F496299

General Info

Members Datasets Scaffolds Average Seq Length
2038 535 2008 190

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100398033|Ga0070661_1003980331
Length 221
Sequence MEIILLERVEKLGAIGDVVKVKDGFARNYLLPRKKALRANEANRKLFEANRARIEEENANKRSDAEKASKSVDGKTVQLIRQASNTGQLYGSVSARDIAEALEGAGAHVAKSQVVLDRPIKAIGMHEVKIALHPEVGVTVKVNVARSPEEADLQAQGIDVMAQMFERDATAFTEEFEPGLEPGIPAAEENPGTPAEAEVGISEEAPADTGTGENRSGEEEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
14 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
15 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
16 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
17 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
18 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
19 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
20 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
21 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
22 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
23 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
24 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
25 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
26 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
27 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
28 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
29 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
30 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
31 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
32 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
33 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
34 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
35 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
36 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
41 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
42 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
43 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
44 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
45 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
46 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
47 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
48 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
49 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
50 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
51 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
93 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
112 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
113 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
114 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
127 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
130 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
131 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
132 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
133 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
134 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
135 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
136 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
137 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
138 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
139 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
140 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
141 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
142 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
143 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
144 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
146 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
147 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
150 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
165 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
166 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
176 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
177 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
178 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
179 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
180 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
181 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
185 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
188 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
195 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
196 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
197 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
199 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
200 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
281 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
286 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
287 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
288 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
289 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
290 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
291 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
292 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
293 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
294 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
295 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
298 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
299 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
300 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
301 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
303 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
304 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
305 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
306 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
307 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
308 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
309 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
310 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
316 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
317 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
318 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
319 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
320 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
321 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
322 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
323 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
324 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
325 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
326 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
327 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
328 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
329 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
330 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
331 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
332 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
333 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
334 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
335 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
336 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
337 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
338 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
339 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
340 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
341 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
342 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
343 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
344 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
345 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
346 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
347 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
348 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
349 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
350 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
351 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
352 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
353 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
354 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
355 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
356 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
357 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
358 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
359 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
360 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
361 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
362 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
363 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
364 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
365 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
366 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
367 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
368 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
369 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
370 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
371 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
372 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
373 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
374 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
375 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
378 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
379 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
380 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
381 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
382 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
383 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
384 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
385 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
389 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
390 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
391 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
392 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
393 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
394 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
395 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
396 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
397 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
398 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
399 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
400 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
401 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
402 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
424 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
425 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
428 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
429 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
440 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
441 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
442 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
443 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
464 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
465 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
466 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
467 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
468 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
469 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
470 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
471 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
472 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
473 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
474 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
475 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
476 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
477 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
478 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
479 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
480 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
481 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
482 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
483 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
484 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
485 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
486 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
487 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
488 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
489 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
490 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
493 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
494 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
495 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
496 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
497 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
498 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
499 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
500 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
501 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
502 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
503 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
504 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
505 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
506 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
507 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
508 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
509 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
510 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
511 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
512 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
513 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
514 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
515 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
516 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
517 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
518 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
519 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
520 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
521 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
522 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
523 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
524 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
525 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
526 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
535 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 1.82
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 5.64
Nodule 0
Rhizoplane 3.29
Rhizosphere 87.34
Stem 0
Stem Tuber 0.05
Unclassified 3.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3230906 2162886007 Bacteria 1541
2 ARcpr5oldR_c000971 3300000041 Bacteria 3098
3 ARcpr5yngRDRAFT_c003421 3300000043 Bacteria 1566
4 JGI24736J21556_1000110 3300001904 Bacteria 13961
5 JGI24741J21665_1000982 3300001915 Bacteria 8568
6 JGI24741J21665_1000991 3300001915 Bacteria 8535
7 JGI24741J21665_1001534 3300001915 Bacteria 6545
8 JGI24752J21851_1000117 3300001976 Bacteria 10849
9 JGI24752J21851_1006279 3300001976 Bacteria 1553
10 JGI24747J21853_1002726 3300001978 Bacteria 1468
11 JGI24740J21852_10000594 3300001979 Bacteria 15640
12 JGI24740J21852_10001036 3300001979 Bacteria 12464
13 JGI24740J21852_10004545 3300001979 Bacteria 5971
14 JGI24740J21852_10010914 3300001979 Bacteria 3473
15 JGI24740J21852_10013016 3300001979 Bacteria 3120
16 JGI24740J21852_10019603 3300001979 Bacteria 2378
17 JGI24740J21852_10019834 3300001979 Bacteria 2360
18 JGI24740J21852_10026549 3300001979 Bacteria 1939
19 JGI24740J21852_10076847 3300001979 Bacteria 882
20 JGI24740J21852_10093189 3300001979 Bacteria 775
21 JGI24739J22299_10000311 3300001989 Bacteria 16579
22 JGI24739J22299_10005667 3300001989 Bacteria 4731
23 JGI24739J22299_10009771 3300001989 Bacteria 3568
24 JGI24739J22299_10025725 3300001989 Bacteria 2070
25 JGI24739J22299_10026329 3300001989 Bacteria 2041
26 JGI24739J22299_10028375 3300001989 Bacteria 1952
27 JGI24739J22299_10037282 3300001989 Bacteria 1638
28 JGI24739J22299_10060964 3300001989 Bacteria 1192
29 JGI24739J22299_10093185 3300001989 Bacteria 915
30 JGI24739J22299_10108056 3300001989 Bacteria 836
31 JGI24737J22298_10000013 3300001990 Bacteria 50248
32 JGI24737J22298_10000835 3300001990 Bacteria 10972
33 JGI24737J22298_10001767 3300001990 Bacteria 7736
34 JGI24737J22298_10003617 3300001990 Bacteria 5447
35 JGI24737J22298_10005360 3300001990 Bacteria 4433
36 JGI24737J22298_10008817 3300001990 Bacteria 3367
37 JGI24737J22298_10012770 3300001990 Bacteria 2738
38 JGI24737J22298_10026184 3300001990 Bacteria 1842
39 JGI24737J22298_10076503 3300001990 Bacteria 998
40 JGI24743J22301_10009940 3300001991 Bacteria 1692
41 JGI24735J21928_10002484 3300002067 Bacteria 6399
42 JGI24735J21928_10009345 3300002067 Bacteria 3150
43 JGI24735J21928_10009748 3300002067 Bacteria 3077
44 JGI24735J21928_10022329 3300002067 Bacteria 1928
45 JGI24735J21928_10037095 3300002067 Bacteria 1429
46 JGI24735J21928_10037412 3300002067 Bacteria 1423
47 JGI24735J21928_10046901 3300002067 Bacteria 1253
48 JGI24735J21928_10089369 3300002067 Bacteria 883
49 JGI24735J21928_10091937 3300002067 Bacteria 870
50 JGI24750J21931_1000571 3300002070 Bacteria 5646
51 JGI24748J21848_1000029 3300002074 Bacteria 90134
52 JGI24738J21930_10001262 3300002075 Bacteria 7103
53 JGI24738J21930_10001427 3300002075 Bacteria 6629
54 JGI24738J21930_10003000 3300002075 Bacteria 4313
55 JGI24738J21930_10004129 3300002075 Bacteria 3580
56 JGI24738J21930_10005863 3300002075 Bacteria 2919
57 JGI24738J21930_10011719 3300002075 Bacteria 1924
58 JGI24738J21930_10019475 3300002075 Bacteria 1414
59 JGI24749J21850_1000261 3300002076 Bacteria 8195
60 JGI24744J21845_10005812 3300002077 Bacteria 2556
61 JGI24034J26672_10000006 3300002239 Bacteria 294495
62 JGI24742J22300_10002400 3300002244 Bacteria 3005
63 JGI24742J22300_10014313 3300002244 Bacteria 1333
64 JGI24751J29686_10012811 3300002459 Bacteria 1730
65 JGI25164J39214_1008973 3300002772 Bacteria 990
66 JGI25150J39212_1000596 3300002774 Bacteria 14118
67 JGI25150J39212_1018431 3300002774 Bacteria 1110
68 JGI25151J46595_10013195 3300003187 Bacteria 3727
69 JGI25406J46586_10102049 3300003203 Bacteria 855
70 JGI25165J46597_1000053 3300003214 Bacteria 235857
71 JGI25165J46597_1000165 3300003214 Bacteria 104009
72 JGI25153J46596_10000006 3300003215 Bacteria 447760
73 JGI25153J46596_10000017 3300003215 Bacteria 274325
74 JGI25153J46596_10025162 3300003215 Bacteria 2132
75 rootH1_10012727 3300003316 Bacteria 3005
76 Ga0007429J51699_1036535 3300003579 Bacteria 1230
77 Ga0055525_1000040 3300003759 Bacteria 286933
78 Ga0055542_1000078 3300003762 Bacteria 131147
79 Ga0055542_1000791 3300003762 Bacteria 23476
80 Ga0055542_1009231 3300003762 Bacteria 1874
81 Ga0055529_1000007 3300003763 Bacteria 403604
82 Ga0055529_1006108 3300003763 Bacteria 1702
83 Ga0055526_1004025 3300003771 Bacteria 9032
84 Ga0055526_1041573 3300003771 Bacteria 1144
85 Ga0055537_1000962 3300003773 Bacteria 13166
86 Ga0055537_1003028 3300003773 Bacteria 5308
87 Ga0055524_1000452 3300003775 Bacteria 33994
88 Ga0055536_1017681 3300003781 Bacteria 2321
89 Ga0055530_10005445 3300003791 Bacteria 6047
90 Ga0055530_10009326 3300003791 Bacteria 3788
91 Ga0055540_1001980 3300003792 Bacteria 11454
92 Ga0055531_10000008 3300003794 Bacteria 222269
93 Ga0055531_10028572 3300003794 Bacteria 1919
94 Ga0065165_1002723 3300005262 Bacteria 14137
95 Ga0065165_1005838 3300005262 Bacteria 6705
96 Ga0065165_1007422 3300005262 Bacteria 5388
97 Ga0065165_1033397 3300005262 Bacteria 1602
98 Ga0065714_10076962 3300005288 Bacteria 2737
99 Ga0065704_10000743 3300005289 Bacteria 24338
100 Ga0065704_10153439 3300005289 Bacteria 1410
101 Ga0065704_10274314 3300005289 Bacteria 935
102 Ga0065715_10098195 3300005293 Bacteria 3583
103 Ga0065707_10083015 3300005295 Bacteria 10847
104 Ga0065707_10099471 3300005295 Bacteria 3003
105 Ga0070658_10007219 3300005327 Bacteria 8967
106 Ga0070658_10017258 3300005327 Bacteria 5777
107 Ga0070658_10019971 3300005327 Bacteria 5366
108 Ga0070658_10023993 3300005327 Bacteria 4895
109 Ga0070658_10033532 3300005327 Bacteria 4131
110 Ga0070658_10045216 3300005327 Bacteria 3560
111 Ga0070658_10046129 3300005327 Bacteria 3526
112 Ga0070658_10059369 3300005327 Bacteria 3114
113 Ga0070658_10100378 3300005327 Bacteria 2392
114 Ga0070658_10108359 3300005327 Bacteria 2299
115 Ga0070658_10167078 3300005327 Bacteria 1847
116 Ga0070658_10261987 3300005327 Bacteria 1468
117 Ga0070658_10362812 3300005327 Bacteria 1241
118 Ga0070658_10426160 3300005327 Bacteria 1141
119 Ga0070658_10426804 3300005327 Bacteria 1140
120 Ga0070658_10442405 3300005327 Bacteria 1119
121 Ga0070658_10474341 3300005327 Bacteria 1079
122 Ga0070676_10003637 3300005328 Bacteria 8065
123 Ga0070676_10004126 3300005328 Bacteria 7630
124 Ga0070676_10073929 3300005328 Bacteria 2051
125 Ga0070676_10078205 3300005328 Bacteria 2001
126 Ga0070676_10212087 3300005328 Bacteria 1275
127 Ga0070683_100057532 3300005329 Bacteria 3612
128 Ga0070683_100107355 3300005329 Bacteria 2632
129 Ga0070683_100126568 3300005329 Bacteria 2415
130 Ga0070683_100155367 3300005329 Bacteria 2170
131 Ga0070683_100232054 3300005329 Bacteria 1754
132 Ga0070683_100330394 3300005329 Bacteria 1451
133 Ga0070683_100491192 3300005329 Bacteria 1172
134 Ga0070683_100930702 3300005329 Bacteria 834
135 Ga0070690_100000002 3300005330 Bacteria 176748
136 Ga0070690_100010584 3300005330 Bacteria 5373
137 Ga0070690_100010994 3300005330 Bacteria 5284
138 Ga0070670_100005828 3300005331 Bacteria 10416
139 Ga0070670_100026630 3300005331 Bacteria 4974
140 Ga0070670_100029191 3300005331 Bacteria 4746
141 Ga0070670_100035587 3300005331 Bacteria 4285
142 Ga0070670_100070080 3300005331 Bacteria 3010
143 Ga0070670_100304119 3300005331 Bacteria 1395
144 Ga0070670_100673807 3300005331 Bacteria 929
145 Ga0070670_100705091 3300005331 Bacteria 908
146 Ga0070670_101037334 3300005331 Bacteria 746
147 Ga0070677_10008070 3300005333 Bacteria 3531
148 Ga0070677_10011538 3300005333 Bacteria 3050
149 Ga0070677_10012863 3300005333 Bacteria 2913
150 Ga0068869_100000225 3300005334 Bacteria 29577
151 Ga0068869_100000237 3300005334 Bacteria 29089
152 Ga0068869_100092294 3300005334 Bacteria 2279
153 Ga0070666_10000002 3300005335 Bacteria 478684
154 Ga0070666_10002523 3300005335 Bacteria 11076
155 Ga0070666_10023981 3300005335 Bacteria 3972
156 Ga0070666_10025521 3300005335 Bacteria 3853
157 Ga0070666_10131460 3300005335 Bacteria 1740
158 Ga0070666_10578448 3300005335 Bacteria 818
159 Ga0070666_10867401 3300005335 Bacteria 667
160 Ga0070680_100006563 3300005336 Bacteria 8850
161 Ga0070680_100028716 3300005336 Bacteria 4464
162 Ga0070680_100084875 3300005336 Bacteria 2615
163 Ga0070680_100098387 3300005336 Bacteria 2426
164 Ga0070680_100122358 3300005336 Bacteria 2172
165 Ga0070680_100295689 3300005336 Bacteria 1373
166 Ga0070682_100145093 3300005337 Bacteria 1623
167 Ga0070682_100326363 3300005337 Bacteria 1136
168 Ga0070682_100366686 3300005337 Bacteria 1079
169 Ga0070682_100594706 3300005337 Bacteria 873
170 Ga0068868_100000013 3300005338 Bacteria 110536
171 Ga0068868_100001197 3300005338 Bacteria 17815
172 Ga0068868_100002570 3300005338 Bacteria 12598
173 Ga0068868_100059688 3300005338 Bacteria 3018
174 Ga0068868_100084629 3300005338 Bacteria 2547
175 Ga0068868_100530864 3300005338 Bacteria 1034
176 Ga0068868_100677396 3300005338 Bacteria 920
177 Ga0070660_100006734 3300005339 Bacteria 7973
178 Ga0070660_100011916 3300005339 Bacteria 6202
179 Ga0070660_100012723 3300005339 Bacteria 6016
180 Ga0070660_100012788 3300005339 Bacteria 6001
181 Ga0070660_100017639 3300005339 Bacteria 5205
182 Ga0070660_100023713 3300005339 Bacteria 4548
183 Ga0070660_100030095 3300005339 Bacteria 4071
184 Ga0070660_100044682 3300005339 Bacteria 3389
185 Ga0070660_100066481 3300005339 Bacteria 2806
186 Ga0070660_100119371 3300005339 Bacteria 2103
187 Ga0070660_100174346 3300005339 Bacteria 1738
188 Ga0070660_100185020 3300005339 Bacteria 1686
189 Ga0070660_100243707 3300005339 Bacteria 1465
190 Ga0070689_100754861 3300005340 Bacteria 853
191 Ga0070691_10000673 3300005341 Bacteria 13295
192 Ga0070687_100200798 3300005343 Bacteria 1208
193 Ga0070661_100008588 3300005344 Bacteria 7063
194 Ga0070661_100011642 3300005344 Bacteria 6133
195 Ga0070661_100014173 3300005344 Bacteria 5614
196 Ga0070661_100016317 3300005344 Bacteria 5249
197 Ga0070661_100020121 3300005344 Bacteria 4758
198 Ga0070661_100035691 3300005344 Bacteria 3612
199 Ga0070661_100043002 3300005344 Bacteria 3299
200 Ga0070661_100054342 3300005344 Bacteria 2933
201 Ga0070661_100069336 3300005344 Bacteria 2592
202 Ga0070661_100072020 3300005344 Bacteria 2543
203 Ga0070661_100089673 3300005344 Bacteria 2277
204 Ga0070661_100108498 3300005344 Bacteria 2071
205 Ga0070661_100140882 3300005344 Bacteria 1817
206 Ga0070661_100159968 3300005344 Bacteria 1705
207 Ga0070661_100188976 3300005344 Bacteria 1570
208 Ga0070661_100213332 3300005344 Bacteria 1478
209 Ga0070661_100398033 3300005344 Bacteria 1088
210 Ga0070661_100584682 3300005344 Bacteria 901
211 Ga0070661_100628744 3300005344 Bacteria 870
212 Ga0070692_10002334 3300005345 Bacteria 7323
213 Ga0070692_10022048 3300005345 Bacteria 3106
214 Ga0070668_100023073 3300005347 Bacteria 4703
215 Ga0070668_100045056 3300005347 Bacteria 3384
216 Ga0070668_100052544 3300005347 Bacteria 3140
217 Ga0070668_100094565 3300005347 Bacteria 2359
218 Ga0070668_100227246 3300005347 Bacteria 1541
219 Ga0070669_100000078 3300005353 Bacteria 94641
220 Ga0070669_100008277 3300005353 Bacteria 7424
221 Ga0070669_100061781 3300005353 Bacteria 2754
222 Ga0070669_100140188 3300005353 Bacteria 1863
223 Ga0070669_100236194 3300005353 Bacteria 1451
224 Ga0070669_100301660 3300005353 Bacteria 1288
225 Ga0070669_100378276 3300005353 Bacteria 1154
226 Ga0070669_100564065 3300005353 Bacteria 950
227 Ga0070675_100006462 3300005354 Bacteria 8999
228 Ga0070671_100001626 3300005355 Bacteria 16939
229 Ga0070671_100011784 3300005355 Bacteria 7033
230 Ga0070671_100014039 3300005355 Bacteria 6467
231 Ga0070671_100026211 3300005355 Bacteria 4789
232 Ga0070671_100030708 3300005355 Bacteria 4434
233 Ga0070671_100060274 3300005355 Bacteria 3160
234 Ga0070671_100084165 3300005355 Bacteria 2660
235 Ga0070671_100095853 3300005355 Bacteria 2487
236 Ga0070671_100131669 3300005355 Bacteria 2106
237 Ga0070671_100182805 3300005355 Bacteria 1775
238 Ga0070671_100541354 3300005355 Bacteria 1004
239 Ga0070674_100003736 3300005356 Bacteria 8585
240 Ga0070674_100044508 3300005356 Bacteria 3027
241 Ga0070674_100062222 3300005356 Bacteria 2608
242 Ga0070674_100080452 3300005356 Bacteria 2326
243 Ga0070674_100102304 3300005356 Bacteria 2089
244 Ga0070674_100629632 3300005356 Bacteria 910
245 Ga0070673_100000002 3300005364 Bacteria 225084
246 Ga0070673_100000113 3300005364 Bacteria 37191
247 Ga0070673_100021007 3300005364 Bacteria 4722
248 Ga0070673_100029419 3300005364 Bacteria 4096
249 Ga0070673_100033993 3300005364 Bacteria 3853
250 Ga0070673_100143519 3300005364 Bacteria 2016
251 Ga0070673_100149747 3300005364 Bacteria 1975
252 Ga0070673_100152269 3300005364 Bacteria 1959
253 Ga0070673_100230244 3300005364 Bacteria 1607
254 Ga0070688_100010565 3300005365 Bacteria 5097
255 Ga0070659_100003603 3300005366 Bacteria 11022
256 Ga0070659_100003637 3300005366 Bacteria 10982
257 Ga0070659_100003958 3300005366 Bacteria 10541
258 Ga0070659_100007496 3300005366 Bacteria 7928
259 Ga0070659_100007614 3300005366 Bacteria 7872
260 Ga0070659_100014821 3300005366 Bacteria 5829
261 Ga0070659_100036603 3300005366 Bacteria 3826
262 Ga0070659_100060491 3300005366 Bacteria 2992
