660 Ga0501079_0410660_282_1037 238
1179 3300050507 nmdc:mga05p37_486728_c1 nmdc:mga05p37_486728_c1_308_1063 238
1180 3300050510 nmdc:mga06r32_433336_c1 nmdc:mga06r32_433336_c1_456_1211 238
1181 3300050511 nmdc:mga08y16_72419_c1 nmdc:mga08y16_72419_c1_2408_3163 238
1182 iso_pu_bacteria 2857729791 2857732589 238
1183 iso_pu_bacteria 2928121344 2928122931 238
1184 iso_pu_bacteria 2995726249 2995728088 238
1185 iso_pu_bacteria 8055034563 8055035903 238
1186 iso_pu_bacteria 8055037949 8055038543 238
1187 3300001990 JGI24737J22298_10040690 JGI24737J22298_100406902 239
1188 3300002070 JGI24750J21931_1014682 JGI24750J21931_10146822 239
1189 3300003659 JGI25404J52841_10010830 JGI25404J52841_100108302 239
1190 3300005295 Ga0065707_10199019 Ga0065707_101990192 239
1191 3300005327 Ga0070658_10056805 Ga0070658_100568051 239
1192 3300005329 Ga0070683_100001378 Ga0070683_1000013787 239
1193 3300005330 Ga0070690_100000812 Ga0070690_10000081211 239
1194 3300005333 Ga0070677_10000526 Ga0070677_1000052611 239
1195 3300005335 Ga0070666_10001337 Ga0070666_100013371 239
1196 3300005338 Ga0068868_100001472 Ga0068868_1000014727 239
1197 3300005339 Ga0070660_100001829 Ga0070660_10000182912 239
1198 3300005340 Ga0070689_100003426 Ga0070689_10000342611 239
1199 3300005343 Ga0070687_100000129 Ga0070687_10000012911 239
1200 3300005344 Ga0070661_100001499 Ga0070661_1000014997 239
1201 3300005344 Ga0070661_100004800 Ga0070661_1000048008 239
1202 3300005347 Ga0070668_100001092 Ga0070668_1000010927 239
1203 3300005353 Ga0070669_100001544 Ga0070669_10000154411 239
1204 3300005354 Ga0070675_100011835 Ga0070675_1000118352 239
1205 3300005355 Ga0070671_100001853 Ga0070671_1000018537 239
1206 3300005365 Ga0070688_100000657 Ga0070688_1000006577 239
1207 3300005366 Ga0070659_100002328 Ga0070659_10000232811 239
1208 3300005367 Ga0070667_100003253 Ga0070667_10000325311 239
1209 3300005438 Ga0070701_10011515 Ga0070701_100115151 239
1210 3300005439 Ga0070711_100084992 Ga0070711_1000849923 239
1211 3300005440 Ga0070705_100001751 Ga0070705_10000175110 239
1212 3300005441 Ga0070700_100012018 Ga0070700_1000120182 239
1213 3300005455 Ga0070663_100002023 Ga0070663_1000020236 239
1214 3300005455 Ga0070663_100048511 Ga0070663_1000485113 239
1215 3300005456 Ga0070678_100001372 Ga0070678_1000013726 239
1216 3300005466 Ga0070685_10001416 Ga0070685_100014161 239
1217 3300005535 Ga0070684_100059847 Ga0070684_1000598473 239
1218 3300005535 Ga0070684_100533696 Ga0070684_1005336962 239
1219 3300005539 Ga0068853_100003943 Ga0068853_10000394311 239
1220 3300005543 Ga0070672_100000867 Ga0070672_1000008677 239
1221 3300005544 Ga0070686_100004310 Ga0070686_1000043101 239
1222 3300005545 Ga0070695_100008518 Ga0070695_1000085186 239
1223 3300005546 Ga0070696_100514153 Ga0070696_1005141531 239
1224 3300005547 Ga0070693_100070706 Ga0070693_1000707062 239
1225 3300005563 Ga0068855_100003374 Ga0068855_10000337410 239
1226 3300005564 Ga0070664_100000070 Ga0070664_1000000705 239
1227 3300005564 Ga0070664_100001934 Ga0070664_10000193411 239
1228 3300005577 Ga0068857_100003654 Ga0068857_1000036542 239
1229 3300005577 Ga0068857_100004680 Ga0068857_1000046801 239
1230 3300005578 Ga0068854_100001002 Ga0068854_10000100212 239
1231 3300005616 Ga0068852_100001511 Ga0068852_10000151111 239
1232 3300005618 Ga0068864_100003320 Ga0068864_10000332011 239
1233 3300005718 Ga0068866_10000167 Ga0068866_1000016710 239
1234 3300005719 Ga0068861_100001113 Ga0068861_10000111311 239
1235 3300005834 Ga0068851_10000382 Ga0068851_100003829 239
1236 3300005841 Ga0068863_100002882 Ga0068863_1000028827 239
1237 3300005842 Ga0068858_100005307 Ga0068858_10000530711 239
1238 3300005843 Ga0068860_100011324 Ga0068860_1000113246 239
1239 3300005983 Ga0081540_1000138 Ga0081540_100013858 239
1240 3300005983 Ga0081540_1000640 Ga0081540_10006404 239
1241 3300005983 Ga0081540_1001923 Ga0081540_100192312 239
1242 3300006028 Ga0070717_10038368 Ga0070717_100383686 239
1243 3300006358 Ga0068871_100001759 Ga0068871_1000017596 239
1244 3300006881 Ga0068865_100002359 Ga0068865_10000235911 239
1245 3300009093 Ga0105240_10021381 Ga0105240_100213817 239
1246 3300009094 Ga0111539_10351792 Ga0111539_103517922 239
1247 3300009098 Ga0105245_10003941 Ga0105245_100039416 239
1248 3300009101 Ga0105247_10000680 Ga0105247_1000068012 239
1249 3300009148 Ga0105243_10007357 Ga0105243_100073576 239
1250 3300009174 Ga0105241_10000690 Ga0105241_100006909 239
1251 3300009176 Ga0105242_10001950 Ga0105242_100019509 239
1252 3300009177 Ga0105248_10003364 Ga0105248_1000336411 239
1253 3300009545 Ga0105237_10003821 Ga0105237_1000382112 239
1254 3300009551 Ga0105238_10001511 Ga0105238_1000151112 239
1255 3300009553 Ga0105249_10001767 Ga0105249_100017678 239
1256 3300010375 Ga0105239_10003469 Ga0105239_1000346912 239
1257 3300011119 Ga0105246_10001442 Ga0105246_100014429 239
1258 3300013100 Ga0157373_10003881 Ga0157373_100038812 239
1259 3300013102 Ga0157371_10000858 Ga0157371_1000085813 239
1260 3300013105 Ga0157369_10002570 Ga0157369_100025709 239
1261 3300013105 Ga0157369_10196245 Ga0157369_101962452 239
1262 3300013296 Ga0157374_10002021 Ga0157374_100020217 239
1263 3300013297 Ga0157378_10001435 Ga0157378_1000143511 239
1264 3300013307 Ga0157372_10006136 Ga0157372_100061366 239
1265 3300013308 Ga0157375_10002065 Ga0157375_100020657 239
1266 3300014325 Ga0163163_10073729 Ga0163163_100737293 239
1267 3300014745 Ga0157377_10001610 Ga0157377_100016104 239
1268 3300014969 Ga0157376_10032402 Ga0157376_100324022 239
1269 3300017792 Ga0163161_10017220 Ga0163161_100172203 239
1270 3300021377 Ga0213874_10023511 Ga0213874_100235112 239
1271 3300021384 Ga0213876_10000541 Ga0213876_1000054112 239
1272 3300021384 Ga0213876_10123628 Ga0213876_101236282 239
1273 3300021384 Ga0213876_10297933 Ga0213876_102979331 239
1274 3300021388 Ga0213875_10119755 Ga0213875_101197551 239
1275 3300021388 Ga0213875_10165417 Ga0213875_101654172 239
1276 3300025315 Ga0207697_10001372 Ga0207697_100013726 239
1277 3300025321 Ga0207656_10000298 Ga0207656_100002988 239
1278 3300025893 Ga0207682_10000214 Ga0207682_1000021415 239
1279 3300025899 Ga0207642_10000260 Ga0207642_100002607 239
1280 3300025900 Ga0207710_10002316 Ga0207710_1000231610 239
1281 3300025901 Ga0207688_10000836 Ga0207688_100008366 239
1282 3300025903 Ga0207680_10001615 Ga0207680_100016152 239
1283 3300025904 Ga0207647_10001682 Ga0207647_1000168212 239
1284 3300025907 Ga0207645_10000251 Ga0207645_1000025134 239
1285 3300025908 Ga0207643_10000176 Ga0207643_1000017634 239
1286 3300025909 Ga0207705_10043327 Ga0207705_100433272 239
1287 3300025911 Ga0207654_10001318 Ga0207654_100013189 239
1288 3300025913 Ga0207695_10011746 Ga0207695_1001174610 239
1289 3300025914 Ga0207671_10002285 Ga0207671_100022859 239
1290 3300025916 Ga0207663_10082208 Ga0207663_100822082 239
1291 3300025918 Ga0207662_10000146 Ga0207662_100001461 239
1292 3300025919 Ga0207657_10003084 Ga0207657_1000308410 239
1293 3300025920 Ga0207649_10000907 Ga0207649_100009077 239
1294 3300025920 Ga0207649_10001001 Ga0207649_100010013 239
1295 3300025921 Ga0207652_10075441 Ga0207652_100754413 239