263 Ga0070659_100076677 3300005366 Bacteria 2665
264 Ga0070659_100129735 3300005366 Bacteria 2046
265 Ga0070659_100159504 3300005366 Bacteria 1844
266 Ga0070659_100194843 3300005366 Bacteria 1666
267 Ga0070659_100222148 3300005366 Bacteria 1559
268 Ga0070659_100251614 3300005366 Bacteria 1464
269 Ga0070659_100255325 3300005366 Bacteria 1453
270 Ga0070659_100456606 3300005366 Bacteria 1084
271 Ga0070659_100710208 3300005366 Bacteria 870
272 Ga0070659_100974101 3300005366 Bacteria 744
273 Ga0070667_100007592 3300005367 Bacteria 8992
274 Ga0070667_100008122 3300005367 Bacteria 8703
275 Ga0070667_100011649 3300005367 Bacteria 7270
276 Ga0070667_100040063 3300005367 Bacteria 3928
277 Ga0070667_100044428 3300005367 Bacteria 3731
278 Ga0070667_100177674 3300005367 Bacteria 1882
279 Ga0070667_100231273 3300005367 Bacteria 1648
280 Ga0070667_100324669 3300005367 Bacteria 1389
281 Ga0070667_100378489 3300005367 Bacteria 1285
282 Ga0070667_100650041 3300005367 Bacteria 973
283 Ga0070667_100723454 3300005367 Bacteria 922
284 Ga0070714_100010147 3300005435 Bacteria 7434
285 Ga0070714_100106803 3300005435 Bacteria 2474
286 Ga0070714_100108202 3300005435 Bacteria 2457
287 Ga0070714_100136912 3300005435 Bacteria 2194
288 Ga0070714_100547661 3300005435 Bacteria 1107
289 Ga0070714_100633533 3300005435 Bacteria 1028
290 Ga0070713_100154621 3300005436 Bacteria 2043
291 Ga0070713_101275045 3300005436 Bacteria 712
292 Ga0070694_100114028 3300005444 Bacteria 1929
293 Ga0070663_100001785 3300005455 Bacteria 11967
294 Ga0070663_100002614 3300005455 Bacteria 10182
295 Ga0070663_100035078 3300005455 Bacteria 3478
296 Ga0070663_100036804 3300005455 Bacteria 3402
297 Ga0070663_100062847 3300005455 Bacteria 2678
298 Ga0070663_100072677 3300005455 Bacteria 2507
299 Ga0070663_100074794 3300005455 Bacteria 2474
300 Ga0070663_100135948 3300005455 Bacteria 1871
301 Ga0070663_100153503 3300005455 Bacteria 1767
302 Ga0070663_100473719 3300005455 Bacteria 1035
303 Ga0070663_100673606 3300005455 Bacteria 877
304 Ga0070678_100001865 3300005456 Bacteria 11367
305 Ga0070678_100006193 3300005456 Bacteria 6994
306 Ga0070678_100006524 3300005456 Bacteria 6853
307 Ga0070678_100012935 3300005456 Bacteria 5211
308 Ga0070678_100114172 3300005456 Bacteria 2118
309 Ga0070678_100321904 3300005456 Bacteria 1321
310 Ga0070678_101079006 3300005456 Bacteria 741
311 Ga0070662_100001998 3300005457 Bacteria 12506
312 Ga0070662_100005546 3300005457 Bacteria 8062
313 Ga0070662_100006784 3300005457 Bacteria 7403
314 Ga0070662_100007277 3300005457 Bacteria 7173
315 Ga0070662_100021491 3300005457 Bacteria 4406
316 Ga0070662_100040361 3300005457 Bacteria 3322
317 Ga0070662_100081331 3300005457 Bacteria 2413
318 Ga0070662_100093220 3300005457 Bacteria 2265
319 Ga0070662_100157411 3300005457 Bacteria 1774
320 Ga0070662_100255435 3300005457 Bacteria 1410
321 Ga0070662_100427614 3300005457 Bacteria 1096
322 Ga0070662_100476600 3300005457 Bacteria 1038
323 Ga0070662_100515641 3300005457 Bacteria 998
324 Ga0070662_100894096 3300005457 Bacteria 757
325 Ga0070681_10013052 3300005458 Bacteria 8249
326 Ga0070681_10053445 3300005458 Bacteria 4025
327 Ga0070681_10229528 3300005458 Bacteria 1770
328 Ga0070681_10437426 3300005458 Bacteria 1220
329 Ga0070681_10666781 3300005458 Bacteria 955
330 Ga0070681_10691416 3300005458 Bacteria 936
331 Ga0068867_100000012 3300005459 Bacteria 118831
332 Ga0068867_100001363 3300005459 Bacteria 16865
333 Ga0068867_100041848 3300005459 Bacteria 3348
334 Ga0068867_100119211 3300005459 Bacteria 2037
335 Ga0068867_100172524 3300005459 Bacteria 1714
336 Ga0068867_100193077 3300005459 Bacteria 1626
337 Ga0068867_100339272 3300005459 Bacteria 1251
338 Ga0070685_10000056 3300005466 Bacteria 68183
339 Ga0070685_10185584 3300005466 Bacteria 1342
340 Ga0070679_100035071 3300005530 Bacteria 4976
341 Ga0070679_100036988 3300005530 Bacteria 4846
342 Ga0070679_100046887 3300005530 Bacteria 4308
343 Ga0070679_100139319 3300005530 Bacteria 2406
344 Ga0070679_100181563 3300005530 Bacteria 2076
345 Ga0070679_100419492 3300005530 Bacteria 1284
346 Ga0070679_100545200 3300005530 Bacteria 1103
347 Ga0070679_100564692 3300005530 Bacteria 1081
348 Ga0070684_100080997 3300005535 Bacteria 2872
349 Ga0070684_100089976 3300005535 Bacteria 2728
350 Ga0070684_100411618 3300005535 Bacteria 1247
351 Ga0068853_100001253 3300005539 Bacteria 18134
352 Ga0068853_100001390 3300005539 Bacteria 17494
353 Ga0068853_100008536 3300005539 Bacteria 8235
354 Ga0068853_100032065 3300005539 Bacteria 4449
355 Ga0068853_100034610 3300005539 Bacteria 4288
356 Ga0068853_100041927 3300005539 Bacteria 3911
357 Ga0068853_100044210 3300005539 Bacteria 3812
358 Ga0068853_100095002 3300005539 Bacteria 2628
359 Ga0068853_100136236 3300005539 Bacteria 2201
360 Ga0068853_100168375 3300005539 Bacteria 1981
361 Ga0068853_100302858 3300005539 Bacteria 1478
362 Ga0068853_100353936 3300005539 Bacteria 1366
363 Ga0068853_100418229 3300005539 Bacteria 1257
364 Ga0068853_100574269 3300005539 Bacteria 1069
365 Ga0068853_100905068 3300005539 Bacteria 847
366 Ga0070672_100034757 3300005543 Bacteria 3827
367 Ga0070672_100052000 3300005543 Bacteria 3197
368 Ga0070672_100093351 3300005543 Bacteria 2431
369 Ga0070672_100322334 3300005543 Bacteria 1314
370 Ga0070672_100336119 3300005543 Bacteria 1285
371 Ga0070672_100524245 3300005543 Bacteria 1027
372 Ga0070672_100641005 3300005543 Bacteria 927
373 Ga0070686_100000002 3300005544 Bacteria 336303
374 Ga0070686_100030015 3300005544 Bacteria 3313
375 Ga0070686_100052566 3300005544 Bacteria 2598
376 Ga0070686_100339924 3300005544 Bacteria 1125
377 Ga0070695_100072948 3300005545 Bacteria 2252
378 Ga0070696_100125082 3300005546 Bacteria 1865
379 Ga0070696_100595710 3300005546 Bacteria 891
380 Ga0070696_100726468 3300005546 Bacteria 812
381 Ga0070693_100087267 3300005547 Bacteria 1873
382 Ga0070693_100158225 3300005547 Bacteria 1440
383 Ga0070693_100187534 3300005547 Bacteria 1335
384 Ga0070665_100000025 3300005548 Bacteria 367488
385 Ga0070665_100003898 3300005548 Bacteria 15768
386 Ga0070665_100004114 3300005548 Bacteria 15302
387 Ga0070665_100008348 3300005548 Bacteria 10477
388 Ga0070665_100014696 3300005548 Bacteria 7854
389 Ga0070665_100100753 3300005548 Bacteria 2893
390 Ga0070665_100244808 3300005548 Bacteria 1794
391 Ga0070665_100286359 3300005548 Bacteria 1650
392 Ga0070665_100999570 3300005548 Bacteria 849
393 Ga0070704_100375178 3300005549 Bacteria 1207
394 Ga0068855_100003124 3300005563 Bacteria 20269
395 Ga0068855_100005719 3300005563 Bacteria 15182
396 Ga0068855_100046618 3300005563 Bacteria 5123
397 Ga0068855_100098889 3300005563 Bacteria 3360
398 Ga0068855_100204747 3300005563 Bacteria 2220
399 Ga0068855_100225629 3300005563 Bacteria 2099
400 Ga0068855_100273721 3300005563 Bacteria 1877
401 Ga0068855_100315702 3300005563 Bacteria 1728
402 Ga0068855_100372072 3300005563 Bacteria 1570
403 Ga0068855_100386202 3300005563 Bacteria 1536
404 Ga0068855_100414184 3300005563 Bacteria 1475
405 Ga0068855_100633198 3300005563 Bacteria 1150
406 Ga0068855_100881370 3300005563 Bacteria 946
407 Ga0068855_100981388 3300005563 Bacteria 888
408 Ga0068855_101091374 3300005563 Bacteria 835
409 Ga0070664_100016140 3300005564 Bacteria 6120
410 Ga0070664_100022762 3300005564 Bacteria 5169
411 Ga0070664_100024836 3300005564 Bacteria 4963
412 Ga0070664_100026135 3300005564 Bacteria 4841
413 Ga0070664_100034407 3300005564 Bacteria 4250
414 Ga0070664_100042114 3300005564 Bacteria 3855
415 Ga0070664_100046135 3300005564 Bacteria 3680
416 Ga0070664_100051211 3300005564 Bacteria 3496
417 Ga0070664_100054109 3300005564 Bacteria 3405
418 Ga0070664_100055976 3300005564 Bacteria 3351
419 Ga0070664_100076181 3300005564 Bacteria 2882
420 Ga0070664_100079137 3300005564 Bacteria 2829
421 Ga0070664_100098785 3300005564 Bacteria 2536
422 Ga0070664_100128768 3300005564 Bacteria 2222
423 Ga0070664_100135308 3300005564 Bacteria 2167
424 Ga0070664_100254373 3300005564 Bacteria 1579
425 Ga0070664_100258121 3300005564 Bacteria 1568
426 Ga0070664_100412830 3300005564 Bacteria 1235
427 Ga0070664_100485328 3300005564 Bacteria 1137
428 Ga0068857_100000736 3300005577 Bacteria 24396
429 Ga0068857_100006657 3300005577 Bacteria 9929
430 Ga0068857_100015256 3300005577 Bacteria 6706
431 Ga0068857_100049513 3300005577 Bacteria 3727
432 Ga0068857_100067292 3300005577 Bacteria 3188
433 Ga0068857_100086426 3300005577 Bacteria 2804
434 Ga0068857_100102735 3300005577 Bacteria 2566
435 Ga0068857_100174580 3300005577 Bacteria 1954
436 Ga0068857_100181248 3300005577 Bacteria 1917
437 Ga0068857_100183849 3300005577 Bacteria 1902
438 Ga0068857_100255432 3300005577 Bacteria 1607
439 Ga0068857_100283080 3300005577 Bacteria 1525
440 Ga0068857_100512624 3300005577 Bacteria 1127
441 Ga0068854_100000306 3300005578 Bacteria 32300
442 Ga0068854_100001981 3300005578 Bacteria 12524
443 Ga0068854_100004380 3300005578 Bacteria 8905
444 Ga0068854_100005946 3300005578 Bacteria 7732
445 Ga0068854_100028745 3300005578 Bacteria 3844
446 Ga0068854_100050137 3300005578 Bacteria 2985
447 Ga0068854_100056103 3300005578 Bacteria 2838
448 Ga0068854_100108056 3300005578 Bacteria 2094
449 Ga0068854_100157827 3300005578 Bacteria 1754
450 Ga0068854_100176807 3300005578 Bacteria 1665
451 Ga0068854_100183145 3300005578 Bacteria 1637
452 Ga0068854_100193076 3300005578 Bacteria 1596
453 Ga0068854_100284143 3300005578 Bacteria 1333
454 Ga0068854_100286311 3300005578 Bacteria 1328
455 Ga0068854_100291170 3300005578 Bacteria 1318
456 Ga0068854_100300913 3300005578 Bacteria 1297
457 Ga0068854_100407423 3300005578 Bacteria 1126
458 Ga0068856_100007389 3300005614 Bacteria 10725
459 Ga0068856_100013594 3300005614 Bacteria 7878
460 Ga0068856_100038415 3300005614 Bacteria 4700
461 Ga0068856_100038930 3300005614 Bacteria 4668
462 Ga0068856_100041186 3300005614 Bacteria 4538
463 Ga0068856_100079590 3300005614 Bacteria 3250
464 Ga0068856_100103666 3300005614 Bacteria 2838
465 Ga0068856_100118846 3300005614 Bacteria 2644
466 Ga0068856_100135858 3300005614 Bacteria 2464
467 Ga0068856_100137688 3300005614 Bacteria 2447
468 Ga0068856_100241818 3300005614 Bacteria 1820
469 Ga0068856_100331344 3300005614 Bacteria 1540
470 Ga0068856_100338459 3300005614 Bacteria 1523
471 Ga0068856_100671866 3300005614 Bacteria 1056
472 Ga0068856_100705216 3300005614 Bacteria 1029
473 Ga0068856_101126795 3300005614 Bacteria 802
474 Ga0068856_101323769 3300005614 Bacteria 735
475 Ga0068856_101438005 3300005614 Bacteria 704
476 Ga0068852_100001648 3300005616 Bacteria 15244
477 Ga0068852_100010470 3300005616 Bacteria 6934
478 Ga0068852_100014770 3300005616 Bacteria 6028
479 Ga0068852_100016593 3300005616 Bacteria 5750
480 Ga0068852_100043248 3300005616 Bacteria 3819
481 Ga0068852_100044260 3300005616 Bacteria 3779
482 Ga0068852_100046086 3300005616 Bacteria 3713
483 Ga0068852_100054789 3300005616 Bacteria 3439
484 Ga0068852_100061149 3300005616 Bacteria 3272
485 Ga0068852_100081898 3300005616 Bacteria 2866
486 Ga0068852_100194808 3300005616 Bacteria 1914
487 Ga0068852_100232945 3300005616 Bacteria 1756
488 Ga0068852_100235773 3300005616 Bacteria 1746
489 Ga0068852_100256428 3300005616 Bacteria 1677
490 Ga0068852_100257697 3300005616 Bacteria 1674
491 Ga0068852_100458313 3300005616 Bacteria 1263
492 Ga0068852_100465834 3300005616 Bacteria 1253
493 Ga0068852_100475867 3300005616 Bacteria 1240
494 Ga0068852_100508471 3300005616 Bacteria 1200
495 Ga0068852_100545318 3300005616 Bacteria 1159
496 Ga0068852_101093148 3300005616 Bacteria 817
497 Ga0068859_100000689 3300005617 Bacteria 33880
498 Ga0068859_100001164 3300005617 Bacteria 26886
499 Ga0068859_100002480 3300005617 Bacteria 18766
500 Ga0068859_100032129 3300005617 Bacteria 5272
501 Ga0068859_100046919 3300005617 Bacteria 4338
502 Ga0068859_100109007 3300005617 Bacteria 2830
503 Ga0068859_100161272 3300005617 Bacteria 2321
504 Ga0068859_100407607 3300005617 Bacteria 1455
505 Ga0068859_100428816 3300005617 Bacteria 1419
506 Ga0068859_100648769 3300005617 Bacteria 1148
507 Ga0068859_101087852 3300005617 Bacteria 879
508 Ga0068864_100000764 3300005618 Bacteria 27049
509 Ga0068864_100001152 3300005618 Bacteria 21995
510 Ga0068864_100004561 3300005618 Bacteria 11373
511 Ga0068864_100007092 3300005618 Bacteria 9202
512 Ga0068864_100041416 3300005618 Bacteria 3939
513 Ga0068864_100065993 3300005618 Bacteria 3140
514 Ga0068864_100076147 3300005618 Bacteria 2931
515 Ga0068864_100114253 3300005618 Bacteria 2407
516 Ga0068864_100123463 3300005618 Bacteria 2318
517 Ga0068864_100295414 3300005618 Bacteria 1515
518 Ga0068866_10031178 3300005718 Bacteria 2565
519 Ga0068866_10129524 3300005718 Bacteria 1433
520 Ga0068866_10326062 3300005718 Bacteria 968
521 Ga0068861_100000005 3300005719 Bacteria 101677
522 Ga0068861_100003714 3300005719 Bacteria 10185
523 Ga0068861_100087199 3300005719 Bacteria 2456
524 Ga0068861_100123824 3300005719 Bacteria 2089
525 Ga0068861_100576059 3300005719 Bacteria 1029
526 Ga0068861_100876984 3300005719 Bacteria 848
527 Ga0068851_10001992 3300005834 Bacteria 8993
528 Ga0068851_10006539 3300005834 Bacteria 5324
529 Ga0068851_10012700 3300005834 Bacteria 3976
530 Ga0068851_10016068 3300005834 Bacteria 3576
531 Ga0068851_10017185 3300005834 Bacteria 3470
532 Ga0068851_10060597 3300005834 Bacteria 1938
533 Ga0068851_10079544 3300005834 Bacteria 1710
534 Ga0068870_10062275 3300005840 Bacteria 2009
535 Ga0068870_10317466 3300005840 Bacteria 989
536 Ga0068863_100000070 3300005841 Bacteria 115715
537 Ga0068863_100003743 3300005841 Bacteria 15048
538 Ga0068863_100009132 3300005841 Bacteria 9682
539 Ga0068863_100012748 3300005841 Bacteria 8107
540 Ga0068863_100020017 3300005841 Bacteria 6400
541 Ga0068863_100031670 3300005841 Bacteria 5046
542 Ga0068858_100000956 3300005842 Bacteria 29895
543 Ga0068858_100005166 3300005842 Bacteria 12785
544 Ga0068858_100006215 3300005842 Bacteria 11641
545 Ga0068858_100008940 3300005842 Bacteria 9601
546 Ga0068858_100031031 3300005842 Bacteria 4963
547 Ga0068858_100039796 3300005842 Bacteria 4358
548 Ga0068858_100111521 3300005842 Bacteria 2555
549 Ga0068858_100137772 3300005842 Bacteria 2291
550 Ga0068858_100516657 3300005842 Bacteria 1155
551 Ga0068860_100000001 3300005843 Bacteria 703043
552 Ga0068860_100006578 3300005843 Bacteria 11669
553 Ga0068860_100124167 3300005843 Bacteria 2474
554 Ga0068860_100201974 3300005843 Bacteria 1926
555 Ga0068860_100204294 3300005843 Bacteria 1915
556 Ga0068860_100214794 3300005843 Bacteria 1866
557 Ga0068860_100236066 3300005843 Bacteria 1778
558 Ga0068862_100000020 3300005844 Bacteria 219516
559 Ga0068862_100000702 3300005844 Bacteria 34174
560 Ga0068862_100001089 3300005844 Bacteria 25856
561 Ga0068862_100005835 3300005844 Bacteria 10261
562 Ga0068862_100824275 3300005844 Bacteria 907
563 Ga0081455_10000477 3300005937 Bacteria 51914
564 Ga0081540_1078141 3300005983 Bacteria 1501
565 Ga0081539_10008339 3300005985 Bacteria 9056
566 Ga0081539_10040401 3300005985 Bacteria 2738
567 Ga0081539_10063450 3300005985 Bacteria 2016
568 Ga0081539_10120854 3300005985 Bacteria 1301
569 Ga0070717_10010182 3300006028 Bacteria 7080
570 Ga0075368_10000465 3300006042 Bacteria 12005
571 Ga0075364_10191074 3300006051 Bacteria 1387
572 Ga0070716_100207191 3300006173 Bacteria 1308
573 Ga0070712_100284140 3300006175 Bacteria 1334
574 Ga0075367_10000528 3300006178 Bacteria 14436
575 Ga0075366_10007416 3300006195 Bacteria 6058
576 Ga0097621_100001363 3300006237 Bacteria 16799
577 Ga0097621_100014112 3300006237 Bacteria 5972
578 Ga0097621_100036110 3300006237 Bacteria 3953
579 Ga0097621_100072455 3300006237 Bacteria 2849
580 Ga0097621_100077246 3300006237 Bacteria 2764
581 Ga0097621_100628490 3300006237 Bacteria 983
582 Ga0075370_10035118 3300006353 Bacteria 2813
583 Ga0075370_10133409 3300006353 Bacteria 1450
584 Ga0068871_100004771 3300006358 Bacteria 9480
585 Ga0068871_100008587 3300006358 Bacteria 7343
586 Ga0068871_100196745 3300006358 Bacteria 1739
587 Ga0068871_100624407 3300006358 Bacteria 982
588 Ga0068871_100679875 3300006358 Bacteria 942
589 Ga0068871_100868813 3300006358 Bacteria 835
590 Ga0068865_100000004 3300006881 Bacteria 226236
591 Ga0068865_100014339 3300006881 Bacteria 5035
592 Ga0068865_100240340 3300006881 Bacteria 1425
593 Ga0068865_100382932 3300006881 Bacteria 1148
594 Ga0068865_100734278 3300006881 Bacteria 847
595 Ga0097620_100000689 3300006931 Bacteria 33880
596 Ga0097620_100001164 3300006931 Bacteria 26886
597 Ga0097620_100002480 3300006931 Bacteria 18766
598 Ga0097620_100032131 3300006931 Bacteria 5272
599 Ga0097620_100046919 3300006931 Bacteria 4338
600 Ga0097620_100109006 3300006931 Bacteria 2830
601 Ga0097620_100161278 3300006931 Bacteria 2321
602 Ga0097620_100407613 3300006931 Bacteria 1455
603 Ga0097620_100428767 3300006931 Bacteria 1419
604 Ga0097620_100648752 3300006931 Bacteria 1148
605 Ga0097620_101087752 3300006931 Bacteria 879
606 Ga0105251_10014991 3300009011 Bacteria 4253
607 Ga0105250_10014249 3300009092 Bacteria 3270
608 Ga0105250_10057796 3300009092 Bacteria 1556
609 Ga0105240_10004392 3300009093 Bacteria 21521
610 Ga0105240_10012494 3300009093 Bacteria 11718
611 Ga0105240_10016200 3300009093 Bacteria 10102
612 Ga0105240_10033235 3300009093 Bacteria 6668
613 Ga0105240_10168669 3300009093 Bacteria 2594
614 Ga0105240_10321673 3300009093 Bacteria 1763
615 Ga0105240_10332249 3300009093 Bacteria 1729
616 Ga0105240_10588465 3300009093 Bacteria 1227
617 Ga0105240_10854143 3300009093 Bacteria 982
618 Ga0105245_10000195 3300009098 Bacteria 57594
619 Ga0105245_10000275 3300009098 Bacteria 48749
620 Ga0105245_10026400 3300009098 Bacteria 5112
621 Ga0105247_10005531 3300009101 Bacteria 7948
622 Ga0114129_10214530 3300009147 Bacteria 2600
623 Ga0105243_10000146 3300009148 Bacteria 81008
624 Ga0105243_10000164 3300009148 Bacteria 75666
625 Ga0105243_10215368 3300009148 Bacteria 1694
626 Ga0105243_10270691 3300009148 Bacteria 1525
627 Ga0105243_10349110 3300009148 Bacteria 1358
628 Ga0105243_10358991 3300009148 Bacteria 1340
629 Ga0105241_10047496 3300009174 Bacteria 3265
630 Ga0105241_10076161 3300009174 Bacteria 2615
631 Ga0105241_10233554 3300009174 Bacteria 1551
632 Ga0105241_10305373 3300009174 Bacteria 1367
633 Ga0105241_10359582 3300009174 Bacteria 1266
634 Ga0105241_11135356 3300009174 Bacteria 737
635 Ga0105242_10000943 3300009176 Bacteria 22683
636 Ga0105242_10173450 3300009176 Bacteria 1897
637 Ga0105242_10750569 3300009176 Bacteria 960
638 Ga0105248_10002856 3300009177 Bacteria 19172
639 Ga0105248_10003607 3300009177 Bacteria 17159
640 Ga0105248_10012759 3300009177 Bacteria 9269
641 Ga0105248_10018539 3300009177 Bacteria 7693
642 Ga0105248_10023059 3300009177 Bacteria 6913
643 Ga0105248_10253631 3300009177 Bacteria 1980
644 Ga0105248_10350942 3300009177 Bacteria 1661
645 Ga0105248_10358555 3300009177 Bacteria 1641
646 Ga0105248_10733694 3300009177 Bacteria 1115
647 Ga0105237_10015881 3300009545 Bacteria 7829
648 Ga0105237_10018056 3300009545 Bacteria 7306
649 Ga0105237_10019254 3300009545 Bacteria 7050
650 Ga0105237_10027667 3300009545 Bacteria 5782
651 Ga0105237_10057560 3300009545 Bacteria 3890
652 Ga0105237_10194946 3300009545 Bacteria 2025
653 Ga0105237_10410907 3300009545 Bacteria 1358
654 Ga0105237_10621132 3300009545 Bacteria 1087
655 Ga0105238_10030198 3300009551 Bacteria 5515
656 Ga0105238_10032364 3300009551 Bacteria 5321
657 Ga0105238_10032773 3300009551 Bacteria 5287
658 Ga0105238_10148934 3300009551 Bacteria 2316
659 Ga0105238_10302540 3300009551 Bacteria 1583
660 Ga0105238_10361224 3300009551 Bacteria 1442
661 Ga0105238_10521334 3300009551 Bacteria 1191
662 Ga0105238_10546078 3300009551 Bacteria 1163
663 Ga0105249_10000005 3300009553 Bacteria 362467
664 Ga0105249_10000097 3300009553 Bacteria 120886
665 Ga0105249_10019285 3300009553 Bacteria 6082
666 Ga0105249_10028412 3300009553 Bacteria 5048
667 Ga0105249_10053425 3300009553 Bacteria 3693
668 Ga0105249_10061804 3300009553 Bacteria 3437
669 Ga0105249_10432012 3300009553 Bacteria 1353
670 Ga0105249_10491226 3300009553 Bacteria 1271
671 Ga0105249_10580497 3300009553 Bacteria 1174
672 Ga0105249_10903603 3300009553 Bacteria 950
673 Ga0105249_11132944 3300009553 Bacteria 853
674 Ga0105249_11379244 3300009553 Bacteria 777
675 Ga0105239_10000104 3300010375 Bacteria 117927
676 Ga0105239_10055897 3300010375 Bacteria 4330
677 Ga0105239_10145471 3300010375 Bacteria 2643
678 Ga0105239_10214248 3300010375 Bacteria 2159
679 Ga0105239_10474092 3300010375 Bacteria 1421
680 Ga0105239_10897375 3300010375 Bacteria 1017
681 Ga0105239_10908296 3300010375 Bacteria 1011
682 Ga0105239_10926436 3300010375 Bacteria 1000
683 Ga0105246_10004302 3300011119 Bacteria 8660
684 Ga0105246_10151641 3300011119 Bacteria 1755
685 Ga0105246_10255540 3300011119 Bacteria 1393
686 Ga0105246_10421353 3300011119 Bacteria 1114
687 Ga0105246_10622155 3300011119 Bacteria 936
688 Ga0157317_1000906 3300012475 Bacteria 1464
689 Ga0157327_1008778 3300012512 Bacteria 914
690 Ga0157373_10026426 3300013100 Bacteria 4193
691 Ga0157373_10039540 3300013100 Bacteria 3377
692 Ga0157373_10085128 3300013100 Bacteria 2228
693 Ga0157373_10091018 3300013100 Bacteria 2148
694 Ga0157373_10091080 3300013100 Bacteria 2147
695 Ga0157373_10158216 3300013100 Bacteria 1594
696 Ga0157373_10167203 3300013100 Bacteria 1548
697 Ga0157373_10167384 3300013100 Bacteria 1547
698 Ga0157373_10177754 3300013100 Bacteria 1498
699 Ga0157373_10203758 3300013100 Bacteria 1395
700 Ga0157373_10248363 3300013100 Bacteria 1258
701 Ga0157373_10380692 3300013100 Bacteria 1009
702 Ga0157371_10000637 3300013102 Bacteria 41589
703 Ga0157371_10033519 3300013102 Bacteria 3689
704 Ga0157371_10042412 3300013102 Bacteria 3243
705 Ga0157371_10044078 3300013102 Bacteria 3178
706 Ga0157371_10044196 3300013102 Bacteria 3172
707 Ga0157371_10054017 3300013102 Bacteria 2853
708 Ga0157371_10076807 3300013102 Bacteria 2365
709 Ga0157371_10084425 3300013102 Bacteria 2249
710 Ga0157371_10110729 3300013102 Bacteria 1949
711 Ga0157371_10305919 3300013102 Bacteria 1151
712 Ga0157371_10311198 3300013102 Bacteria 1141
713 Ga0157371_10688070 3300013102 Bacteria 765
714 Ga0157370_10004829 3300013104 Bacteria 15324
715 Ga0157370_10011178 3300013104 Bacteria 9413
716 Ga0157370_10049711 3300013104 Bacteria 4012
717 Ga0157370_10069321 3300013104 Bacteria 3331
718 Ga0157370_10072786 3300013104 Bacteria 3242
719 Ga0157370_10185576 3300013104 Bacteria 1931
720 Ga0157370_10517719 3300013104 Bacteria 1095
721 Ga0157370_10668379 3300013104 Bacteria 949
722 Ga0157370_10685037 3300013104 Bacteria 936
723 Ga0157369_10008501 3300013105 Bacteria 11771
724 Ga0157369_10018433 3300013105 Bacteria 7826
725 Ga0157369_10037284 3300013105 Bacteria 5322
726 Ga0157369_10081998 3300013105 Bacteria 3451
727 Ga0157369_10090703 3300013105 Bacteria 3263
728 Ga0157369_10178401 3300013105 Bacteria 2236
729 Ga0157369_10182533 3300013105 Bacteria 2207
730 Ga0157369_10223249 3300013105 Bacteria 1971
731 Ga0157369_10231357 3300013105 Bacteria 1932
732 Ga0157369_10313222 3300013105 Bacteria 1632
733 Ga0157369_10354454 3300013105 Bacteria 1524
734 Ga0157369_10484221 3300013105 Bacteria 1280
735 Ga0157369_10525148 3300013105 Bacteria 1224
736 Ga0157369_10640820 3300013105 Bacteria 1096
737 Ga0157369_10737342 3300013105 Bacteria 1014
738 Ga0157369_10899987 3300013105 Bacteria 907
739 Ga0157374_10001738 3300013296 Bacteria 18262
740 Ga0157374_10006891 3300013296 Bacteria 9668
741 Ga0157374_10007945 3300013296 Bacteria 9061
742 Ga0157374_10040849 3300013296 Bacteria 4273
743 Ga0157374_10092230 3300013296 Bacteria 2890
744 Ga0157374_10352727 3300013296 Bacteria 1462
745 Ga0157374_11010713 3300013296 Bacteria 851
746 Ga0157378_10000408 3300013297 Bacteria 42491
747 Ga0157378_10026677 3300013297 Bacteria 5092
748 Ga0157378_10106061 3300013297 Bacteria 2570
749 Ga0157378_10330333 3300013297 Bacteria 1484
750 Ga0163162_10017714 3300013306 Bacteria 6970
751 Ga0163162_10076882 3300013306 Bacteria 3401
752 Ga0163162_10156896 3300013306 Bacteria 2396
753 Ga0163162_10188736 3300013306 Bacteria 2188
754 Ga0163162_10213629 3300013306 Bacteria 2059
755 Ga0163162_11237229 3300013306 Bacteria 848
756 Ga0157372_10010467 3300013307 Bacteria 9871
757 Ga0157372_10068515 3300013307 Bacteria 3989
758 Ga0157372_10077873 3300013307 Bacteria 3746
759 Ga0157372_10088501 3300013307 Bacteria 3516
760 Ga0157372_10162368 3300013307 Bacteria 2582
761 Ga0157372_10186145 3300013307 Bacteria 2405
762 Ga0157372_10276877 3300013307 Bacteria 1951
763 Ga0157372_10367222 3300013307 Bacteria 1677
764 Ga0157372_10386951 3300013307 Bacteria 1629
765 Ga0157372_10434655 3300013307 Bacteria 1530
766 Ga0157372_10490966 3300013307 Bacteria 1432
767 Ga0157372_10668220 3300013307 Bacteria 1210
768 Ga0157372_10718543 3300013307 Bacteria 1162
769 Ga0157372_11134075 3300013307 Bacteria 904
770 Ga0157372_11285225 3300013307 Bacteria 844
771 Ga0157375_10005342 3300013308 Bacteria 11162
772 Ga0157375_10022053 3300013308 Bacteria 5856
773 Ga0157375_10035812 3300013308 Bacteria 4742
774 Ga0157375_10061117 3300013308 Bacteria 3739
775 Ga0157375_10569314 3300013308 Bacteria 1294
776 Ga0157375_10769756 3300013308 Bacteria 1113
777 Ga0157375_11851690 3300013308 Bacteria 716
778 Ga0163163_10000500 3300014325 Bacteria 35255
779 Ga0163163_10060897 3300014325 Bacteria 3739
780 Ga0163163_10380871 3300014325 Bacteria 1468
781 Ga0157380_10000280 3300014326 Bacteria 30637
782 Ga0157380_10001415 3300014326 Bacteria 15694
783 Ga0157380_10145536 3300014326 Bacteria 2042
784 Ga0157380_10766690 3300014326 Bacteria 978
785 Ga0157380_10983633 3300014326 Bacteria 876
786 Ga0182008_10064342 3300014497 Bacteria 1806
787 Ga0157377_10001666 3300014745 Bacteria 9679
788 Ga0157377_10039898 3300014745 Bacteria 2598
789 Ga0157377_10137769 3300014745 Bacteria 1497
790 Ga0157377_10389368 3300014745 Bacteria 946
791 Ga0157377_10573703 3300014745 Bacteria 800
792 Ga0157379_10010704 3300014968 Bacteria 7993
793 Ga0157379_10034850 3300014968 Bacteria 4488
794 Ga0157379_10050088 3300014968 Bacteria 3728
795 Ga0157379_10082736 3300014968 Bacteria 2876
796 Ga0157379_10108244 3300014968 Bacteria 2495
797 Ga0157379_10319316 3300014968 Bacteria 1418
798 Ga0157376_10000128 3300014969 Bacteria 52246
799 Ga0157376_10004672 3300014969 Bacteria 9548
800 Ga0183363_1001 3300015690 Bacteria 611534
801 Ga0163161_10002791 3300017792 Bacteria 12382
802 Ga0163161_10064295 3300017792 Bacteria 2676
803 Ga0163161_10228675 3300017792 Bacteria 1443
804 Ga0163161_10333951 3300017792 Bacteria 1201
805 Ga0197907_10628569 3300020069 Bacteria 930
806 Ga0206355_1265600 3300020076 Bacteria 671
807 Ga0206355_1403083 3300020076 Bacteria 1340
808 Ga0206351_10532014 3300020077 Bacteria 660
809 Ga0206354_10542035 3300020081 Bacteria 882
810 Ga0213875_10000897 3300021388 Bacteria 21712
811 Ga0224712_10073116 3300022467 Bacteria 1398
812 Ga0207672_1000695 3300025223 Bacteria 3853
813 Ga0209674_105486 3300025226 Bacteria 1866
814 Ga0209147_100569 3300025229 Bacteria 20626
815 Ga0209563_100019 3300025230 Bacteria 697828
816 Ga0207427_100922 3300025231 Bacteria 12594
817 Ga0207425_1000022 3300025245 Bacteria 355305
818 Ga0207425_1003889 3300025245 Bacteria 4637
819 Ga0209646_1003961 3300025246 Bacteria 2793
820 Ga0209026_1001085 3300025250 Bacteria 13075
821 Ga0209026_1013778 3300025250 Bacteria 1366
822 Ga0209148_1000026 3300025254 Bacteria 629213
823 Ga0209148_1000116 3300025254 Bacteria 190078
824 Ga0209148_1004852 3300025254 Bacteria 3201
825 Ga0209129_1000525 3300025258 Bacteria 26784
826 Ga0209233_1000098 3300025261 Bacteria 294111
827 Ga0209233_1000119 3300025261 Bacteria 235924
828 Ga0209565_1000010 3300025263 Bacteria 687724
829 Ga0209565_1000100 3300025263 Bacteria 130380
830 Ga0207666_1016789 3300025271 Bacteria 1052
831 Ga0209455_1000005 3300025272 Bacteria 1416756
832 Ga0209455_1000767 3300025272 Bacteria 18024
833 Ga0209455_1034396 3300025272 Bacteria 824
834 Ga0209673_1011463 3300025273 Bacteria 3653
835 Ga0209673_1019761 3300025273 Bacteria 2408
836 Ga0209676_1009533 3300025292 Bacteria 4178
837 Ga0209025_1000842 3300025294 Bacteria 48558