1296 3300025923 Ga0207681_10001125 Ga0207681_1000112510 239
1297 3300025924 Ga0207694_10001152 Ga0207694_1000115210 239
1298 3300025925 Ga0207650_10001243 Ga0207650_1000124311 239
1299 3300025926 Ga0207659_10000831 Ga0207659_1000083111 239
1300 3300025927 Ga0207687_10015252 Ga0207687_100152526 239
1301 3300025931 Ga0207644_10001068 Ga0207644_100010687 239
1302 3300025932 Ga0207690_10002228 Ga0207690_1000222810 239
1303 3300025934 Ga0207686_10009014 Ga0207686_100090144 239
1304 3300025935 Ga0207709_10003815 Ga0207709_100038152 239
1305 3300025936 Ga0207670_10000695 Ga0207670_100006957 239
1306 3300025937 Ga0207669_10000390 Ga0207669_1000039012 239
1307 3300025938 Ga0207704_10000842 Ga0207704_100008426 239
1308 3300025940 Ga0207691_10000371 Ga0207691_100003719 239
1309 3300025941 Ga0207711_10000513 Ga0207711_1000051312 239
1310 3300025942 Ga0207689_10002310 Ga0207689_1000231010 239
1311 3300025944 Ga0207661_10002789 Ga0207661_100027896 239
1312 3300025945 Ga0207679_10000102 Ga0207679_1000010247 239
1313 3300025945 Ga0207679_10000425 Ga0207679_100004259 239
1314 3300025949 Ga0207667_10010676 Ga0207667_1001067611 239
1315 3300025960 Ga0207651_10000093 Ga0207651_1000009311 239
1316 3300025961 Ga0207712_10001464 Ga0207712_100014647 239
1317 3300025972 Ga0207668_10000798 Ga0207668_1000079814 239
1318 3300025981 Ga0207640_10000598 Ga0207640_100005987 239
1319 3300025986 Ga0207658_10001648 Ga0207658_1000164810 239
1320 3300026023 Ga0207677_10000456 Ga0207677_100004569 239
1321 3300026035 Ga0207703_10000384 Ga0207703_1000038411 239
1322 3300026041 Ga0207639_10004761 Ga0207639_100047611 239
1323 3300026067 Ga0207678_10002390 Ga0207678_100023907 239
1324 3300026067 Ga0207678_10010485 Ga0207678_100104853 239
1325 3300026075 Ga0207708_10023885 Ga0207708_100238854 239
1326 3300026078 Ga0207702_10003152 Ga0207702_100031527 239
1327 3300026088 Ga0207641_10001449 Ga0207641_100014497 239
1328 3300026095 Ga0207676_10001221 Ga0207676_100012217 239
1329 3300026116 Ga0207674_10000671 Ga0207674_1000067134 239
1330 3300026116 Ga0207674_10266209 Ga0207674_102662092 239
1331 3300026118 Ga0207675_100002014 Ga0207675_10000201411 239
1332 3300026121 Ga0207683_10000375 Ga0207683_1000037510 239
1333 3300026121 Ga0207683_10341395 Ga0207683_103413952 239
1334 3300026142 Ga0207698_10000755 Ga0207698_1000075511 239
1335 3300028379 Ga0268266_10002601 Ga0268266_100026017 239
1336 3300028380 Ga0268265_10001155 Ga0268265_1000115511 239
1337 3300028381 Ga0268264_10000938 Ga0268264_1000093811 239
1338 3300031240 Ga0265320_10017283 Ga0265320_100172832 239
1339 3300031250 Ga0265331_10033783 Ga0265331_100337833 239
1340 3300031344 Ga0265316_10086431 Ga0265316_100864312 239
1341 3300031665 Ga0316575_10050339 Ga0316575_100503393 239
1342 3300031691 Ga0316579_10038435 Ga0316579_100384352 239
1343 3300031712 Ga0265342_10238253 Ga0265342_102382531 239
1344 3300031727 Ga0316576_10083745 Ga0316576_100837453 239
1345 3300031727 Ga0316576_10143290 Ga0316576_101432903 239
1346 3300031733 Ga0316577_10038969 Ga0316577_100389694 239
1347 3300032168 Ga0316593_10005355 Ga0316593_100053552 239
1348 3300032168 Ga0316593_10020510 Ga0316593_100205102 239
1349 3300032168 Ga0316593_10057683 Ga0316593_100576831 239
1350 3300033541 Ga0316596_1011731 Ga0316596_10117312 239
1351 3300035115 Ga0373941_0037090 Ga0373941_0037090_291_1055 239
1352 3300035171 Ga0373946_0093571 Ga0373946_0093571_575_1294 239
1353 3300036647 Ga0316582_0148054 Ga0316582_0148054_227_979 239
1354 3300036647 Ga0316582_0388358 Ga0316582_0388358_184_936 239
1355 3300036712 Ga0316584_0001402 Ga0316584_0001402_3033_3785 239
1356 3300037068 Ga0373925_0207428 Ga0373925_0207428_377_1141 239
1357 3300037853 Ga0436364_0207864 Ga0436364_0207864_2488_3225 239
1358 3300037853 Ga0436364_0598581 Ga0436364_0598581_194_946 239
1359 3300037853 Ga0436364_0653298 Ga0436364_0653298_70_807 239
1360 3300037853 Ga0436364_0935450 Ga0436364_0935450_1026_1763 239
1361 3300037853 Ga0436364_1113697 Ga0436364_1113697_1537_2274 239
1362 3300037853 Ga0436364_1161322 Ga0436364_1161322_3159_3896 239
1363 3300037853 Ga0436364_1291049 Ga0436364_1291049_157_909 239
1364 3300037853 Ga0436364_1366309 Ga0436364_1366309_437_1174 239
1365 3300039437 Ga0436365_0283204 Ga0436365_0283204_16673_17410 239
1366 3300039437 Ga0436365_1114212 Ga0436365_1114212_653_1405 239
1367 3300039437 Ga0436365_1397674 Ga0436365_1397674_1263_1982 239
1368 3300039437 Ga0436365_1779432 Ga0436365_1779432_1096_1833 239
1369 3300039438 Ga0436360_0587385 Ga0436360_0587385_51_788 239
1370 3300039450 Ga0436363_0222055 Ga0436363_0222055_1072_1836 239
1371 3300039453 Ga0436362_0808991 Ga0436362_0808991_590_1327 239
1372 3300042005 Ga0439448_0015703 Ga0439448_0015703_195_959 239
1373 3300042876 Ga0451577_0121152 Ga0451577_0121152_40_804 239
1374 3300044673 Ga0453683_0005938 Ga0453683_0005938_5644_6396 239
1375 3300044673 Ga0453683_0027559 Ga0453683_0027559_2011_2763 239
1376 3300044712 Ga0453684_0052888 Ga0453684_0052888_4175_4927 239
1377 3300044712 Ga0453684_0178157 Ga0453684_0178157_1512_2264 239
1378 3300044712 Ga0453684_0231434 Ga0453684_0231434_969_1721 239
1379 3300044712 Ga0453684_0360342 Ga0453684_0360342_780_1532 239
1380 3300045051 Ga0451576_0012429 Ga0451576_0012429_4276_5028 239
1381 3300045051 Ga0451576_0024883 Ga0451576_0024883_5560_6321 239
1382 3300045051 Ga0451576_0036606 Ga0451576_0036606_1084_1848 239
1383 3300045051 Ga0451576_0094400 Ga0451576_0094400_1044_1805 239
1384 3300046511 Ga0495608_0027558 Ga0495608_0027558_1894_2646 239
1385 3300048905 Ga0496102_0005255 Ga0496102_0005255_10089_10853 239
1386 3300048909 Ga0496106_0005250 Ga0496106_0005250_6371_7135 239
1387 3300048910 Ga0496107_0062331 Ga0496107_0062331_61_825 239
1388 3300048911 Ga0496108_0076730 Ga0496108_0076730_1935_2687 239
1389 3300048912 Ga0496109_0006013 Ga0496109_0006013_8776_9540 239
1390 3300048915 Ga0496112_0001235 Ga0496112_0001235_10206_10970 239
1391 3300049571 Ga0501034_0120131 Ga0501034_0120131_346_1125 239
1392 3300050511 nmdc:mga08y16_292919_c1 nmdc:mga08y16_292919_c1_443_1207 239
1393 3300053077 Ga0495601_0000235 Ga0495601_0000235_18894_19649 239
1394 3300053084 Ga0495595_0017221 Ga0495595_0017221_104_859 239
1395 3300053085 Ga0495619_0117877 Ga0495619_0117877_989_1741 239
1396 3300061734 Ga0530510_0007842 Ga0530510_0007842_2313_3074 239
1397 3300005290 Ga0065712_10079152 Ga0065712_100791524 240
1398 3300005293 Ga0065715_10022986 Ga0065715_100229862 240
1399 3300005327 Ga0070658_10014417 Ga0070658_100144177 240
1400 3300005330 Ga0070690_100001334 Ga0070690_1000013344 240
1401 3300005335 Ga0070666_10088334 Ga0070666_100883342 240
1402 3300005338 Ga0068868_100035781 Ga0068868_1000357813 240
1403 3300005340 Ga0070689_100040778 Ga0070689_1000407782 240
1404 3300005344 Ga0070661_100340548 Ga0070661_1003405481 240
1405 3300005353 Ga0070669_100321252 Ga0070669_1003212522 240
1406 3300005355 Ga0070671_100073369 Ga0070671_1000733693 240
1407 3300005367 Ga0070667_100018342 Ga0070667_1000183425 240
1408 3300005406 Ga0070703_10058342 Ga0070703_100583421 240