838 Ga0209564_1003336 3300025295 Bacteria 11147
839 Ga0209564_1018267 3300025295 Bacteria 2683
840 Ga0209564_1028366 3300025295 Bacteria 1792
841 Ga0209758_1000001 3300025297 Bacteria 1981790
842 Ga0209758_1000004 3300025297 Bacteria 1375322
843 Ga0209758_1011966 3300025297 Bacteria 4932
844 Ga0209758_1012371 3300025297 Bacteria 4785
845 Ga0209050_1000001 3300025298 Bacteria 3563507
846 Ga0209050_1000026 3300025298 Bacteria 499134
847 Ga0209050_1011009 3300025298 Bacteria 4361
848 Ga0209050_1022005 3300025298 Bacteria 2300
849 Ga0209256_1000010 3300025299 Bacteria 912110
850 Ga0207426_1060445 3300025302 Bacteria 1092
851 Ga0207426_1065511 3300025302 Bacteria 1030
852 Ga0209051_1000279 3300025303 Bacteria 83677
853 Ga0209257_1000009 3300025304 Bacteria 1205047
854 Ga0209257_1004523 3300025304 Bacteria 10682
855 Ga0209257_1018759 3300025304 Bacteria 2641
856 Ga0207697_10002366 3300025315 Bacteria 9823
857 Ga0207697_10012951 3300025315 Bacteria 3485
858 Ga0207697_10037553 3300025315 Bacteria 1984
859 Ga0207697_10058229 3300025315 Bacteria 1605
860 Ga0207656_10005833 3300025321 Bacteria 4386
861 Ga0207656_10014997 3300025321 Bacteria 2995
862 Ga0207656_10016553 3300025321 Bacteria 2872
863 Ga0207656_10020509 3300025321 Bacteria 2628
864 Ga0207656_10029158 3300025321 Bacteria 2270
865 Ga0207656_10034120 3300025321 Bacteria 2123
866 Ga0207656_10051737 3300025321 Bacteria 1777
867 Ga0207656_10106117 3300025321 Bacteria 1293
868 Ga0207656_10215258 3300025321 Bacteria 932
869 Ga0207696_1011929 3300025711 Bacteria 3101
870 Ga0207713_1030060 3300025735 Bacteria 2422
871 Ga0207682_10000417 3300025893 Bacteria 19557
872 Ga0207682_10032814 3300025893 Bacteria 2088
873 Ga0207692_10157007 3300025898 Bacteria 1308
874 Ga0207642_10055169 3300025899 Bacteria 1816
875 Ga0207642_10063806 3300025899 Bacteria 1724
876 Ga0207642_10193416 3300025899 Bacteria 1118
877 Ga0207710_10012743 3300025900 Bacteria 3540
878 Ga0207688_10011182 3300025901 Bacteria 4888
879 Ga0207688_10043874 3300025901 Bacteria 2491
880 Ga0207688_10103714 3300025901 Bacteria 1645
881 Ga0207688_10187341 3300025901 Bacteria 1236
882 Ga0207680_10000004 3300025903 Bacteria 827324
883 Ga0207680_10000793 3300025903 Bacteria 14887
884 Ga0207680_10002831 3300025903 Bacteria 8130
885 Ga0207680_10006622 3300025903 Bacteria 5619
886 Ga0207680_10022044 3300025903 Bacteria 3458
887 Ga0207680_10132330 3300025903 Bacteria 1645
888 Ga0207680_10292015 3300025903 Bacteria 1135
889 Ga0207680_10501621 3300025903 Bacteria 864
890 Ga0207647_10000450 3300025904 Bacteria 33415
891 Ga0207647_10001366 3300025904 Bacteria 18757
892 Ga0207647_10001428 3300025904 Bacteria 18307
893 Ga0207647_10001605 3300025904 Bacteria 17381
894 Ga0207647_10004391 3300025904 Bacteria 10461
895 Ga0207647_10005058 3300025904 Bacteria 9723
896 Ga0207647_10021214 3300025904 Bacteria 4339
897 Ga0207647_10080102 3300025904 Bacteria 1959
898 Ga0207647_10104293 3300025904 Bacteria 1680
899 Ga0207647_10121437 3300025904 Bacteria 1540
900 Ga0207647_10136520 3300025904 Bacteria 1439
901 Ga0207647_10139122 3300025904 Bacteria 1423
902 Ga0207647_10316852 3300025904 Bacteria 886
903 Ga0207645_10003385 3300025907 Bacteria 12121
904 Ga0207645_10006329 3300025907 Bacteria 8512
905 Ga0207645_10013619 3300025907 Bacteria 5473
906 Ga0207645_10020146 3300025907 Bacteria 4367
907 Ga0207645_10069037 3300025907 Bacteria 2261
908 Ga0207645_10110518 3300025907 Bacteria 1779
909 Ga0207645_10147536 3300025907 Bacteria 1534
910 Ga0207643_10327096 3300025908 Bacteria 958
911 Ga0207705_10004442 3300025909 Bacteria 10601
912 Ga0207705_10004859 3300025909 Bacteria 10090
913 Ga0207705_10005992 3300025909 Bacteria 9047
914 Ga0207705_10012595 3300025909 Bacteria 6105
915 Ga0207705_10012814 3300025909 Bacteria 6054
916 Ga0207705_10015325 3300025909 Bacteria 5501
917 Ga0207705_10016836 3300025909 Bacteria 5235
918 Ga0207705_10028578 3300025909 Bacteria 3975
919 Ga0207705_10062830 3300025909 Bacteria 2683
920 Ga0207705_10082172 3300025909 Bacteria 2349
921 Ga0207705_10092046 3300025909 Bacteria 2221
922 Ga0207705_10167823 3300025909 Bacteria 1652
923 Ga0207705_10198291 3300025909 Bacteria 1520
924 Ga0207705_10208165 3300025909 Bacteria 1483
925 Ga0207705_10240335 3300025909 Bacteria 1379
926 Ga0207705_10246870 3300025909 Bacteria 1361
927 Ga0207705_10258245 3300025909 Bacteria 1330
928 Ga0207705_10286219 3300025909 Bacteria 1262
929 Ga0207705_10413344 3300025909 Bacteria 1044
930 Ga0207705_10533777 3300025909 Bacteria 912
931 Ga0207654_10002603 3300025911 Bacteria 9152
932 Ga0207654_10015435 3300025911 Bacteria 3965
933 Ga0207707_10017099 3300025912 Bacteria 6320
934 Ga0207707_10043923 3300025912 Bacteria 3897
935 Ga0207707_10075837 3300025912 Bacteria 2934
936 Ga0207707_10280179 3300025912 Bacteria 1444
937 Ga0207707_10281123 3300025912 Bacteria 1442
938 Ga0207707_10314569 3300025912 Bacteria 1353
939 Ga0207707_10566755 3300025912 Bacteria 964
940 Ga0207707_10746584 3300025912 Bacteria 819
941 Ga0207695_10010505 3300025913 Bacteria 11324
942 Ga0207695_10017424 3300025913 Bacteria 8360
943 Ga0207695_10025246 3300025913 Bacteria 6657
944 Ga0207695_10065915 3300025913 Bacteria 3721
945 Ga0207695_10066126 3300025913 Bacteria 3715
946 Ga0207695_10165792 3300025913 Bacteria 2138
947 Ga0207695_10172618 3300025913 Bacteria 2087
948 Ga0207695_10414308 3300025913 Bacteria 1232
949 Ga0207695_10484053 3300025913 Bacteria 1120
950 Ga0207671_10001601 3300025914 Bacteria 25733
951 Ga0207671_10001907 3300025914 Bacteria 23137
952 Ga0207671_10012401 3300025914 Bacteria 6856
953 Ga0207671_10026831 3300025914 Bacteria 4310
954 Ga0207671_10109655 3300025914 Bacteria 2099
955 Ga0207671_10137492 3300025914 Bacteria 1880
956 Ga0207671_10166107 3300025914 Bacteria 1711
957 Ga0207693_10025397 3300025915 Bacteria 4698
958 Ga0207693_10281847 3300025915 Bacteria 1302
959 Ga0207663_10117300 3300025916 Bacteria 1816
960 Ga0207660_10000036 3300025917 Bacteria 65280
961 Ga0207660_10017439 3300025917 Bacteria 4771
962 Ga0207660_10090677 3300025917 Bacteria 2265
963 Ga0207660_10109095 3300025917 Bacteria 2080
964 Ga0207660_10127011 3300025917 Bacteria 1937
965 Ga0207660_10132255 3300025917 Bacteria 1900
966 Ga0207660_10146102 3300025917 Bacteria 1812
967 Ga0207660_10171320 3300025917 Bacteria 1680
968 Ga0207660_10255822 3300025917 Bacteria 1383
969 Ga0207660_10641789 3300025917 Bacteria 865
970 Ga0207660_10766184 3300025917 Bacteria 788
971 Ga0207657_10001825 3300025919 Bacteria 22973
972 Ga0207657_10003125 3300025919 Bacteria 17705
973 Ga0207657_10003140 3300025919 Bacteria 17670
974 Ga0207657_10006548 3300025919 Bacteria 12060
975 Ga0207657_10009031 3300025919 Bacteria 10066
976 Ga0207657_10009948 3300025919 Bacteria 9517
977 Ga0207657_10015454 3300025919 Bacteria 7395
978 Ga0207657_10020873 3300025919 Bacteria 6181
979 Ga0207657_10021840 3300025919 Bacteria 6011
980 Ga0207657_10023414 3300025919 Bacteria 5751
981 Ga0207657_10028619 3300025919 Bacteria 5080
982 Ga0207657_10029076 3300025919 Bacteria 5036
983 Ga0207657_10034505 3300025919 Bacteria 4548
984 Ga0207657_10036123 3300025919 Bacteria 4425
985 Ga0207657_10036409 3300025919 Bacteria 4405
986 Ga0207657_10054959 3300025919 Bacteria 3441
987 Ga0207657_10055505 3300025919 Bacteria 3421
988 Ga0207657_10069195 3300025919 Bacteria 2996
989 Ga0207657_10111534 3300025919 Bacteria 2258
990 Ga0207657_10112650 3300025919 Bacteria 2245
991 Ga0207657_10125891 3300025919 Bacteria 2104
992 Ga0207657_10152566 3300025919 Bacteria 1881
993 Ga0207657_10288960 3300025919 Bacteria 1300
994 Ga0207657_10325416 3300025919 Bacteria 1215
995 Ga0207657_10337786 3300025919 Bacteria 1189
996 Ga0207657_10421043 3300025919 Bacteria 1050
997 Ga0207657_10458634 3300025919 Bacteria 1000
998 Ga0207657_10562663 3300025919 Bacteria 891
999 Ga0207657_10634173 3300025919 Bacteria 832
1000 Ga0207649_10002156 3300025920 Bacteria 11134
1001 Ga0207649_10023188 3300025920 Bacteria 3592
1002 Ga0207649_10028053 3300025920 Bacteria 3311
1003 Ga0207649_10030980 3300025920 Bacteria 3174
1004 Ga0207649_10032642 3300025920 Bacteria 3105
1005 Ga0207649_10039151 3300025920 Bacteria 2872
1006 Ga0207649_10076629 3300025920 Bacteria 2152
1007 Ga0207649_10156205 3300025920 Bacteria 1576
1008 Ga0207649_10158723 3300025920 Bacteria 1565
1009 Ga0207649_10204995 3300025920 Bacteria 1395
1010 Ga0207649_10220816 3300025920 Bacteria 1350
1011 Ga0207649_10386137 3300025920 Bacteria 1045
1012 Ga0207649_10409089 3300025920 Bacteria 1017
1013 Ga0207649_10523493 3300025920 Bacteria 904
1014 Ga0207652_10031855 3300025921 Bacteria 4428
1015 Ga0207652_10062022 3300025921 Bacteria 3230
1016 Ga0207652_10075635 3300025921 Bacteria 2935
1017 Ga0207652_10080614 3300025921 Bacteria 2846
1018 Ga0207652_10220681 3300025921 Bacteria 1708
1019 Ga0207652_10277269 3300025921 Bacteria 1512
1020 Ga0207652_10326654 3300025921 Bacteria 1385
1021 Ga0207681_10000130 3300025923 Bacteria 61067
1022 Ga0207681_10325509 3300025923 Bacteria 1223
1023 Ga0207681_10355686 3300025923 Bacteria 1173
1024 Ga0207694_10003169 3300025924 Bacteria 13128
1025 Ga0207694_10003700 3300025924 Bacteria 12110
1026 Ga0207694_10020155 3300025924 Bacteria 5043
1027 Ga0207694_10037544 3300025924 Bacteria 3721
1028 Ga0207694_10071926 3300025924 Bacteria 2703
1029 Ga0207694_10089680 3300025924 Bacteria 2425
1030 Ga0207694_10099374 3300025924 Bacteria 2305
1031 Ga0207694_10105007 3300025924 Bacteria 2242
1032 Ga0207694_10132697 3300025924 Bacteria 1997
1033 Ga0207694_10276387 3300025924 Bacteria 1379
1034 Ga0207694_10595180 3300025924 Bacteria 930
1035 Ga0207694_10735119 3300025924 Bacteria 833
1036 Ga0207650_10036184 3300025925 Bacteria 3589
1037 Ga0207650_10052383 3300025925 Bacteria 3023
1038 Ga0207650_10116445 3300025925 Bacteria 2075
1039 Ga0207650_10199728 3300025925 Bacteria 1601
1040 Ga0207659_10076509 3300025926 Bacteria 2460
1041 Ga0207659_10449437 3300025926 Bacteria 1085
1042 Ga0207687_10003292 3300025927 Bacteria 10928
1043 Ga0207687_10010252 3300025927 Bacteria 6121
1044 Ga0207687_10058695 3300025927 Bacteria 2708
1045 Ga0207700_10113161 3300025928 Bacteria 2188
1046 Ga0207700_10175388 3300025928 Bacteria 1791
1047 Ga0207700_10933996 3300025928 Bacteria 776
1048 Ga0207664_10046964 3300025929 Bacteria 3390
1049 Ga0207664_10132594 3300025929 Bacteria 2099
1050 Ga0207664_10174266 3300025929 Bacteria 1843
1051 Ga0207664_10209192 3300025929 Bacteria 1687
1052 Ga0207664_10418532 3300025929 Bacteria 1193
1053 Ga0207644_10000363 3300025931 Bacteria 29548
1054 Ga0207644_10003018 3300025931 Bacteria 10832
1055 Ga0207644_10008816 3300025931 Bacteria 6604
1056 Ga0207644_10008908 3300025931 Bacteria 6573
1057 Ga0207644_10013604 3300025931 Bacteria 5431
1058 Ga0207644_10023299 3300025931 Bacteria 4239
1059 Ga0207644_10036016 3300025931 Bacteria 3472
1060 Ga0207644_10038172 3300025931 Bacteria 3381
1061 Ga0207644_10047287 3300025931 Bacteria 3070
1062 Ga0207644_10348761 3300025931 Bacteria 1201
1063 Ga0207644_10465715 3300025931 Bacteria 1039
1064 Ga0207690_10000213 3300025932 Bacteria 44040
1065 Ga0207690_10004314 3300025932 Bacteria 8395
1066 Ga0207690_10010821 3300025932 Bacteria 5436
1067 Ga0207690_10024735 3300025932 Bacteria 3763
1068 Ga0207690_10027937 3300025932 Bacteria 3570
1069 Ga0207690_10034020 3300025932 Bacteria 3280
1070 Ga0207690_10035483 3300025932 Bacteria 3221
1071 Ga0207690_10045082 3300025932 Bacteria 2911
1072 Ga0207690_10045727 3300025932 Bacteria 2894
1073 Ga0207690_10096898 3300025932 Bacteria 2098
1074 Ga0207690_10138636 3300025932 Bacteria 1789
1075 Ga0207690_10171634 3300025932 Bacteria 1625
1076 Ga0207690_10303147 3300025932 Bacteria 1251
1077 Ga0207690_10397065 3300025932 Bacteria 1099
1078 Ga0207690_10435543 3300025932 Bacteria 1051
1079 Ga0207690_10679649 3300025932 Bacteria 845
1080 Ga0207690_10952634 3300025932 Bacteria 713
1081 Ga0207706_10001681 3300025933 Bacteria 21822
1082 Ga0207706_10002348 3300025933 Bacteria 18484
1083 Ga0207706_10002904 3300025933 Bacteria 16576
1084 Ga0207706_10004412 3300025933 Bacteria 13222
1085 Ga0207706_10005362 3300025933 Bacteria 11952
1086 Ga0207706_10012962 3300025933 Bacteria 7587
1087 Ga0207706_10018444 3300025933 Bacteria 6280
1088 Ga0207706_10019463 3300025933 Bacteria 6107
1089 Ga0207706_10044942 3300025933 Bacteria 3913
1090 Ga0207706_10067025 3300025933 Bacteria 3158
1091 Ga0207706_10070052 3300025933 Bacteria 3084
1092 Ga0207706_10150961 3300025933 Bacteria 2043
1093 Ga0207706_10165081 3300025933 Bacteria 1946
1094 Ga0207706_10205273 3300025933 Bacteria 1728
1095 Ga0207706_10559277 3300025933 Bacteria 984
1096 Ga0207686_10000999 3300025934 Bacteria 16788
1097 Ga0207686_10970650 3300025934 Bacteria 688
1098 Ga0207709_10000123 3300025935 Bacteria 115697
1099 Ga0207709_10000314 3300025935 Bacteria 52842
1100 Ga0207709_10307373 3300025935 Bacteria 1181
1101 Ga0207709_10422633 3300025935 Bacteria 1024
1102 Ga0207670_10339522 3300025936 Bacteria 1187
1103 Ga0207669_10002136 3300025937 Bacteria 8381
1104 Ga0207669_10054957 3300025937 Bacteria 2408
1105 Ga0207669_10161434 3300025937 Bacteria 1583
1106 Ga0207669_10359783 3300025937 Bacteria 1127
1107 Ga0207704_10000005 3300025938 Bacteria 225353
1108 Ga0207704_10075826 3300025938 Bacteria 2152
1109 Ga0207704_10113325 3300025938 Bacteria 1839
1110 Ga0207704_10333352 3300025938 Bacteria 1175
1111 Ga0207665_10200106 3300025939 Bacteria 1455
1112 Ga0207691_10010358 3300025940 Bacteria 8942
1113 Ga0207691_10034600 3300025940 Bacteria 4696
1114 Ga0207691_10044424 3300025940 Bacteria 4091
1115 Ga0207691_10049113 3300025940 Bacteria 3866
1116 Ga0207691_10057057 3300025940 Bacteria 3555
1117 Ga0207691_10129459 3300025940 Bacteria 2230
1118 Ga0207691_10159692 3300025940 Bacteria 1978
1119 Ga0207691_10404640 3300025940 Bacteria 1164
1120 Ga0207691_10565857 3300025940 Bacteria 963
1121 Ga0207711_10000044 3300025941 Bacteria 157113
1122 Ga0207711_10003187 3300025941 Bacteria 14306
1123 Ga0207711_10004961 3300025941 Bacteria 11295
1124 Ga0207711_10006432 3300025941 Bacteria 9891
1125 Ga0207711_10029068 3300025941 Bacteria 4659
1126 Ga0207711_10060446 3300025941 Bacteria 3266
1127 Ga0207711_10091717 3300025941 Bacteria 2672
1128 Ga0207711_10132160 3300025941 Bacteria 2239
1129 Ga0207711_10346012 3300025941 Bacteria 1376
1130 Ga0207711_10426594 3300025941 Bacteria 1234
1131 Ga0207689_10000043 3300025942 Bacteria 93054
1132 Ga0207689_10005657 3300025942 Bacteria 11121
1133 Ga0207689_10016412 3300025942 Bacteria 6269
1134 Ga0207689_10288442 3300025942 Bacteria 1359
1135 Ga0207661_10040495 3300025944 Bacteria 3663
1136 Ga0207661_10127973 3300025944 Bacteria 2171
1137 Ga0207661_10313167 3300025944 Bacteria 1409
1138 Ga0207661_10438891 3300025944 Bacteria 1188
1139 Ga0207661_10534221 3300025944 Bacteria 1073
1140 Ga0207661_10581081 3300025944 Bacteria 1027
1141 Ga0207679_10004475 3300025945 Bacteria 8712
1142 Ga0207679_10005586 3300025945 Bacteria 7883
1143 Ga0207679_10033250 3300025945 Bacteria 3628
1144 Ga0207679_10056546 3300025945 Bacteria 2897
1145 Ga0207679_10066090 3300025945 Bacteria 2709
1146 Ga0207679_10070193 3300025945 Bacteria 2639
1147 Ga0207679_10109487 3300025945 Bacteria 2177
1148 Ga0207679_10124193 3300025945 Bacteria 2060
1149 Ga0207679_10252079 3300025945 Bacteria 1501
1150 Ga0207679_10302456 3300025945 Bacteria 1379
1151 Ga0207679_10325497 3300025945 Bacteria 1332
1152 Ga0207679_10370994 3300025945 Bacteria 1253
1153 Ga0207679_10372305 3300025945 Bacteria 1250
1154 Ga0207679_10440840 3300025945 Bacteria 1153
1155 Ga0207679_10447834 3300025945 Bacteria 1145
1156 Ga0207679_10503309 3300025945 Bacteria 1081
1157 Ga0207679_10633586 3300025945 Bacteria 966
1158 Ga0207679_10947482 3300025945 Bacteria 788
1159 Ga0207667_10000651 3300025949 Bacteria 45008
1160 Ga0207667_10041692 3300025949 Bacteria 4881
1161 Ga0207667_10066424 3300025949 Bacteria 3759
1162 Ga0207667_10087197 3300025949 Bacteria 3229
1163 Ga0207667_10089128 3300025949 Bacteria 3189
1164 Ga0207667_10120141 3300025949 Bacteria 2708
1165 Ga0207667_10158549 3300025949 Bacteria 2328
1166 Ga0207667_10169517 3300025949 Bacteria 2244
1167 Ga0207667_10204134 3300025949 Bacteria 2027
1168 Ga0207667_10349703 3300025949 Bacteria 1507
1169 Ga0207667_10373400 3300025949 Bacteria 1453
1170 Ga0207667_10671361 3300025949 Bacteria 1040
1171 Ga0207667_10774955 3300025949 Bacteria 957
1172 Ga0207651_10000007 3300025960 Bacteria 225286
1173 Ga0207651_10005083 3300025960 Bacteria 6714
1174 Ga0207651_10008872 3300025960 Bacteria 5460
1175 Ga0207651_10011246 3300025960 Bacteria 5001
1176 Ga0207651_10055669 3300025960 Bacteria 2718
1177 Ga0207651_10055861 3300025960 Bacteria 2714
1178 Ga0207651_10117747 3300025960 Bacteria 2008
1179 Ga0207651_10120928 3300025960 Bacteria 1985
1180 Ga0207712_10000001 3300025961 Bacteria 750309
1181 Ga0207712_10000074 3300025961 Bacteria 120822
1182 Ga0207712_10013236 3300025961 Bacteria 5286
1183 Ga0207712_10242519 3300025961 Bacteria 1452
1184 Ga0207712_10255236 3300025961 Bacteria 1419
1185 Ga0207712_10301749 3300025961 Bacteria 1314
1186 Ga0207668_10008280 3300025972 Bacteria 6195
1187 Ga0207668_10070743 3300025972 Bacteria 2489
1188 Ga0207668_10076582 3300025972 Bacteria 2409
1189 Ga0207668_10282118 3300025972 Bacteria 1362
1190 Ga0207668_10288027 3300025972 Bacteria 1350
1191 Ga0207640_10001822 3300025981 Bacteria 11433
1192 Ga0207640_10002785 3300025981 Bacteria 9373
1193 Ga0207640_10014906 3300025981 Bacteria 4486
1194 Ga0207640_10017347 3300025981 Bacteria 4211
1195 Ga0207640_10022813 3300025981 Bacteria 3753
1196 Ga0207640_10050048 3300025981 Bacteria 2709
1197 Ga0207640_10068326 3300025981 Bacteria 2381
1198 Ga0207640_10107282 3300025981 Bacteria 1971
1199 Ga0207640_10129763 3300025981 Bacteria 1820
1200 Ga0207640_10145116 3300025981 Bacteria 1735
1201 Ga0207640_10148408 3300025981 Bacteria 1719
1202 Ga0207640_10221716 3300025981 Bacteria 1448
1203 Ga0207640_10226516 3300025981 Bacteria 1435
1204 Ga0207640_10371929 3300025981 Bacteria 1155
1205 Ga0207658_10001041 3300025986 Bacteria 22533
1206 Ga0207658_10001339 3300025986 Bacteria 19300
1207 Ga0207658_10007902 3300025986 Bacteria 7245
1208 Ga0207658_10020014 3300025986 Bacteria 4632
1209 Ga0207658_10047562 3300025986 Bacteria 3140
1210 Ga0207658_10053779 3300025986 Bacteria 2976
1211 Ga0207658_10077777 3300025986 Bacteria 2532
1212 Ga0207658_10282923 3300025986 Bacteria 1422
1213 Ga0207658_10510136 3300025986 Bacteria 1072
1214 Ga0207658_10600986 3300025986 Bacteria 988
1215 Ga0207658_10655569 3300025986 Bacteria 946
1216 Ga0207658_10894046 3300025986 Bacteria 808
1217 Ga0207677_10000085 3300026023 Bacteria 78393
1218 Ga0207677_10007135 3300026023 Bacteria 6153
1219 Ga0207677_10007140 3300026023 Bacteria 6151
1220 Ga0207677_10020495 3300026023 Bacteria 4015
1221 Ga0207677_10376244 3300026023 Bacteria 1197
1222 Ga0207677_10404616 3300026023 Bacteria 1158
1223 Ga0207703_10000661 3300026035 Bacteria 34492
1224 Ga0207703_10002210 3300026035 Bacteria 17083
1225 Ga0207703_10004178 3300026035 Bacteria 11907
1226 Ga0207703_10007316 3300026035 Bacteria 8776
1227 Ga0207703_10009056 3300026035 Bacteria 7838
1228 Ga0207703_10009152 3300026035 Bacteria 7796
1229 Ga0207703_10026676 3300026035 Bacteria 4550
1230 Ga0207703_10109164 3300026035 Bacteria 2358
1231 Ga0207703_10489289 3300026035 Bacteria 1153
1232 Ga0207639_10000138 3300026041 Bacteria 54326
1233 Ga0207639_10000306 3300026041 Bacteria 34858
1234 Ga0207639_10002847 3300026041 Bacteria 11617
1235 Ga0207639_10010651 3300026041 Bacteria 6367
1236 Ga0207639_10018714 3300026041 Bacteria 4925
1237 Ga0207639_10059006 3300026041 Bacteria 2954
1238 Ga0207639_10173707 3300026041 Bacteria 1827
1239 Ga0207639_10202438 3300026041 Bacteria 1704
1240 Ga0207639_10242398 3300026041 Bacteria 1568
1241 Ga0207639_10479070 3300026041 Bacteria 1134
1242 Ga0207639_10487501 3300026041 Bacteria 1124
1243 Ga0207639_10504622 3300026041 Bacteria 1106
1244 Ga0207678_10000625 3300026067 Bacteria 32330
1245 Ga0207678_10002012 3300026067 Bacteria 18467
1246 Ga0207678_10003288 3300026067 Bacteria 14580
1247 Ga0207678_10019982 3300026067 Bacteria 5886
1248 Ga0207678_10035972 3300026067 Bacteria 4311
1249 Ga0207678_10054068 3300026067 Bacteria 3458
1250 Ga0207678_10055159 3300026067 Bacteria 3423
1251 Ga0207678_10060312 3300026067 Bacteria 3263
1252 Ga0207678_10065532 3300026067 Bacteria 3119
1253 Ga0207678_10110234 3300026067 Bacteria 2348
1254 Ga0207678_10126217 3300026067 Bacteria 2183
1255 Ga0207678_10160114 3300026067 Bacteria 1922
1256 Ga0207678_10285847 3300026067 Bacteria 1416
1257 Ga0207678_10310163 3300026067 Bacteria 1357
1258 Ga0207678_10314333 3300026067 Bacteria 1347
1259 Ga0207678_10331210 3300026067 Bacteria 1311
1260 Ga0207678_10417137 3300026067 Bacteria 1164
1261 Ga0207678_10637089 3300026067 Bacteria 936
1262 Ga0207678_10638400 3300026067 Bacteria 935
1263 Ga0207708_10029953 3300026075 Bacteria 4127
1264 Ga0207702_10003043 3300026078 Bacteria 15581
1265 Ga0207702_10012870 3300026078 Bacteria 6959
1266 Ga0207702_10033646 3300026078 Bacteria 4282
1267 Ga0207702_10056816 3300026078 Bacteria 3324
1268 Ga0207702_10073569 3300026078 Bacteria 2947
1269 Ga0207702_10088682 3300026078 Bacteria 2703
1270 Ga0207702_10127183 3300026078 Bacteria 2289
1271 Ga0207702_10162382 3300026078 Bacteria 2041
1272 Ga0207702_10182347 3300026078 Bacteria 1934
1273 Ga0207702_10213686 3300026078 Bacteria 1794
1274 Ga0207702_10253694 3300026078 Bacteria 1653
1275 Ga0207702_10357344 3300026078 Bacteria 1399
1276 Ga0207702_10429509 3300026078 Bacteria 1279
1277 Ga0207702_10443963 3300026078 Bacteria 1258
1278 Ga0207702_10451684 3300026078 Bacteria 1247
1279 Ga0207702_10789345 3300026078 Bacteria 938
1280 Ga0207702_10916668 3300026078 Bacteria 868
1281 Ga0207702_11067361 3300026078 Bacteria 801
1282 Ga0207641_10000033 3300026088 Bacteria 219261
1283 Ga0207641_10002463 3300026088 Bacteria 17101
1284 Ga0207641_10017686 3300026088 Bacteria 5838
1285 Ga0207641_10074338 3300026088 Bacteria 2931
1286 Ga0207641_10182174 3300026088 Bacteria 1925
1287 Ga0207641_10362799 3300026088 Bacteria 1383
1288 Ga0207641_11536028 3300026088 Bacteria 667
1289 Ga0207648_10000005 3300026089 Bacteria 225083
1290 Ga0207648_10009542 3300026089 Bacteria 9282
1291 Ga0207648_10017604 3300026089 Bacteria 6491
1292 Ga0207648_10066045 3300026089 Bacteria 3155
1293 Ga0207648_10085498 3300026089 Bacteria 2751
1294 Ga0207648_10182280 3300026089 Bacteria 1859
1295 Ga0207648_10299460 3300026089 Bacteria 1442
1296 Ga0207648_10315417 3300026089 Bacteria 1404
1297 Ga0207648_11105398 3300026089 Bacteria 743
1298 Ga0207676_10000193 3300026095 Bacteria 53147
1299 Ga0207676_10001310 3300026095 Bacteria 18517
1300 Ga0207676_10002304 3300026095 Bacteria 13699
1301 Ga0207676_10008893 3300026095 Bacteria 7145
1302 Ga0207676_10014208 3300026095 Bacteria 5720
1303 Ga0207676_10274732 3300026095 Bacteria 1527
1304 Ga0207674_10005155 3300026116 Bacteria 15575
1305 Ga0207674_10008541 3300026116 Bacteria 11814
1306 Ga0207674_10008911 3300026116 Bacteria 11530
1307 Ga0207674_10010054 3300026116 Bacteria 10763
1308 Ga0207674_10011026 3300026116 Bacteria 10165
1309 Ga0207674_10026848 3300026116 Bacteria 6107
1310 Ga0207674_10115284 3300026116 Bacteria 2658
1311 Ga0207674_10205783 3300026116 Bacteria 1917
1312 Ga0207674_11268491 3300026116 Bacteria 706
1313 Ga0207674_11278756 3300026116 Bacteria 703
1314 Ga0207675_100000020 3300026118 Bacteria 117374
1315 Ga0207675_100003055 3300026118 Bacteria 16418
1316 Ga0207675_100014477 3300026118 Bacteria 7353
1317 Ga0207675_100123581 3300026118 Bacteria 2450
1318 Ga0207675_100135492 3300026118 Bacteria 2336
1319 Ga0207675_100152747 3300026118 Bacteria 2198
1320 Ga0207675_100217470 3300026118 Bacteria 1840
1321 Ga0207683_10002608 3300026121 Bacteria 15739
1322 Ga0207683_10005676 3300026121 Bacteria 10700
1323 Ga0207683_10007711 3300026121 Bacteria 9219
1324 Ga0207683_10022069 3300026121 Bacteria 5462
1325 Ga0207683_10025235 3300026121 Bacteria 5125
1326 Ga0207683_10143345 3300026121 Bacteria 2153
1327 Ga0207683_10334750 3300026121 Bacteria 1388
1328 Ga0207683_10773740 3300026121 Bacteria 891
1329 Ga0207698_10000751 3300026142 Bacteria 18819
1330 Ga0207698_10001376 3300026142 Bacteria 14155
1331 Ga0207698_10004176 3300026142 Bacteria 8786
1332 Ga0207698_10004925 3300026142 Bacteria 8187
1333 Ga0207698_10013479 3300026142 Bacteria 5394
1334 Ga0207698_10016964 3300026142 Bacteria 4927
1335 Ga0207698_10018354 3300026142 Bacteria 4764
1336 Ga0207698_10020656 3300026142 Bacteria 4537
1337 Ga0207698_10035079 3300026142 Bacteria 3666
1338 Ga0207698_10063830 3300026142 Bacteria 2884
1339 Ga0207698_10070641 3300026142 Bacteria 2767
1340 Ga0207698_10101973 3300026142 Bacteria 2381
1341 Ga0207698_10105999 3300026142 Bacteria 2343
1342 Ga0207698_10110081 3300026142 Bacteria 2306
1343 Ga0207698_10125131 3300026142 Bacteria 2184
1344 Ga0207698_10236368 3300026142 Bacteria 1662
1345 Ga0207698_10315678 3300026142 Bacteria 1461
1346 Ga0207698_10380246 3300026142 Bacteria 1343
1347 Ga0207698_10492571 3300026142 Bacteria 1191
1348 Ga0207698_10951321 3300026142 Bacteria 868
1349 Ga0209967_1012570 3300027364 Bacteria 1197
1350 Ga0209999_1018098 3300027543 Bacteria 1288
1351 Ga0209970_1014509 3300027614 Bacteria 1309
1352 Ga0209813_10000642 3300027866 Bacteria 8057
1353 Ga0209974_10020267 3300027876 Bacteria 2204
1354 Ga0268266_10000028 3300028379 Bacteria 425294
1355 Ga0268266_10000315 3300028379 Bacteria 76532
1356 Ga0268266_10032675 3300028379 Bacteria 4421
1357 Ga0268266_10040809 3300028379 Bacteria 3957
1358 Ga0268266_10154815 3300028379 Bacteria 2069
1359 Ga0268266_10494660 3300028379 Bacteria 1167
1360 Ga0268265_10000524 3300028380 Bacteria 39127
1361 Ga0268265_10000655 3300028380 Bacteria 34369
1362 Ga0268265_10000877 3300028380 Bacteria 28171
1363 Ga0268265_10004694 3300028380 Bacteria 9433
1364 Ga0268265_10037695 3300028380 Bacteria 3550
1365 Ga0268265_10081652 3300028380 Bacteria 2553
1366 Ga0268265_10157984 3300028380 Bacteria 1921
1367 Ga0268265_10595854 3300028380 Bacteria 1055
1368 Ga0268265_11491259 3300028380 Bacteria 680
1369 Ga0268264_10000006 3300028381 Bacteria 827324
1370 Ga0268264_10000594 3300028381 Bacteria 43886
1371 Ga0268264_10030328 3300028381 Bacteria 4432
1372 Ga0268264_10066778 3300028381 Bacteria 3034
1373 Ga0268264_10222948 3300028381 Bacteria 1736
1374 Ga0268264_10226230 3300028381 Bacteria 1725
1375 Ga0268264_10246579 3300028381 Bacteria 1657
1376 Ga0268264_11242710 3300028381 Bacteria 755
1377 Ga0307517_10010919 3300028786 Bacteria 12655
1378 Ga0307517_10015604 3300028786 Bacteria 10076
1379 Ga0316182_1051886 3300030745 Bacteria 1311
1380 Ga0307513_10324308 3300031456 Bacteria 1297
1381 Ga0307408_100034262 3300031548 Bacteria 3555
1382 Ga0307408_100063351 3300031548 Bacteria 2704
1383 Ga0307408_100166926 3300031548 Bacteria 1754
1384 Ga0307408_100468283 3300031548 Bacteria 1096
1385 Ga0307405_10006669 3300031731 Bacteria 5700
1386 Ga0307405_10011630 3300031731 Bacteria 4624
1387 Ga0307405_10032333 3300031731 Bacteria 3092
1388 Ga0307405_10078060 3300031731 Bacteria 2153
1389 Ga0307405_10106086 3300031731 Bacteria 1894
1390 Ga0307405_10208850 3300031731 Bacteria 1423
1391 Ga0307405_10544027 3300031731 Bacteria 938
1392 Ga0307405_10993554 3300031731 Bacteria 715
1393 Ga0307413_10528879 3300031824 Bacteria 952
1394 Ga0307413_10601644 3300031824 Bacteria 900
1395 Ga0307410_10004647 3300031852 Bacteria 7132
1396 Ga0307410_10035455 3300031852 Bacteria 3240
1397 Ga0307410_10362872 3300031852 Bacteria 1160
1398 Ga0307410_10813577 3300031852 Bacteria 795
1399 Ga0307406_10008063 3300031901 Bacteria 5866
1400 Ga0307406_10008583 3300031901 Bacteria 5704
1401 Ga0307406_10546600 3300031901 Bacteria 947
1402 Ga0307407_10014619 3300031903 Bacteria 3851
1403 Ga0307407_10075741 3300031903 Bacteria 2018
1404 Ga0307412_10010301 3300031911 Bacteria 5384
1405 Ga0307412_10011200 3300031911 Bacteria 5189
1406 Ga0307412_10070371 3300031911 Bacteria 2384
1407 Ga0307412_10130640 3300031911 Bacteria 1823
1408 Ga0307412_10969519 3300031911 Bacteria 749
1409 Ga0307409_100030466 3300031995 Bacteria 3876