1409 3300005444 Ga0070694_100006547 Ga0070694_1000065472 240
1410 3300005457 Ga0070662_100141147 Ga0070662_1001411472 240
1411 3300005459 Ga0068867_100257362 Ga0068867_1002573623 240
1412 3300005466 Ga0070685_10004344 Ga0070685_100043446 240
1413 3300005468 Ga0070707_100003600 Ga0070707_1000036005 240
1414 3300005468 Ga0070707_100011087 Ga0070707_1000110878 240
1415 3300005468 Ga0070707_100304531 Ga0070707_1003045313 240
1416 3300005518 Ga0070699_100111738 Ga0070699_1001117383 240
1417 3300005539 Ga0068853_100093101 Ga0068853_1000931011 240
1418 3300005544 Ga0070686_100221860 Ga0070686_1002218601 240
1419 3300005549 Ga0070704_100000897 Ga0070704_1000008979 240
1420 3300005549 Ga0070704_100605301 Ga0070704_1006053011 240
1421 3300005563 Ga0068855_100004501 Ga0068855_10000450119 240
1422 3300005564 Ga0070664_100026866 Ga0070664_1000268663 240
1423 3300005615 Ga0070702_100033498 Ga0070702_1000334982 240
1424 3300005616 Ga0068852_100672893 Ga0068852_1006728932 240
1425 3300005617 Ga0068859_100102105 Ga0068859_1001021051 240
1426 3300005618 Ga0068864_100014922 Ga0068864_1000149223 240
1427 3300005618 Ga0068864_100178664 Ga0068864_1001786643 240
1428 3300005834 Ga0068851_10062572 Ga0068851_100625722 240
1429 3300005841 Ga0068863_100208714 Ga0068863_1002087143 240
1430 3300005842 Ga0068858_100059043 Ga0068858_1000590433 240
1431 3300005843 Ga0068860_100061705 Ga0068860_1000617054 240
1432 3300005844 Ga0068862_100080071 Ga0068862_1000800713 240
1433 3300006163 Ga0070715_10000063 Ga0070715_1000006325 240
1434 3300006173 Ga0070716_100078021 Ga0070716_1000780213 240
1435 3300006237 Ga0097621_100259045 Ga0097621_1002590451 240
1436 3300006844 Ga0075428_100047133 Ga0075428_1000471333 240
1437 3300006844 Ga0075428_100049375 Ga0075428_1000493753 240
1438 3300006844 Ga0075428_100185233 Ga0075428_1001852334 240
1439 3300006846 Ga0075430_100518947 Ga0075430_1005189471 240
1440 3300006931 Ga0097620_100102107 Ga0097620_1001021074 240
1441 3300007265 Ga0099794_10003880 Ga0099794_100038802 240
1442 3300009093 Ga0105240_10007255 Ga0105240_100072553 240
1443 3300009093 Ga0105240_10094300 Ga0105240_100943001 240
1444 3300009093 Ga0105240_10134066 Ga0105240_101340662 240
1445 3300009094 Ga0111539_10000358 Ga0111539_1000035811 240
1446 3300009101 Ga0105247_10063001 Ga0105247_100630012 240
1447 3300009148 Ga0105243_10378635 Ga0105243_103786352 240
1448 3300009176 Ga0105242_10028561 Ga0105242_100285615 240
1449 3300009177 Ga0105248_10321545 Ga0105248_103215452 240
1450 3300013102 Ga0157371_10317708 Ga0157371_103177082 240
1451 3300013306 Ga0163162_10053079 Ga0163162_100530795 240
1452 3300013308 Ga0157375_10245995 Ga0157375_102459952 240
1453 3300014325 Ga0163163_10054400 Ga0163163_100544003 240
1454 3300014968 Ga0157379_10123869 Ga0157379_101238692 240
1455 3300014969 Ga0157376_10124275 Ga0157376_101242754 240
1456 3300014969 Ga0157376_11005865 Ga0157376_110058651 240
1457 3300017792 Ga0163161_10337928 Ga0163161_103379281 240
1458 3300021388 Ga0213875_10000276 Ga0213875_1000027631 240
1459 3300021388 Ga0213875_10073977 Ga0213875_100739772 240
1460 3300021388 Ga0213875_10091254 Ga0213875_100912542 240
1461 3300022467 Ga0224712_10012148 Ga0224712_100121482 240
1462 3300025903 Ga0207680_10004606 Ga0207680_100046064 240
1463 3300025905 Ga0207685_10000041 Ga0207685_100000414 240
1464 3300025909 Ga0207705_10015184 Ga0207705_100151842 240
1465 3300025913 Ga0207695_10004415 Ga0207695_100044155 240
1466 3300025913 Ga0207695_10291348 Ga0207695_102913482 240
1467 3300025922 Ga0207646_10004552 Ga0207646_100045528 240
1468 3300025922 Ga0207646_10004920 Ga0207646_100049207 240
1469 3300025923 Ga0207681_10284649 Ga0207681_102846491 240
1470 3300025933 Ga0207706_10166685 Ga0207706_101666852 240
1471 3300025935 Ga0207709_10190844 Ga0207709_101908442 240
1472 3300025936 Ga0207670_10152603 Ga0207670_101526031 240
1473 3300025941 Ga0207711_10006144 Ga0207711_100061446 240
1474 3300025945 Ga0207679_10348756 Ga0207679_103487562 240
1475 3300025945 Ga0207679_10419024 Ga0207679_104190241 240
1476 3300025961 Ga0207712_10196151 Ga0207712_101961512 240
1477 3300025961 Ga0207712_10224990 Ga0207712_102249902 240
1478 3300025981 Ga0207640_10396827 Ga0207640_103968271 240
1479 3300025986 Ga0207658_10025324 Ga0207658_100253243 240
1480 3300026023 Ga0207677_10051529 Ga0207677_100515292 240
1481 3300026035 Ga0207703_10473076 Ga0207703_104730762 240
1482 3300026075 Ga0207708_10153194 Ga0207708_101531942 240
1483 3300026088 Ga0207641_10083361 Ga0207641_100833613 240
1484 3300026095 Ga0207676_10032052 Ga0207676_100320523 240
1485 3300026095 Ga0207676_10725031 Ga0207676_107250311 240
1486 3300026116 Ga0207674_10568106 Ga0207674_105681061 240
1487 3300026118 Ga0207675_100637354 Ga0207675_1006373542 240
1488 3300026142 Ga0207698_10400789 Ga0207698_104007891 240
1489 3300027671 Ga0209588_1109662 Ga0209588_11096621 240
1490 3300027907 Ga0207428_10013505 Ga0207428_100135057 240
1491 3300028381 Ga0268264_10095284 Ga0268264_100952843 240
1492 3300028800 Ga0265338_10020696 Ga0265338_100206963 240
1493 3300030760 Ga0265762_1004498 Ga0265762_10044982 240
1494 3300030879 Ga0265765_1005577 Ga0265765_10055771 240
1495 3300031090 Ga0265760_10034992 Ga0265760_100349922 240
1496 3300031241 Ga0265325_10001084 Ga0265325_1000108415 240
1497 3300031249 Ga0265339_10000685 Ga0265339_100006852 240
1498 3300031250 Ga0265331_10000102 Ga0265331_1000010231 240
1499 3300031344 Ga0265316_10240214 Ga0265316_102402142 240
1500 3300031595 Ga0265313_10000865 Ga0265313_1000086516 240
1501 3300031665 Ga0316575_10165460 Ga0316575_101654601 240
1502 3300031691 Ga0316579_10091232 Ga0316579_100912321 240
1503 3300031711 Ga0265314_10000258 Ga0265314_100002586 240
1504 3300031712 Ga0265342_10001056 Ga0265342_100010567 240
1505 3300031727 Ga0316576_10001112 Ga0316576_1000111210 240
1506 3300031728 Ga0316578_10011768 Ga0316578_100117682 240
1507 3300031728 Ga0316578_10044301 Ga0316578_100443013 240
1508 3300031728 Ga0316578_10129128 Ga0316578_101291282 240
1509 3300031728 Ga0316578_10230492 Ga0316578_102304921 240
1510 3300031733 Ga0316577_10008546 Ga0316577_100085462 240
1511 3300031733 Ga0316577_10014688 Ga0316577_100146882 240
1512 3300031852 Ga0307410_10435769 Ga0307410_104357692 240
1513 3300032137 Ga0316585_10019994 Ga0316585_100199942 240
1514 3300032168 Ga0316593_10010568 Ga0316593_100105683 240
1515 3300032168 Ga0316593_10062211 Ga0316593_100622112 240
1516 3300035398 Ga0316574_0017026 Ga0316574_0017026_922_1689 240
1517 3300035398 Ga0316574_0100775 Ga0316574_0100775_760_1527 240
1518 3300036647 Ga0316582_0020619 Ga0316582_0020619_1515_2291 240
1519 3300036647 Ga0316582_0025596 Ga0316582_0025596_933_1700 240
1520 3300036647 Ga0316582_0053359 Ga0316582_0053359_1570_2337 240
1521 3300036712 Ga0316584_0003289 Ga0316584_0003289_9029_9796 240
1522 3300036712 Ga0316584_0003840 Ga0316584_0003840_4699_5466 240
1523 3300036712 Ga0316584_0003883 Ga0316584_0003883_7196_7954 240
1524 3300036712 Ga0316584_0023535 Ga0316584_0023535_2013_2780 240
1525 3300036712 Ga0316584_0562059 Ga0316584_0562059_18_773 240
1526 3300037588 Ga0316581_0018084 Ga0316581_0018084_79_855 240
1527 3300037853 Ga0436364_0079644 Ga0436364_0079644_137242_138045 240
1528 3300037853 Ga0436364_0545736 Ga0436364_0545736_8318_9115 240
1529 3300037853 Ga0436364_1040205 Ga0436364_1040205_116_889 240
1530 3300038726 Ga0400490_04614 Ga0400490_04614_2924_3685 240
1531 3300038742 Ga0400486_07680 Ga0400486_07680_576_1337 240
1532 3300039062 Ga0400483_195000 Ga0400483_195000_60446_61207 240
1533 3300039437 Ga0436365_0847170 Ga0436365_0847170_213_995 240
1534 3300039437 Ga0436365_1422517 Ga0436365_1422517_77_835 240
1535 3300039438 Ga0436360_0459232 Ga0436360_0459232_1765_2553 240
1536 3300039447 Ga0436361_0073402 Ga0436361_0073402_462_1250 240
1537 3300039450 Ga0436363_0096334 Ga0436363_0096334_47_835 240
1538 3300039453 Ga0436362_0735076 Ga0436362_0735076_72_860 240
1539 3300042876 Ga0451577_0175909 Ga0451577_0175909_703_1461 240
1540 3300042876 Ga0451577_0446006 Ga0451577_0446006_268_1041 240
1541 3300042876 Ga0451577_0737711 Ga0451577_0737711_13_768 240
1542 3300044673 Ga0453683_0000280 Ga0453683_0000280_36167_36922 240
1543 3300044673 Ga0453683_0000891 Ga0453683_0000891_6680_7435 240
1544 3300044673 Ga0453683_0001047 Ga0453683_0001047_5654_6409 240
1545 3300044673 Ga0453683_0256609 Ga0453683_0256609_35_790 240
1546 3300044712 Ga0453684_0022082 Ga0453684_0022082_7905_8660 240
1547 3300044712 Ga0453684_0064823 Ga0453684_0064823_2171_2929 240
1548 3300045051 Ga0451576_0001202 Ga0451576_0001202_25524_26282 240
1549 3300045051 Ga0451576_0170485 Ga0451576_0170485_1497_2258 240
1550 3300046472 Ga0495580_0193675 Ga0495580_0193675_630_1370 240
1551 3300046683 Ga0495658_0429262 Ga0495658_0429262_41_796 240
1552 3300048908 Ga0496105_0172825 Ga0496105_0172825_240_995 240
1553 3300048911 Ga0496108_0037537 Ga0496108_0037537_2974_3729 240
1554 3300048915 Ga0496112_0332913 Ga0496112_0332913_664_1419 240
1555 3300048917 Ga0496114_0173980 Ga0496114_0173980_713_1468 240
1556 3300049569 Ga0501032_0001600 Ga0501032_0001600_14466_15224 240
1557 3300049569 Ga0501032_0068479 Ga0501032_0068479_308_1066 240
1558 3300049569 Ga0501032_0235317 Ga0501032_0235317_257_1021 240
1559 3300049570 Ga0501033_0093339 Ga0501033_0093339_1087_1860 240
1560 3300049571 Ga0501034_0002221 Ga0501034_0002221_6389_7153 240
1561 3300049571 Ga0501034_0022346 Ga0501034_0022346_1668_2426 240
1562 3300049571 Ga0501034_0076402 Ga0501034_0076402_336_1109 240
1563 3300049571 Ga0501034_0134238 Ga0501034_0134238_1509_2291 240
1564 3300049571 Ga0501034_0220435 Ga0501034_0220435_534_1292 240
1565 3300049571 Ga0501034_0243812 Ga0501034_0243812_439_1197 240
1566 3300049571 Ga0501034_0270112 Ga0501034_0270112_616_1395 240
1567 3300049572 Ga0501036_0077234 Ga0501036_0077234_52_810 240
1568 3300049573 Ga0501037_0006091 Ga0501037_0006091_6062_6826 240
1569 3300049573 Ga0501037_0155025 Ga0501037_0155025_439_1197 240
1570 3300049573 Ga0501037_0483499 Ga0501037_0483499_53_811 240
1571 3300049574 Ga0501038_0003995 Ga0501038_0003995_5840_6604 240
1572 3300049574 Ga0501038_0028402 Ga0501038_0028402_2404_3162 240
1573 3300049574 Ga0501038_0316604 Ga0501038_0316604_369_1127 240
1574 3300049575 Ga0501039_0017563 Ga0501039_0017563_2822_3580 240
1575 3300049579 Ga0501043_0072840 Ga0501043_0072840_1259_2017 240
1576 3300049579 Ga0501043_0164505 Ga0501043_0164505_248_1006 240
1577 3300049580 Ga0501046_0014309 Ga0501046_0014309_3081_3839 240
1578 3300049580 Ga0501046_0051871 Ga0501046_0051871_583_1341 240
1579 3300049580 Ga0501046_0338445 Ga0501046_0338445_47_829 240
1580 3300049581 Ga0501047_0048076 Ga0501047_0048076_351_1109 240
1581 3300049581 Ga0501047_0442731 Ga0501047_0442731_261_1025 240
1582 3300049581 Ga0501047_0478199 Ga0501047_0478199_51_809 240
1583 3300049582 Ga0501048_0125816 Ga0501048_0125816_318_1076 240
1584 3300049584 Ga0501068_0035832 Ga0501068_0035832_706_1464 240
1585 3300049588 Ga0501072_0110278 Ga0501072_0110278_897_1655 240
1586 3300049588 Ga0501072_0308239 Ga0501072_0308239_368_1162 240
1587 3300049589 Ga0501073_0014781 Ga0501073_0014781_741_1499 240
1588 3300049589 Ga0501073_0089425 Ga0501073_0089425_838_1596 240
1589 3300049589 Ga0501073_0458198 Ga0501073_0458198_38_796 240
1590 3300049590 Ga0501074_0081104 Ga0501074_0081104_299_1057 240
1591 3300049742 Ga0501080_0115442 Ga0501080_0115442_64_822 240
1592 3300049744 Ga0501083_0049244 Ga0501083_0049244_993_1751 240
1593 3300049744 Ga0501083_0063763 Ga0501083_0063763_791_1549 240
1594 3300049822 Ga0501035_0083249 Ga0501035_0083249_598_1380 240
1595 3300049822 Ga0501035_0105131 Ga0501035_0105131_1177_1935 240
1596 3300049822 Ga0501035_0290401 Ga0501035_0290401_12_776 240
1597 3300049823 Ga0501044_0103067 Ga0501044_0103067_723_1481 240
1598 3300049823 Ga0501044_0441433 Ga0501044_0441433_64_843 240
1599 3300049823 Ga0501044_0589506 Ga0501044_0589506_72_830 240
1600 3300050507 nmdc:mga05p37_285757_c1 nmdc:mga05p37_285757_c1_311_1156 240
1601 3300050511 nmdc:mga08y16_226482_c1 nmdc:mga08y16_226482_c1_103_858 240
1602 3300053142 Ga0500577_0006420 Ga0500577_0006420_381_1136 240
1603 iso_pu_bacteria 2671180531 2673167664 240
1604 iso_pu_bacteria 2687453257 2688070184 240
1605 iso_pu_bacteria 2889415604 2889420872 240
1606 iso_pu_bacteria 2920107658 2920110133 240
1607 3300000532 CNAas_1000040 CNAas_10000406 241
1608 3300002239 JGI24034J26672_10000026 JGI24034J26672_1000002686 241
1609 3300002459 JGI24751J29686_10000030 JGI24751J29686_1000003038 241
1610 3300003203 JGI25406J46586_10003840 JGI25406J46586_100038402 241
1611 3300003203 JGI25406J46586_10059736 JGI25406J46586_100597361 241
1612 3300003203 JGI25406J46586_10077736 JGI25406J46586_100777362 241
1613 3300005288 Ga0065714_10064504 Ga0065714_1006450421 241
1614 3300005289 Ga0065704_10139293 Ga0065704_101392932 241
1615 3300005289 Ga0065704_10209631 Ga0065704_102096312 241
1616 3300005290 Ga0065712_10067766 Ga0065712_1006776621 241
1617 3300005290 Ga0065712_10122253 Ga0065712_101222532 241
1618 3300005290 Ga0065712_10182341 Ga0065712_101823412 241
1619 3300005293 Ga0065715_10001956 Ga0065715_100019562 241
1620 3300005293 Ga0065715_10041779 Ga0065715_100417792 241
1621 3300005293 Ga0065715_10089158 Ga0065715_1008915811 241
1622 3300005293 Ga0065715_10152536 Ga0065715_101525363 241
1623 3300005293 Ga0065715_10188464 Ga0065715_101884642 241
1624 3300005293 Ga0065715_10301965 Ga0065715_103019652 241
1625 3300005295 Ga0065707_10195597 Ga0065707_101955972 241
1626 3300005295 Ga0065707_10237340 Ga0065707_102373402 241
1627 3300005295 Ga0065707_10288125 Ga0065707_102881252 241
1628 3300005330 Ga0070690_100001011 Ga0070690_1000010117 241
1629 3300005331 Ga0070670_100002791 Ga0070670_10000279112 241
1630 3300005333 Ga0070677_10152901 Ga0070677_101529012 241
1631 3300005334 Ga0068869_100103722 Ga0068869_1001037221 241
1632 3300005334 Ga0068869_100143427 Ga0068869_1001434272 241
1633 3300005334 Ga0068869_100168917 Ga0068869_1001689172 241
1634 3300005335 Ga0070666_10051188 Ga0070666_100511882 241
1635 3300005336 Ga0070680_100326609 Ga0070680_1003266092 241
1636 3300005337 Ga0070682_100029208 Ga0070682_1000292084 241
1637 3300005338 Ga0068868_100039981 Ga0068868_1000399813 241