1410 Ga0307409_100091735 3300031995 Bacteria 2490
1411 Ga0307409_100093100 3300031995 Bacteria 2475
1412 Ga0307409_100124455 3300031995 Bacteria 2190
1413 Ga0307409_100269587 3300031995 Bacteria 1567
1414 Ga0307409_100412273 3300031995 Bacteria 1294
1415 Ga0307409_100470045 3300031995 Bacteria 1218
1416 Ga0307409_100532302 3300031995 Bacteria 1150
1417 Ga0307409_101135797 3300031995 Bacteria 803
1418 Ga0307416_100003438 3300032002 Bacteria 9303
1419 Ga0307416_100013884 3300032002 Bacteria 5492
1420 Ga0307416_100817329 3300032002 Bacteria 1028
1421 Ga0307416_101282137 3300032002 Bacteria 838
1422 Ga0307414_10001010 3300032004 Bacteria 14378
1423 Ga0307414_10220923 3300032004 Bacteria 1555
1424 Ga0307414_10226144 3300032004 Bacteria 1539
1425 Ga0307414_10357465 3300032004 Bacteria 1255
1426 Ga0307414_10474124 3300032004 Bacteria 1102
1427 Ga0307414_10506148 3300032004 Bacteria 1069
1428 Ga0307414_10542168 3300032004 Bacteria 1035
1429 Ga0307411_10003341 3300032005 Bacteria 7428
1430 Ga0307411_10006255 3300032005 Bacteria 5939
1431 Ga0307411_10151432 3300032005 Bacteria 1724
1432 Ga0307411_10175894 3300032005 Bacteria 1619
1433 Ga0307411_10289723 3300032005 Bacteria 1307
1434 Ga0307411_10357127 3300032005 Bacteria 1193
1435 Ga0307411_10376988 3300032005 Bacteria 1165
1436 Ga0307411_10635061 3300032005 Bacteria 922
1437 Ga0307411_10723282 3300032005 Bacteria 869
1438 Ga0307415_100030148 3300032126 Bacteria 3477
1439 Ga0307415_100081448 3300032126 Bacteria 2312
1440 Ga0307415_100116218 3300032126 Bacteria 1995
1441 Ga0307415_100134814 3300032126 Bacteria 1876
1442 Ga0307510_10119138 3300033180 Bacteria 2350
1443 Ga0307510_10232056 3300033180 Bacteria 1347
1444 Ga0373923_0033469 3300035111 Bacteria 2081
1445 Ga0373941_0119195 3300035115 Bacteria 939
1446 Ga0373941_0151102 3300035115 Bacteria 852
1447 Ga0373954_0082775 3300035118 Bacteria 1535
1448 Ga0373960_0049190 3300035121 Bacteria 1246
1449 Ga0373960_0138379 3300035121 Bacteria 822
1450 Ga0373943_0455470 3300035170 Bacteria 744
1451 Ga0373942_0063647 3300035207 Bacteria 1062
1452 Ga0373931_0009585 3300035691 Bacteria 4634
1453 Ga0373935_0047789 3300035692 Bacteria 2707
1454 Ga0373935_0069053 3300035692 Bacteria 2275
1455 Ga0373927_0025599 3300035695 Bacteria 3858
1456 Ga0373933_0122438 3300035724 Bacteria 1630
1457 Ga0373937_0085639 3300036401 Bacteria 2916
1458 Ga0373925_0036385 3300037068 Bacteria 3633
1459 Ga0395899_0000103 3300037312 Bacteria 147274
1460 Ga0395899_0001950 3300037312 Bacteria 16977
1461 Ga0395899_0015182 3300037312 Bacteria 5872
1462 Ga0395899_0024414 3300037312 Bacteria 4570
1463 Ga0395899_0034866 3300037312 Bacteria 3779
1464 Ga0395899_0040739 3300037312 Bacteria 3473
1465 Ga0395899_0053354 3300037312 Bacteria 2993
1466 Ga0395899_0053589 3300037312 Bacteria 2986
1467 Ga0395899_0107111 3300037312 Bacteria 2012
1468 Ga0395899_0109509 3300037312 Bacteria 1987
1469 Ga0395899_0154352 3300037312 Bacteria 1625
1470 Ga0395899_0162610 3300037312 Bacteria 1576
1471 Ga0395899_0176237 3300037312 Bacteria 1503
1472 Ga0395899_0181294 3300037312 Bacteria 1478
1473 Ga0395899_0209042 3300037312 Bacteria 1357
1474 Ga0395899_0219249 3300037312 Bacteria 1318
1475 Ga0395899_0289571 3300037312 Bacteria 1111
1476 Ga0395899_0685876 3300037312 Bacteria 644
1477 Ga0395900_0000093 3300037418 Bacteria 166505
1478 Ga0395900_0000325 3300037418 Bacteria 70579
1479 Ga0395900_0001087 3300037418 Bacteria 34570
1480 Ga0395900_0001290 3300037418 Bacteria 30554
1481 Ga0395900_0020586 3300037418 Bacteria 6738
1482 Ga0395900_0023955 3300037418 Bacteria 6247
1483 Ga0395900_0028278 3300037418 Bacteria 5743
1484 Ga0395900_0034108 3300037418 Bacteria 5239
1485 Ga0395900_0045255 3300037418 Bacteria 4533
1486 Ga0395900_0048120 3300037418 Bacteria 4392
1487 Ga0395900_0048535 3300037418 Bacteria 4373
1488 Ga0395900_0091818 3300037418 Bacteria 3119
1489 Ga0395900_0109184 3300037418 Bacteria 2842
1490 Ga0395900_0109823 3300037418 Bacteria 2833
1491 Ga0395900_0125689 3300037418 Bacteria 2630
1492 Ga0395900_0128722 3300037418 Bacteria 2595
1493 Ga0395900_0129797 3300037418 Bacteria 2583
1494 Ga0395900_0146278 3300037418 Bacteria 2416
1495 Ga0395900_0157340 3300037418 Bacteria 2320
1496 Ga0395900_0165784 3300037418 Bacteria 2251
1497 Ga0395900_0191350 3300037418 Bacteria 2075
1498 Ga0395900_0196867 3300037418 Bacteria 2041
1499 Ga0395900_0263737 3300037418 Bacteria 1719
1500 Ga0395900_0294916 3300037418 Bacteria 1609
1501 Ga0395900_0350852 3300037418 Bacteria 1449
1502 Ga0395900_0414088 3300037418 Bacteria 1309
1503 Ga0395900_0427492 3300037418 Bacteria 1284
1504 Ga0395900_0582892 3300037418 Bacteria 1060
1505 Ga0395900_0745429 3300037418 Bacteria 910
1506 Ga0395900_0906782 3300037418 Bacteria 804
1507 Ga0395898_0000053 3300037466 Bacteria 279600
1508 Ga0395898_0006749 3300037466 Bacteria 12226
1509 Ga0395898_0072459 3300037466 Bacteria 3328
1510 Ga0395898_0086177 3300037466 Bacteria 3027
1511 Ga0395898_0100601 3300037466 Bacteria 2776
1512 Ga0395898_0146453 3300037466 Bacteria 2260
1513 Ga0395898_0213635 3300037466 Bacteria 1840
1514 Ga0395898_0330150 3300037466 Bacteria 1454
1515 Ga0395898_0335348 3300037466 Bacteria 1442
1516 Ga0395898_0357119 3300037466 Bacteria 1393
1517 Ga0395898_0424649 3300037466 Bacteria 1267
1518 Ga0395898_0514147 3300037466 Bacteria 1138
1519 Ga0395898_0619179 3300037466 Bacteria 1025
1520 Ga0395898_0666448 3300037466 Bacteria 982
1521 Ga0395898_0976618 3300037466 Bacteria 783
1522 Ga0395905_0000031 3300037471 Bacteria 286757
1523 Ga0395905_0000218 3300037471 Bacteria 87745
1524 Ga0395905_0000298 3300037471 Bacteria 72500
1525 Ga0395905_0002160 3300037471 Bacteria 22295
1526 Ga0395905_0003525 3300037471 Bacteria 16688
1527 Ga0395905_0004981 3300037471 Bacteria 13682
1528 Ga0395905_0011188 3300037471 Bacteria 8676
1529 Ga0395905_0021011 3300037471 Bacteria 6181
1530 Ga0395905_0024148 3300037471 Bacteria 5738
1531 Ga0395905_0024791 3300037471 Bacteria 5660
1532 Ga0395905_0029054 3300037471 Bacteria 5210
1533 Ga0395905_0032012 3300037471 Bacteria 4947
1534 Ga0395905_0034086 3300037471 Bacteria 4780
1535 Ga0395905_0045674 3300037471 Bacteria 4108
1536 Ga0395905_0066550 3300037471 Bacteria 3374
1537 Ga0395905_0069718 3300037471 Bacteria 3293
1538 Ga0395905_0087794 3300037471 Bacteria 2915
1539 Ga0395905_0091962 3300037471 Bacteria 2844
1540 Ga0395905_0133389 3300037471 Bacteria 2336
1541 Ga0395905_0149610 3300037471 Bacteria 2196
1542 Ga0395905_0165759 3300037471 Bacteria 2076
1543 Ga0395905_0176931 3300037471 Bacteria 2003
1544 Ga0395905_0179700 3300037471 Bacteria 1986
1545 Ga0395905_0183937 3300037471 Bacteria 1962
1546 Ga0395905_0262478 3300037471 Bacteria 1612
1547 Ga0395905_0311521 3300037471 Bacteria 1462
1548 Ga0395905_0343273 3300037471 Bacteria 1384
1549 Ga0395905_0365865 3300037471 Bacteria 1335
1550 Ga0395905_0379500 3300037471 Bacteria 1307
1551 Ga0395905_0609346 3300037471 Bacteria 994
1552 Ga0395905_0643619 3300037471 Bacteria 962
1553 Ga0395905_0691054 3300037471 Bacteria 922
1554 Ga0395905_0827664 3300037471 Bacteria 828
1555 Ga0395905_0852610 3300037471 Bacteria 814
1556 Ga0395905_1053264 3300037471 Bacteria 716
1557 Ga0436364_0267368 3300037853 Bacteria 35795
1558 Ga0436364_1244538 3300037853 Bacteria 1142
1559 Ga0395901_0000603 3300038443 Bacteria 41824
1560 Ga0395901_0001133 3300038443 Bacteria 28265
1561 Ga0395901_0002869 3300038443 Bacteria 17398
1562 Ga0395901_0003360 3300038443 Bacteria 16117
1563 Ga0395901_0007049 3300038443 Bacteria 11362
1564 Ga0395901_0015960 3300038443 Bacteria 7651
1565 Ga0395901_0042410 3300038443 Bacteria 4717
1566 Ga0395901_0043460 3300038443 Bacteria 4661
1567 Ga0395901_0048919 3300038443 Bacteria 4391
1568 Ga0395901_0059325 3300038443 Bacteria 3981
1569 Ga0395901_0062942 3300038443 Bacteria 3861
1570 Ga0395901_0075822 3300038443 Bacteria 3508
1571 Ga0395901_0103747 3300038443 Bacteria 2983
1572 Ga0395901_0119896 3300038443 Bacteria 2764
1573 Ga0395901_0134330 3300038443 Bacteria 2600
1574 Ga0395901_0187633 3300038443 Bacteria 2168
1575 Ga0395901_0211757 3300038443 Bacteria 2028
1576 Ga0395901_0215873 3300038443 Bacteria 2006
1577 Ga0395901_0238206 3300038443 Bacteria 1898
1578 Ga0395901_0245240 3300038443 Bacteria 1867
1579 Ga0395901_0285573 3300038443 Bacteria 1713
1580 Ga0395901_0297482 3300038443 Bacteria 1673
1581 Ga0395901_0487641 3300038443 Bacteria 1256
1582 Ga0395901_0615440 3300038443 Bacteria 1093
1583 Ga0395901_0700679 3300038443 Bacteria 1010
1584 Ga0395901_0980212 3300038443 Bacteria 822
1585 Ga0395901_1052899 3300038443 Bacteria 786
1586 Ga0237819_00997 3300038705 Bacteria 8549
1587 Ga0237816_01348 3300039145 Bacteria 1986
1588 Ga0436365_1759449 3300039437 Bacteria 1090
1589 Ga0436365_1765941 3300039437 Bacteria 1102
1590 Ga0436363_1307031 3300039450 Bacteria 709
1591 Ga0439436_0010448 3300041404 Bacteria 2831
1592 Ga0439438_080358 3300041405 Bacteria 800
1593 Ga0439439_0015658 3300041406 Bacteria 1853
1594 Ga0439466_0063717 3300041411 Bacteria 1183
1595 Ga0439465_0012432 3300041413 Bacteria 2661
1596 Ga0439465_0024370 3300041413 Bacteria 1906
1597 Ga0451787_474471 3300041441 Bacteria 821
1598 Ga0451795_1296634 3300041456 Bacteria 1282
1599 Ga0451833_0859678 3300041491 Bacteria 1356
1600 Ga0451853_1878420 3300041512 Bacteria 1848
1601 Ga0439431_0000266 3300041997 Bacteria 10688
1602 Ga0439431_0001884 3300041997 Bacteria 4650
1603 Ga0439442_006828 3300042002 Bacteria 2291
1604 Ga0439445_0057548 3300042004 Bacteria 1058
1605 Ga0439448_0014521 3300042005 Bacteria 2376
1606 Ga0439448_0041089 3300042005 Bacteria 1495
1607 Ga0439449_0016693 3300042007 Bacteria 2758
1608 Ga0439449_0066737 3300042007 Bacteria 1327
1609 Ga0439452_012996 3300042010 Bacteria 2348
1610 Ga0439455_0001059 3300042012 Bacteria 4360
1611 Ga0439457_009600 3300042014 Bacteria 2248
1612 Ga0439462_0000072 3300042015 Bacteria 15184
1613 Ga0450890_007651 3300042127 Bacteria 1382
1614 Ga0450894_022132 3300042131 Bacteria 861
1615 Ga0439446_0090261 3300042156 Bacteria 958
1616 Ga0439458_0000003 3300042157 Bacteria 33633
1617 Ga0439458_0001169 3300042157 Bacteria 6661
1618 Ga0439434_0017782 3300042435 Bacteria 2127
1619 Ga0439464_0016573 3300042439 Bacteria 1993
1620 Ga0439464_0049328 3300042439 Bacteria 1214
1621 Ga0439460_0049043 3300042461 Bacteria 1261
1622 Ga0466969_0070561 3300044656 Bacteria 1680
1623 Ga0466972_0016710 3300044658 Bacteria 3669
1624 Ga0466972_0099084 3300044658 Bacteria 1379
1625 Ga0466973_0265260 3300044659 Bacteria 1191
1626 Ga0466965_0064703 3300044683 Bacteria 1831
1627 Ga0466966_0000001 3300044684 Bacteria 410376
1628 Ga0466966_0035584 3300044684 Bacteria 3216
1629 Ga0466966_0045811 3300044684 Bacteria 2795
1630 Ga0466966_0124094 3300044684 Bacteria 1584
1631 Ga0466966_0269109 3300044684 Bacteria 1025
1632 Ga0466961_0010293 3300044693 Bacteria 5960
1633 Ga0466961_0011461 3300044693 Bacteria 5670
1634 Ga0466961_0066414 3300044693 Bacteria 2291
1635 Ga0466961_0262323 3300044693 Bacteria 1059
1636 Ga0466963_0001571 3300044694 Bacteria 12383
1637 Ga0466963_0005775 3300044694 Bacteria 7279
1638 Ga0466963_0012123 3300044694 Bacteria 5269
1639 Ga0466963_0015629 3300044694 Bacteria 4706
1640 Ga0466963_0027255 3300044694 Bacteria 3657
1641 Ga0466963_0076558 3300044694 Bacteria 2259
1642 Ga0466963_0110260 3300044694 Bacteria 1889
1643 Ga0466963_0145563 3300044694 Bacteria 1643
1644 Ga0466963_0286199 3300044694 Bacteria 1158
1645 Ga0466963_0362192 3300044694 Bacteria 1021
1646 Ga0466963_0436933 3300044694 Bacteria 923
1647 Ga0466964_0011968 3300044706 Bacteria 3280
1648 Ga0466971_0007970 3300044719 Bacteria 4617
1649 Ga0466971_0010170 3300044719 Bacteria 4108
1650 Ga0466971_0071253 3300044719 Bacteria 1579
1651 Ga0466971_0112712 3300044719 Bacteria 1256
1652 Ga0466968_0069985 3300044735 Bacteria 1525
1653 Ga0466968_0162402 3300044735 Bacteria 1031
1654 Ga0466970_0018332 3300044765 Bacteria 3622
1655 Ga0466970_0018657 3300044765 Bacteria 3594
1656 Ga0466970_0124328 3300044765 Bacteria 1414
1657 Ga0466957_0003468 3300044842 Bacteria 8660
1658 Ga0466957_0003546 3300044842 Bacteria 8595
1659 Ga0466957_0018902 3300044842 Bacteria 4050
1660 Ga0466957_0095064 3300044842 Bacteria 1871
1661 Ga0466957_0277146 3300044842 Bacteria 1121
1662 Ga0466957_0359512 3300044842 Bacteria 989
1663 Ga0466957_0582018 3300044842 Bacteria 782
1664 Ga0466960_0023437 3300044901 Bacteria 2771
1665 Ga0466960_0079156 3300044901 Bacteria 1652
1666 Ga0466959_0002064 3300045049 Bacteria 12709
1667 Ga0466959_0049401 3300045049 Bacteria 3090
1668 Ga0466959_0070810 3300045049 Bacteria 2526
1669 Ga0466959_0093564 3300045049 Bacteria 2157
1670 Ga0466959_0212995 3300045049 Bacteria 1342
1671 Ga0466958_0000867 3300045836 Bacteria 13493
1672 Ga0466958_0036365 3300045836 Bacteria 2947
1673 Ga0466958_0128384 3300045836 Bacteria 1591
1674 Ga0466958_0131142 3300045836 Bacteria 1574
1675 Ga0466958_0165135 3300045836 Bacteria 1400
1676 Ga0466958_0410413 3300045836 Bacteria 875
1677 Ga0466958_0437855 3300045836 Bacteria 846
1678 Ga0466967_0021736 3300045976 Bacteria 5219
1679 Ga0466967_0032298 3300045976 Bacteria 4418
1680 Ga0466967_0046607 3300045976 Bacteria 3775
1681 Ga0466967_0053683 3300045976 Bacteria 3543
1682 Ga0466967_0055341 3300045976 Bacteria 3494
1683 Ga0466967_0093266 3300045976 Bacteria 2739
1684 Ga0466967_0166106 3300045976 Bacteria 2074
1685 Ga0466967_0268400 3300045976 Bacteria 1634
1686 Ga0466967_0282024 3300045976 Bacteria 1594
1687 Ga0466967_0661833 3300045976 Bacteria 1033
1688 Ga0466967_0706066 3300045976 Bacteria 999
1689 Ga0466967_0858709 3300045976 Bacteria 902
1690 Ga0495617_003757 3300046452 Bacteria 5632
1691 Ga0495627_000621 3300046453 Bacteria 28245
1692 Ga0495627_013170 3300046453 Bacteria 2914
1693 Ga0495590_0276979 3300046457 Bacteria 628
1694 Ga0495650_0000058 3300046471 Bacteria 302308
1695 Ga0495585_0015180 3300046492 Bacteria 4476
1696 Ga0495607_0066211 3300046501 Bacteria 2034
1697 Ga0495583_0000111 3300046506 Bacteria 138300
1698 Ga0495583_0037338 3300046506 Bacteria 2303
1699 Ga0495606_0021008 3300046507 Bacteria 4792
1700 Ga0495606_0068197 3300046507 Bacteria 2251
1701 Ga0495610_0000072 3300046512 Bacteria 120618
1702 Ga0495616_0112830 3300046513 Bacteria 1261
1703 Ga0495631_0166832 3300046518 Bacteria 944
1704 Ga0495631_0252170 3300046518 Bacteria 752
1705 Ga0495632_0000007 3300046519 Bacteria 343246
1706 Ga0495632_0145657 3300046519 Bacteria 1097
1707 Ga0495632_0163809 3300046519 Bacteria 1023
1708 Ga0495637_0000971 3300046520 Bacteria 18217
1709 Ga0495637_0026836 3300046520 Bacteria 2581
1710 Ga0495643_0000005 3300046522 Bacteria 443135
1711 Ga0495643_0025789 3300046522 Bacteria 3323
1712 Ga0495648_0001438 3300046524 Bacteria 23303
1713 Ga0495648_0084734 3300046524 Bacteria 1793
1714 Ga0495648_0188419 3300046524 Bacteria 1042
1715 Ga0495663_0000005 3300046525 Bacteria 342265
1716 Ga0495663_0076555 3300046525 Bacteria 1072
1717 Ga0495663_0131859 3300046525 Bacteria 843
1718 Ga0495642_0016307 3300046528 Bacteria 2894
1719 Ga0495598_0007441 3300046537 Bacteria 2513
1720 Ga0495621_0000481 3300046539 Bacteria 9812
1721 Ga0495621_0000528 3300046539 Bacteria 9462
1722 Ga0495597_0115110 3300046542 Bacteria 1125
1723 Ga0495622_0007809 3300046557 Bacteria 4967
1724 Ga0495633_0001368 3300046558 Bacteria 19079
1725 Ga0495633_0002896 3300046558 Bacteria 11765
1726 Ga0495633_0007470 3300046558 Bacteria 6284
1727 Ga0495633_0117301 3300046558 Bacteria 1233
1728 Ga0495668_0000759 3300046616 Bacteria 37993
1729 Ga0495625_0000064 3300046660 Bacteria 174730
1730 Ga0495625_0000189 3300046660 Bacteria 97637
1731 Ga0495625_0005244 3300046660 Bacteria 11925
1732 Ga0495625_0133908 3300046660 Bacteria 1676
1733 Ga0495625_0222655 3300046660 Bacteria 1236
1734 Ga0495625_0349640 3300046660 Bacteria 935
1735 Ga0495661_0046403 3300046665 Bacteria 2653
1736 Ga0495623_0066877 3300046679 Bacteria 2244
1737 Ga0495669_0000512 3300046684 Bacteria 17642
1738 Ga0495669_0007442 3300046684 Bacteria 4592
1739 Ga0495669_0048972 3300046684 Bacteria 1891
1740 Ga0495669_0051272 3300046684 Bacteria 1852
1741 Ga0495669_0339313 3300046684 Bacteria 726
1742 Ga0495670_0000004 3300046691 Bacteria 310086
1743 Ga0495670_0003293 3300046691 Bacteria 7958
1744 Ga0495671_0000007 3300046692 Bacteria 443069
1745 Ga0495649_0048964 3300046694 Bacteria 2296
1746 Ga0495600_0000530 3300046809 Bacteria 19818
1747 Ga0495636_0053222 3300047318 Bacteria 1699
1748 Ga0495683_0011752 3300047323 Bacteria 4604
1749 Ga0495687_003705 3300047443 Bacteria 10864
1750 Ga0495687_010391 3300047443 Bacteria 5108
1751 Ga0495677_0006237 3300047445 Bacteria 4502
1752 Ga0495677_0022715 3300047445 Bacteria 2276
1753 Ga0495677_0038412 3300047445 Bacteria 1749
1754 Ga0495685_059613 3300047447 Bacteria 1288
1755 Ga0495673_0016342 3300047469 Bacteria 3795
1756 Ga0495673_0029007 3300047469 Bacteria 2615
1757 Ga0495681_0000043 3300047470 Bacteria 115514
1758 Ga0495681_0012249 3300047470 Bacteria 5052
1759 Ga0495681_0143425 3300047470 Bacteria 1007
1760 Ga0495686_0000060 3300047472 Bacteria 237402
1761 Ga0495686_0000091 3300047472 Bacteria 190563
1762 Ga0495686_0000904 3300047472 Bacteria 37345
1763 Ga0495686_0016391 3300047472 Bacteria 5026
1764 Ga0495686_0045492 3300047472 Bacteria 2777
1765 Ga0495686_0292211 3300047472 Bacteria 902
1766 Ga0495686_0326206 3300047472 Bacteria 840
1767 Ga0495602_0084339 3300048088 Bacteria 2659
1768 Ga0495615_0048339 3300048090 Bacteria 1087
1769 Ga0496100_0002351 3300048903 Bacteria 9571
1770 Ga0496100_0460623 3300048903 Bacteria 976
1771 Ga0496101_0000292 3300048904 Bacteria 34928
1772 Ga0496101_0025402 3300048904 Bacteria 4111
1773 Ga0496101_0170624 3300048904 Bacteria 1672
1774 Ga0496101_0414389 3300048904 Bacteria 1062
1775 Ga0496102_0016210 3300048905 Bacteria 6512
1776 Ga0496102_0162422 3300048905 Bacteria 2101
1777 Ga0496102_0464439 3300048905 Bacteria 1187
1778 Ga0496103_0000643 3300048906 Bacteria 26435
1779 Ga0496103_0109934 3300048906 Bacteria 1750
1780 Ga0496103_0213293 3300048906 Bacteria 1241
1781 Ga0496103_0443807 3300048906 Bacteria 832
1782 Ga0496104_0364311 3300048907 Bacteria 1358
1783 Ga0496104_0485077 3300048907 Bacteria 1147
1784 Ga0496104_0654645 3300048907 Bacteria 959
1785 Ga0496105_0051276 3300048908 Bacteria 3409
1786 Ga0496105_0099313 3300048908 Bacteria 2404
1787 Ga0496105_0191429 3300048908 Bacteria 1672
1788 Ga0496105_0257059 3300048908 Bacteria 1414
1789 Ga0496106_0014932 3300048909 Bacteria 5744
1790 Ga0496106_0043116 3300048909 Bacteria 3385
1791 Ga0496107_0003345 3300048910 Bacteria 10711
1792 Ga0496107_0011839 3300048910 Bacteria 6091
1793 Ga0496107_0049890 3300048910 Bacteria 3016
1794 Ga0496107_0069946 3300048910 Bacteria 2548
1795 Ga0496107_0080557 3300048910 Bacteria 2374
1796 Ga0496107_0139776 3300048910 Bacteria 1790
1797 Ga0496108_0001766 3300048911 Bacteria 17208
1798 Ga0496108_0001779 3300048911 Bacteria 17174
1799 Ga0496108_0046675 3300048911 Bacteria 3619
1800 Ga0496108_0047520 3300048911 Bacteria 3587
1801 Ga0496108_0318470 3300048911 Bacteria 1356
1802 Ga0496109_0004339 3300048912 Bacteria 11850
1803 Ga0496109_0010384 3300048912 Bacteria 7951
1804 Ga0496109_0010905 3300048912 Bacteria 7784
1805 Ga0496109_0012943 3300048912 Bacteria 7214
1806 Ga0496109_0085318 3300048912 Bacteria 2914
1807 Ga0496109_0092296 3300048912 Bacteria 2801
1808 Ga0496110_0001965 3300048913 Bacteria 15272
1809 Ga0496110_0008211 3300048913 Bacteria 8391
1810 Ga0496110_0043663 3300048913 Bacteria 3915
1811 Ga0496110_0137047 3300048913 Bacteria 2212
1812 Ga0496110_0775515 3300048913 Bacteria 863
1813 Ga0496111_0000323 3300048914 Bacteria 23780
1814 Ga0496111_0014202 3300048914 Bacteria 5434
1815 Ga0496111_0014437 3300048914 Bacteria 5395
1816 Ga0496111_0117561 3300048914 Bacteria 1962
1817 Ga0496111_0206021 3300048914 Bacteria 1462
1818 Ga0496111_0336937 3300048914 Bacteria 1117
1819 Ga0496112_0000161 3300048915 Bacteria 42407
1820 Ga0496112_0006533 3300048915 Bacteria 10253
1821 Ga0496112_0006858 3300048915 Bacteria 10042
1822 Ga0496112_0020565 3300048915 Bacteria 6257
1823 Ga0496112_0092289 3300048915 Bacteria 2997
1824 Ga0496112_0126383 3300048915 Bacteria 2527
1825 Ga0496112_0523582 3300048915 Bacteria 1120
1826 Ga0496113_0001079 3300048916 Bacteria 14769
1827 Ga0496113_0004623 3300048916 Bacteria 8484
1828 Ga0496113_0016895 3300048916 Bacteria 5051
1829 Ga0496113_0106545 3300048916 Bacteria 2177
1830 Ga0496113_0376792 3300048916 Bacteria 1139
1831 Ga0496114_0000092 3300048917 Bacteria 64974
1832 Ga0496115_0000428 3300048918 Bacteria 34193
1833 Ga0496116_0011628 3300048919 Bacteria 7263
1834 Ga0496116_0231958 3300048919 Bacteria 935
1835 Ga0496117_0005240 3300048920 Bacteria 13757
1836 Ga0496117_0009462 3300048920 Bacteria 9064
1837 Ga0496117_0121334 3300048920 Bacteria 1605
1838 Ga0496117_0128330 3300048920 Bacteria 1542
1839 Ga0496117_0171657 3300048920 Bacteria 1258
1840 Ga0496118_0000811 3300048921 Bacteria 49879
1841 Ga0496118_0020700 3300048921 Bacteria 5824
1842 Ga0496118_0125414 3300048921 Bacteria 1663
1843 Ga0496118_0126319 3300048921 Bacteria 1654
1844 Ga0496118_0330670 3300048921 Bacteria 822
1845 Ga0496118_0358344 3300048921 Bacteria 774
1846 Ga0496119_0107113 3300048922 Bacteria 1559
1847 Ga0496120_0023040 3300048923 Bacteria 3904
1848 Ga0496120_0082963 3300048923 Bacteria 1731
1849 Ga0496121_0000072 3300048924 Bacteria 244975
1850 Ga0496121_0000347 3300048924 Bacteria 96608
1851 Ga0496121_0000349 3300048924 Bacteria 96428
1852 Ga0496121_0018980 3300048924 Bacteria 6899
1853 Ga0496121_0048291 3300048924 Bacteria 3622
1854 Ga0496121_0072540 3300048924 Bacteria 2763
1855 Ga0496122_0067295 3300048925 Bacteria 2581
1856 Ga0496122_0085973 3300048925 Bacteria 2167
1857 Ga0496123_0044190 3300048926 Bacteria 3049
1858 Ga0496124_0000739 3300048927 Bacteria 53515
1859 Ga0496124_0138395 3300048927 Bacteria 1925
1860 Ga0496124_0223914 3300048927 Bacteria 1412
1861 Ga0496124_0419293 3300048927 Bacteria 923
1862 Ga0496124_0536752 3300048927 Bacteria 775
1863 Ga0496125_0029187 3300048928 Bacteria 4962
1864 Ga0496125_0040228 3300048928 Bacteria 4013
1865 Ga0496125_0102662 3300048928 Bacteria 2100
1866 Ga0496125_0132121 3300048928 Bacteria 1755
1867 Ga0496126_0044387 3300048929 Bacteria 4094
1868 Ga0496126_0215458 3300048929 Bacteria 1615
1869 Ga0496126_0608755 3300048929 Bacteria 860
1870 Ga0501306_005744 3300049127 Bacteria 1435
1871 Ga0501306_005768 3300049127 Bacteria 1433
1872 Ga0501309_032117 3300049129 Bacteria 778
1873 Ga0501309_033098 3300049129 Bacteria 769
1874 Ga0501310_035028 3300049130 Bacteria 680
1875 Ga0501305_006306 3300049161 Bacteria 1468
1876 Ga0501307_014062 3300049162 Bacteria 973
1877 Ga0495678_019508 3300049459 Bacteria 3023
1878 Ga0495682_0029467 3300049460 Bacteria 2033
1879 Ga0495682_0054194 3300049460 Bacteria 1456
1880 Ga0501290_000007 3300049513 Bacteria 38548
1881 Ga0501292_000015 3300049515 Bacteria 64087
1882 Ga0501294_000459 3300049517 Bacteria 4795
1883 Ga0501300_002035 3300049523 Bacteria 3015
1884 Ga0501311_027722 3300049527 Bacteria 805
1885 Ga0501312_006891 3300049528 Bacteria 1435
1886 Ga0501313_010755 3300049529 Bacteria 1047
1887 Ga0501314_002498 3300049530 Bacteria 1426
1888 Ga0501315_011815 3300049531 Bacteria 1071
1889 Ga0501317_000859 3300049533 Bacteria 2388
1890 Ga0501317_008890 3300049533 Bacteria 1168
1891 Ga0501323_027378 3300049539 Bacteria 785
1892 Ga0501323_027665 3300049539 Bacteria 782
1893 Ga0501324_002322 3300049540 Bacteria 1368
1894 Ga0501324_008476 3300049540 Bacteria 907
1895 Ga0501333_002519 3300049549 Bacteria 1078
1896 Ga0501335_002933 3300049551 Bacteria 1420
1897 Ga0501337_005934 3300049553 Bacteria 826
1898 Ga0501338_03161 3300049554 Bacteria 964
1899 Ga0501031_0401735 3300049568 Bacteria 886
1900 Ga0501032_0143636 3300049569 Bacteria 1571
1901 Ga0501033_0156163 3300049570 Bacteria 1644
1902 Ga0501034_0056271 3300049571 Bacteria 3958
1903 Ga0501034_0298252 3300049571 Bacteria 1549
1904 Ga0501036_0518949 3300049572 Bacteria 991
1905 Ga0501043_0150904 3300049579 Bacteria 1819
1906 Ga0501043_0214668 3300049579 Bacteria 1490
1907 Ga0501046_0236856 3300049580 Bacteria 1347
1908 Ga0501047_0076865 3300049581 Bacteria 3213
1909 Ga0501047_0520160 3300049581 Bacteria 1016
1910 Ga0501047_0689180 3300049581 Bacteria 840
1911 Ga0501068_0173040 3300049584 Bacteria 1363
1912 Ga0501070_0080765 3300049586 Bacteria 2690
1913 Ga0501070_0210243 3300049586 Bacteria 1597
1914 Ga0501198_007662 3300049649 Bacteria 1556
1915 Ga0501206_001153 3300049653 Bacteria 3295
1916 Ga0501209_111683 3300049656 Bacteria 807
1917 Ga0501222_001017 3300049662 Bacteria 3992
1918 Ga0501223_000042 3300049663 Bacteria 44258
1919 Ga0501223_000214 3300049663 Bacteria 14812
1920 Ga0501223_004972 3300049663 Bacteria 2812
1921 Ga0501224_000031 3300049664 Bacteria 43294
1922 Ga0501224_008638 3300049664 Bacteria 1486
1923 Ga0501227_066995 3300049665 Bacteria 928
1924 Ga0501233_000068 3300049668 Bacteria 13583
1925 Ga0501233_065502 3300049668 Bacteria 911
1926 Ga0501235_008358 3300049669 Bacteria 2258
1927 Ga0501235_013185 3300049669 Bacteria 1819
1928 Ga0501249_000079 3300049679 Bacteria 31536
1929 Ga0501257_001257 3300049686 Bacteria 5208
1930 Ga0501261_001291 3300049690 Bacteria 3075
1931 Ga0501221_004253 3300049704 Bacteria 2374
1932 Ga0501225_0000070 3300049705 Bacteria 33694
1933 Ga0501225_0000520 3300049705 Bacteria 12018
1934 Ga0501225_0003808 3300049705 Bacteria 4533
1935 Ga0501225_0019156 3300049705 Bacteria 1894
1936 Ga0501225_0108329 3300049705 Bacteria 817
1937 Ga0501229_012675 3300049706 Bacteria 1078
1938 Ga0501234_001986 3300049707 Bacteria 3235
1939 Ga0501245_003957 3300049708 Bacteria 2025
1940 Ga0501080_0090579 3300049742 Bacteria 2841
1941 Ga0501080_0226892 3300049742 Bacteria 1708
1942 Ga0501262_006069 3300049759 Bacteria 1438
1943 Ga0501272_015792 3300049769 Bacteria 880
1944 Ga0501273_010471 3300049770 Bacteria 1140
1945 Ga0501279_000015 3300049775 Bacteria 64426
1946 Ga0501279_013398 3300049775 Bacteria 1123
1947 Ga0501280_000076 3300049776 Bacteria 26206
1948 Ga0501281_00692 3300049777 Bacteria 2928
1949 Ga0501282_017523 3300049778 Bacteria 781
1950 Ga0501035_0320754 3300049822 Bacteria 1302
1951 Ga0501044_0055834 3300049823 Bacteria 4055
1952 Ga0501044_0061238 3300049823 Bacteria 3851
1953 Ga0501044_0505326 3300049823 Bacteria 1109
1954 Ga0501204_024551 3300049850 Bacteria 806
1955 Ga0501226_000051 3300049853 Bacteria 49149
1956 nmdc:mga00v17_334012_c1 3300050491 Bacteria 985
1957 nmdc:mga0yw44_521925_c1 3300050492 Bacteria 806
1958 nmdc:mga06z11_513_c1 3300050494 Bacteria 14293
1959 nmdc:mga04h51_241_c1 3300050495 Bacteria 14370
1960 nmdc:mga07m45_107902_c1 3300050496 Bacteria 1602
1961 nmdc:mga07m45_70943_c1 3300050496 Bacteria 1982
1962 nmdc:mga0qj67_45931_c1 3300050509 Bacteria 3446
1963 Ga0495612_0109925 3300053078 Bacteria 1179
1964 Ga0500610_0000069 3300053079 Bacteria 31273
1965 Ga0500643_000166 3300053087 Bacteria 65586
1966 Ga0500643_001656 3300053087 Bacteria 12420
1967 Ga0500643_008204 3300053087 Bacteria 4129
1968 Ga0500643_017972 3300053087 Bacteria 2356
1969 Ga0500643_042974 3300053087 Bacteria 1319
1970 Ga0500566_0000633 3300053094 Bacteria 19622
1971 Ga0500641_0015756 3300053096 Bacteria 2810
1972 Ga0500555_000965 3300053103 Bacteria 9967
1973 Ga0500562_124647 3300053108 Bacteria 702
1974 Ga0500572_153674 3300053111 Bacteria 752
1975 Ga0500592_000226 3300053116 Bacteria 10274
1976 Ga0500595_017070 3300053119 Bacteria 2690
1977 Ga0500597_016953 3300053120 Bacteria 2791
1978 Ga0500642_0000268 3300053130 Bacteria 19498
1979 Ga0500652_063317 3300053131 Bacteria 1526
1980 Ga0500559_0000227 3300053136 Bacteria 44722
1981 Ga0500559_0009983 3300053136 Bacteria 4090
1982 Ga0500559_0162447 3300053136 Bacteria 1050
1983 Ga0500568_0006231 3300053139 Bacteria 6021
1984 Ga0500573_0000045 3300053140 Bacteria 98878
1985 Ga0500604_0017646 3300053151 Bacteria 1979
1986 Ga0500616_0009696 3300053153 Bacteria 5825
1987 Ga0500622_0336067 3300053156 Bacteria 632
1988 Ga0500624_000001 3300053157 Bacteria 284974
1989 Ga0500627_0276073 3300053158 Bacteria 739