1638 3300005340 Ga0070689_100128362 Ga0070689_1001283623 241
1639 3300005343 Ga0070687_100170001 Ga0070687_1001700012 241
1640 3300005343 Ga0070687_100271253 Ga0070687_1002712531 241
1641 3300005345 Ga0070692_10056376 Ga0070692_100563761 241
1642 3300005345 Ga0070692_10078838 Ga0070692_100788383 241
1643 3300005347 Ga0070668_100312028 Ga0070668_1003120282 241
1644 3300005353 Ga0070669_100066581 Ga0070669_1000665812 241
1645 3300005353 Ga0070669_100115061 Ga0070669_1001150612 241
1646 3300005353 Ga0070669_100520740 Ga0070669_1005207401 241
1647 3300005355 Ga0070671_100089287 Ga0070671_1000892873 241
1648 3300005355 Ga0070671_100155199 Ga0070671_1001551992 241
1649 3300005355 Ga0070671_100228293 Ga0070671_1002282932 241
1650 3300005364 Ga0070673_100082833 Ga0070673_1000828332 241
1651 3300005364 Ga0070673_100172015 Ga0070673_1001720152 241
1652 3300005364 Ga0070673_100288759 Ga0070673_1002887592 241
1653 3300005365 Ga0070688_100006128 Ga0070688_1000061282 241
1654 3300005366 Ga0070659_100004306 Ga0070659_1000043064 241
1655 3300005367 Ga0070667_100173995 Ga0070667_1001739951 241
1656 3300005438 Ga0070701_10113763 Ga0070701_101137632 241
1657 3300005440 Ga0070705_100027907 Ga0070705_1000279073 241
1658 3300005440 Ga0070705_100067072 Ga0070705_1000670723 241
1659 3300005441 Ga0070700_100000719 Ga0070700_1000007193 241
1660 3300005441 Ga0070700_100020667 Ga0070700_1000206674 241
1661 3300005441 Ga0070700_100039705 Ga0070700_1000397052 241
1662 3300005441 Ga0070700_100062514 Ga0070700_1000625142 241
1663 3300005441 Ga0070700_100257511 Ga0070700_1002575111 241
1664 3300005444 Ga0070694_100008855 Ga0070694_1000088555 241
1665 3300005444 Ga0070694_100109337 Ga0070694_1001093373 241
1666 3300005444 Ga0070694_100201814 Ga0070694_1002018142 241
1667 3300005444 Ga0070694_100333469 Ga0070694_1003334691 241
1668 3300005444 Ga0070694_100381266 Ga0070694_1003812661 241
1669 3300005445 Ga0070708_100137339 Ga0070708_1001373392 241
1670 3300005457 Ga0070662_100180045 Ga0070662_1001800452 241
1671 3300005458 Ga0070681_10002315 Ga0070681_100023158 241
1672 3300005458 Ga0070681_10007845 Ga0070681_100078457 241
1673 3300005458 Ga0070681_10051872 Ga0070681_100518724 241
1674 3300005458 Ga0070681_10166545 Ga0070681_101665453 241
1675 3300005459 Ga0068867_100074453 Ga0068867_1000744532 241
1676 3300005467 Ga0070706_100000125 Ga0070706_10000012564 241
1677 3300005467 Ga0070706_100008529 Ga0070706_10000852910 241
1678 3300005467 Ga0070706_100210603 Ga0070706_1002106034 241
1679 3300005467 Ga0070706_100565234 Ga0070706_1005652342 241
1680 3300005468 Ga0070707_100260130 Ga0070707_1002601302 241
1681 3300005468 Ga0070707_100430159 Ga0070707_1004301592 241
1682 3300005471 Ga0070698_100005037 Ga0070698_1000050372 241
1683 3300005471 Ga0070698_100006865 Ga0070698_1000068659 241
1684 3300005471 Ga0070698_100008229 Ga0070698_10000822911 241
1685 3300005518 Ga0070699_100000880 Ga0070699_10000088016 241
1686 3300005518 Ga0070699_100004094 Ga0070699_1000040942 241
1687 3300005530 Ga0070679_100000587 Ga0070679_10000058717 241
1688 3300005530 Ga0070679_100077077 Ga0070679_1000770773 241
1689 3300005536 Ga0070697_100031128 Ga0070697_1000311282 241
1690 3300005536 Ga0070697_100055838 Ga0070697_1000558382 241
1691 3300005536 Ga0070697_100153616 Ga0070697_1001536162 241
1692 3300005539 Ga0068853_100163691 Ga0068853_1001636912 241
1693 3300005539 Ga0068853_100170360 Ga0068853_1001703602 241
1694 3300005543 Ga0070672_100016594 Ga0070672_1000165942 241
1695 3300005543 Ga0070672_100197393 Ga0070672_1001973931 241
1696 3300005543 Ga0070672_100560480 Ga0070672_1005604802 241
1697 3300005543 Ga0070672_100656057 Ga0070672_1006560571 241
1698 3300005544 Ga0070686_100006195 Ga0070686_1000061953 241
1699 3300005544 Ga0070686_100022101 Ga0070686_1000221014 241
1700 3300005544 Ga0070686_100142294 Ga0070686_1001422943 241
1701 3300005545 Ga0070695_100267266 Ga0070695_1002672661 241
1702 3300005545 Ga0070695_100510046 Ga0070695_1005100461 241
1703 3300005546 Ga0070696_100040295 Ga0070696_1000402953 241
1704 3300005546 Ga0070696_100693071 Ga0070696_1006930711 241
1705 3300005547 Ga0070693_100020755 Ga0070693_1000207552 241
1706 3300005547 Ga0070693_100030719 Ga0070693_1000307192 241
1707 3300005548 Ga0070665_100283231 Ga0070665_1002832312 241
1708 3300005549 Ga0070704_100054755 Ga0070704_1000547552 241
1709 3300005549 Ga0070704_100134808 Ga0070704_1001348082 241
1710 3300005549 Ga0070704_100161122 Ga0070704_1001611222 241
1711 3300005549 Ga0070704_100325872 Ga0070704_1003258721 241
1712 3300005563 Ga0068855_100250783 Ga0068855_1002507833 241
1713 3300005564 Ga0070664_100047571 Ga0070664_1000475714 241
1714 3300005577 Ga0068857_100033566 Ga0068857_1000335662 241
1715 3300005578 Ga0068854_100046307 Ga0068854_1000463073 241
1716 3300005578 Ga0068854_100253706 Ga0068854_1002537061 241
1717 3300005615 Ga0070702_100017673 Ga0070702_1000176735 241
1718 3300005615 Ga0070702_100252847 Ga0070702_1002528471 241
1719 3300005615 Ga0070702_100308007 Ga0070702_1003080071 241
1720 3300005616 Ga0068852_100399548 Ga0068852_1003995483 241
1721 3300005617 Ga0068859_100009084 Ga0068859_1000090845 241
1722 3300005617 Ga0068859_100022162 Ga0068859_1000221624 241
1723 3300005617 Ga0068859_100050914 Ga0068859_1000509143 241
1724 3300005617 Ga0068859_100059991 Ga0068859_1000599912 241
1725 3300005617 Ga0068859_100169710 Ga0068859_1001697102 241
1726 3300005617 Ga0068859_100355574 Ga0068859_1003555741 241
1727 3300005618 Ga0068864_100024719 Ga0068864_1000247192 241
1728 3300005618 Ga0068864_100035972 Ga0068864_1000359723 241
1729 3300005618 Ga0068864_100040419 Ga0068864_1000404192 241
1730 3300005618 Ga0068864_100246022 Ga0068864_1002460222 241
1731 3300005618 Ga0068864_100676324 Ga0068864_1006763242 241
1732 3300005719 Ga0068861_100020275 Ga0068861_1000202754 241
1733 3300005719 Ga0068861_100340958 Ga0068861_1003409582 241
1734 3300005719 Ga0068861_100558303 Ga0068861_1005583032 241
1735 3300005834 Ga0068851_10010828 Ga0068851_100108285 241
1736 3300005841 Ga0068863_100080336 Ga0068863_1000803363 241
1737 3300005841 Ga0068863_100264213 Ga0068863_1002642134 241
1738 3300005842 Ga0068858_100006538 Ga0068858_1000065388 241
1739 3300005842 Ga0068858_100041680 Ga0068858_1000416802 241
1740 3300005842 Ga0068858_100049299 Ga0068858_1000492991 241
1741 3300005842 Ga0068858_100206719 Ga0068858_1002067192 241
1742 3300005842 Ga0068858_100275829 Ga0068858_1002758292 241
1743 3300005843 Ga0068860_100019352 Ga0068860_1000193522 241
1744 3300005843 Ga0068860_100030361 Ga0068860_1000303616 241
1745 3300005843 Ga0068860_100243218 Ga0068860_1002432182 241
1746 3300005844 Ga0068862_100156570 Ga0068862_1001565702 241
1747 3300005844 Ga0068862_100655808 Ga0068862_1006558082 241
1748 3300005985 Ga0081539_10000110 Ga0081539_1000011053 241
1749 3300005985 Ga0081539_10001757 Ga0081539_1000175712 241
1750 3300005985 Ga0081539_10005290 Ga0081539_100052905 241
1751 3300005985 Ga0081539_10006601 Ga0081539_100066018 241
1752 3300006173 Ga0070716_100116535 Ga0070716_1001165352 241
1753 3300006237 Ga0097621_100000449 Ga0097621_10000044932 241
1754 3300006358 Ga0068871_100064226 Ga0068871_1000642262 241
1755 3300006358 Ga0068871_100314906 Ga0068871_1003149062 241
1756 3300006844 Ga0075428_100009001 Ga0075428_1000090013 241
1757 3300006846 Ga0075430_100076170 Ga0075430_1000761702 241
1758 3300006852 Ga0075433_10008826 Ga0075433_100088262 241
1759 3300006852 Ga0075433_10044089 Ga0075433_100440892 241
1760 3300006852 Ga0075433_10045889 Ga0075433_100458892 241
1761 3300006852 Ga0075433_10062021 Ga0075433_100620216 241
1762 3300006852 Ga0075433_10118535 Ga0075433_101185352 241
1763 3300006852 Ga0075433_10176928 Ga0075433_101769283 241
1764 3300006871 Ga0075434_100019404 Ga0075434_1000194045 241
1765 3300006871 Ga0075434_100020621 Ga0075434_1000206218 241
1766 3300006871 Ga0075434_100035585 Ga0075434_1000355856 241
1767 3300006871 Ga0075434_100110623 Ga0075434_1001106233 241
1768 3300006871 Ga0075434_100240687 Ga0075434_1002406872 241
1769 3300006871 Ga0075434_100277852 Ga0075434_1002778522 241
1770 3300006880 Ga0075429_100124879 Ga0075429_1001248793 241
1771 3300006880 Ga0075429_100295766 Ga0075429_1002957662 241
1772 3300006880 Ga0075429_100395773 Ga0075429_1003957732 241
1773 3300006881 Ga0068865_100141872 Ga0068865_1001418722 241
1774 3300006881 Ga0068865_100365257 Ga0068865_1003652572 241
1775 3300006914 Ga0075436_100001175 Ga0075436_1000011753 241
1776 3300006931 Ga0097620_100009084 Ga0097620_1000090847 241
1777 3300006931 Ga0097620_100022163 Ga0097620_1000221634 241
1778 3300006931 Ga0097620_100050908 Ga0097620_1000509085 241
1779 3300006931 Ga0097620_100059986 Ga0097620_1000599862 241
1780 3300006931 Ga0097620_100169714 Ga0097620_1001697142 241
1781 3300006931 Ga0097620_100355571 Ga0097620_1003555711 241
1782 3300007076 Ga0075435_100009611 Ga0075435_1000096113 241
1783 3300009011 Ga0105251_10056175 Ga0105251_100561752 241
1784 3300009093 Ga0105240_10158004 Ga0105240_101580043 241
1785 3300009094 Ga0111539_10076099 Ga0111539_100760993 241
1786 3300009094 Ga0111539_10112739 Ga0111539_101127391 241
1787 3300009094 Ga0111539_10310035 Ga0111539_103100353 241
1788 3300009094 Ga0111539_10375944 Ga0111539_103759442 241
1789 3300009098 Ga0105245_10107745 Ga0105245_101077454 241
1790 3300009098 Ga0105245_10668767 Ga0105245_106687671 241
1791 3300009101 Ga0105247_10000047 Ga0105247_1000004725 241
1792 3300009101 Ga0105247_10001044 Ga0105247_100010443 241
1793 3300009101 Ga0105247_10093410 Ga0105247_100934102 241
1794 3300009147 Ga0114129_10070556 Ga0114129_100705564 241
1795 3300009147 Ga0114129_10473193 Ga0114129_104731932 241
1796 3300009147 Ga0114129_10481150 Ga0114129_104811503 241
1797 3300009147 Ga0114129_10514193 Ga0114129_105141932 241
1798 3300009147 Ga0114129_10610367 Ga0114129_106103671 241
1799 3300009147 Ga0114129_10759767 Ga0114129_107597672 241
1800 3300009148 Ga0105243_10000027 Ga0105243_10000027143 241
1801 3300009148 Ga0105243_10000474 Ga0105243_100004747 241
1802 3300009148 Ga0105243_10025565 Ga0105243_100255653 241
1803 3300009148 Ga0105243_10147343 Ga0105243_101473434 241
1804 3300009148 Ga0105243_10410071 Ga0105243_104100712 241
1805 3300009174 Ga0105241_10070341 Ga0105241_100703414 241
1806 3300009174 Ga0105241_10294902 Ga0105241_102949022 241
1807 3300009174 Ga0105241_10298249 Ga0105241_102982492 241
1808 3300009176 Ga0105242_10000038 Ga0105242_1000003867 241
1809 3300009176 Ga0105242_10000107 Ga0105242_1000010735 241
1810 3300009176 Ga0105242_10005047 Ga0105242_100050478 241
1811 3300009176 Ga0105242_10123128 Ga0105242_101231282 241
1812 3300009176 Ga0105242_10160011 Ga0105242_101600112 241
1813 3300009177 Ga0105248_10028561 Ga0105248_100285614 241
1814 3300009177 Ga0105248_10032857 Ga0105248_100328573 241
1815 3300009177 Ga0105248_10071202 Ga0105248_100712026 241
1816 3300009177 Ga0105248_10169319 Ga0105248_101693193 241
1817 3300009545 Ga0105237_10000829 Ga0105237_1000082914 241
1818 3300009545 Ga0105237_10258032 Ga0105237_102580323 241
1819 3300009553 Ga0105249_10000113 Ga0105249_1000011323 241
1820 3300009553 Ga0105249_10001390 Ga0105249_100013902 241
1821 3300009553 Ga0105249_10022829 Ga0105249_100228292 241
1822 3300009553 Ga0105249_10490726 Ga0105249_104907262 241
1823 3300010375 Ga0105239_10060038 Ga0105239_100600382 241
1824 3300010375 Ga0105239_10241798 Ga0105239_102417982 241
1825 3300011119 Ga0105246_10073632 Ga0105246_100736322 241
1826 3300011119 Ga0105246_10086527 Ga0105246_100865272 241
1827 3300011119 Ga0105246_10280360 Ga0105246_102803602 241
1828 3300011119 Ga0105246_10319732 Ga0105246_103197322 241
1829 3300013100 Ga0157373_10018812 Ga0157373_100188126 241
1830 3300013100 Ga0157373_10044616 Ga0157373_100446163 241
1831 3300013102 Ga0157371_10310404 Ga0157371_103104042 241
1832 3300013296 Ga0157374_10913170 Ga0157374_109131701 241
1833 3300013297 Ga0157378_10000048 Ga0157378_1000004823 241
1834 3300013297 Ga0157378_10005648 Ga0157378_100056489 241
1835 3300013297 Ga0157378_10025656 Ga0157378_100256565 241
1836 3300013297 Ga0157378_10113691 Ga0157378_101136912 241
1837 3300013297 Ga0157378_10229130 Ga0157378_102291302 241
1838 3300013297 Ga0157378_10381753 Ga0157378_103817532 241
1839 3300013297 Ga0157378_10528555 Ga0157378_105285551 241
1840 3300013297 Ga0157378_10645347 Ga0157378_106453472 241
1841 3300013306 Ga0163162_10000023 Ga0163162_10000023109 241
1842 3300013306 Ga0163162_10001226 Ga0163162_1000122615 241
1843 3300013306 Ga0163162_10051608 Ga0163162_100516083 241
1844 3300013306 Ga0163162_10108278 Ga0163162_101082782 241
1845 3300013306 Ga0163162_10203558 Ga0163162_102035582 241
1846 3300013306 Ga0163162_10208523 Ga0163162_102085232 241
1847 3300013306 Ga0163162_10216899 Ga0163162_102168993 241
1848 3300013306 Ga0163162_10658561 Ga0163162_106585612 241
1849 3300013307 Ga0157372_10286185 Ga0157372_102861851 241
1850 3300013307 Ga0157372_10494190 Ga0157372_104941902 241
1851 3300013308 Ga0157375_10006519 Ga0157375_100065198 241
1852 3300013308 Ga0157375_10048768 Ga0157375_100487683 241
1853 3300013308 Ga0157375_10254236 Ga0157375_102542363 241
1854 3300013308 Ga0157375_10348662 Ga0157375_103486622 241
1855 3300014325 Ga0163163_10000156 Ga0163163_1000015644 241
1856 3300014325 Ga0163163_10377167 Ga0163163_103771671 241
1857 3300014326 Ga0157380_10001458 Ga0157380_100014589 241
1858 3300014326 Ga0157380_10012266 Ga0157380_100122664 241
1859 3300014326 Ga0157380_10039177 Ga0157380_100391775 241
1860 3300014326 Ga0157380_10040754 Ga0157380_100407543 241
1861 3300014326 Ga0157380_10053569 Ga0157380_100535694 241
1862 3300014326 Ga0157380_10322233 Ga0157380_103222332 241
1863 3300014745 Ga0157377_10050432 Ga0157377_100504323 241
1864 3300014968 Ga0157379_10105838 Ga0157379_101058384 241
1865 3300014968 Ga0157379_10153851 Ga0157379_101538512 241
1866 3300015262 Ga0182007_10056709 Ga0182007_100567092 241
1867 3300017792 Ga0163161_10025332 Ga0163161_100253323 241
1868 3300017792 Ga0163161_10059173 Ga0163161_100591733 241
1869 3300017792 Ga0163161_10174310 Ga0163161_101743102 241
1870 3300017792 Ga0163161_10231857 Ga0163161_102318572 241
1871 3300021384 Ga0213876_10000043 Ga0213876_10000043127 241