1990 Ga0500639_167588 3300053163 Bacteria 990
1991 Ga0500637_0001304 3300053178 Bacteria 10485
1992 Ga0500637_0318890 3300053178 Bacteria 840
1993 Ga0500611_000848 3300053727 Bacteria 3173
1994 Ga0500645_000037 3300053730 Bacteria 112944
1995 Ga0500645_064700 3300053730 Bacteria 1054
1996 Ga0500596_013838 3300053735 Bacteria 1216
1997 Ga0587084_006819 3300059477 Bacteria 1399
1998 Ga0587090_005411 3300059510 Bacteria 1599
1999 Ga0587092_008218 3300059512 Bacteria 1373
2000 Ga0587101_025311 3300059623 Bacteria 888
2001 Ga0587068_043091 3300059641 Bacteria 823
2002 Ga0587076_089455 3300059645 Bacteria 671
2003 Ga0587079_052713 3300059647 Bacteria 859
2004 Ga0587120_014612 3300059659 Bacteria 703
2005 Ga0466962_0003328 3300061719 Bacteria 7636
2006 Ga0466962_0064663 3300061719 Bacteria 1746
2007 Ga0466962_0081669 3300061719 Bacteria 1546
2008 Ga0466962_0112922 3300061719 Bacteria 1309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300012475 Ga0157317_1000906 Ga0157317_10009063 154
2 3300046457 Ga0495590_0276979 Ga0495590_0276979_48_614 154
3 3300003762 Ga0055542_1000078 Ga0055542_100007818 155
4 3300003762 Ga0055542_1000791 Ga0055542_100079110 155
5 3300003763 Ga0055529_1000007 Ga0055529_1000007245 155
6 3300025254 Ga0209148_1000026 Ga0209148_1000026140 155
7 3300025272 Ga0209455_1000005 Ga0209455_1000005887 155
8 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006148 157
9 3300005457 Ga0070662_100894096 Ga0070662_1008940961 159
10 3300025297 Ga0209758_1000001 Ga0209758_10000011677 159
11 3300005719 Ga0068861_100876984 Ga0068861_1008769841 161
12 3300017792 Ga0163161_10228675 Ga0163161_102286751 161
13 3300025931 Ga0207644_10047287 Ga0207644_100472872 161
14 3300046524 Ga0495648_0001438 Ga0495648_0001438_1135_1749 161
15 3300002244 JGI24742J22300_10014313 JGI24742J22300_100143133 163
16 3300003579 Ga0007429J51699_1036535 Ga0007429J51699_10365353 163
17 3300005367 Ga0070667_100378489 Ga0070667_1003784893 163
18 3300005456 Ga0070678_100001865 Ga0070678_1000018653 163
19 3300006881 Ga0068865_100382932 Ga0068865_1003829323 163
20 3300009148 Ga0105243_10000164 Ga0105243_1000016457 163
21 3300011119 Ga0105246_10255540 Ga0105246_102555403 163
22 3300013308 Ga0157375_10569314 Ga0157375_105693142 163
23 3300025926 Ga0207659_10076509 Ga0207659_100765094 163
24 3300025935 Ga0207709_10000123 Ga0207709_1000012345 163
25 3300025937 Ga0207669_10002136 Ga0207669_100021369 163
26 3300025938 Ga0207704_10113325 Ga0207704_101133253 163
27 3300025986 Ga0207658_10510136 Ga0207658_105101361 163
28 3300026089 Ga0207648_10066045 Ga0207648_100660455 163
29 3300026121 Ga0207683_10007711 Ga0207683_100077113 163
30 3300046519 Ga0495632_0145657 Ga0495632_0145657_159_773 163
31 3300046522 Ga0495643_0025789 Ga0495643_0025789_2667_3281 163
32 3300046528 Ga0495642_0016307 Ga0495642_0016307_1913_2527 163
33 3300047445 Ga0495677_0006237 Ga0495677_0006237_1578_2192 163
34 3300005344 Ga0070661_100213332 Ga0070661_1002133321 164
35 3300005455 Ga0070663_100473719 Ga0070663_1004737192 164
36 3300005563 Ga0068855_100372072 Ga0068855_1003720721 164
37 3300005614 Ga0068856_100118846 Ga0068856_1001188462 164
38 3300005616 Ga0068852_100458313 Ga0068852_1004583132 164
39 3300013102 Ga0157371_10054017 Ga0157371_100540172 164
40 3300013105 Ga0157369_10081998 Ga0157369_100819985 164
41 3300013296 Ga0157374_10092230 Ga0157374_100922303 164
42 3300025949 Ga0207667_10774955 Ga0207667_107749552 164
43 3300026067 Ga0207678_10054068 Ga0207678_100540685 164
44 3300026078 Ga0207702_10357344 Ga0207702_103573441 164
45 3300026142 Ga0207698_10020656 Ga0207698_100206568 164
46 3300026142 Ga0207698_10101973 Ga0207698_101019734 164
47 3300037853 Ga0436364_1244538 Ga0436364_1244538_355_945 164
48 3300041491 Ga0451833_0859678 Ga0451833_0859678_60_674 165
49 3300053136 Ga0500559_0000227 Ga0500559_0000227_1922_2509 165
50 3300053163 Ga0500639_167588 Ga0500639_167588_173_760 165
51 3300053178 Ga0500637_0318890 Ga0500637_0318890_144_731 165
52 3300003316 rootH1_10012727 rootH1_100127271 166
53 3300005328 Ga0070676_10212087 Ga0070676_102120872 166
54 3300005547 Ga0070693_100158225 Ga0070693_1001582252 166
55 3300005719 Ga0068861_100576059 Ga0068861_1005760591 166
56 3300009553 Ga0105249_10432012 Ga0105249_104320122 166
57 3300025246 Ga0209646_1003961 Ga0209646_10039614 166
58 3300028786 Ga0307517_10010919 Ga0307517_1001091910 166
59 3300001979 JGI24740J21852_10000594 JGI24740J21852_1000059414 167
60 3300001989 JGI24739J22299_10000311 JGI24739J22299_1000031115 167
61 3300001990 JGI24737J22298_10000013 JGI24737J22298_1000001322 167
62 3300002075 JGI24738J21930_10001262 JGI24738J21930_100012621 167
63 3300005330 Ga0070690_100010994 Ga0070690_1000109947 167
64 3300005331 Ga0070670_100705091 Ga0070670_1007050911 167
65 3300005333 Ga0070677_10011538 Ga0070677_100115382 167
66 3300005334 Ga0068869_100000237 Ga0068869_1000002376 167
67 3300005338 Ga0068868_100002570 Ga0068868_1000025708 167
68 3300005338 Ga0068868_100059688 Ga0068868_1000596883 167
69 3300005340 Ga0070689_100754861 Ga0070689_1007548611 167
70 3300005343 Ga0070687_100200798 Ga0070687_1002007982 167
71 3300005353 Ga0070669_100008277 Ga0070669_1000082776 167
72 3300005364 Ga0070673_100000113 Ga0070673_10000011325 167
73 3300005366 Ga0070659_100003603 Ga0070659_1000036036 167
74 3300005366 Ga0070659_100974101 Ga0070659_1009741011 167
75 3300005367 Ga0070667_100008122 Ga0070667_1000081224 167
76 3300005456 Ga0070678_101079006 Ga0070678_1010790061 167
77 3300005457 Ga0070662_100005546 Ga0070662_1000055467 167
78 3300005459 Ga0068867_100001363 Ga0068867_1000013632 167
79 3300005539 Ga0068853_100001253 Ga0068853_10000125316 167
80 3300005543 Ga0070672_100034757 Ga0070672_1000347575 167
81 3300005543 Ga0070672_100322334 Ga0070672_1003223343 167
82 3300005544 Ga0070686_100339924 Ga0070686_1003399242 167
83 3300005563 Ga0068855_100003124 Ga0068855_10000312413 167
84 3300005564 Ga0070664_100055976 Ga0070664_1000559765 167
85 3300005577 Ga0068857_100000736 Ga0068857_1000007368 167
86 3300005578 Ga0068854_100001981 Ga0068854_10000198113 167
87 3300005617 Ga0068859_100000689 Ga0068859_1000006899 167
88 3300005617 Ga0068859_100001164 Ga0068859_10000116426 167
89 3300005618 Ga0068864_100000764 Ga0068864_10000076426 167
90 3300005618 Ga0068864_100001152 Ga0068864_10000115220 167
91 3300005718 Ga0068866_10031178 Ga0068866_100311783 167
92 3300005834 Ga0068851_10079544 Ga0068851_100795443 167
93 3300005841 Ga0068863_100020017 Ga0068863_1000200177 167
94 3300005842 Ga0068858_100005166 Ga0068858_1000051669 167
95 3300005842 Ga0068858_100006215 Ga0068858_1000062159 167
96 3300005842 Ga0068858_100516657 Ga0068858_1005166572 167
97 3300006237 Ga0097621_100036110 Ga0097621_1000361103 167
98 3300006353 Ga0075370_10133409 Ga0075370_101334092 167
99 3300006358 Ga0068871_100624407 Ga0068871_1006244071 167
100 3300006931 Ga0097620_100000689 Ga0097620_1000006899 167
101 3300006931 Ga0097620_100001164 Ga0097620_1000011645 167
102 3300009092 Ga0105250_10014249 Ga0105250_100142494 167
103 3300009098 Ga0105245_10000275 Ga0105245_100002757 167
104 3300009148 Ga0105243_10215368 Ga0105243_102153683 167
105 3300009148 Ga0105243_10270691 Ga0105243_102706912 167
106 3300009174 Ga0105241_10233554 Ga0105241_102335542 167
107 3300009177 Ga0105248_10002856 Ga0105248_100028568 167
108 3300009177 Ga0105248_10018539 Ga0105248_100185397 167
109 3300009553 Ga0105249_10019285 Ga0105249_100192857 167
110 3300013102 Ga0157371_10000637 Ga0157371_1000063740 167
111 3300013306 Ga0163162_10188736 Ga0163162_101887363 167
112 3300013307 Ga0157372_10088501 Ga0157372_100885014 167
113 3300013308 Ga0157375_10022053 Ga0157375_100220534 167
114 3300014325 Ga0163163_10000500 Ga0163163_1000050036 167
115 3300014745 Ga0157377_10039898 Ga0157377_100398982 167
116 3300014968 Ga0157379_10108244 Ga0157379_101082444 167
117 3300025711 Ga0207696_1011929 Ga0207696_10119295 167
118 3300025904 Ga0207647_10139122 Ga0207647_101391222 167
119 3300025940 Ga0207691_10034600 Ga0207691_100346005 167
120 3300025941 Ga0207711_10000044 Ga0207711_10000044116 167
121 3300025960 Ga0207651_10055669 Ga0207651_100556694 167
122 3300025986 Ga0207658_10007902 Ga0207658_100079027 167
123 3300026023 Ga0207677_10376244 Ga0207677_103762442 167
124 3300026035 Ga0207703_10007316 Ga0207703_100073169 167
125 3300026035 Ga0207703_10026676 Ga0207703_100266762 167
126 3300026067 Ga0207678_10638400 Ga0207678_106384002 167
127 3300026095 Ga0207676_10001310 Ga0207676_100013107 167
128 3300026118 Ga0207675_100217470 Ga0207675_1002174704 167
129 3300028380 Ga0268265_10595854 Ga0268265_105958542 167
130 3300037471 Ga0395905_0609346 Ga0395905_0609346_30_668 167
131 3300048912 Ga0496109_0092296 Ga0496109_0092296_1398_2090 167
132 3300048920 Ga0496117_0171657 Ga0496117_0171657_213_806 167
133 3300048923 Ga0496120_0023040 Ga0496120_0023040_2516_3109 167
134 3300048927 Ga0496124_0000739 Ga0496124_0000739_4167_4760 167
135 3300050496 nmdc:mga07m45_107902_c1 nmdc:mga07m45_107902_c1_348_944 167
136 3300059510 Ga0587090_005411 Ga0587090_005411_808_1464 167
137 3300001915 JGI24741J21665_1000982 JGI24741J21665_10009822 168
138 3300001979 JGI24740J21852_10001036 JGI24740J21852_100010369 168
139 3300002067 JGI24735J21928_10022329 JGI24735J21928_100223291 168
140 3300005344 Ga0070661_100072020 Ga0070661_1000720201 168
141 3300005366 Ga0070659_100710208 Ga0070659_1007102081 168
142 3300005455 Ga0070663_100062847 Ga0070663_1000628475 168
143 3300005459 Ga0068867_100172524 Ga0068867_1001725242 168
144 3300005548 Ga0070665_100003898 Ga0070665_10000389812 168
145 3300005563 Ga0068855_100204747 Ga0068855_1002047475 168
146 3300005564 Ga0070664_100051211 Ga0070664_1000512112 168
147 3300005578 Ga0068854_100284143 Ga0068854_1002841432 168
148 3300005578 Ga0068854_100407423 Ga0068854_1004074231 168
149 3300005616 Ga0068852_100256428 Ga0068852_1002564283 168
150 3300005841 Ga0068863_100009132 Ga0068863_1000091325 168
151 3300014326 Ga0157380_10145536 Ga0157380_101455364 168
152 3300025907 Ga0207645_10013619 Ga0207645_100136194 168
153 3300025909 Ga0207705_10016836 Ga0207705_100168366 168
154 3300025912 Ga0207707_10017099 Ga0207707_100170992 168
155 3300025917 Ga0207660_10017439 Ga0207660_100174395 168
156 3300025919 Ga0207657_10003125 Ga0207657_1000312510 168
157 3300025920 Ga0207649_10030980 Ga0207649_100309802 168
158 3300025933 Ga0207706_10002904 Ga0207706_1000290415 168
159 3300025933 Ga0207706_10165081 Ga0207706_101650812 168
160 3300025945 Ga0207679_10070193 Ga0207679_100701935 168
161 3300025949 Ga0207667_10373400 Ga0207667_103734003 168
162 3300026041 Ga0207639_10504622 Ga0207639_105046221 168
163 3300026067 Ga0207678_10110234 Ga0207678_101102345 168
164 3300026088 Ga0207641_10002463 Ga0207641_1000246316 168
165 3300026089 Ga0207648_10182280 Ga0207648_101822802 168
166 3300026116 Ga0207674_10008541 Ga0207674_1000854114 168
167 3300028379 Ga0268266_10000315 Ga0268266_1000031561 168
168 3300037418 Ga0395900_0196867 Ga0395900_0196867_824_1450 168
169 3300037471 Ga0395905_0087794 Ga0395905_0087794_1704_2360 168
170 3300042007 Ga0439449_0066737 Ga0439449_0066737_26_643 168
171 3300049581 Ga0501047_0520160 Ga0501047_0520160_318_941 168
172 3300049586 Ga0501070_0080765 Ga0501070_0080765_1526_2149 168
173 3300049742 Ga0501080_0226892 Ga0501080_0226892_735_1358 168
174 3300005338 Ga0068868_100677396 Ga0068868_1006773961 169
175 3300005548 Ga0070665_100008348 Ga0070665_10000834811 169
176 3300013104 Ga0157370_10185576 Ga0157370_101855764 169
177 3300025901 Ga0207688_10103714 Ga0207688_101037142 169
178 3300025942 Ga0207689_10288442 Ga0207689_102884422 169
179 3300031548 Ga0307408_100166926 Ga0307408_1001669262 169
180 3300031731 Ga0307405_10106086 Ga0307405_101060861 169
181 3300031911 Ga0307412_10010301 Ga0307412_100103014 169
182 3300032004 Ga0307414_10001010 Ga0307414_100010104 169
183 3300042439 Ga0439464_0016573 Ga0439464_0016573_143_829 169
184 3300044842 Ga0466957_0277146 Ga0466957_0277146_233_850 169
185 3300045976 Ga0466967_0055341 Ga0466967_0055341_2662_3279 169
186 3300047445 Ga0495677_0038412 Ga0495677_0038412_709_1344 169
187 3300049571 Ga0501034_0056271 Ga0501034_0056271_1897_2493 169
188 3300049663 Ga0501223_000214 Ga0501223_000214_8799_9395 169
189 3300049664 Ga0501224_000031 Ga0501224_000031_29197_29793 169
190 3300049668 Ga0501233_000068 Ga0501233_000068_9584_10180 169
191 3300049669 Ga0501235_008358 Ga0501235_008358_1411_2007 169
192 3300049705 Ga0501225_0000070 Ga0501225_0000070_13541_14137 169
193 3300049707 Ga0501234_001986 Ga0501234_001986_2531_3127 169
194 3300049853 Ga0501226_000051 Ga0501226_000051_35177_35773 169
195 3300053130 Ga0500642_0000268 Ga0500642_0000268_3877_4488 169
196 3300005328 Ga0070676_10073929 Ga0070676_100739293 170
197 3300005331 Ga0070670_100005828 Ga0070670_10000582814 170
198 3300005366 Ga0070659_100194843 Ga0070659_1001948432 170
199 3300005367 Ga0070667_100324669 Ga0070667_1003246692 170
200 3300005563 Ga0068855_100881370 Ga0068855_1008813701 170
201 3300006175 Ga0070712_100284140 Ga0070712_1002841403 170
202 3300025915 Ga0207693_10281847 Ga0207693_102818471 170
203 3300025919 Ga0207657_10006548 Ga0207657_1000654816 170
204 3300025925 Ga0207650_10036184 Ga0207650_100361842 170
205 3300025986 Ga0207658_10020014 Ga0207658_100200145 170
206 3300031731 Ga0307405_10006669 Ga0307405_100066699 170
207 3300031852 Ga0307410_10004647 Ga0307410_1000464711 170
208 3300037471 Ga0395905_0000218 Ga0395905_0000218_74472_75086 170
209 3300046694 Ga0495649_0048964 Ga0495649_0048964_1466_2080 170
210 3300047323 Ga0495683_0011752 Ga0495683_0011752_3945_4559 170
211 3300047443 Ga0495687_010391 Ga0495687_010391_3458_4072 170
212 3300001990 JGI24737J22298_10005360 JGI24737J22298_100053603 171
213 3300001990 JGI24737J22298_10026184 JGI24737J22298_100261841 171
214 3300003759 Ga0055525_1000040 Ga0055525_100004087 171
215 3300005288 Ga0065714_10076962 Ga0065714_100769623 171
216 3300005344 Ga0070661_100014173 Ga0070661_1000141732 171
217 3300005355 Ga0070671_100030708 Ga0070671_1000307085 171
218 3300005366 Ga0070659_100251614 Ga0070659_1002516142 171
219 3300005435 Ga0070714_100108202 Ga0070714_1001082021 171
220 3300005436 Ga0070713_101275045 Ga0070713_1012750451 171
221 3300005548 Ga0070665_100999570 Ga0070665_1009995701 171
222 3300005564 Ga0070664_100128768 Ga0070664_1001287683 171
223 3300005842 Ga0068858_100031031 Ga0068858_1000310313 171
224 3300005843 Ga0068860_100204294 Ga0068860_1002042942 171
225 3300009545 Ga0105237_10410907 Ga0105237_104109073 171
226 3300013307 Ga0157372_10386951 Ga0157372_103869512 171
227 3300020081 Ga0206354_10542035 Ga0206354_105420351 171
228 3300025226 Ga0209674_105486 Ga0209674_1054863 171
229 3300025230 Ga0209563_100019 Ga0209563_100019190 171
230 3300025250 Ga0209026_1013778 Ga0209026_10137781 171
231 3300025321 Ga0207656_10014997 Ga0207656_100149973 171
232 3300025914 Ga0207671_10012401 Ga0207671_100124018 171
233 3300025919 Ga0207657_10111534 Ga0207657_101115344 171
234 3300025920 Ga0207649_10002156 Ga0207649_1000215611 171
235 3300025924 Ga0207694_10003169 Ga0207694_1000316914 171
236 3300025928 Ga0207700_10933996 Ga0207700_109339961 171
237 3300025931 Ga0207644_10003018 Ga0207644_100030187 171
238 3300025931 Ga0207644_10348761 Ga0207644_103487613 171
239 3300025932 Ga0207690_10000213 Ga0207690_100002138 171
240 3300025934 Ga0207686_10970650 Ga0207686_109706501 171
241 3300025945 Ga0207679_10109487 Ga0207679_101094874 171
242 3300026035 Ga0207703_10004178 Ga0207703_100041783 171
243 3300026067 Ga0207678_10000625 Ga0207678_1000062520 171
244 3300026088 Ga0207641_10182174 Ga0207641_101821743 171
245 3300026142 Ga0207698_10492571 Ga0207698_104925712 171
246 3300028379 Ga0268266_10494660 Ga0268266_104946602 171
247 3300028381 Ga0268264_10222948 Ga0268264_102229482 171
248 3300028786 Ga0307517_10015604 Ga0307517_100156048 171
249 3300035691 Ga0373931_0009585 Ga0373931_0009585_1646_2260 171
250 3300037312 Ga0395899_0109509 Ga0395899_0109509_102_713 171
251 3300037471 Ga0395905_0643619 Ga0395905_0643619_200_811 171
252 3300039437 Ga0436365_1765941 Ga0436365_1765941_438_1049 171
253 3300044659 Ga0466973_0265260 Ga0466973_0265260_25_633 171
254 3300044694 Ga0466963_0001571 Ga0466963_0001571_4541_5152 171
255 3300044694 Ga0466963_0015629 Ga0466963_0015629_1452_2063 171
256 3300044842 Ga0466957_0003468 Ga0466957_0003468_4832_5443 171
257 3300045976 Ga0466967_0021736 Ga0466967_0021736_335_946 171
258 3300046684 Ga0495669_0007442 Ga0495669_0007442_537_1205 171
259 3300048912 Ga0496109_0012943 Ga0496109_0012943_130_726 171
260 3300048916 Ga0496113_0376792 Ga0496113_0376792_86_682 171
261 3300048928 Ga0496125_0132121 Ga0496125_0132121_718_1314 171
262 3300049523 Ga0501300_002035 Ga0501300_002035_71_676 171
263 3300049686 Ga0501257_001257 Ga0501257_001257_2196_2813 171
264 3300053139 Ga0500568_0006231 Ga0500568_0006231_3682_4290 171
265 3300059512 Ga0587092_008218 Ga0587092_008218_18_629 171
266 3300059641 Ga0587068_043091 Ga0587068_043091_184_795 171
267 3300059659 Ga0587120_014612 Ga0587120_014612_17_628 171
268 3300001979 JGI24740J21852_10019834 JGI24740J21852_100198342 172
269 3300001989 JGI24739J22299_10009771 JGI24739J22299_100097712 172
270 3300001990 JGI24737J22298_10008817 JGI24737J22298_100088175 172
271 3300002075 JGI24738J21930_10004129 JGI24738J21930_100041294 172
272 3300005289 Ga0065704_10153439 Ga0065704_101534392 172
273 3300005295 Ga0065707_10099471 Ga0065707_100994711 172
274 3300005327 Ga0070658_10046129 Ga0070658_100461295 172
275 3300005329 Ga0070683_100155367 Ga0070683_1001553672 172
276 3300005331 Ga0070670_100035587 Ga0070670_1000355875 172
277 3300005335 Ga0070666_10023981 Ga0070666_100239812 172
278 3300005335 Ga0070666_10025521 Ga0070666_100255215 172
279 3300005337 Ga0070682_100145093 Ga0070682_1001450932 172
280 3300005344 Ga0070661_100043002 Ga0070661_1000430025 172
281 3300005364 Ga0070673_100021007 Ga0070673_1000210077 172
282 3300005364 Ga0070673_100033993 Ga0070673_1000339935 172
283 3300005366 Ga0070659_100003637 Ga0070659_1000036377 172
284 3300005367 Ga0070667_100007592 Ga0070667_1000075925 172
285 3300005455 Ga0070663_100036804 Ga0070663_1000368045 172
286 3300005456 Ga0070678_100006193 Ga0070678_1000061935 172
287 3300005457 Ga0070662_100001998 Ga0070662_10000199816 172
288 3300005543 Ga0070672_100052000 Ga0070672_1000520008 172
289 3300005548 Ga0070665_100004114 Ga0070665_1000041149 172
290 3300005548 Ga0070665_100014696 Ga0070665_10001469613 172
291 3300005564 Ga0070664_100024836 Ga0070664_1000248367 172
292 3300005577 Ga0068857_100015256 Ga0068857_1000152563 172
293 3300005578 Ga0068854_100004380 Ga0068854_1000043804 172
294 3300005616 Ga0068852_100016593 Ga0068852_1000165935 172
295 3300005617 Ga0068859_101087852 Ga0068859_1010878521 172
296 3300005840 Ga0068870_10317466 Ga0068870_103174661 172
297 3300005842 Ga0068858_100111521 Ga0068858_1001115213 172
298 3300006931 Ga0097620_101087752 Ga0097620_1010877521 172
299 3300009093 Ga0105240_10854143 Ga0105240_108541432 172
300 3300009148 Ga0105243_10349110 Ga0105243_103491101 172
301 3300011119 Ga0105246_10622155 Ga0105246_106221551 172
302 3300013102 Ga0157371_10033519 Ga0157371_100335193 172
303 3300013102 Ga0157371_10305919 Ga0157371_103059192 172
304 3300013296 Ga0157374_10007945 Ga0157374_100079459 172
305 3300013306 Ga0163162_10017714 Ga0163162_1001771412 172
306 3300013307 Ga0157372_10077873 Ga0157372_100778732 172
307 3300013308 Ga0157375_10035812 Ga0157375_100358124 172
308 3300014745 Ga0157377_10573703 Ga0157377_105737031 172
309 3300025904 Ga0207647_10004391 Ga0207647_1000439114 172
310 3300025907 Ga0207645_10020146 Ga0207645_100201465 172
311 3300025909 Ga0207705_10062830 Ga0207705_100628302 172
312 3300025909 Ga0207705_10258245 Ga0207705_102582453 172
313 3300025919 Ga0207657_10009948 Ga0207657_100099489 172
314 3300025919 Ga0207657_10337786 Ga0207657_103377861 172
315 3300025919 Ga0207657_10421043 Ga0207657_104210432 172
316 3300025920 Ga0207649_10028053 Ga0207649_100280535 172
317 3300025925 Ga0207650_10052383 Ga0207650_100523833 172
318 3300025932 Ga0207690_10035483 Ga0207690_100354833 172
319 3300025933 Ga0207706_10001681 Ga0207706_100016813 172
320 3300025938 Ga0207704_10075826 Ga0207704_100758262 172
321 3300025944 Ga0207661_10127973 Ga0207661_101279732 172
322 3300025945 Ga0207679_10056546 Ga0207679_100565462 172
323 3300025972 Ga0207668_10076582 Ga0207668_100765823 172
324 3300025981 Ga0207640_10107282 Ga0207640_101072822 172
325 3300025986 Ga0207658_10047562 Ga0207658_100475624 172
326 3300026041 Ga0207639_10242398 Ga0207639_102423982 172
327 3300026067 Ga0207678_10002012 Ga0207678_100020129 172
328 3300026089 Ga0207648_10315417 Ga0207648_103154172 172
329 3300026116 Ga0207674_10005155 Ga0207674_1000515515 172
330 3300026121 Ga0207683_10334750 Ga0207683_103347501 172
331 3300028379 Ga0268266_10040809 Ga0268266_100408093 172
332 3300028380 Ga0268265_11491259 Ga0268265_114912591 172
333 3300031824 Ga0307413_10601644 Ga0307413_106016441 172
334 3300031911 Ga0307412_10969519 Ga0307412_109695191 172
335 3300031995 Ga0307409_100269587 Ga0307409_1002695872 172
336 3300032005 Ga0307411_10006255 Ga0307411_1000625511 172
337 3300037418 Ga0395900_0582892 Ga0395900_0582892_54_665 172
338 3300037471 Ga0395905_0003525 Ga0395905_0003525_14855_15466 172
339 3300037471 Ga0395905_0029054 Ga0395905_0029054_4024_4662 172
340 3300044694 Ga0466963_0286199 Ga0466963_0286199_404_1018 172
341 3300044842 Ga0466957_0018902 Ga0466957_0018902_2184_2792 172
342 3300045836 Ga0466958_0410413 Ga0466958_0410413_243_851 172
343 3300045976 Ga0466967_0032298 Ga0466967_0032298_2704_3318 172
344 3300045976 Ga0466967_0268400 Ga0466967_0268400_649_1245 172
345 3300045976 Ga0466967_0858709 Ga0466967_0858709_169_777 172
346 3300046616 Ga0495668_0000759 Ga0495668_0000759_21832_22452 172
347 3300048924 Ga0496121_0000347 Ga0496121_0000347_2715_3314 172
348 3300049460 Ga0495682_0054194 Ga0495682_0054194_553_1173 172
349 3300049656 Ga0501209_111683 Ga0501209_111683_130_765 172
350 3300049770 Ga0501273_010471 Ga0501273_010471_112_747 172
351 3300001990 JGI24737J22298_10076503 JGI24737J22298_100765032 173
352 3300005327 Ga0070658_10019971 Ga0070658_100199717 173
353 3300005330 Ga0070690_100010584 Ga0070690_1000105845 173
354 3300005336 Ga0070680_100006563 Ga0070680_1000065638 173
355 3300005338 Ga0068868_100001197 Ga0068868_10000119718 173
356 3300005353 Ga0070669_100140188 Ga0070669_1001401883 173
357 3300005355 Ga0070671_100011784 Ga0070671_10001178410 173
358 3300005356 Ga0070674_100003736 Ga0070674_1000037365 173
359 3300005367 Ga0070667_100040063 Ga0070667_1000400635 173
360 3300005367 Ga0070667_100231273 Ga0070667_1002312732 173
361 3300005458 Ga0070681_10053445 Ga0070681_100534452 173
362 3300005459 Ga0068867_100119211 Ga0068867_1001192113 173
363 3300005530 Ga0070679_100419492 Ga0070679_1004194921 173
364 3300005544 Ga0070686_100030015 Ga0070686_1000300153 173
365 3300005547 Ga0070693_100187534 Ga0070693_1001875342 173
366 3300005563 Ga0068855_100225629 Ga0068855_1002256294 173
367 3300005578 Ga0068854_100291170 Ga0068854_1002911702 173
368 3300005614 Ga0068856_100038415 Ga0068856_1000384158 173
369 3300005614 Ga0068856_100137688 Ga0068856_1001376882 173
370 3300005618 Ga0068864_100076147 Ga0068864_1000761473 173
371 3300005719 Ga0068861_100123824 Ga0068861_1001238244 173
372 3300005834 Ga0068851_10001992 Ga0068851_100019924 173
373 3300005842 Ga0068858_100000956 Ga0068858_10000095618 173
374 3300005844 Ga0068862_100001089 Ga0068862_10000108917 173
375 3300006237 Ga0097621_100014112 Ga0097621_1000141124 173
376 3300006881 Ga0068865_100014339 Ga0068865_1000143394 173
377 3300009176 Ga0105242_10173450 Ga0105242_101734503 173
378 3300009176 Ga0105242_10750569 Ga0105242_107505691 173
379 3300009177 Ga0105248_10003607 Ga0105248_1000360718 173
380 3300009553 Ga0105249_11132944 Ga0105249_111329442 173
381 3300009553 Ga0105249_11379244 Ga0105249_113792441 173
382 3300013100 Ga0157373_10167384 Ga0157373_101673842 173
383 3300013100 Ga0157373_10177754 Ga0157373_101777542 173
384 3300013102 Ga0157371_10076807 Ga0157371_100768074 173
385 3300013105 Ga0157369_10178401 Ga0157369_101784013 173
386 3300014968 Ga0157379_10319316 Ga0157379_103193161 173
387 3300017792 Ga0163161_10333951 Ga0163161_103339511 173
388 3300020069 Ga0197907_10628569 Ga0197907_106285691 173
389 3300025321 Ga0207656_10005833 Ga0207656_100058333 173
390 3300025903 Ga0207680_10000793 Ga0207680_100007936 173
391 3300025907 Ga0207645_10069037 Ga0207645_100690372 173
392 3300025909 Ga0207705_10015325 Ga0207705_100153256 173
393 3300025913 Ga0207695_10010505 Ga0207695_1001050513 173
394 3300025917 Ga0207660_10000036 Ga0207660_1000003624 173
395 3300025919 Ga0207657_10112650 Ga0207657_101126504 173
396 3300025921 Ga0207652_10277269 Ga0207652_102772692 173
397 3300025931 Ga0207644_10008908 Ga0207644_100089084 173
398 3300025932 Ga0207690_10034020 Ga0207690_100340201 173
399 3300025936 Ga0207670_10339522 Ga0207670_103395222 173
400 3300025937 Ga0207669_10161434 Ga0207669_101614342 173
401 3300025941 Ga0207711_10003187 Ga0207711_100031876 173
402 3300025941 Ga0207711_10346012 Ga0207711_103460122 173
403 3300025949 Ga0207667_10204134 Ga0207667_102041343 173
404 3300025960 Ga0207651_10055861 Ga0207651_100558614 173
405 3300025960 Ga0207651_10120928 Ga0207651_101209282 173
406 3300025961 Ga0207712_10242519 Ga0207712_102425191 173
407 3300025981 Ga0207640_10014906 Ga0207640_100149066 173
408 3300025986 Ga0207658_10001339 Ga0207658_1000133910 173
409 3300025986 Ga0207658_10655569 Ga0207658_106555691 173
410 3300026023 Ga0207677_10007135 Ga0207677_100071356 173
411 3300026023 Ga0207677_10020495 Ga0207677_100204956 173
412 3300026035 Ga0207703_10000661 Ga0207703_1000066127 173
413 3300026041 Ga0207639_10479070 Ga0207639_104790702 173
414 3300026067 Ga0207678_10314333 Ga0207678_103143332 173
415 3300026078 Ga0207702_10056816 Ga0207702_100568166 173
416 3300026118 Ga0207675_100123581 Ga0207675_1001235814 173
417 3300026142 Ga0207698_10125131 Ga0207698_101251314 173
418 3300028380 Ga0268265_10000877 Ga0268265_1000087723 173
419 3300028381 Ga0268264_10030328 Ga0268264_100303284 173
420 3300028381 Ga0268264_11242710 Ga0268264_112427101 173
421 3300031995 Ga0307409_100412273 Ga0307409_1004122731 173
422 3300032004 Ga0307414_10220923 Ga0307414_102209232 173
423 3300033180 Ga0307510_10232056 Ga0307510_102320563 173
424 3300037312 Ga0395899_0107111 Ga0395899_0107111_148_771 173
425 3300037418 Ga0395900_0000325 Ga0395900_0000325_35535_36158 173
426 3300037466 Ga0395898_0330150 Ga0395898_0330150_762_1385 173
427 3300037471 Ga0395905_0183937 Ga0395905_0183937_764_1447 173
428 3300038443 Ga0395901_0003360 Ga0395901_0003360_609_1232 173
429 3300046660 Ga0495625_0222655 Ga0495625_0222655_548_1204 173
430 3300046684 Ga0495669_0000512 Ga0495669_0000512_6235_6855 173
431 3300046684 Ga0495669_0048972 Ga0495669_0048972_229_867 173
432 3300046809 Ga0495600_0000530 Ga0495600_0000530_17177_17797 173
433 3300048910 Ga0496107_0069946 Ga0496107_0069946_434_1102 173
434 3300048910 Ga0496107_0080557 Ga0496107_0080557_1072_1692 173
435 3300048911 Ga0496108_0046675 Ga0496108_0046675_1163_1783 173
436 3300048912 Ga0496109_0085318 Ga0496109_0085318_331_951 173
437 3300048913 Ga0496110_0043663 Ga0496110_0043663_2367_2987 173
438 3300048914 Ga0496111_0014437 Ga0496111_0014437_894_1514 173
439 3300048915 Ga0496112_0006533 Ga0496112_0006533_7710_8330 173
440 3300048916 Ga0496113_0016895 Ga0496113_0016895_1077_1697 173
441 3300048927 Ga0496124_0419293 Ga0496124_0419293_241_843 173
442 3300049742 Ga0501080_0090579 Ga0501080_0090579_1556_2200 173
443 3300049822 Ga0501035_0320754 Ga0501035_0320754_637_1281 173
444 3300053730 Ga0500645_000037 Ga0500645_000037_104781_105401 173
445 3300005262 Ga0065165_1007422 Ga0065165_10074224 174
446 3300005331 Ga0070670_100026630 Ga0070670_1000266303 174
447 3300005347 Ga0070668_100052544 Ga0070668_1000525444 174
448 3300005355 Ga0070671_100084165 Ga0070671_1000841651 174
449 3300005364 Ga0070673_100152269 Ga0070673_1001522693 174
450 3300005563 Ga0068855_100386202 Ga0068855_1003862023 174
451 3300005564 Ga0070664_100034407 Ga0070664_1000344074 174
452 3300005617 Ga0068859_100407607 Ga0068859_1004076071 174
453 3300005618 Ga0068864_100007092 Ga0068864_1000070925 174
454 3300005718 Ga0068866_10326062 Ga0068866_103260622 174
455 3300006051 Ga0075364_10191074 Ga0075364_101910742 174
456 3300006195 Ga0075366_10007416 Ga0075366_100074165 174
457 3300006237 Ga0097621_100628490 Ga0097621_1006284902 174
458 3300006931 Ga0097620_100407613 Ga0097620_1004076131 174
459 3300009092 Ga0105250_10057796 Ga0105250_100577962 174
460 3300009174 Ga0105241_11135356 Ga0105241_111353561 174
461 3300009177 Ga0105248_10012759 Ga0105248_1001275910 174
462 3300013100 Ga0157373_10380692 Ga0157373_103806923 174
463 3300013105 Ga0157369_10223249 Ga0157369_102232493 174
464 3300013296 Ga0157374_10352727 Ga0157374_103527272 174
465 3300025899 Ga0207642_10193416 Ga0207642_101934163 174
466 3300025912 Ga0207707_10746584 Ga0207707_107465841 174
467 3300025931 Ga0207644_10013604 Ga0207644_100136044 174
468 3300025932 Ga0207690_10303147 Ga0207690_103031472 174
469 3300025937 Ga0207669_10054957 Ga0207669_100549574 174
470 3300025940 Ga0207691_10044424 Ga0207691_100444242 174
471 3300025940 Ga0207691_10129459 Ga0207691_101294593 174
472 3300025941 Ga0207711_10029068 Ga0207711_100290684 174
473 3300025941 Ga0207711_10091717 Ga0207711_100917173 174
474 3300025945 Ga0207679_10033250 Ga0207679_100332502 174
475 3300025945 Ga0207679_10124193 Ga0207679_101241933 174
476 3300025945 Ga0207679_10633586 Ga0207679_106335862 174
477 3300025960 Ga0207651_10117747 Ga0207651_101177474 174
478 3300026121 Ga0207683_10143345 Ga0207683_101433454 174
479 3300027543 Ga0209999_1018098 Ga0209999_10180982 174
480 3300031456 Ga0307513_10324308 Ga0307513_103243083 174
481 3300037466 Ga0395898_0357119 Ga0395898_0357119_451_1083 174
482 3300044901 Ga0466960_0023437 Ga0466960_0023437_1323_1943 174
483 3300046471 Ga0495650_0000058 Ga0495650_0000058_56779_57399 174
484 3300046507 Ga0495606_0021008 Ga0495606_0021008_689_1309 174
485 3300046557 Ga0495622_0007809 Ga0495622_0007809_2237_2857 174
486 3300046684 Ga0495669_0339313 Ga0495669_0339313_12_629 174
487 3300047318 Ga0495636_0053222 Ga0495636_0053222_176_796 174
488 3300047443 Ga0495687_003705 Ga0495687_003705_7482_8102 174
489 3300047447 Ga0495685_059613 Ga0495685_059613_485_1102 174
490 3300048910 Ga0496107_0003345 Ga0496107_0003345_8179_8796 174
491 3300048912 Ga0496109_0010905 Ga0496109_0010905_6541_7158 174
492 3300048914 Ga0496111_0336937 Ga0496111_0336937_82_708 174
493 3300048915 Ga0496112_0006858 Ga0496112_0006858_7132_7749 174
494 3300048917 Ga0496114_0000092 Ga0496114_0000092_6944_7573 174
495 3300049127 Ga0501306_005744 Ga0501306_005744_806_1414 174
496 3300049129 Ga0501309_033098 Ga0501309_033098_140_748 174
497 3300049130 Ga0501310_035028 Ga0501310_035028_22_630 174
498 3300049161 Ga0501305_006306 Ga0501305_006306_22_630 174
499 3300049162 Ga0501307_014062 Ga0501307_014062_22_630 174
500 3300049527 Ga0501311_027722 Ga0501311_027722_168_776 174
501 3300049528 Ga0501312_006891 Ga0501312_006891_806_1414 174
502 3300049529 Ga0501313_010755 Ga0501313_010755_408_1016 174
503 3300049530 Ga0501314_002498 Ga0501314_002498_18_626 174
504 3300049540 Ga0501324_008476 Ga0501324_008476_282_890 174
505 3300049649 Ga0501198_007662 Ga0501198_007662_64_672 174
506 3300049679 Ga0501249_000079 Ga0501249_000079_482_1090 174
507 3300049850 Ga0501204_024551 Ga0501204_024551_166_774 174
508 3300050491 nmdc:mga00v17_334012_c1 nmdc:mga00v17_334012_c1_250_858 174
509 3300053079 Ga0500610_0000069 Ga0500610_0000069_2334_2954 174
510 3300003791 Ga0055530_10005445 Ga0055530_100054457 175
511 3300003794 Ga0055531_10000008 Ga0055531_100000083 175
512 3300005262 Ga0065165_1033397 Ga0065165_10333971 175
513 3300005336 Ga0070680_100084875 Ga0070680_1000848752 175
514 3300005339 Ga0070660_100066481 Ga0070660_1000664814 175
515 3300005345 Ga0070692_10022048 Ga0070692_100220485 175
516 3300005353 Ga0070669_100236194 Ga0070669_1002361942 175
517 3300005366 Ga0070659_100060491 Ga0070659_1000604913 175
518 3300005458 Ga0070681_10691416 Ga0070681_106914161 175
519 3300005530 Ga0070679_100035071 Ga0070679_1000350716 175
520 3300005546 Ga0070696_100125082 Ga0070696_1001250822 175
521 3300005546 Ga0070696_100726468 Ga0070696_1007264682 175
522 3300005577 Ga0068857_100086426 Ga0068857_1000864264 175
523 3300005614 Ga0068856_100041186 Ga0068856_1000411865 175
524 3300005614 Ga0068856_100671866 Ga0068856_1006718662 175
525 3300005614 Ga0068856_101126795 Ga0068856_1011267952 175
526 3300005616 Ga0068852_100001648 Ga0068852_10000164811 175
527 3300005616 Ga0068852_100232945 Ga0068852_1002329452 175
528 3300009545 Ga0105237_10621132 Ga0105237_106211322 175
529 3300009553 Ga0105249_10053425 Ga0105249_100534255 175
530 3300013102 Ga0157371_10084425 Ga0157371_100844253 175
531 3300013102 Ga0157371_10110729 Ga0157371_101107291 175
532 3300013105 Ga0157369_10313222 Ga0157369_103132223 175
533 3300015690 Ga0183363_1001 Ga0183363_1001521 175
534 3300025298 Ga0209050_1000026 Ga0209050_1000026180 175
535 3300025304 Ga0209257_1000009 Ga0209257_1000009180 175
536 3300025315 Ga0207697_10037553 Ga0207697_100375532 175
537 3300025903 Ga0207680_10022044 Ga0207680_100220443 175
538 3300025907 Ga0207645_10110518 Ga0207645_101105181 175
539 3300025908 Ga0207643_10327096 Ga0207643_103270962 175
540 3300025914 Ga0207671_10166107 Ga0207671_101661071 175
541 3300025917 Ga0207660_10146102 Ga0207660_101461023 175
542 3300025921 Ga0207652_10080614 Ga0207652_100806144 175
543 3300025929 Ga0207664_10209192 Ga0207664_102091922 175
544 3300025940 Ga0207691_10565857 Ga0207691_105658571 175
545 3300025949 Ga0207667_10169517 Ga0207667_101695171 175
546 3300025949 Ga0207667_10349703 Ga0207667_103497032 175
547 3300025960 Ga0207651_10011246 Ga0207651_100112468 175
548 3300025961 Ga0207712_10255236 Ga0207712_102552361 175
549 3300025972 Ga0207668_10288027 Ga0207668_102880273 175
550 3300026035 Ga0207703_10109164 Ga0207703_101091643 175
551 3300026067 Ga0207678_10417137 Ga0207678_104171371 175
552 3300026078 Ga0207702_10127183 Ga0207702_101271833 175
553 3300026088 Ga0207641_11536028 Ga0207641_115360281 175
554 3300026095 Ga0207676_10014208 Ga0207676_100142081 175
555 3300026121 Ga0207683_10025235 Ga0207683_100252353 175
556 3300026142 Ga0207698_10001376 Ga0207698_100013769 175
557 3300026142 Ga0207698_10004925 Ga0207698_100049255 175
558 3300028379 Ga0268266_10032675 Ga0268266_100326756 175
559 3300031995 Ga0307409_101135797 Ga0307409_1011357971 175
560 3300032004 Ga0307414_10542168 Ga0307414_105421681 175
561 3300035111 Ga0373923_0033469 Ga0373923_0033469_270_935 175
562 3300035118 Ga0373954_0082775 Ga0373954_0082775_818_1495 175
563 3300035724 Ga0373933_0122438 Ga0373933_0122438_178_843 175
564 3300036401 Ga0373937_0085639 Ga0373937_0085639_1839_2516 175
565 3300037312 Ga0395899_0053354 Ga0395899_0053354_1814_2446 175
566 3300037418 Ga0395900_0023955 Ga0395900_0023955_5069_5725 175
567 3300037471 Ga0395905_0179700 Ga0395905_0179700_1251_1850 175
568 3300038443 Ga0395901_0134330 Ga0395901_0134330_631_1287 175
569 3300038443 Ga0395901_0215873 Ga0395901_0215873_707_1339 175
570 3300042461 Ga0439460_0049043 Ga0439460_0049043_200_826 175
571 3300044684 Ga0466966_0000001 Ga0466966_0000001_311105_311704 175
572 3300046513 Ga0495616_0112830 Ga0495616_0112830_190_810 175
573 3300046518 Ga0495631_0166832 Ga0495631_0166832_254_874 175
574 3300046558 Ga0495633_0002896 Ga0495633_0002896_6056_6676 175
575 3300046679 Ga0495623_0066877 Ga0495623_0066877_95_772 175
576 3300048088 Ga0495602_0084339 Ga0495602_0084339_460_1137 175
577 3300049570 Ga0501033_0156163 Ga0501033_0156163_412_1011 175
578 3300049572 Ga0501036_0518949 Ga0501036_0518949_203_802 175
579 3300049823 Ga0501044_0055834 Ga0501044_0055834_2281_2880 175
580 3300053078 Ga0495612_0109925 Ga0495612_0109925_329_994 175
581 3300053111 Ga0500572_153674 Ga0500572_153674_38_643 175
582 3300053136 Ga0500559_0009983 Ga0500559_0009983_89_694 175
583 3300001976 JGI24752J21851_1006279 JGI24752J21851_10062793 176
584 3300002067 JGI24735J21928_10089369 JGI24735J21928_100893692 176
585 3300002772 JGI25164J39214_1008973 JGI25164J39214_10089731 176
586 3300003214 JGI25165J46597_1000165 JGI25165J46597_100016517 176
587 3300003771 Ga0055526_1041573 Ga0055526_10415731 176
588 3300003773 Ga0055537_1003028 Ga0055537_10030285 176
589 3300005331 Ga0070670_100673807 Ga0070670_1006738071 176
590 3300005334 Ga0068869_100092294 Ga0068869_1000922942 176
591 3300005335 Ga0070666_10578448 Ga0070666_105784481 176
592 3300005337 Ga0070682_100594706 Ga0070682_1005947061 176
593 3300005339 Ga0070660_100174346 Ga0070660_1001743463 176
594 3300005344 Ga0070661_100008588 Ga0070661_1000085883 176
595 3300005344 Ga0070661_100584682 Ga0070661_1005846822 176
596 3300005355 Ga0070671_100131669 Ga0070671_1001316694 176
597 3300005364 Ga0070673_100143519 Ga0070673_1001435193 176
598 3300005366 Ga0070659_100222148 Ga0070659_1002221483 176
599 3300005367 Ga0070667_100044428 Ga0070667_1000444284 176
600 3300005367 Ga0070667_100650041 Ga0070667_1006500411 176
601 3300005435 Ga0070714_100633533 Ga0070714_1006335332 176
602 3300005456 Ga0070678_100321904 Ga0070678_1003219041 176
603 3300005457 Ga0070662_100515641 Ga0070662_1005156412 176
604 3300005459 Ga0068867_100193077 Ga0068867_1001930772 176
605 3300005530 Ga0070679_100564692 Ga0070679_1005646923 176
606 3300005539 Ga0068853_100905068 Ga0068853_1009050681 176
607 3300005546 Ga0070696_100595710 Ga0070696_1005957101 176
608 3300005547 Ga0070693_100087267 Ga0070693_1000872673 176
609 3300005564 Ga0070664_100054109 Ga0070664_1000541091 176
610 3300005564 Ga0070664_100254373 Ga0070664_1002543732 176
611 3300005577 Ga0068857_100006657 Ga0068857_1000066575 176
612 3300005578 Ga0068854_100050137 Ga0068854_1000501374 176
613 3300005614 Ga0068856_100007389 Ga0068856_1000073893 176
614 3300005614 Ga0068856_100038930 Ga0068856_1000389305 176
615 3300005614 Ga0068856_100338459 Ga0068856_1003384592 176
616 3300005614 Ga0068856_101438005 Ga0068856_1014380051 176
617 3300005616 Ga0068852_100044260 Ga0068852_1000442604 176
618 3300005616 Ga0068852_100235773 Ga0068852_1002357733 176
619 3300005616 Ga0068852_100475867 Ga0068852_1004758671 176
620 3300005617 Ga0068859_100648769 Ga0068859_1006487692 176
621 3300005618 Ga0068864_100041416 Ga0068864_1000414165 176
622 3300005834 Ga0068851_10060597 Ga0068851_100605973 176
623 3300005841 Ga0068863_100012748 Ga0068863_1000127485 176
624 3300005842 Ga0068858_100137772 Ga0068858_1001377722 176
625 3300005844 Ga0068862_100824275 Ga0068862_1008242751 176
626 3300005985 Ga0081539_10063450 Ga0081539_100634502 176
627 3300006237 Ga0097621_100077246 Ga0097621_1000772463 176
628 3300006358 Ga0068871_100196745 Ga0068871_1001967453 176
629 3300006358 Ga0068871_100868813 Ga0068871_1008688131 176
630 3300006931 Ga0097620_100648752 Ga0097620_1006487522 176
631 3300009093 Ga0105240_10168669 Ga0105240_101686693 176
632 3300009093 Ga0105240_10321673 Ga0105240_103216733 176
633 3300009174 Ga0105241_10359582 Ga0105241_103595821 176
634 3300009545 Ga0105237_10018056 Ga0105237_100180567 176
635 3300009545 Ga0105237_10194946 Ga0105237_101949464 176
636 3300009551 Ga0105238_10361224 Ga0105238_103612242 176
637 3300011119 Ga0105246_10151641 Ga0105246_101516413 176
638 3300013102 Ga0157371_10042412 Ga0157371_100424124 176
639 3300013104 Ga0157370_10668379 Ga0157370_106683792 176
640 3300013105 Ga0157369_10008501 Ga0157369_100085012 176
641 3300013105 Ga0157369_10231357 Ga0157369_102313572 176
642 3300013307 Ga0157372_10068515 Ga0157372_100685155 176
643 3300013307 Ga0157372_10434655 Ga0157372_104346551 176
644 3300014325 Ga0163163_10380871 Ga0163163_103808713 176
645 3300014497 Ga0182008_10064342 Ga0182008_100643423 176
646 3300014968 Ga0157379_10010704 Ga0157379_100107048 176
647 3300025263 Ga0209565_1000100 Ga0209565_100010092 176
648 3300025273 Ga0209673_1019761 Ga0209673_10197613 176
649 3300025295 Ga0209564_1018267 Ga0209564_10182672 176
650 3300025298 Ga0209050_1022005 Ga0209050_10220053 176
651 3300025302 Ga0207426_1060445 Ga0207426_10604452 176
652 3300025321 Ga0207656_10106117 Ga0207656_101061173 176
653 3300025903 Ga0207680_10132330 Ga0207680_101323302 176
654 3300025903 Ga0207680_10501621 Ga0207680_105016212 176
655 3300025913 Ga0207695_10484053 Ga0207695_104840532 176
656 3300025914 Ga0207671_10026831 Ga0207671_100268315 176
657 3300025919 Ga0207657_10288960 Ga0207657_102889601 176
658 3300025920 Ga0207649_10220816 Ga0207649_102208163 176
659 3300025920 Ga0207649_10386137 Ga0207649_103861371 176
660 3300025924 Ga0207694_10595180 Ga0207694_105951801 176
661 3300025929 Ga0207664_10418532 Ga0207664_104185322 176
662 3300025932 Ga0207690_10435543 Ga0207690_104355432 176
663 3300025933 Ga0207706_10044942 Ga0207706_100449424 176
664 3300025945 Ga0207679_10503309 Ga0207679_105033092 176
665 3300025949 Ga0207667_10158549 Ga0207667_101585493 176
666 3300025981 Ga0207640_10050048 Ga0207640_100500484 176
667 3300025986 Ga0207658_10077777 Ga0207658_100777774 176
668 3300025986 Ga0207658_10600986 Ga0207658_106009861 176
669 3300026035 Ga0207703_10489289 Ga0207703_104892892 176
670 3300026067 Ga0207678_10019982 Ga0207678_100199829 176
671 3300026067 Ga0207678_10310163 Ga0207678_103101632 176
672 3300026078 Ga0207702_10182347 Ga0207702_101823474 176
673 3300026078 Ga0207702_10253694 Ga0207702_102536942 176
674 3300026078 Ga0207702_10451684 Ga0207702_104516842 176
675 3300026088 Ga0207641_10017686 Ga0207641_100176865 176
676 3300026089 Ga0207648_10299460 Ga0207648_102994602 176
677 3300026116 Ga0207674_10011026 Ga0207674_100110269 176
678 3300028380 Ga0268265_10004694 Ga0268265_1000469411 176
679 3300028381 Ga0268264_10246579 Ga0268264_102465791 176
680 3300037312 Ga0395899_0289571 Ga0395899_0289571_474_1082 176
681 3300037418 Ga0395900_0091818 Ga0395900_0091818_87_695 176
682 3300037466 Ga0395898_0424649 Ga0395898_0424649_148_759 176
683 3300037466 Ga0395898_0514147 Ga0395898_0514147_501_1109 176
684 3300037471 Ga0395905_0311521 Ga0395905_0311521_825_1433 176
685 3300037471 Ga0395905_0827664 Ga0395905_0827664_87_695 176
686 3300038443 Ga0395901_0245240 Ga0395901_0245240_1230_1838 176
687 3300038443 Ga0395901_0297482 Ga0395901_0297482_979_1587 176
688 3300042439 Ga0439464_0049328 Ga0439464_0049328_515_1159 176
689 3300044694 Ga0466963_0012123 Ga0466963_0012123_4273_4899 176
690 3300046539 Ga0495621_0000481 Ga0495621_0000481_2361_3035 176
691 3300048090 Ga0495615_0048339 Ga0495615_0048339_28_702 176
692 3300048904 Ga0496101_0025402 Ga0496101_0025402_1805_2464 176
693 3300048904 Ga0496101_0170624 Ga0496101_0170624_643_1251 176
694 3300048906 Ga0496103_0213293 Ga0496103_0213293_146_805 176
695 3300048907 Ga0496104_0364311 Ga0496104_0364311_646_1305 176
696 3300048907 Ga0496104_0485077 Ga0496104_0485077_227_844 176
697 3300048908 Ga0496105_0099313 Ga0496105_0099313_943_1560 176
698 3300048908 Ga0496105_0257059 Ga0496105_0257059_323_982 176
699 3300048909 Ga0496106_0043116 Ga0496106_0043116_1542_2201 176
700 3300048910 Ga0496107_0049890 Ga0496107_0049890_1009_1668 176
701 3300048911 Ga0496108_0047520 Ga0496108_0047520_810_1469 176
702 3300048912 Ga0496109_0010384 Ga0496109_0010384_3510_4169 176
703 3300048913 Ga0496110_0008211 Ga0496110_0008211_6016_6675 176
704 3300048914 Ga0496111_0014202 Ga0496111_0014202_1089_1748 176
705 3300048915 Ga0496112_0126383 Ga0496112_0126383_963_1622 176
706 3300048916 Ga0496113_0106545 Ga0496113_0106545_627_1286 176
707 3300049579 Ga0501043_0214668 Ga0501043_0214668_33_641 176
708 3300049580 Ga0501046_0236856 Ga0501046_0236856_348_956 176
709 3300049581 Ga0501047_0076865 Ga0501047_0076865_145_753 176
710 3300049823 Ga0501044_0505326 Ga0501044_0505326_206_814 176
711 3300001978 JGI24747J21853_1002726 JGI24747J21853_10027261 177
712 3300001979 JGI24740J21852_10019603 JGI24740J21852_100196033 177
713 3300001989 JGI24739J22299_10026329 JGI24739J22299_100263291 177
714 3300001991 JGI24743J22301_10009940 JGI24743J22301_100099402 177
715 3300002075 JGI24738J21930_10011719 JGI24738J21930_100117194 177
716 3300002077 JGI24744J21845_10005812 JGI24744J21845_100058122 177
717 3300003762 Ga0055542_1009231 Ga0055542_10092311 177
718 3300003763 Ga0055529_1006108 Ga0055529_10061083 177
719 3300005327 Ga0070658_10045216 Ga0070658_100452162 177
720 3300005327 Ga0070658_10100378 Ga0070658_101003781 177
721 3300005328 Ga0070676_10004126 Ga0070676_100041262 177
722 3300005331 Ga0070670_100070080 Ga0070670_1000700804 177
723 3300005333 Ga0070677_10012863 Ga0070677_100128634 177
724 3300005334 Ga0068869_100000225 Ga0068869_1000002257 177
725 3300005335 Ga0070666_10867401 Ga0070666_108674011 177
726 3300005338 Ga0068868_100000013 Ga0068868_10000001352 177
727 3300005339 Ga0070660_100012788 Ga0070660_1000127881 177
728 3300005339 Ga0070660_100044682 Ga0070660_1000446821 177
729 3300005344 Ga0070661_100020121 Ga0070661_1000201211 177
730 3300005356 Ga0070674_100080452 Ga0070674_1000804521 177
731 3300005364 Ga0070673_100000002 Ga0070673_100000002146 177
732 3300005364 Ga0070673_100230244 Ga0070673_1002302442 177
733 3300005366 Ga0070659_100129735 Ga0070659_1001297351 177
734 3300005456 Ga0070678_100114172 Ga0070678_1001141724 177
735 3300005459 Ga0068867_100000012 Ga0068867_10000001268 177
736 3300005535 Ga0070684_100080997 Ga0070684_1000809971 177
737 3300005539 Ga0068853_100034610 Ga0068853_1000346101 177
738 3300005539 Ga0068853_100095002 Ga0068853_1000950023 177
739 3300005543 Ga0070672_100641005 Ga0070672_1006410052 177
740 3300005548 Ga0070665_100286359 Ga0070665_1002863592 177
741 3300005564 Ga0070664_100016140 Ga0070664_1000161401 177
742 3300005577 Ga0068857_100049513 Ga0068857_1000495135 177
743 3300005577 Ga0068857_100512624 Ga0068857_1005126242 177
744 3300005616 Ga0068852_100508471 Ga0068852_1005084711 177
745 3300005718 Ga0068866_10129524 Ga0068866_101295242 177
746 3300005985 Ga0081539_10008339 Ga0081539_100083399 177
747 3300006881 Ga0068865_100000004 Ga0068865_100000004146 177
748 3300006881 Ga0068865_100734278 Ga0068865_1007342781 177
749 3300009098 Ga0105245_10000195 Ga0105245_1000019543 177
750 3300009148 Ga0105243_10000146 Ga0105243_1000014665 177
751 3300009176 Ga0105242_10000943 Ga0105242_100009438 177
752 3300009177 Ga0105248_10253631 Ga0105248_102536313 177
753 3300009177 Ga0105248_10733694 Ga0105248_107336941 177
754 3300009551 Ga0105238_10148934 Ga0105238_101489343 177
755 3300009551 Ga0105238_10302540 Ga0105238_103025403 177
756 3300009553 Ga0105249_10028412 Ga0105249_100284124 177
757 3300011119 Ga0105246_10004302 Ga0105246_100043023 177
758 3300013104 Ga0157370_10011178 Ga0157370_100111783 177
759 3300013105 Ga0157369_10090703 Ga0157369_100907035 177
760 3300013105 Ga0157369_10525148 Ga0157369_105251483 177
761 3300013296 Ga0157374_10001738 Ga0157374_100017382 177
762 3300013296 Ga0157374_10006891 Ga0157374_100068917 177
763 3300013297 Ga0157378_10000408 Ga0157378_1000040824 177
764 3300013297 Ga0157378_10026677 Ga0157378_100266775 177
765 3300013306 Ga0163162_11237229 Ga0163162_112372292 177
766 3300013308 Ga0157375_10005342 Ga0157375_1000534210 177
767 3300013308 Ga0157375_10769756 Ga0157375_107697562 177
768 3300014326 Ga0157380_10983633 Ga0157380_109836332 177
769 3300014745 Ga0157377_10001666 Ga0157377_1000166610 177
770 3300014745 Ga0157377_10389368 Ga0157377_103893682 177
771 3300014969 Ga0157376_10000128 Ga0157376_1000012850 177
772 3300021388 Ga0213875_10000897 Ga0213875_100008978 177
773 3300025231 Ga0207427_100922 Ga0207427_10092211 177
774 3300025250 Ga0209026_1001085 Ga0209026_10010854 177
775 3300025254 Ga0209148_1000116 Ga0209148_1000116107 177
776 3300025254 Ga0209148_1004852 Ga0209148_10048524 177
777 3300025261 Ga0209233_1000098 Ga0209233_1000098178 177
778 3300025272 Ga0209455_1000767 Ga0209455_10007676 177
779 3300025272 Ga0209455_1034396 Ga0209455_10343961 177
780 3300025315 Ga0207697_10012951 Ga0207697_100129512 177
781 3300025893 Ga0207682_10032814 Ga0207682_100328142 177
782 3300025899 Ga0207642_10055169 Ga0207642_100551692 177
783 3300025899 Ga0207642_10063806 Ga0207642_100638061 177
784 3300025901 Ga0207688_10011182 Ga0207688_100111825 177
785 3300025904 Ga0207647_10104293 Ga0207647_101042931 177
786 3300025904 Ga0207647_10121437 Ga0207647_101214372 177
787 3300025904 Ga0207647_10316852 Ga0207647_103168521 177
788 3300025907 Ga0207645_10003385 Ga0207645_1000338510 177
789 3300025909 Ga0207705_10004442 Ga0207705_1000444212 177
790 3300025909 Ga0207705_10198291 Ga0207705_101982913 177
791 3300025913 Ga0207695_10025246 Ga0207695_100252461 177
792 3300025913 Ga0207695_10172618 Ga0207695_101726182 177
793 3300025917 Ga0207660_10171320 Ga0207660_101713203 177
794 3300025917 Ga0207660_10641789 Ga0207660_106417892 177
795 3300025919 Ga0207657_10021840 Ga0207657_100218406 177
796 3300025919 Ga0207657_10054959 Ga0207657_100549593 177
797 3300025919 Ga0207657_10055505 Ga0207657_100555056 177
798 3300025920 Ga0207649_10523493 Ga0207649_105234931 177
799 3300025924 Ga0207694_10020155 Ga0207694_100201554 177
800 3300025924 Ga0207694_10089680 Ga0207694_100896803 177
801 3300025925 Ga0207650_10199728 Ga0207650_101997283 177
802 3300025926 Ga0207659_10449437 Ga0207659_104494372 177
803 3300025927 Ga0207687_10003292 Ga0207687_100032926 177
804 3300025932 Ga0207690_10138636 Ga0207690_101386361 177
805 3300025932 Ga0207690_10397065 Ga0207690_103970651 177
806 3300025932 Ga0207690_10679649 Ga0207690_106796491 177
807 3300025934 Ga0207686_10000999 Ga0207686_1000099921 177
808 3300025935 Ga0207709_10000314 Ga0207709_1000031414 177
809 3300025935 Ga0207709_10422633 Ga0207709_104226332 177
810 3300025938 Ga0207704_10000005 Ga0207704_1000000566 177
811 3300025938 Ga0207704_10333352 Ga0207704_103333523 177
812 3300025940 Ga0207691_10057057 Ga0207691_100570573 177
813 3300025940 Ga0207691_10404640 Ga0207691_104046402 177
814 3300025941 Ga0207711_10426594 Ga0207711_104265942 177
815 3300025942 Ga0207689_10000043 Ga0207689_1000004330 177
816 3300025942 Ga0207689_10005657 Ga0207689_100056573 177
817 3300025942 Ga0207689_10016412 Ga0207689_100164125 177
818 3300025945 Ga0207679_10066090 Ga0207679_100660901 177
819 3300025949 Ga0207667_10041692 Ga0207667_100416924 177
820 3300025960 Ga0207651_10000007 Ga0207651_1000000766 177
821 3300025961 Ga0207712_10013236 Ga0207712_100132363 177
822 3300025981 Ga0207640_10068326 Ga0207640_100683264 177
823 3300026023 Ga0207677_10000085 Ga0207677_1000008555 177
824 3300026067 Ga0207678_10285847 Ga0207678_102858471 177
825 3300026078 Ga0207702_10012870 Ga0207702_1001287010 177
826 3300026089 Ga0207648_10000005 Ga0207648_1000000567 177
827 3300026089 Ga0207648_10017604 Ga0207648_100176042 177
828 3300026118 Ga0207675_100135492 Ga0207675_1001354923 177
829 3300026121 Ga0207683_10005676 Ga0207683_100056764 177
830 3300026142 Ga0207698_10035079 Ga0207698_100350792 177
831 3300028380 Ga0268265_10037695 Ga0268265_100376952 177
832 3300030745 Ga0316182_1051886 Ga0316182_10518862 177
833 3300031995 Ga0307409_100470045 Ga0307409_1004700452 177
834 3300037312 Ga0395899_0001950 Ga0395899_0001950_4921_5532 177
835 3300037312 Ga0395899_0040739 Ga0395899_0040739_2188_2799 177
836 3300037312 Ga0395899_0154352 Ga0395899_0154352_676_1287 177
837 3300037312 Ga0395899_0209042 Ga0395899_0209042_298_909 177
838 3300037418 Ga0395900_0001290 Ga0395900_0001290_17589_18200 177
839 3300037418 Ga0395900_0028278 Ga0395900_0028278_1971_2582 177
840 3300037418 Ga0395900_0427492 Ga0395900_0427492_569_1180 177
841 3300037466 Ga0395898_0086177 Ga0395898_0086177_1386_1997 177
842 3300037471 Ga0395905_0011188 Ga0395905_0011188_6032_6643 177
843 3300037471 Ga0395905_0069718 Ga0395905_0069718_2306_2917 177
844 3300037853 Ga0436364_0267368 Ga0436364_0267368_21802_22419 177
845 3300038443 Ga0395901_0007049 Ga0395901_0007049_9694_10305 177
846 3300038443 Ga0395901_0285573 Ga0395901_0285573_435_1046 177
847 3300044656 Ga0466969_0070561 Ga0466969_0070561_475_1071 177
848 3300044765 Ga0466970_0018332 Ga0466970_0018332_1000_1602 177
849 3300044842 Ga0466957_0582018 Ga0466957_0582018_16_624 177
850 3300045049 Ga0466959_0212995 Ga0466959_0212995_119_715 177
851 3300045836 Ga0466958_0165135 Ga0466958_0165135_103_705 177
852 3300045976 Ga0466967_0706066 Ga0466967_0706066_104_724 177
853 3300046525 Ga0495663_0131859 Ga0495663_0131859_126_755 177
854 3300046537 Ga0495598_0007441 Ga0495598_0007441_956_1585 177
855 3300046539 Ga0495621_0000528 Ga0495621_0000528_4838_5467 177
856 3300046542 Ga0495597_0115110 Ga0495597_0115110_56_664 177
857 3300046558 Ga0495633_0117301 Ga0495633_0117301_194_823 177
858 3300046660 Ga0495625_0000064 Ga0495625_0000064_148420_149028 177
859 3300046684 Ga0495669_0051272 Ga0495669_0051272_342_971 177
860 3300046691 Ga0495670_0003293 Ga0495670_0003293_7164_7793 177
861 3300048906 Ga0496103_0443807 Ga0496103_0443807_158_778 177
862 3300048915 Ga0496112_0523582 Ga0496112_0523582_95_715 177
863 3300048922 Ga0496119_0107113 Ga0496119_0107113_433_1032 177
864 3300048928 Ga0496125_0040228 Ga0496125_0040228_1222_1824 177
865 3300059647 Ga0587079_052713 Ga0587079_052713_229_840 177
866 3300005293 Ga0065715_10098195 Ga0065715_100981955 178
867 3300005327 Ga0070658_10442405 Ga0070658_104424052 178
868 3300005329 Ga0070683_100107355 Ga0070683_1001073553 178
869 3300005331 Ga0070670_100029191 Ga0070670_1000291916 178
870 3300005331 Ga0070670_101037334 Ga0070670_1010373341 178
871 3300005333 Ga0070677_10008070 Ga0070677_100080706 178
872 3300005354 Ga0070675_100006462 Ga0070675_1000064627 178
873 3300005457 Ga0070662_100006784 Ga0070662_1000067845 178
874 3300005459 Ga0068867_100339272 Ga0068867_1003392723 178
875 3300005543 Ga0070672_100093351 Ga0070672_1000933513 178
876 3300005563 Ga0068855_100633198 Ga0068855_1006331982 178
877 3300005578 Ga0068854_100176807 Ga0068854_1001768072 178
878 3300005616 Ga0068852_101093148 Ga0068852_1010931481 178
879 3300005618 Ga0068864_100114253 Ga0068864_1001142533 178
880 3300005719 Ga0068861_100087199 Ga0068861_1000871992 178
881 3300005840 Ga0068870_10062275 Ga0068870_100622753 178
882 3300005843 Ga0068860_100124167 Ga0068860_1001241672 178
883 3300005985 Ga0081539_10040401 Ga0081539_100404013 178
884 3300009174 Ga0105241_10305373 Ga0105241_103053732 178
885 3300009553 Ga0105249_10061804 Ga0105249_100618044 178
886 3300013100 Ga0157373_10248363 Ga0157373_102483631 178
887 3300013102 Ga0157371_10311198 Ga0157371_103111982 178
888 3300013307 Ga0157372_10276877 Ga0157372_102768772 178
889 3300031731 Ga0307405_10993554 Ga0307405_109935541 178
890 3300031901 Ga0307406_10546600 Ga0307406_105466001 178
891 3300037312 Ga0395899_0034866 Ga0395899_0034866_2575_3234 178
892 3300037418 Ga0395900_0020586 Ga0395900_0020586_4211_4831 178
893 3300037418 Ga0395900_0109823 Ga0395900_0109823_2016_2648 178
894 3300037418 Ga0395900_0128722 Ga0395900_0128722_47_706 178
895 3300037418 Ga0395900_0294916 Ga0395900_0294916_749_1354 178
896 3300037471 Ga0395905_0004981 Ga0395905_0004981_4682_5287 178
897 3300037471 Ga0395905_1053264 Ga0395905_1053264_57_674 178
898 3300038443 Ga0395901_0042410 Ga0395901_0042410_3044_3649 178
899 3300038443 Ga0395901_0043460 Ga0395901_0043460_1086_1706 178
900 3300038443 Ga0395901_0048919 Ga0395901_0048919_1460_2119 178
901 3300038443 Ga0395901_0059325 Ga0395901_0059325_748_1380 178
902 3300038443 Ga0395901_0487641 Ga0395901_0487641_611_1222 178
903 3300039437 Ga0436365_1759449 Ga0436365_1759449_464_1036 178
904 3300039450 Ga0436363_1307031 Ga0436363_1307031_29_616 178
905 3300044658 Ga0466972_0016710 Ga0466972_0016710_2909_3508 178
906 3300044694 Ga0466963_0027255 Ga0466963_0027255_2856_3482 178
907 3300044694 Ga0466963_0145563 Ga0466963_0145563_127_735 178
908 3300044694 Ga0466963_0362192 Ga0466963_0362192_258_872 178
909 3300044706 Ga0466964_0011968 Ga0466964_0011968_591_1190 178
910 3300044719 Ga0466971_0007970 Ga0466971_0007970_3554_4168 178
911 3300045836 Ga0466958_0036365 Ga0466958_0036365_1802_2410 178
912 3300046691 Ga0495670_0000004 Ga0495670_0000004_178630_179232 178