1872 3300021384 Ga0213876_10000283 Ga0213876_1000028336 241
1873 3300025223 Ga0207672_1000156 Ga0207672_100015611 241
1874 3300025315 Ga0207697_10129407 Ga0207697_101294071 241
1875 3300025321 Ga0207656_10005843 Ga0207656_100058434 241
1876 3300025885 Ga0207653_10000400 Ga0207653_1000040014 241
1877 3300025900 Ga0207710_10000001 Ga0207710_10000001553 241
1878 3300025900 Ga0207710_10002769 Ga0207710_100027697 241
1879 3300025903 Ga0207680_10070356 Ga0207680_100703562 241
1880 3300025904 Ga0207647_10021671 Ga0207647_100216714 241
1881 3300025907 Ga0207645_10189759 Ga0207645_101897592 241
1882 3300025908 Ga0207643_10067989 Ga0207643_100679893 241
1883 3300025910 Ga0207684_10000130 Ga0207684_10000130106 241
1884 3300025910 Ga0207684_10001792 Ga0207684_1000179214 241
1885 3300025910 Ga0207684_10107705 Ga0207684_101077051 241
1886 3300025910 Ga0207684_10131173 Ga0207684_101311733 241
1887 3300025910 Ga0207684_10165352 Ga0207684_101653524 241
1888 3300025912 Ga0207707_10000577 Ga0207707_1000057723 241
1889 3300025912 Ga0207707_10038041 Ga0207707_100380412 241
1890 3300025912 Ga0207707_10151696 Ga0207707_101516961 241
1891 3300025914 Ga0207671_10009012 Ga0207671_1000901213 241
1892 3300025914 Ga0207671_10256790 Ga0207671_102567902 241
1893 3300025914 Ga0207671_10609738 Ga0207671_106097381 241
1894 3300025917 Ga0207660_10118160 Ga0207660_101181604 241
1895 3300025917 Ga0207660_10314999 Ga0207660_103149991 241
1896 3300025918 Ga0207662_10043744 Ga0207662_100437443 241
1897 3300025918 Ga0207662_10046470 Ga0207662_100464702 241
1898 3300025918 Ga0207662_10176936 Ga0207662_101769363 241
1899 3300025921 Ga0207652_10010606 Ga0207652_100106066 241
1900 3300025921 Ga0207652_10043700 Ga0207652_100437003 241
1901 3300025922 Ga0207646_10149616 Ga0207646_101496162 241
1902 3300025922 Ga0207646_10269196 Ga0207646_102691963 241
1903 3300025923 Ga0207681_10014548 Ga0207681_100145484 241
1904 3300025923 Ga0207681_10292495 Ga0207681_102924952 241
1905 3300025925 Ga0207650_10000010 Ga0207650_10000010305 241
1906 3300025927 Ga0207687_10268305 Ga0207687_102683052 241
1907 3300025927 Ga0207687_10324228 Ga0207687_103242281 241
1908 3300025931 Ga0207644_10000285 Ga0207644_100002857 241
1909 3300025931 Ga0207644_10080345 Ga0207644_100803452 241
1910 3300025931 Ga0207644_10109564 Ga0207644_101095641 241
1911 3300025931 Ga0207644_10268626 Ga0207644_102686262 241
1912 3300025932 Ga0207690_10045184 Ga0207690_100451844 241
1913 3300025932 Ga0207690_10275600 Ga0207690_102756002 241
1914 3300025933 Ga0207706_10211548 Ga0207706_102115481 241
1915 3300025933 Ga0207706_10263151 Ga0207706_102631512 241
1916 3300025933 Ga0207706_10313566 Ga0207706_103135662 241
1917 3300025934 Ga0207686_10000008 Ga0207686_10000008142 241
1918 3300025934 Ga0207686_10000463 Ga0207686_1000046310 241
1919 3300025934 Ga0207686_10016548 Ga0207686_100165483 241
1920 3300025934 Ga0207686_10053520 Ga0207686_100535202 241
1921 3300025934 Ga0207686_10312709 Ga0207686_103127091 241
1922 3300025935 Ga0207709_10000025 Ga0207709_100000259 241
1923 3300025935 Ga0207709_10000493 Ga0207709_1000049329 241
1924 3300025935 Ga0207709_10001939 Ga0207709_100019393 241
1925 3300025935 Ga0207709_10035958 Ga0207709_100359585 241
1926 3300025936 Ga0207670_10004103 Ga0207670_100041034 241
1927 3300025936 Ga0207670_10064713 Ga0207670_100647132 241
1928 3300025936 Ga0207670_10115390 Ga0207670_101153902 241
1929 3300025938 Ga0207704_10087011 Ga0207704_100870113 241
1930 3300025938 Ga0207704_10094645 Ga0207704_100946452 241
1931 3300025939 Ga0207665_10253016 Ga0207665_102530162 241
1932 3300025940 Ga0207691_10046619 Ga0207691_100466195 241
1933 3300025940 Ga0207691_10272142 Ga0207691_102721422 241
1934 3300025940 Ga0207691_10286898 Ga0207691_102868981 241
1935 3300025941 Ga0207711_10008004 Ga0207711_100080044 241
1936 3300025941 Ga0207711_10077141 Ga0207711_100771412 241
1937 3300025941 Ga0207711_10195015 Ga0207711_101950153 241
1938 3300025942 Ga0207689_10022079 Ga0207689_100220791 241
1939 3300025942 Ga0207689_10027470 Ga0207689_100274704 241
1940 3300025942 Ga0207689_10047194 Ga0207689_100471943 241
1941 3300025942 Ga0207689_10226814 Ga0207689_102268141 241
1942 3300025942 Ga0207689_10309475 Ga0207689_103094752 241
1943 3300025944 Ga0207661_10386847 Ga0207661_103868472 241
1944 3300025945 Ga0207679_10239496 Ga0207679_102394961 241
1945 3300025945 Ga0207679_10311808 Ga0207679_103118083 241
1946 3300025949 Ga0207667_10093626 Ga0207667_100936265 241
1947 3300025960 Ga0207651_10125775 Ga0207651_101257752 241
1948 3300025961 Ga0207712_10000408 Ga0207712_1000040819 241
1949 3300025961 Ga0207712_10171804 Ga0207712_101718041 241
1950 3300025961 Ga0207712_10287102 Ga0207712_102871023 241
1951 3300025972 Ga0207668_10279507 Ga0207668_102795072 241
1952 3300025981 Ga0207640_10139361 Ga0207640_101393612 241
1953 3300025981 Ga0207640_10242125 Ga0207640_102421252 241
1954 3300025986 Ga0207658_10036943 Ga0207658_100369433 241
1955 3300026023 Ga0207677_10201657 Ga0207677_102016573 241
1956 3300026035 Ga0207703_10000867 Ga0207703_100008676 241
1957 3300026035 Ga0207703_10045116 Ga0207703_100451165 241
1958 3300026035 Ga0207703_10050255 Ga0207703_100502553 241
1959 3300026035 Ga0207703_10285496 Ga0207703_102854962 241
1960 3300026075 Ga0207708_10001694 Ga0207708_100016942 241
1961 3300026075 Ga0207708_10028396 Ga0207708_100283964 241
1962 3300026075 Ga0207708_10085114 Ga0207708_100851142 241
1963 3300026088 Ga0207641_10057795 Ga0207641_100577952 241
1964 3300026088 Ga0207641_10115170 Ga0207641_101151703 241
1965 3300026088 Ga0207641_10209104 Ga0207641_102091042 241
1966 3300026088 Ga0207641_10359365 Ga0207641_103593652 241
1967 3300026089 Ga0207648_10065955 Ga0207648_100659554 241
1968 3300026089 Ga0207648_10173974 Ga0207648_101739741 241
1969 3300026089 Ga0207648_10206900 Ga0207648_102069002 241
1970 3300026089 Ga0207648_10303271 Ga0207648_103032712 241
1971 3300026095 Ga0207676_10019238 Ga0207676_100192384 241
1972 3300026095 Ga0207676_10024955 Ga0207676_100249552 241
1973 3300026095 Ga0207676_10313320 Ga0207676_103133201 241
1974 3300026116 Ga0207674_10002399 Ga0207674_1000239917 241
1975 3300026118 Ga0207675_100001958 Ga0207675_10000195815 241
1976 3300026118 Ga0207675_100012425 Ga0207675_1000124256 241
1977 3300026118 Ga0207675_100447650 Ga0207675_1004476501 241
1978 3300026142 Ga0207698_10795302 Ga0207698_107953021 241
1979 3300028380 Ga0268265_10041099 Ga0268265_100410993 241
1980 3300028380 Ga0268265_10132990 Ga0268265_101329903 241
1981 3300028381 Ga0268264_10013722 Ga0268264_100137224 241
1982 3300028381 Ga0268264_10048036 Ga0268264_100480362 241
1983 3300028381 Ga0268264_10059751 Ga0268264_100597513 241
1984 3300028381 Ga0268264_10176763 Ga0268264_101767633 241
1985 3300028381 Ga0268264_10317674 Ga0268264_103176742 241
1986 3300028381 Ga0268264_10410677 Ga0268264_104106772 241
1987 3300031548 Ga0307408_100089283 Ga0307408_1000892832 241
1988 3300031731 Ga0307405_10102765 Ga0307405_101027652 241
1989 3300031824 Ga0307413_10157747 Ga0307413_101577472 241
1990 3300031824 Ga0307413_10167609 Ga0307413_101676091 241