913 3300047470 Ga0495681_0143425 Ga0495681_0143425_312_920 178
914 3300047472 Ga0495686_0326206 Ga0495686_0326206_37_630 178
915 3300053094 Ga0500566_0000633 Ga0500566_0000633_3396_3998 178
916 3300053108 Ga0500562_124647 Ga0500562_124647_56_658 178
917 iso_pu_bacteria 2879163058 2879166782 178
918 iso_pu_bacteria 2928526807 2928527193 178
919 iso_pu_bacteria 8057101203 8057103717 178
920 3300001979 JGI24740J21852_10076847 JGI24740J21852_100768471 179
921 3300001989 JGI24739J22299_10028375 JGI24739J22299_100283751 179
922 3300001990 JGI24737J22298_10000835 JGI24737J22298_100008354 179
923 3300001990 JGI24737J22298_10001767 JGI24737J22298_100017672 179
924 3300002067 JGI24735J21928_10037095 JGI24735J21928_100370952 179
925 3300002067 JGI24735J21928_10046901 JGI24735J21928_100469011 179
926 3300002075 JGI24738J21930_10003000 JGI24738J21930_100030001 179
927 3300002075 JGI24738J21930_10019475 JGI24738J21930_100194752 179
928 3300005327 Ga0070658_10007219 Ga0070658_1000721913 179
929 3300005327 Ga0070658_10017258 Ga0070658_100172582 179
930 3300005327 Ga0070658_10033532 Ga0070658_100335323 179
931 3300005327 Ga0070658_10108359 Ga0070658_101083593 179
932 3300005327 Ga0070658_10261987 Ga0070658_102619872 179
933 3300005327 Ga0070658_10426804 Ga0070658_104268043 179
934 3300005327 Ga0070658_10474341 Ga0070658_104743411 179
935 3300005328 Ga0070676_10078205 Ga0070676_100782052 179
936 3300005335 Ga0070666_10002523 Ga0070666_100025239 179
937 3300005336 Ga0070680_100028716 Ga0070680_1000287163 179
938 3300005338 Ga0068868_100084629 Ga0068868_1000846293 179
939 3300005339 Ga0070660_100012723 Ga0070660_1000127232 179
940 3300005339 Ga0070660_100017639 Ga0070660_1000176393 179
941 3300005339 Ga0070660_100023713 Ga0070660_1000237134 179
942 3300005339 Ga0070660_100119371 Ga0070660_1001193713 179
943 3300005344 Ga0070661_100035691 Ga0070661_1000356913 179
944 3300005344 Ga0070661_100140882 Ga0070661_1001408823 179
945 3300005345 Ga0070692_10002334 Ga0070692_100023342 179
946 3300005347 Ga0070668_100045056 Ga0070668_1000450565 179
947 3300005353 Ga0070669_100301660 Ga0070669_1003016601 179
948 3300005355 Ga0070671_100182805 Ga0070671_1001828053 179
949 3300005356 Ga0070674_100044508 Ga0070674_1000445083 179
950 3300005364 Ga0070673_100029419 Ga0070673_1000294195 179
951 3300005366 Ga0070659_100003958 Ga0070659_10000395810 179
952 3300005366 Ga0070659_100007614 Ga0070659_1000076149 179
953 3300005366 Ga0070659_100076677 Ga0070659_1000766773 179
954 3300005367 Ga0070667_100011649 Ga0070667_1000116498 179
955 3300005367 Ga0070667_100723454 Ga0070667_1007234541 179
956 3300005444 Ga0070694_100114028 Ga0070694_1001140283 179
957 3300005455 Ga0070663_100002614 Ga0070663_1000026144 179
958 3300005455 Ga0070663_100074794 Ga0070663_1000747941 179
959 3300005456 Ga0070678_100006524 Ga0070678_1000065242 179
960 3300005457 Ga0070662_100040361 Ga0070662_1000403615 179
961 3300005457 Ga0070662_100081331 Ga0070662_1000813313 179
962 3300005457 Ga0070662_100255435 Ga0070662_1002554351 179
963 3300005457 Ga0070662_100427614 Ga0070662_1004276142 179
964 3300005459 Ga0068867_100041848 Ga0068867_1000418482 179
965 3300005466 Ga0070685_10185584 Ga0070685_101855842 179
966 3300005530 Ga0070679_100046887 Ga0070679_1000468876 179
967 3300005539 Ga0068853_100041927 Ga0068853_1000419271 179
968 3300005539 Ga0068853_100044210 Ga0068853_1000442105 179
969 3300005539 Ga0068853_100302858 Ga0068853_1003028582 179
970 3300005539 Ga0068853_100353936 Ga0068853_1003539362 179
971 3300005543 Ga0070672_100336119 Ga0070672_1003361192 179
972 3300005543 Ga0070672_100524245 Ga0070672_1005242451 179
973 3300005544 Ga0070686_100052566 Ga0070686_1000525663 179
974 3300005545 Ga0070695_100072948 Ga0070695_1000729482 179
975 3300005549 Ga0070704_100375178 Ga0070704_1003751782 179
976 3300005563 Ga0068855_100098889 Ga0068855_1000988893 179
977 3300005564 Ga0070664_100022762 Ga0070664_1000227626 179
978 3300005564 Ga0070664_100046135 Ga0070664_1000461354 179
979 3300005564 Ga0070664_100258121 Ga0070664_1002581212 179
980 3300005577 Ga0068857_100183849 Ga0068857_1001838493 179
981 3300005578 Ga0068854_100000306 Ga0068854_10000030633 179
982 3300005578 Ga0068854_100056103 Ga0068854_1000561034 179
983 3300005614 Ga0068856_100079590 Ga0068856_1000795906 179
984 3300005616 Ga0068852_100043248 Ga0068852_1000432483 179
985 3300005616 Ga0068852_100046086 Ga0068852_1000460863 179
986 3300005616 Ga0068852_100257697 Ga0068852_1002576972 179
987 3300005617 Ga0068859_100032129 Ga0068859_1000321294 179
988 3300005617 Ga0068859_100161272 Ga0068859_1001612722 179
989 3300005618 Ga0068864_100295414 Ga0068864_1002954143 179
990 3300005834 Ga0068851_10017185 Ga0068851_100171855 179
991 3300005841 Ga0068863_100003743 Ga0068863_1000037439 179
992 3300005842 Ga0068858_100008940 Ga0068858_1000089406 179
993 3300005842 Ga0068858_100039796 Ga0068858_1000397967 179
994 3300005843 Ga0068860_100201974 Ga0068860_1002019743 179
995 3300005843 Ga0068860_100214794 Ga0068860_1002147941 179
996 3300005843 Ga0068860_100236066 Ga0068860_1002360662 179
997 3300006237 Ga0097621_100001363 Ga0097621_10000136315 179
998 3300006237 Ga0097621_100072455 Ga0097621_1000724553 179
999 3300006358 Ga0068871_100004771 Ga0068871_1000047719 179
1000 3300006358 Ga0068871_100008587 Ga0068871_1000085874 179
1001 3300006931 Ga0097620_100032131 Ga0097620_1000321314 179
1002 3300006931 Ga0097620_100161278 Ga0097620_1001612782 179
1003 3300009098 Ga0105245_10026400 Ga0105245_100264004 179
1004 3300009147 Ga0114129_10214530 Ga0114129_102145303 179
1005 3300009551 Ga0105238_10030198 Ga0105238_100301987 179
1006 3300009553 Ga0105249_10580497 Ga0105249_105804972 179
1007 3300010375 Ga0105239_10214248 Ga0105239_102142483 179
1008 3300010375 Ga0105239_10926436 Ga0105239_109264362 179
1009 3300013100 Ga0157373_10026426 Ga0157373_100264262 179
1010 3300013102 Ga0157371_10044078 Ga0157371_100440782 179
1011 3300013104 Ga0157370_10685037 Ga0157370_106850371 179
1012 3300013296 Ga0157374_10040849 Ga0157374_100408493 179
1013 3300013296 Ga0157374_11010713 Ga0157374_110107131 179
1014 3300013306 Ga0163162_10156896 Ga0163162_101568963 179
1015 3300013306 Ga0163162_10213629 Ga0163162_102136291 179
1016 3300013307 Ga0157372_10367222 Ga0157372_103672222 179
1017 3300013307 Ga0157372_10718543 Ga0157372_107185432 179
1018 3300013307 Ga0157372_11285225 Ga0157372_112852252 179
1019 3300013308 Ga0157375_10061117 Ga0157375_100611175 179
1020 3300014745 Ga0157377_10137769 Ga0157377_101377692 179
1021 3300014968 Ga0157379_10050088 Ga0157379_100500883 179
1022 3300014969 Ga0157376_10004672 Ga0157376_100046729 179
1023 3300017792 Ga0163161_10064295 Ga0163161_100642952 179
1024 3300025321 Ga0207656_10029158 Ga0207656_100291582 179
1025 3300025893 Ga0207682_10000417 Ga0207682_1000041717 179
1026 3300025898 Ga0207692_10157007 Ga0207692_101570073 179
1027 3300025901 Ga0207688_10187341 Ga0207688_101873411 179
1028 3300025903 Ga0207680_10002831 Ga0207680_100028313 179
1029 3300025903 Ga0207680_10292015 Ga0207680_102920151 179
1030 3300025904 Ga0207647_10000450 Ga0207647_1000045018 179
1031 3300025904 Ga0207647_10001366 Ga0207647_100013662 179
1032 3300025907 Ga0207645_10006329 Ga0207645_100063292 179
1033 3300025907 Ga0207645_10147536 Ga0207645_101475362 179
1034 3300025909 Ga0207705_10004859 Ga0207705_100048596 179
1035 3300025909 Ga0207705_10005992 Ga0207705_100059921 179
1036 3300025909 Ga0207705_10012595 Ga0207705_100125957 179
1037 3300025909 Ga0207705_10028578 Ga0207705_100285785 179
1038 3300025909 Ga0207705_10082172 Ga0207705_100821724 179
1039 3300025909 Ga0207705_10240335 Ga0207705_102403352 179
1040 3300025912 Ga0207707_10075837 Ga0207707_100758372 179
1041 3300025917 Ga0207660_10255822 Ga0207660_102558223 179
1042 3300025919 Ga0207657_10001825 Ga0207657_1000182512 179
1043 3300025919 Ga0207657_10009031 Ga0207657_1000903113 179
1044 3300025919 Ga0207657_10020873 Ga0207657_100208737 179
1045 3300025919 Ga0207657_10028619 Ga0207657_100286195 179
1046 3300025919 Ga0207657_10458634 Ga0207657_104586342 179
1047 3300025920 Ga0207649_10032642 Ga0207649_100326422 179
1048 3300025921 Ga0207652_10220681 Ga0207652_102206813 179
1049 3300025924 Ga0207694_10099374 Ga0207694_100993742 179
1050 3300025927 Ga0207687_10058695 Ga0207687_100586954 179
1051 3300025931 Ga0207644_10000363 Ga0207644_1000036320 179
1052 3300025932 Ga0207690_10004314 Ga0207690_100043149 179
1053 3300025932 Ga0207690_10010821 Ga0207690_100108216 179
1054 3300025932 Ga0207690_10096898 Ga0207690_100968983 179
1055 3300025932 Ga0207690_10952634 Ga0207690_109526341 179
1056 3300025933 Ga0207706_10002348 Ga0207706_1000234811 179
1057 3300025933 Ga0207706_10019463 Ga0207706_100194633 179
1058 3300025933 Ga0207706_10150961 Ga0207706_101509613 179
1059 3300025933 Ga0207706_10205273 Ga0207706_102052732 179
1060 3300025940 Ga0207691_10049113 Ga0207691_100491135 179
1061 3300025941 Ga0207711_10004961 Ga0207711_100049619 179
1062 3300025944 Ga0207661_10438891 Ga0207661_104388912 179
1063 3300025945 Ga0207679_10004475 Ga0207679_100044754 179
1064 3300025945 Ga0207679_10370994 Ga0207679_103709942 179
1065 3300025949 Ga0207667_10120141 Ga0207667_101201412 179
1066 3300025960 Ga0207651_10005083 Ga0207651_100050837 179
1067 3300025972 Ga0207668_10070743 Ga0207668_100707434 179
1068 3300025981 Ga0207640_10001822 Ga0207640_100018222 179
1069 3300025986 Ga0207658_10053779 Ga0207658_100537794 179
1070 3300025986 Ga0207658_10894046 Ga0207658_108940462 179
1071 3300026023 Ga0207677_10007140 Ga0207677_100071406 179
1072 3300026035 Ga0207703_10009152 Ga0207703_100091529 179
1073 3300026041 Ga0207639_10018714 Ga0207639_100187142 179
1074 3300026041 Ga0207639_10487501 Ga0207639_104875012 179
1075 3300026067 Ga0207678_10035972 Ga0207678_100359722 179
1076 3300026067 Ga0207678_10060312 Ga0207678_100603124 179
1077 3300026067 Ga0207678_10331210 Ga0207678_103312101 179
1078 3300026075 Ga0207708_10029953 Ga0207708_100299533 179
1079 3300026078 Ga0207702_10088682 Ga0207702_100886824 179
1080 3300026088 Ga0207641_10362799 Ga0207641_103627992 179
1081 3300026089 Ga0207648_10009542 Ga0207648_100095426 179
1082 3300026095 Ga0207676_10008893 Ga0207676_100088938 179
1083 3300026095 Ga0207676_10274732 Ga0207676_102747323 179
1084 3300026118 Ga0207675_100152747 Ga0207675_1001527472 179
1085 3300026121 Ga0207683_10022069 Ga0207683_100220696 179
1086 3300026142 Ga0207698_10004176 Ga0207698_1000417610 179
1087 3300026142 Ga0207698_10013479 Ga0207698_100134792 179
1088 3300026142 Ga0207698_10110081 Ga0207698_101100812 179
1089 3300026142 Ga0207698_10380246 Ga0207698_103802461 179
1090 3300027364 Ga0209967_1012570 Ga0209967_10125702 179
1091 3300027614 Ga0209970_1014509 Ga0209970_10145092 179
1092 3300027876 Ga0209974_10020267 Ga0209974_100202674 179
1093 3300028381 Ga0268264_10000594 Ga0268264_100005945 179
1094 3300028381 Ga0268264_10226230 Ga0268264_102262301 179
1095 3300031903 Ga0307407_10075741 Ga0307407_100757412 179
1096 3300031995 Ga0307409_100124455 Ga0307409_1001244554 179
1097 3300032002 Ga0307416_100817329 Ga0307416_1008173293 179
1098 3300032004 Ga0307414_10357465 Ga0307414_103574652 179
1099 3300032004 Ga0307414_10506148 Ga0307414_105061481 179
1100 3300032005 Ga0307411_10357127 Ga0307411_103571271 179
1101 3300032005 Ga0307411_10376988 Ga0307411_103769882 179
1102 3300032005 Ga0307411_10635061 Ga0307411_106350612 179
1103 3300032126 Ga0307415_100081448 Ga0307415_1000814482 179
1104 3300035115 Ga0373941_0119195 Ga0373941_0119195_40_684 179
1105 3300035115 Ga0373941_0151102 Ga0373941_0151102_62_676 179
1106 3300035207 Ga0373942_0063647 Ga0373942_0063647_165_779 179
1107 3300037418 Ga0395900_0263737 Ga0395900_0263737_1106_1690 179
1108 3300037418 Ga0395900_0350852 Ga0395900_0350852_259_870 179
1109 3300037466 Ga0395898_0619179 Ga0395898_0619179_424_1008 179
1110 3300037471 Ga0395905_0165759 Ga0395905_0165759_1162_1758 179
1111 3300037471 Ga0395905_0176931 Ga0395905_0176931_588_1172 179
1112 3300037471 Ga0395905_0852610 Ga0395905_0852610_126_725 179
1113 3300038443 Ga0395901_0211757 Ga0395901_0211757_1286_1870 179
1114 3300044684 Ga0466966_0269109 Ga0466966_0269109_152_751 179
1115 3300044693 Ga0466961_0011461 Ga0466961_0011461_1966_2565 179
1116 3300044735 Ga0466968_0162402 Ga0466968_0162402_355_957 179
1117 3300045049 Ga0466959_0002064 Ga0466959_0002064_8926_9525 179
1118 3300045049 Ga0466959_0049401 Ga0466959_0049401_2033_2647 179
1119 3300045976 Ga0466967_0166106 Ga0466967_0166106_1063_1677 179
1120 3300048903 Ga0496100_0002351 Ga0496100_0002351_1797_2411 179
1121 3300048904 Ga0496101_0000292 Ga0496101_0000292_19659_20273 179
1122 3300048904 Ga0496101_0414389 Ga0496101_0414389_16_612 179
1123 3300048905 Ga0496102_0016210 Ga0496102_0016210_5602_6216 179
1124 3300048906 Ga0496103_0109934 Ga0496103_0109934_909_1523 179
1125 3300048907 Ga0496104_0654645 Ga0496104_0654645_83_697 179
1126 3300048908 Ga0496105_0191429 Ga0496105_0191429_622_1236 179
1127 3300048909 Ga0496106_0014932 Ga0496106_0014932_4256_4870 179
1128 3300048910 Ga0496107_0011839 Ga0496107_0011839_1541_2155 179
1129 3300048911 Ga0496108_0001766 Ga0496108_0001766_12786_13400 179
1130 3300048912 Ga0496109_0004339 Ga0496109_0004339_10149_10763 179
1131 3300048913 Ga0496110_0001965 Ga0496110_0001965_3733_4347 179
1132 3300048914 Ga0496111_0000323 Ga0496111_0000323_3487_4101 179
1133 3300048915 Ga0496112_0000161 Ga0496112_0000161_39041_39655 179
1134 3300048916 Ga0496113_0004623 Ga0496113_0004623_6149_6763 179
1135 3300049127 Ga0501306_005768 Ga0501306_005768_22_642 179
1136 3300049129 Ga0501309_032117 Ga0501309_032117_147_767 179
1137 3300049539 Ga0501323_027665 Ga0501323_027665_140_760 179
1138 3300049568 Ga0501031_0401735 Ga0501031_0401735_246_827 179
1139 3300049569 Ga0501032_0143636 Ga0501032_0143636_40_621 179
1140 3300049579 Ga0501043_0150904 Ga0501043_0150904_503_1084 179
1141 3300049581 Ga0501047_0689180 Ga0501047_0689180_247_828 179
1142 3300049584 Ga0501068_0173040 Ga0501068_0173040_672_1292 179
1143 3300049586 Ga0501070_0210243 Ga0501070_0210243_869_1450 179
1144 3300049705 Ga0501225_0108329 Ga0501225_0108329_179_799 179
1145 3300049823 Ga0501044_0061238 Ga0501044_0061238_1196_1777 179
1146 iso_pu_bacteria 2928968154 2928969321 179
1147 3300005327 Ga0070658_10362812 Ga0070658_103628122 180
1148 3300005578 Ga0068854_100028745 Ga0068854_1000287451 180
1149 3300005937 Ga0081455_10000477 Ga0081455_1000047722 180
1150 3300009093 Ga0105240_10004392 Ga0105240_1000439218 180
1151 3300013100 Ga0157373_10203758 Ga0157373_102037582 180
1152 3300013105 Ga0157369_10899987 Ga0157369_108999871 180
1153 3300025912 Ga0207707_10314569 Ga0207707_103145691 180
1154 3300025924 Ga0207694_10735119 Ga0207694_107351192 180
1155 3300025981 Ga0207640_10129763 Ga0207640_101297633 180
1156 3300025981 Ga0207640_10145116 Ga0207640_101451162 180
1157 3300026078 Ga0207702_10429509 Ga0207702_104295092 180
1158 3300032005 Ga0307411_10151432 Ga0307411_101514322 180
1159 3300037312 Ga0395899_0024414 Ga0395899_0024414_1767_2399 180
1160 3300037418 Ga0395900_0045255 Ga0395900_0045255_974_1585 180
1161 3300037418 Ga0395900_0191350 Ga0395900_0191350_517_1182 180
1162 3300037471 Ga0395905_0045674 Ga0395905_0045674_198_830 180
1163 3300044719 Ga0466971_0071253 Ga0466971_0071253_38_637 180
1164 3300046492 Ga0495585_0015180 Ga0495585_0015180_3304_3918 180
1165 3300046660 Ga0495625_0000189 Ga0495625_0000189_9089_9703 180
1166 3300061719 Ga0466962_0112922 Ga0466962_0112922_134_748 180
1167 iso_pu_bacteria 2599185354 2600200515 180
1168 iso_pu_bacteria 2738541301 2738850997 180
1169 iso_pu_bacteria 2738541304 2738866727 180
1170 iso_pu_bacteria 2738543022 2739299244 180
1171 iso_pu_bacteria 2738543033 2739360923 180
1172 iso_pu_bacteria 2751185897 2753763703 180
1173 iso_pu_bacteria 2830075706 2830076774 180
1174 iso_pu_bacteria 2928027323 2928027773 180
1175 iso_pu_bacteria 2928100450 2928103881 180
1176 iso_pu_bacteria 2928959182 2928961810 180
1177 iso_pu_bacteria 2984555340 2984557934 180
1178 iso_pu_bacteria 2984564862 2984567701 180
1179 iso_pu_bacteria 2990265787 2990267382 180
1180 iso_pu_bacteria 2993356040 2993358752 180
1181 iso_pu_bacteria 2993693658 2993695383 180
1182 3300001989 JGI24739J22299_10025725 JGI24739J22299_100257254 181
1183 3300003203 JGI25406J46586_10102049 JGI25406J46586_101020491 181
1184 3300003781 Ga0055536_1017681 Ga0055536_10176814 181
1185 3300003792 Ga0055540_1001980 Ga0055540_100198011 181
1186 3300005328 Ga0070676_10003637 Ga0070676_100036379 181
1187 3300005347 Ga0070668_100023073 Ga0070668_1000230732 181
1188 3300005353 Ga0070669_100061781 Ga0070669_1000617813 181
1189 3300005353 Ga0070669_100378276 Ga0070669_1003782761 181
1190 3300005355 Ga0070671_100001626 Ga0070671_10000162614 181
1191 3300005355 Ga0070671_100014039 Ga0070671_1000140392 181
1192 3300005355 Ga0070671_100541354 Ga0070671_1005413542 181
1193 3300005356 Ga0070674_100102304 Ga0070674_1001023043 181
1194 3300005366 Ga0070659_100159504 Ga0070659_1001595041 181
1195 3300005367 Ga0070667_100177674 Ga0070667_1001776741 181
1196 3300005455 Ga0070663_100135948 Ga0070663_1001359481 181
1197 3300005456 Ga0070678_100012935 Ga0070678_1000129357 181
1198 3300005457 Ga0070662_100157411 Ga0070662_1001574112 181
1199 3300005548 Ga0070665_100244808 Ga0070665_1002448081 181
1200 3300005564 Ga0070664_100076181 Ga0070664_1000761812 181
1201 3300005617 Ga0068859_100046919 Ga0068859_1000469193 181
1202 3300005844 Ga0068862_100005835 Ga0068862_1000058356 181
1203 3300005985 Ga0081539_10120854 Ga0081539_101208542 181
1204 3300006931 Ga0097620_100046919 Ga0097620_1000469193 181
1205 3300009177 Ga0105248_10350942 Ga0105248_103509421 181
1206 3300014326 Ga0157380_10766690 Ga0157380_107666902 181
1207 3300025271 Ga0207666_1016789 Ga0207666_10167892 181
1208 3300025315 Ga0207697_10002366 Ga0207697_100023667 181
1209 3300025901 Ga0207688_10043874 Ga0207688_100438742 181
1210 3300025909 Ga0207705_10246870 Ga0207705_102468702 181
1211 3300025923 Ga0207681_10325509 Ga0207681_103255091 181
1212 3300025931 Ga0207644_10038172 Ga0207644_100381721 181
1213 3300025931 Ga0207644_10465715 Ga0207644_104657152 181
1214 3300025933 Ga0207706_10005362 Ga0207706_1000536216 181
1215 3300025940 Ga0207691_10010358 Ga0207691_100103583 181
1216 3300025941 Ga0207711_10060446 Ga0207711_100604464 181
1217 3300025960 Ga0207651_10008872 Ga0207651_100088728 181
1218 3300025972 Ga0207668_10008280 Ga0207668_100082805 181
1219 3300025972 Ga0207668_10282118 Ga0207668_102821183 181
1220 3300025986 Ga0207658_10282923 Ga0207658_102829232 181
1221 3300026067 Ga0207678_10160114 Ga0207678_101601143 181
1222 3300026089 Ga0207648_11105398 Ga0207648_111053981 181
1223 3300026118 Ga0207675_100014477 Ga0207675_1000144777 181
1224 3300026121 Ga0207683_10002608 Ga0207683_1000260813 181
1225 3300028380 Ga0268265_10081652 Ga0268265_100816523 181
1226 3300028380 Ga0268265_10157984 Ga0268265_101579844 181
1227 3300037418 Ga0395900_0001087 Ga0395900_0001087_9945_10556 181
1228 3300037418 Ga0395900_0109184 Ga0395900_0109184_461_1111 181
1229 3300037471 Ga0395905_0000298 Ga0395905_0000298_66600_67220 181
1230 3300037471 Ga0395905_0066550 Ga0395905_0066550_2076_2669 181
1231 3300037471 Ga0395905_0343273 Ga0395905_0343273_542_1192 181
1232 3300038443 Ga0395901_0000603 Ga0395901_0000603_33452_34063 181
1233 3300038443 Ga0395901_0187633 Ga0395901_0187633_605_1198 181
1234 3300038443 Ga0395901_0238206 Ga0395901_0238206_1037_1687 181
1235 3300041441 Ga0451787_474471 Ga0451787_474471_195_791 181
1236 3300041456 Ga0451795_1296634 Ga0451795_1296634_103_717 181
1237 3300042005 Ga0439448_0014521 Ga0439448_0014521_127_732 181
1238 3300042127 Ga0450890_007651 Ga0450890_007651_410_1018 181
1239 3300044658 Ga0466972_0099084 Ga0466972_0099084_93_701 181
1240 3300046501 Ga0495607_0066211 Ga0495607_0066211_388_981 181
1241 3300046519 Ga0495632_0000007 Ga0495632_0000007_29979_30575 181
1242 3300046520 Ga0495637_0000971 Ga0495637_0000971_3140_3736 181
1243 3300046522 Ga0495643_0000005 Ga0495643_0000005_136864_137460 181
1244 3300046524 Ga0495648_0188419 Ga0495648_0188419_72_668 181
1245 3300046525 Ga0495663_0000005 Ga0495663_0000005_28998_29594 181
1246 3300046558 Ga0495633_0001368 Ga0495633_0001368_18430_19026 181
1247 3300046558 Ga0495633_0007470 Ga0495633_0007470_54_650 181
1248 3300046660 Ga0495625_0133908 Ga0495625_0133908_418_1014 181
1249 3300046692 Ga0495671_0000007 Ga0495671_0000007_136864_137460 181
1250 3300047469 Ga0495673_0016342 Ga0495673_0016342_2743_3336 181
1251 3300047470 Ga0495681_0012249 Ga0495681_0012249_540_1136 181
1252 3300047472 Ga0495686_0000904 Ga0495686_0000904_33267_33860 181
1253 3300047472 Ga0495686_0016391 Ga0495686_0016391_2671_3267 181
1254 3300047472 Ga0495686_0292211 Ga0495686_0292211_15_635 181
1255 3300048911 Ga0496108_0318470 Ga0496108_0318470_490_1101 181
1256 3300048915 Ga0496112_0020565 Ga0496112_0020565_3416_4027 181
1257 3300048918 Ga0496115_0000428 Ga0496115_0000428_26572_27183 181
1258 3300048920 Ga0496117_0009462 Ga0496117_0009462_115_702 181
1259 3300048921 Ga0496118_0000811 Ga0496118_0000811_25978_26565 181
1260 3300048927 Ga0496124_0536752 Ga0496124_0536752_160_747 181
1261 3300049540 Ga0501324_002322 Ga0501324_002322_11_613 181
1262 3300049778 Ga0501282_017523 Ga0501282_017523_155_751 181
1263 3300053087 Ga0500643_008204 Ga0500643_008204_105_713 181
1264 3300053153 Ga0500616_0009696 Ga0500616_0009696_24_632 181
1265 3300061719 Ga0466962_0064663 Ga0466962_0064663_20_616 181
1266 iso_pu_bacteria 2643221605 2644037113 181
1267 iso_pu_bacteria 2643221606 2644043639 181
1268 iso_pu_bacteria 2643221671 2644393798 181
1269 iso_pu_bacteria 2896429255 2896430826 181
1270 iso_pu_bacteria 2919138771 2919141385 181
1271 iso_pu_bacteria 2946787523 2946788040 181
1272 3300001979 JGI24740J21852_10093189 JGI24740J21852_100931891 182
1273 3300002067 JGI24735J21928_10091937 JGI24735J21928_100919372 182
1274 3300005329 Ga0070683_100491192 Ga0070683_1004911922 182
1275 3300005335 Ga0070666_10131460 Ga0070666_101314603 182
1276 3300005337 Ga0070682_100366686 Ga0070682_1003666862 182
1277 3300005344 Ga0070661_100089673 Ga0070661_1000896733 182
1278 3300005347 Ga0070668_100227246 Ga0070668_1002272463 182
1279 3300005355 Ga0070671_100095853 Ga0070671_1000958534 182
1280 3300005364 Ga0070673_100149747 Ga0070673_1001497473 182
1281 3300005366 Ga0070659_100014821 Ga0070659_1000148215 182
1282 3300005435 Ga0070714_100136912 Ga0070714_1001369122 182
1283 3300005457 Ga0070662_100021491 Ga0070662_1000214914 182
1284 3300005539 Ga0068853_100001390 Ga0068853_1000013907 182
1285 3300005563 Ga0068855_100005719 Ga0068855_1000057192 182
1286 3300005563 Ga0068855_101091374 Ga0068855_1010913741 182
1287 3300005564 Ga0070664_100098785 Ga0070664_1000987855 182
1288 3300005578 Ga0068854_100300913 Ga0068854_1003009132 182
1289 3300005614 Ga0068856_100241818 Ga0068856_1002418181 182
1290 3300006358 Ga0068871_100679875 Ga0068871_1006798752 182
1291 3300009093 Ga0105240_10033235 Ga0105240_100332354 182
1292 3300009174 Ga0105241_10047496 Ga0105241_100474964 182
1293 3300009551 Ga0105238_10032364 Ga0105238_100323647 182
1294 3300009551 Ga0105238_10546078 Ga0105238_105460782 182
1295 3300009553 Ga0105249_10903603 Ga0105249_109036031 182
1296 3300010375 Ga0105239_10055897 Ga0105239_100558973 182
1297 3300025903 Ga0207680_10006622 Ga0207680_100066223 182
1298 3300025904 Ga0207647_10021214 Ga0207647_100212148 182
1299 3300025904 Ga0207647_10080102 Ga0207647_100801023 182
1300 3300025917 Ga0207660_10766184 Ga0207660_107661841 182
1301 3300025919 Ga0207657_10562663 Ga0207657_105626632 182
1302 3300025919 Ga0207657_10634173 Ga0207657_106341732 182
1303 3300025921 Ga0207652_10326654 Ga0207652_103266543 182
1304 3300025924 Ga0207694_10071926 Ga0207694_100719262 182
1305 3300025929 Ga0207664_10132594 Ga0207664_101325942 182
1306 3300025931 Ga0207644_10036016 Ga0207644_100360163 182
1307 3300025933 Ga0207706_10004412 Ga0207706_1000441218 182
1308 3300025933 Ga0207706_10018444 Ga0207706_100184446 182
1309 3300025949 Ga0207667_10000651 Ga0207667_100006513 182
1310 3300025981 Ga0207640_10002785 Ga0207640_100027855 182
1311 3300026041 Ga0207639_10002847 Ga0207639_100028473 182
1312 3300026078 Ga0207702_10916668 Ga0207702_109166682 182
1313 3300026142 Ga0207698_10105999 Ga0207698_101059994 182
1314 3300031548 Ga0307408_100034262 Ga0307408_1000342624 182
1315 3300031731 Ga0307405_10011630 Ga0307405_100116304 182
1316 3300031901 Ga0307406_10008583 Ga0307406_100085831 182
1317 3300031903 Ga0307407_10014619 Ga0307407_100146194 182
1318 3300031911 Ga0307412_10070371 Ga0307412_100703713 182
1319 3300031995 Ga0307409_100093100 Ga0307409_1000931003 182
1320 3300032002 Ga0307416_100013884 Ga0307416_1000138847 182
1321 3300032005 Ga0307411_10003341 Ga0307411_100033419 182
1322 3300035121 Ga0373960_0049190 Ga0373960_0049190_101_709 182
1323 3300037418 Ga0395900_0048535 Ga0395900_0048535_920_1525 182
1324 3300037418 Ga0395900_0146278 Ga0395900_0146278_1719_2330 182
1325 3300037418 Ga0395900_0157340 Ga0395900_0157340_1041_1676 182
1326 3300037466 Ga0395898_0335348 Ga0395898_0335348_178_783 182
1327 3300037466 Ga0395898_0976618 Ga0395898_0976618_21_632 182
1328 3300037471 Ga0395905_0021011 Ga0395905_0021011_76_687 182
1329 3300037471 Ga0395905_0034086 Ga0395905_0034086_3049_3654 182
1330 3300037471 Ga0395905_0149610 Ga0395905_0149610_228_863 182
1331 3300038443 Ga0395901_0002869 Ga0395901_0002869_8439_9044 182
1332 3300038443 Ga0395901_0015960 Ga0395901_0015960_688_1323 182
1333 3300042012 Ga0439455_0001059 Ga0439455_0001059_2431_3027 182
1334 3300042157 Ga0439458_0001169 Ga0439458_0001169_4974_5570 182
1335 3300044684 Ga0466966_0045811 Ga0466966_0045811_1825_2412 182
1336 3300044684 Ga0466966_0124094 Ga0466966_0124094_854_1441 182
1337 3300044694 Ga0466963_0436933 Ga0466963_0436933_223_810 182
1338 3300046506 Ga0495583_0000111 Ga0495583_0000111_34608_35201 182
1339 3300046665 Ga0495661_0046403 Ga0495661_0046403_538_1131 182
1340 3300049460 Ga0495682_0029467 Ga0495682_0029467_1385_1978 182
1341 3300053096 Ga0500641_0015756 Ga0500641_0015756_1814_2416 182
1342 3300053103 Ga0500555_000965 Ga0500555_000965_3772_4365 182
1343 3300053735 Ga0500596_013838 Ga0500596_013838_548_1138 182
1344 3300059645 Ga0587076_089455 Ga0587076_089455_44_655 182
1345 iso_pu_bacteria 2643221622 2644126311 182
1346 3300000041 ARcpr5oldR_c000971 ARcpr5oldR_0009714 183
1347 3300000043 ARcpr5yngRDRAFT_c003421 ARcpr5yngRDRAFT_0034213 183
1348 3300002774 JGI25150J39212_1018431 JGI25150J39212_10184311 183
1349 3300003215 JGI25153J46596_10025162 JGI25153J46596_100251623 183
1350 3300003773 Ga0055537_1000962 Ga0055537_10009624 183
1351 3300003775 Ga0055524_1000452 Ga0055524_100045224 183
1352 3300003794 Ga0055531_10028572 Ga0055531_100285724 183
1353 3300005262 Ga0065165_1005838 Ga0065165_10058383 183
1354 3300005355 Ga0070671_100060274 Ga0070671_1000602744 183
1355 3300005356 Ga0070674_100062222 Ga0070674_1000622221 183
1356 3300005356 Ga0070674_100629632 Ga0070674_1006296321 183
1357 3300005435 Ga0070714_100010147 Ga0070714_1000101478 183
1358 3300005618 Ga0068864_100123463 Ga0068864_1001234632 183
1359 3300006028 Ga0070717_10010182 Ga0070717_100101826 183
1360 3300010375 Ga0105239_10897375 Ga0105239_108973752 183
1361 3300012512 Ga0157327_1008778 Ga0157327_10087781 183
1362 3300013297 Ga0157378_10106061 Ga0157378_101060613 183
1363 3300025229 Ga0209147_100569 Ga0209147_10056911 183
1364 3300025245 Ga0207425_1003889 Ga0207425_10038892 183
1365 3300025263 Ga0209565_1000010 Ga0209565_1000010583 183
1366 3300025273 Ga0209673_1011463 Ga0209673_10114634 183
1367 3300025292 Ga0209676_1009533 Ga0209676_10095333 183
1368 3300025295 Ga0209564_1028366 Ga0209564_10283662 183
1369 3300025297 Ga0209758_1011966 Ga0209758_10119668 183
1370 3300025297 Ga0209758_1012371 Ga0209758_10123712 183
1371 3300025298 Ga0209050_1000001 Ga0209050_10000012767 183
1372 3300025298 Ga0209050_1011009 Ga0209050_10110097 183
1373 3300025299 Ga0209256_1000010 Ga0209256_1000010807 183
1374 3300025302 Ga0207426_1065511 Ga0207426_10655113 183