1991 3300031852 Ga0307410_10147722 Ga0307410_101477223 241
1992 3300031852 Ga0307410_10222037 Ga0307410_102220372 241
1993 3300031901 Ga0307406_10031996 Ga0307406_100319963 241
1994 3300031995 Ga0307409_100395838 Ga0307409_1003958382 241
1995 3300032002 Ga0307416_100243039 Ga0307416_1002430392 241
1996 3300032004 Ga0307414_10008080 Ga0307414_100080802 241
1997 3300032004 Ga0307414_10299504 Ga0307414_102995041 241
1998 3300032126 Ga0307415_100033995 Ga0307415_1000339955 241
1999 3300032126 Ga0307415_100510014 Ga0307415_1005100142 241
2000 3300037418 Ga0395900_0140129 Ga0395900_0140129_1549_2307 241
2001 3300037418 Ga0395900_0196989 Ga0395900_0196989_1000_1725 241
2002 3300037466 Ga0395898_0193157 Ga0395898_0193157_936_1694 241
2003 3300037466 Ga0395898_0636552 Ga0395898_0636552_105_863 241
2004 3300037471 Ga0395905_0040992 Ga0395905_0040992_2793_3518 241
2005 3300037853 Ga0436364_0003086 Ga0436364_0003086_689_1447 241
2006 3300039437 Ga0436365_0421852 Ga0436365_0421852_133596_134354 241
2007 3300039437 Ga0436365_0935686 Ga0436365_0935686_1418_2176 241
2008 3300039437 Ga0436365_1132500 Ga0436365_1132500_632_1390 241
2009 3300039437 Ga0436365_1595370 Ga0436365_1595370_195_920 241
2010 3300042157 Ga0439458_0072768 Ga0439458_0072768_128_853 241
2011 3300042435 Ga0439434_0082002 Ga0439434_0082002_119_883 241
2012 3300044673 Ga0453683_0150042 Ga0453683_0150042_381_1142 241
2013 3300045051 Ga0451576_0775981 Ga0451576_0775981_43_801 241
2014 3300048905 Ga0496102_0260303 Ga0496102_0260303_679_1437 241
2015 3300048907 Ga0496104_0890781 Ga0496104_0890781_45_770 241
2016 3300048909 Ga0496106_0069286 Ga0496106_0069286_508_1266 241
2017 3300048909 Ga0496106_0133009 Ga0496106_0133009_415_1140 241
2018 3300048910 Ga0496107_0128403 Ga0496107_0128403_596_1354 241
2019 3300048910 Ga0496107_0236291 Ga0496107_0236291_246_1004 241
2020 3300048913 Ga0496110_0638853 Ga0496110_0638853_16_774 241
2021 3300048915 Ga0496112_0456462 Ga0496112_0456462_459_1184 241
2022 3300048915 Ga0496112_0583431 Ga0496112_0583431_37_795 241
2023 3300049516 Ga0501293_007669 Ga0501293_007669_116_874 241
2024 3300049519 Ga0501296_002969 Ga0501296_002969_66_824 241
2025 3300049520 Ga0501297_011866 Ga0501297_011866_56_814 241
2026 3300049521 Ga0501298_005636 Ga0501298_005636_152_910 241
2027 3300049522 Ga0501299_002465 Ga0501299_002465_950_1708 241
2028 3300049574 Ga0501038_0007946 Ga0501038_0007946_7798_8556 241
2029 3300049580 Ga0501046_0368610 Ga0501046_0368610_109_870 241
2030 3300049652 Ga0501202_023766 Ga0501202_023766_166_924 241
2031 3300049652 Ga0501202_039277 Ga0501202_039277_231_989 241
2032 3300049661 Ga0501217_081826 Ga0501217_081826_99_857 241
2033 3300049663 Ga0501223_001670 Ga0501223_001670_1353_2111 241
2034 3300049668 Ga0501233_006769 Ga0501233_006769_423_1181 241
2035 3300049669 Ga0501235_003437 Ga0501235_003437_1911_2669 241
2036 3300049669 Ga0501235_016642 Ga0501235_016642_542_1300 241
2037 3300049679 Ga0501249_042551 Ga0501249_042551_262_987 241
2038 3300049684 Ga0501255_020100 Ga0501255_020100_51_809 241
2039 3300049690 Ga0501261_013782 Ga0501261_013782_165_923 241
2040 3300049705 Ga0501225_0001550 Ga0501225_0001550_6048_6806 241
2041 3300049705 Ga0501225_0044761 Ga0501225_0044761_273_1031 241
2042 3300049707 Ga0501234_002639 Ga0501234_002639_1605_2363 241
2043 3300049767 Ga0501270_007195 Ga0501270_007195_43_768 241
2044 3300049779 Ga0501283_000325 Ga0501283_000325_4621_5346 241
2045 3300049853 Ga0501226_005037 Ga0501226_005037_639_1397 241
2046 3300050507 nmdc:mga05p37_115286_c1 nmdc:mga05p37_115286_c1_1930_2688 241
2047 3300050507 nmdc:mga05p37_300144_c1 nmdc:mga05p37_300144_c1_124_882 241
2048 3300050507 nmdc:mga05p37_317055_c1 nmdc:mga05p37_317055_c1_460_1218 241
2049 3300050507 nmdc:mga05p37_329514_c1 nmdc:mga05p37_329514_c1_253_1014 241
2050 3300050507 nmdc:mga05p37_734563_c1 nmdc:mga05p37_734563_c1_270_1028 241
2051 3300050511 nmdc:mga08y16_278776_c1 nmdc:mga08y16_278776_c1_165_923 241
2052 3300050511 nmdc:mga08y16_75051_c1 nmdc:mga08y16_75051_c1_476_1234 241
2053 3300050511 nmdc:mga08y16_86150_c1 nmdc:mga08y16_86150_c1_671_1429 241
2054 3300050512 nmdc:mga0n895_129906_c1 nmdc:mga0n895_129906_c1_1292_2017 241
2055 3300050512 nmdc:mga0n895_141334_c1 nmdc:mga0n895_141334_c1_565_1323 241
2056 3300050512 nmdc:mga0n895_226829_c1 nmdc:mga0n895_226829_c1_635_1393 241
2057 3300050512 nmdc:mga0n895_240226_c1 nmdc:mga0n895_240226_c1_556_1314 241
2058 3300050512 nmdc:mga0n895_594604_c1 nmdc:mga0n895_594604_c1_190_948 241
2059 3300050512 nmdc:mga0n895_89055_c1 nmdc:mga0n895_89055_c1_2120_2878 241
2060 3300050513 nmdc:mga0rr50_10031_c1 nmdc:mga0rr50_10031_c1_1074_1832 241
2061 3300050513 nmdc:mga0rr50_137562_c1 nmdc:mga0rr50_137562_c1_506_1267 241
2062 3300050513 nmdc:mga0rr50_169_c1 nmdc:mga0rr50_169_c1_17298_18056 241
2063 3300050514 nmdc:mga08x19_26_c1 nmdc:mga08x19_26_c1_101131_101889 241
2064 3300050515 nmdc:mga0a205_132190_c1 nmdc:mga0a205_132190_c1_650_1375 241
2065 3300050515 nmdc:mga0a205_289709_c1 nmdc:mga0a205_289709_c1_620_1378 241
2066 3300050515 nmdc:mga0a205_460169_c1 nmdc:mga0a205_460169_c1_292_1110 241
2067 3300050515 nmdc:mga0a205_72336_c1 nmdc:mga0a205_72336_c1_1625_2383 241
2068 3300050515 nmdc:mga0a205_84763_c1 nmdc:mga0a205_84763_c1_1785_2510 241
2069 3300053153 Ga0500616_0000797 Ga0500616_0000797_5285_6043 241
2070 3300054114 Ga0501084_0425019 Ga0501084_0425019_314_1072 241
2071 3300054114 Ga0501084_0514318 Ga0501084_0514318_234_995 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

45

292

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9824 1 240
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9807 1 239
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9796 1 241
1btm-assembly1.cif.gz_B triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid 0.9759 1 239
6nlh-assembly4.cif.gz_H structure of human triose phosphate isomerase r189a 0.9718 1 241
ID Description Score Start End Superfamily
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9796 1 241 3.20.20.70
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9779 29 241 3.20.20.70
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9687 29 241 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.968 1 239 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 1 241 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7S4TA46-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9995 114 238 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A351UNB1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9992 79 237 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7S0CIF1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9971 107 238 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A645DQY7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9961 84 239 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A660REK8-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.996 81 239 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Feature Viewer

pLDDT pTM Quality
95.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map