1375 3300025303 Ga0209051_1000279 Ga0209051_100027935 183
1376 3300025304 Ga0209257_1004523 Ga0209257_10045232 183
1377 3300025928 Ga0207700_10113161 Ga0207700_101131614 183
1378 3300025929 Ga0207664_10174266 Ga0207664_101742663 183
1379 3300025931 Ga0207644_10008816 Ga0207644_100088162 183
1380 3300025937 Ga0207669_10359783 Ga0207669_103597832 183
1381 3300025944 Ga0207661_10581081 Ga0207661_105810812 183
1382 3300025945 Ga0207679_10440840 Ga0207679_104408402 183
1383 3300025981 Ga0207640_10022813 Ga0207640_100228131 183
1384 3300026121 Ga0207683_10773740 Ga0207683_107737402 183
1385 3300031995 Ga0307409_100030466 Ga0307409_1000304665 183
1386 3300031995 Ga0307409_100532302 Ga0307409_1005323022 183
1387 3300037418 Ga0395900_0125689 Ga0395900_0125689_547_1161 183
1388 3300037471 Ga0395905_0133389 Ga0395905_0133389_490_1104 183
1389 3300038443 Ga0395901_0119896 Ga0395901_0119896_774_1388 183
1390 3300038705 Ga0237819_00997 Ga0237819_00997_2395_2982 183
1391 3300039145 Ga0237816_01348 Ga0237816_01348_321_908 183
1392 3300041404 Ga0439436_0010448 Ga0439436_0010448_1347_1955 183
1393 3300041406 Ga0439439_0015658 Ga0439439_0015658_577_1185 183
1394 3300041411 Ga0439466_0063717 Ga0439466_0063717_268_870 183
1395 3300041413 Ga0439465_0012432 Ga0439465_0012432_45_653 183
1396 3300041413 Ga0439465_0024370 Ga0439465_0024370_45_647 183
1397 3300041997 Ga0439431_0000266 Ga0439431_0000266_41_643 183
1398 3300041997 Ga0439431_0001884 Ga0439431_0001884_3039_3647 183
1399 3300042002 Ga0439442_006828 Ga0439442_006828_1277_1879 183
1400 3300042004 Ga0439445_0057548 Ga0439445_0057548_412_1014 183
1401 3300042010 Ga0439452_012996 Ga0439452_012996_467_1075 183
1402 3300042014 Ga0439457_009600 Ga0439457_009600_521_1129 183
1403 3300042015 Ga0439462_0000072 Ga0439462_0000072_14539_15141 183
1404 3300042131 Ga0450894_022132 Ga0450894_022132_44_652 183
1405 3300042156 Ga0439446_0090261 Ga0439446_0090261_101_709 183
1406 3300042435 Ga0439434_0017782 Ga0439434_0017782_747_1349 183
1407 3300044683 Ga0466965_0064703 Ga0466965_0064703_844_1449 183
1408 3300044693 Ga0466961_0262323 Ga0466961_0262323_82_666 183
1409 3300046660 Ga0495625_0349640 Ga0495625_0349640_198_788 183
1410 3300048905 Ga0496102_0464439 Ga0496102_0464439_262_882 183
1411 3300049539 Ga0501323_027378 Ga0501323_027378_112_714 183
1412 3300050509 nmdc:mga0qj67_45931_c1 nmdc:mga0qj67_45931_c1_2291_2926 183
1413 3300053151 Ga0500604_0017646 Ga0500604_0017646_98_688 183
1414 iso_pu_bacteria 2885427238 2885427816 183
1415 3300005563 Ga0068855_100273721 Ga0068855_1002737212 184
1416 3300005578 Ga0068854_100108056 Ga0068854_1001080562 184
1417 3300005617 Ga0068859_100002480 Ga0068859_10000248015 184
1418 3300005617 Ga0068859_100428816 Ga0068859_1004288163 184
1419 3300005618 Ga0068864_100004561 Ga0068864_1000045615 184
1420 3300005719 Ga0068861_100000005 Ga0068861_10000000563 184
1421 3300005841 Ga0068863_100031670 Ga0068863_1000316705 184
1422 3300005843 Ga0068860_100006578 Ga0068860_1000065782 184
1423 3300005844 Ga0068862_100000702 Ga0068862_10000070212 184
1424 3300006881 Ga0068865_100240340 Ga0068865_1002403402 184
1425 3300006931 Ga0097620_100002480 Ga0097620_10000248015 184
1426 3300006931 Ga0097620_100428767 Ga0097620_1004287673 184
1427 3300009101 Ga0105247_10005531 Ga0105247_100055318 184
1428 3300009553 Ga0105249_10000097 Ga0105249_1000009773 184
1429 3300013104 Ga0157370_10004829 Ga0157370_1000482914 184
1430 3300014968 Ga0157379_10082736 Ga0157379_100827362 184
1431 3300025304 Ga0209257_1018759 Ga0209257_10187594 184
1432 3300025900 Ga0207710_10012743 Ga0207710_100127434 184
1433 3300025961 Ga0207712_10000074 Ga0207712_1000007436 184
1434 3300026088 Ga0207641_10074338 Ga0207641_100743384 184
1435 3300026095 Ga0207676_10000193 Ga0207676_1000019342 184
1436 3300026118 Ga0207675_100000020 Ga0207675_10000002083 184
1437 3300028380 Ga0268265_10000655 Ga0268265_1000065523 184
1438 3300028381 Ga0268264_10066778 Ga0268264_100667784 184
1439 3300031911 Ga0307412_10011200 Ga0307412_100112004 184
1440 3300037312 Ga0395899_0176237 Ga0395899_0176237_75_686 184
1441 3300037418 Ga0395900_0048120 Ga0395900_0048120_3025_3636 184
1442 3300037466 Ga0395898_0100601 Ga0395898_0100601_167_778 184
1443 3300037471 Ga0395905_0024148 Ga0395905_0024148_5066_5677 184
1444 3300037471 Ga0395905_0091962 Ga0395905_0091962_2137_2748 184
1445 3300037471 Ga0395905_0379500 Ga0395905_0379500_200_811 184
1446 3300038443 Ga0395901_0075822 Ga0395901_0075822_87_698 184
1447 3300038443 Ga0395901_0700679 Ga0395901_0700679_306_914 184
1448 3300038443 Ga0395901_0980212 Ga0395901_0980212_87_698 184
1449 3300041512 Ga0451853_1878420 Ga0451853_1878420_1056_1649 184
1450 3300042005 Ga0439448_0041089 Ga0439448_0041089_38_649 184
1451 3300042157 Ga0439458_0000003 Ga0439458_0000003_26471_27082 184
1452 3300044693 Ga0466961_0010293 Ga0466961_0010293_5317_5931 184
1453 3300044694 Ga0466963_0005775 Ga0466963_0005775_198_812 184
1454 3300044719 Ga0466971_0010170 Ga0466971_0010170_715_1329 184
1455 3300044842 Ga0466957_0003546 Ga0466957_0003546_6149_6763 184
1456 3300044842 Ga0466957_0095064 Ga0466957_0095064_1128_1724 184
1457 3300045049 Ga0466959_0093564 Ga0466959_0093564_253_867 184
1458 3300045836 Ga0466958_0000867 Ga0466958_0000867_6742_7356 184
1459 3300045976 Ga0466967_0093266 Ga0466967_0093266_1915_2529 184
1460 3300049571 Ga0501034_0298252 Ga0501034_0298252_353_961 184
1461 3300050492 nmdc:mga0yw44_521925_c1 nmdc:mga0yw44_521925_c1_39_644 184
1462 3300053119 Ga0500595_017070 Ga0500595_017070_151_765 184
1463 3300053140 Ga0500573_0000045 Ga0500573_0000045_95204_95806 184
1464 3300061719 Ga0466962_0003328 Ga0466962_0003328_657_1271 184
1465 3300001904 JGI24736J21556_1000110 JGI24736J21556_10001109 185
1466 3300001976 JGI24752J21851_1000117 JGI24752J21851_10001179 185
1467 3300001979 JGI24740J21852_10013016 JGI24740J21852_100130165 185
1468 3300001989 JGI24739J22299_10060964 JGI24739J22299_100609642 185
1469 3300001989 JGI24739J22299_10108056 JGI24739J22299_101080561 185
1470 3300001990 JGI24737J22298_10012770 JGI24737J22298_100127706 185
1471 3300002067 JGI24735J21928_10002484 JGI24735J21928_100024845 185
1472 3300002070 JGI24750J21931_1000571 JGI24750J21931_10005718 185
1473 3300002074 JGI24748J21848_1000029 JGI24748J21848_100002989 185
1474 3300002075 JGI24738J21930_10005863 JGI24738J21930_100058635 185
1475 3300002076 JGI24749J21850_1000261 JGI24749J21850_10002619 185
1476 3300002239 JGI24034J26672_10000006 JGI24034J26672_10000006236 185
1477 3300002244 JGI24742J22300_10002400 JGI24742J22300_100024002 185
1478 3300002459 JGI24751J29686_10012811 JGI24751J29686_100128112 185
1479 3300003214 JGI25165J46597_1000053 JGI25165J46597_10000537 185
1480 3300005262 Ga0065165_1002723 Ga0065165_100272311 185
1481 3300005327 Ga0070658_10059369 Ga0070658_100593691 185
1482 3300005329 Ga0070683_100232054 Ga0070683_1002320543 185
1483 3300005330 Ga0070690_100000002 Ga0070690_100000002116 185
1484 3300005331 Ga0070670_100304119 Ga0070670_1003041191 185
1485 3300005335 Ga0070666_10000002 Ga0070666_10000002478 185
1486 3300005336 Ga0070680_100295689 Ga0070680_1002956892 185
1487 3300005339 Ga0070660_100011916 Ga0070660_10001191610 185
1488 3300005339 Ga0070660_100030095 Ga0070660_1000300954 185
1489 3300005344 Ga0070661_100108498 Ga0070661_1001084981 185
1490 3300005347 Ga0070668_100094565 Ga0070668_1000945652 185
1491 3300005353 Ga0070669_100000078 Ga0070669_10000007890 185
1492 3300005365 Ga0070688_100010565 Ga0070688_1000105654 185
1493 3300005366 Ga0070659_100036603 Ga0070659_1000366032 185
1494 3300005366 Ga0070659_100255325 Ga0070659_1002553252 185
1495 3300005455 Ga0070663_100035078 Ga0070663_1000350782 185
1496 3300005457 Ga0070662_100007277 Ga0070662_1000072775 185
1497 3300005458 Ga0070681_10013052 Ga0070681_100130525 185
1498 3300005458 Ga0070681_10666781 Ga0070681_106667811 185
1499 3300005466 Ga0070685_10000056 Ga0070685_1000005670 185
1500 3300005530 Ga0070679_100036988 Ga0070679_1000369886 185
1501 3300005539 Ga0068853_100032065 Ga0068853_1000320653 185
1502 3300005539 Ga0068853_100168375 Ga0068853_1001683753 185
1503 3300005544 Ga0070686_100000002 Ga0070686_10000000297 185
1504 3300005548 Ga0070665_100000025 Ga0070665_100000025239 185
1505 3300005563 Ga0068855_100046618 Ga0068855_1000466183 185
1506 3300005564 Ga0070664_100135308 Ga0070664_1001353082 185
1507 3300005564 Ga0070664_100485328 Ga0070664_1004853282 185
1508 3300005577 Ga0068857_100102735 Ga0068857_1001027352 185
1509 3300005577 Ga0068857_100255432 Ga0068857_1002554322 185
1510 3300005578 Ga0068854_100183145 Ga0068854_1001831452 185
1511 3300005614 Ga0068856_101323769 Ga0068856_1013237692 185
1512 3300005616 Ga0068852_100010470 Ga0068852_1000104705 185
1513 3300005616 Ga0068852_100081898 Ga0068852_1000818985 185
1514 3300005616 Ga0068852_100465834 Ga0068852_1004658342 185
1515 3300005617 Ga0068859_100109007 Ga0068859_1001090073 185
1516 3300005618 Ga0068864_100065993 Ga0068864_1000659934 185
1517 3300005719 Ga0068861_100003714 Ga0068861_1000037144 185
1518 3300005834 Ga0068851_10006539 Ga0068851_100065394 185
1519 3300005834 Ga0068851_10016068 Ga0068851_100160683 185
1520 3300005841 Ga0068863_100000070 Ga0068863_10000007080 185
1521 3300005843 Ga0068860_100000001 Ga0068860_100000001485 185
1522 3300005844 Ga0068862_100000020 Ga0068862_100000020175 185
1523 3300006042 Ga0075368_10000465 Ga0075368_100004656 185
1524 3300006178 Ga0075367_10000528 Ga0075367_1000052812 185
1525 3300006353 Ga0075370_10035118 Ga0075370_100351184 185
1526 3300006931 Ga0097620_100109006 Ga0097620_1001090063 185
1527 3300009093 Ga0105240_10016200 Ga0105240_100162002 185
1528 3300009177 Ga0105248_10023059 Ga0105248_1002305910 185
1529 3300009177 Ga0105248_10358555 Ga0105248_103585552 185
1530 3300009545 Ga0105237_10019254 Ga0105237_1001925411 185
1531 3300009553 Ga0105249_10000005 Ga0105249_10000005255 185
1532 3300009553 Ga0105249_10491226 Ga0105249_104912261 185
1533 3300010375 Ga0105239_10908296 Ga0105239_109082962 185
1534 3300013100 Ga0157373_10039540 Ga0157373_100395403 185
1535 3300013100 Ga0157373_10167203 Ga0157373_101672032 185
1536 3300013102 Ga0157371_10044196 Ga0157371_100441962 185
1537 3300013104 Ga0157370_10049711 Ga0157370_100497118 185
1538 3300013105 Ga0157369_10018433 Ga0157369_100184337 185
1539 3300013306 Ga0163162_10076882 Ga0163162_100768823 185
1540 3300013307 Ga0157372_10010467 Ga0157372_100104672 185
1541 3300013307 Ga0157372_10490966 Ga0157372_104909662 185
1542 3300014325 Ga0163163_10060897 Ga0163163_100608975 185
1543 3300014326 Ga0157380_10001415 Ga0157380_1000141512 185
1544 3300014968 Ga0157379_10034850 Ga0157379_100348505 185
1545 3300017792 Ga0163161_10002791 Ga0163161_1000279110 185
1546 3300020076 Ga0206355_1265600 Ga0206355_12656001 185
1547 3300025223 Ga0207672_1000695 Ga0207672_10006954 185
1548 3300025261 Ga0209233_1000119 Ga0209233_1000119222 185
1549 3300025315 Ga0207697_10058229 Ga0207697_100582293 185
1550 3300025321 Ga0207656_10016553 Ga0207656_100165535 185
1551 3300025321 Ga0207656_10051737 Ga0207656_100517372 185
1552 3300025321 Ga0207656_10215258 Ga0207656_102152581 185
1553 3300025903 Ga0207680_10000004 Ga0207680_10000004383 185
1554 3300025909 Ga0207705_10167823 Ga0207705_101678232 185
1555 3300025911 Ga0207654_10002603 Ga0207654_100026039 185
1556 3300025912 Ga0207707_10043923 Ga0207707_100439235 185
1557 3300025913 Ga0207695_10065915 Ga0207695_100659158 185
1558 3300025913 Ga0207695_10066126 Ga0207695_100661264 185
1559 3300025914 Ga0207671_10001601 Ga0207671_1000160127 185
1560 3300025917 Ga0207660_10109095 Ga0207660_101090952 185
1561 3300025919 Ga0207657_10036123 Ga0207657_100361232 185
1562 3300025919 Ga0207657_10036409 Ga0207657_100364098 185
1563 3300025919 Ga0207657_10069195 Ga0207657_100691954 185
1564 3300025921 Ga0207652_10031855 Ga0207652_100318556 185
1565 3300025923 Ga0207681_10000130 Ga0207681_1000013061 185
1566 3300025924 Ga0207694_10003700 Ga0207694_1000370011 185
1567 3300025925 Ga0207650_10116445 Ga0207650_101164452 185
1568 3300025931 Ga0207644_10023299 Ga0207644_100232993 185
1569 3300025932 Ga0207690_10045082 Ga0207690_100450822 185
1570 3300025932 Ga0207690_10171634 Ga0207690_101716341 185
1571 3300025933 Ga0207706_10070052 Ga0207706_100700521 185
1572 3300025941 Ga0207711_10006432 Ga0207711_100064327 185
1573 3300025941 Ga0207711_10132160 Ga0207711_101321602 185
1574 3300025944 Ga0207661_10534221 Ga0207661_105342212 185
1575 3300025945 Ga0207679_10302456 Ga0207679_103024563 185
1576 3300025945 Ga0207679_10447834 Ga0207679_104478342 185
1577 3300025949 Ga0207667_10066424 Ga0207667_100664247 185
1578 3300025949 Ga0207667_10671361 Ga0207667_106713612 185
1579 3300025961 Ga0207712_10000001 Ga0207712_10000001257 185
1580 3300025961 Ga0207712_10301749 Ga0207712_103017491 185
1581 3300025981 Ga0207640_10221716 Ga0207640_102217163 185
1582 3300025981 Ga0207640_10371929 Ga0207640_103719292 185
1583 3300025986 Ga0207658_10001041 Ga0207658_1000104110 185
1584 3300026035 Ga0207703_10002210 Ga0207703_1000221021 185
1585 3300026035 Ga0207703_10009056 Ga0207703_100090567 185
1586 3300026041 Ga0207639_10000306 Ga0207639_1000030637 185
1587 3300026041 Ga0207639_10173707 Ga0207639_101737072 185
1588 3300026067 Ga0207678_10055159 Ga0207678_100551592 185
1589 3300026078 Ga0207702_10073569 Ga0207702_100735694 185
1590 3300026088 Ga0207641_10000033 Ga0207641_10000033189 185
1591 3300026095 Ga0207676_10002304 Ga0207676_100023044 185
1592 3300026116 Ga0207674_10026848 Ga0207674_1002684811 185
1593 3300026116 Ga0207674_10115284 Ga0207674_101152843 185
1594 3300026116 Ga0207674_11268491 Ga0207674_112684911 185
1595 3300026116 Ga0207674_11278756 Ga0207674_112787561 185
1596 3300026118 Ga0207675_100003055 Ga0207675_10000305517 185
1597 3300026142 Ga0207698_10016964 Ga0207698_100169643 185
1598 3300027866 Ga0209813_10000642 Ga0209813_100006423 185
1599 3300028379 Ga0268266_10000028 Ga0268266_10000028148 185
1600 3300028380 Ga0268265_10000524 Ga0268265_100005246 185
1601 3300028381 Ga0268264_10000006 Ga0268264_10000006383 185
1602 3300031824 Ga0307413_10528879 Ga0307413_105288792 185
1603 3300033180 Ga0307510_10119138 Ga0307510_101191384 185
1604 3300035121 Ga0373960_0138379 Ga0373960_0138379_166_774 185
1605 3300037312 Ga0395899_0000103 Ga0395899_0000103_65036_65644 185
1606 3300037312 Ga0395899_0015182 Ga0395899_0015182_354_962 185
1607 3300037312 Ga0395899_0181294 Ga0395899_0181294_619_1278 185
1608 3300037418 Ga0395900_0000093 Ga0395900_0000093_119637_120245 185
1609 3300037418 Ga0395900_0129797 Ga0395900_0129797_457_1065 185
1610 3300037418 Ga0395900_0165784 Ga0395900_0165784_511_1119 185
1611 3300037418 Ga0395900_0906782 Ga0395900_0906782_73_732 185
1612 3300037466 Ga0395898_0000053 Ga0395898_0000053_119637_120245 185
1613 3300037466 Ga0395898_0006749 Ga0395898_0006749_7129_7737 185
1614 3300037466 Ga0395898_0146453 Ga0395898_0146453_784_1443 185
1615 3300037466 Ga0395898_0666448 Ga0395898_0666448_120_728 185
1616 3300037471 Ga0395905_0000031 Ga0395905_0000031_166513_167121 185
1617 3300037471 Ga0395905_0002160 Ga0395905_0002160_7310_7918 185
1618 3300037471 Ga0395905_0032012 Ga0395905_0032012_2943_3551 185
1619 3300037471 Ga0395905_0262478 Ga0395905_0262478_223_831 185
1620 3300038443 Ga0395901_0001133 Ga0395901_0001133_20799_21407 185
1621 3300038443 Ga0395901_0103747 Ga0395901_0103747_1684_2343 185
1622 3300038443 Ga0395901_0615440 Ga0395901_0615440_204_812 185
1623 3300038443 Ga0395901_1052899 Ga0395901_1052899_98_706 185
1624 3300044735 Ga0466968_0069985 Ga0466968_0069985_778_1365 185
1625 3300044765 Ga0466970_0124328 Ga0466970_0124328_218_814 185
1626 3300045976 Ga0466967_0046607 Ga0466967_0046607_1892_2503 185
1627 3300046506 Ga0495583_0037338 Ga0495583_0037338_382_993 185
1628 3300046507 Ga0495606_0068197 Ga0495606_0068197_779_1372 185
1629 3300046524 Ga0495648_0084734 Ga0495648_0084734_641_1252 185
1630 3300046525 Ga0495663_0076555 Ga0495663_0076555_436_1026 185
1631 3300046660 Ga0495625_0005244 Ga0495625_0005244_8029_8640 185
1632 3300047445 Ga0495677_0022715 Ga0495677_0022715_1149_1760 185
1633 3300047472 Ga0495686_0000091 Ga0495686_0000091_90494_91087 185
1634 3300047472 Ga0495686_0045492 Ga0495686_0045492_196_804 185
1635 3300048905 Ga0496102_0162422 Ga0496102_0162422_1419_2003 185
1636 3300048906 Ga0496103_0000643 Ga0496103_0000643_3500_4084 185
1637 3300048908 Ga0496105_0051276 Ga0496105_0051276_2248_2832 185
1638 3300048910 Ga0496107_0139776 Ga0496107_0139776_743_1327 185
1639 3300048913 Ga0496110_0775515 Ga0496110_0775515_10_594 185
1640 3300048914 Ga0496111_0206021 Ga0496111_0206021_862_1446 185
1641 3300048915 Ga0496112_0092289 Ga0496112_0092289_1623_2231 185
1642 3300048916 Ga0496113_0001079 Ga0496113_0001079_263_871 185
1643 3300048919 Ga0496116_0011628 Ga0496116_0011628_1043_1627 185
1644 3300048920 Ga0496117_0005240 Ga0496117_0005240_9987_10571 185
1645 3300048921 Ga0496118_0020700 Ga0496118_0020700_77_661 185
1646 3300048921 Ga0496118_0125414 Ga0496118_0125414_178_771 185
1647 3300048924 Ga0496121_0048291 Ga0496121_0048291_225_824 185
1648 3300048927 Ga0496124_0138395 Ga0496124_0138395_163_747 185
1649 3300049513 Ga0501290_000007 Ga0501290_000007_189_782 185
1650 3300049515 Ga0501292_000015 Ga0501292_000015_35143_35736 185
1651 3300049517 Ga0501294_000459 Ga0501294_000459_2890_3483 185
1652 3300049531 Ga0501315_011815 Ga0501315_011815_361_954 185
1653 3300049533 Ga0501317_008890 Ga0501317_008890_439_1032 185
1654 3300049549 Ga0501333_002519 Ga0501333_002519_350_943 185
1655 3300049554 Ga0501338_03161 Ga0501338_03161_341_934 185
1656 3300049653 Ga0501206_001153 Ga0501206_001153_1199_1792 185
1657 3300049662 Ga0501222_001017 Ga0501222_001017_178_771 185
1658 3300049663 Ga0501223_004972 Ga0501223_004972_996_1589 185
1659 3300049664 Ga0501224_008638 Ga0501224_008638_706_1299 185
1660 3300049665 Ga0501227_066995 Ga0501227_066995_190_783 185
1661 3300049668 Ga0501233_065502 Ga0501233_065502_44_637 185
1662 3300049690 Ga0501261_001291 Ga0501261_001291_1146_1739 185
1663 3300049704 Ga0501221_004253 Ga0501221_004253_536_1129 185
1664 3300049705 Ga0501225_0019156 Ga0501225_0019156_85_678 185
1665 3300049775 Ga0501279_000015 Ga0501279_000015_35143_35736 185
1666 3300049776 Ga0501280_000076 Ga0501280_000076_14823_15416 185
1667 3300049777 Ga0501281_00692 Ga0501281_00692_1221_1814 185
1668 3300050494 nmdc:mga06z11_513_c1 nmdc:mga06z11_513_c1_5906_6502 185
1669 3300050495 nmdc:mga04h51_241_c1 nmdc:mga04h51_241_c1_7793_8389 185
1670 3300050496 nmdc:mga07m45_70943_c1 nmdc:mga07m45_70943_c1_1232_1828 185
1671 3300053087 Ga0500643_001656 Ga0500643_001656_4027_4641 185
1672 3300053116 Ga0500592_000226 Ga0500592_000226_961_1551 185
1673 3300053131 Ga0500652_063317 Ga0500652_063317_103_717 185
1674 3300053136 Ga0500559_0162447 Ga0500559_0162447_380_994 185
1675 3300053158 Ga0500627_0276073 Ga0500627_0276073_63_653 185
1676 3300053727 Ga0500611_000848 Ga0500611_000848_33_623 185
1677 3300053730 Ga0500645_064700 Ga0500645_064700_118_732 185
1678 3300059477 Ga0587084_006819 Ga0587084_006819_16_618 185
1679 3300059623 Ga0587101_025311 Ga0587101_025311_16_618 185
1680 iso_pu_bacteria 2512564014 2512643284 185
1681 iso_pu_bacteria 2775507255 2778123886 185
1682 3300002774 JGI25150J39212_1000596 JGI25150J39212_100059613 186
1683 3300003187 JGI25151J46595_10013195 JGI25151J46595_100131955 186
1684 3300003215 JGI25153J46596_10000017 JGI25153J46596_1000001776 186
1685 3300003771 Ga0055526_1004025 Ga0055526_100402510 186
1686 3300003791 Ga0055530_10009326 Ga0055530_100093262 186
1687 3300005295 Ga0065707_10083015 Ga0065707_100830152 186
1688 3300005327 Ga0070658_10167078 Ga0070658_101670783 186
1689 3300005339 Ga0070660_100006734 Ga0070660_1000067344 186
1690 3300005344 Ga0070661_100054342 Ga0070661_1000543425 186
1691 3300005344 Ga0070661_100628744 Ga0070661_1006287442 186
1692 3300005355 Ga0070671_100026211 Ga0070671_1000262112 186
1693 3300005435 Ga0070714_100106803 Ga0070714_1001068035 186
1694 3300005455 Ga0070663_100072677 Ga0070663_1000726772 186
1695 3300005563 Ga0068855_100414184 Ga0068855_1004141842 186
1696 3300005578 Ga0068854_100157827 Ga0068854_1001578272 186
1697 3300005614 Ga0068856_100103666 Ga0068856_1001036661 186
1698 3300005614 Ga0068856_100331344 Ga0068856_1003313442 186
1699 3300005616 Ga0068852_100054789 Ga0068852_1000547892 186
1700 3300005983 Ga0081540_1078141 Ga0081540_10781413 186
1701 3300009093 Ga0105240_10588465 Ga0105240_105884652 186
1702 3300009148 Ga0105243_10358991 Ga0105243_103589913 186
1703 3300009545 Ga0105237_10027667 Ga0105237_100276675 186
1704 3300010375 Ga0105239_10000104 Ga0105239_1000010420 186
1705 3300013105 Ga0157369_10182533 Ga0157369_101825333 186
1706 3300013308 Ga0157375_11851690 Ga0157375_118516901 186
1707 3300014326 Ga0157380_10000280 Ga0157380_100002803 186
1708 3300025245 Ga0207425_1000022 Ga0207425_1000022124 186
1709 3300025258 Ga0209129_1000525 Ga0209129_10005258 186
1710 3300025294 Ga0209025_1000842 Ga0209025_100084246 186
1711 3300025295 Ga0209564_1003336 Ga0209564_100333611 186
1712 3300025297 Ga0209758_1000004 Ga0209758_1000004751 186
1713 3300025909 Ga0207705_10286219 Ga0207705_102862191 186
1714 3300025913 Ga0207695_10017424 Ga0207695_100174247 186
1715 3300025914 Ga0207671_10001907 Ga0207671_100019079 186
1716 3300025919 Ga0207657_10152566 Ga0207657_101525662 186
1717 3300025920 Ga0207649_10076629 Ga0207649_100766291 186
1718 3300025924 Ga0207694_10276387 Ga0207694_102763872 186
1719 3300025928 Ga0207700_10175388 Ga0207700_101753884 186
1720 3300025929 Ga0207664_10046964 Ga0207664_100469643 186
1721 3300025935 Ga0207709_10307373 Ga0207709_103073732 186
1722 3300025940 Ga0207691_10159692 Ga0207691_101596921 186
1723 3300025981 Ga0207640_10226516 Ga0207640_102265162 186
1724 3300026067 Ga0207678_10637089 Ga0207678_106370891 186
1725 3300026078 Ga0207702_10162382 Ga0207702_101623824 186
1726 3300026078 Ga0207702_10443963 Ga0207702_104439632 186
1727 3300026078 Ga0207702_10789345 Ga0207702_107893452 186
1728 3300026142 Ga0207698_10000751 Ga0207698_1000075121 186
1729 3300026142 Ga0207698_10070641 Ga0207698_100706415 186
1730 3300037312 Ga0395899_0685876 Ga0395899_0685876_32_634 186
1731 3300037418 Ga0395900_0745429 Ga0395900_0745429_125_727 186
1732 3300044684 Ga0466966_0035584 Ga0466966_0035584_1261_1863 186
1733 3300044693 Ga0466961_0066414 Ga0466961_0066414_770_1372 186
1734 3300044765 Ga0466970_0018657 Ga0466970_0018657_2107_2709 186
1735 3300044901 Ga0466960_0079156 Ga0466960_0079156_31_630 186
1736 3300045049 Ga0466959_0070810 Ga0466959_0070810_1685_2287 186
1737 3300045836 Ga0466958_0128384 Ga0466958_0128384_674_1276 186
1738 3300046519 Ga0495632_0163809 Ga0495632_0163809_259_858 186
1739 3300047469 Ga0495673_0029007 Ga0495673_0029007_1956_2555 186
1740 3300047472 Ga0495686_0000060 Ga0495686_0000060_16367_16966 186
1741 3300048903 Ga0496100_0460623 Ga0496100_0460623_147_764 186
1742 3300048920 Ga0496117_0128330 Ga0496117_0128330_625_1224 186
1743 3300048921 Ga0496118_0126319 Ga0496118_0126319_281_877 186
1744 3300048924 Ga0496121_0000072 Ga0496121_0000072_20486_21082 186
1745 3300048924 Ga0496121_0018980 Ga0496121_0018980_3183_3779 186
1746 3300048929 Ga0496126_0044387 Ga0496126_0044387_1967_2563 186
1747 3300049705 Ga0501225_0003808 Ga0501225_0003808_21_617 186
1748 3300053087 Ga0500643_000166 Ga0500643_000166_43693_44280 186
1749 3300053087 Ga0500643_017972 Ga0500643_017972_30_629 186
1750 3300053087 Ga0500643_042974 Ga0500643_042974_99_698 186
1751 3300053120 Ga0500597_016953 Ga0500597_016953_51_644 186
1752 3300053157 Ga0500624_000001 Ga0500624_000001_134822_135415 186
1753 3300053178 Ga0500637_0001304 Ga0500637_0001304_119_712 186
1754 3300061719 Ga0466962_0081669 Ga0466962_0081669_931_1533 186
1755 iso_pu_bacteria 2919709256 2919711411 186
1756 3300031548 Ga0307408_100063351 Ga0307408_1000633512 187
1757 3300031731 Ga0307405_10544027 Ga0307405_105440272 187
1758 3300031852 Ga0307410_10813577 Ga0307410_108135771 187
1759 3300032002 Ga0307416_101282137 Ga0307416_1012821371 187
1760 3300044694 Ga0466963_0110260 Ga0466963_0110260_645_1310 187
1761 3300045976 Ga0466967_0053683 Ga0466967_0053683_1415_2056 187
1762 3300046452 Ga0495617_003757 Ga0495617_003757_2110_2712 187
1763 3300046453 Ga0495627_013170 Ga0495627_013170_1422_2024 187
1764 3300046512 Ga0495610_0000072 Ga0495610_0000072_20463_21065 187
1765 3300046518 Ga0495631_0252170 Ga0495631_0252170_129_734 187
1766 3300046520 Ga0495637_0026836 Ga0495637_0026836_171_776 187
1767 3300047470 Ga0495681_0000043 Ga0495681_0000043_29512_30117 187
1768 3300048920 Ga0496117_0121334 Ga0496117_0121334_144_734 187
1769 3300048923 Ga0496120_0082963 Ga0496120_0082963_98_688 187
1770 3300048929 Ga0496126_0608755 Ga0496126_0608755_73_684 187
1771 3300049459 Ga0495678_019508 Ga0495678_019508_15_620 187
1772 3300049553 Ga0501337_005934 Ga0501337_005934_206_802 187
1773 3300053156 Ga0500622_0336067 Ga0500622_0336067_17_622 187
1774 3300001915 JGI24741J21665_1001534 JGI24741J21665_10015347 188
1775 3300001979 JGI24740J21852_10004545 JGI24740J21852_100045455 188
1776 3300001979 JGI24740J21852_10026549 JGI24740J21852_100265491 188
1777 3300001989 JGI24739J22299_10037282 JGI24739J22299_100372821 188
1778 3300001989 JGI24739J22299_10093185 JGI24739J22299_100931852 188
1779 3300002067 JGI24735J21928_10009345 JGI24735J21928_100093456 188
1780 3300002067 JGI24735J21928_10037412 JGI24735J21928_100374122 188
1781 3300005327 Ga0070658_10426160 Ga0070658_104261601 188
1782 3300005329 Ga0070683_100057532 Ga0070683_1000575323 188
1783 3300005329 Ga0070683_100126568 Ga0070683_1001265682 188
1784 3300005329 Ga0070683_100330394 Ga0070683_1003303942 188
1785 3300005336 Ga0070680_100098387 Ga0070680_1000983874 188
1786 3300005336 Ga0070680_100122358 Ga0070680_1001223582 188
1787 3300005337 Ga0070682_100326363 Ga0070682_1003263633 188
1788 3300005338 Ga0068868_100530864 Ga0068868_1005308642 188
1789 3300005339 Ga0070660_100185020 Ga0070660_1001850202 188
1790 3300005341 Ga0070691_10000673 Ga0070691_100006735 188
1791 3300005344 Ga0070661_100011642 Ga0070661_1000116422 188
1792 3300005344 Ga0070661_100016317 Ga0070661_1000163179 188
1793 3300005344 Ga0070661_100159968 Ga0070661_1001599682 188
1794 3300005344 Ga0070661_100188976 Ga0070661_1001889762 188
1795 3300005344 Ga0070661_100398033 Ga0070661_1003980331 188
1796 3300005366 Ga0070659_100007496 Ga0070659_1000074967 188
1797 3300005435 Ga0070714_100547661 Ga0070714_1005476611 188
1798 3300005436 Ga0070713_100154621 Ga0070713_1001546212 188
1799 3300005455 Ga0070663_100153503 Ga0070663_1001535032 188
1800 3300005455 Ga0070663_100673606 Ga0070663_1006736061 188
1801 3300005457 Ga0070662_100476600 Ga0070662_1004766003 188
1802 3300005458 Ga0070681_10229528 Ga0070681_102295283 188
1803 3300005458 Ga0070681_10437426 Ga0070681_104374261 188
1804 3300005530 Ga0070679_100139319 Ga0070679_1001393193 188
1805 3300005530 Ga0070679_100181563 Ga0070679_1001815633 188
1806 3300005530 Ga0070679_100545200 Ga0070679_1005452003 188
1807 3300005535 Ga0070684_100089976 Ga0070684_1000899765 188
1808 3300005535 Ga0070684_100411618 Ga0070684_1004116181 188
1809 3300005539 Ga0068853_100008536 Ga0068853_10000853610 188
1810 3300005539 Ga0068853_100418229 Ga0068853_1004182291 188
1811 3300005539 Ga0068853_100574269 Ga0068853_1005742692 188
1812 3300005563 Ga0068855_100981388 Ga0068855_1009813881 188
1813 3300005564 Ga0070664_100026135 Ga0070664_1000261355 188
1814 3300005564 Ga0070664_100079137 Ga0070664_1000791373 188
1815 3300005564 Ga0070664_100412830 Ga0070664_1004128303 188
1816 3300005577 Ga0068857_100067292 Ga0068857_1000672924 188
1817 3300005577 Ga0068857_100174580 Ga0068857_1001745803 188
1818 3300005577 Ga0068857_100181248 Ga0068857_1001812482 188
1819 3300005578 Ga0068854_100005946 Ga0068854_1000059463 188
1820 3300005578 Ga0068854_100286311 Ga0068854_1002863113 188
1821 3300005614 Ga0068856_100135858 Ga0068856_1001358583 188
1822 3300005614 Ga0068856_100705216 Ga0068856_1007052161 188
1823 3300005616 Ga0068852_100014770 Ga0068852_1000147703 188
1824 3300005616 Ga0068852_100061149 Ga0068852_1000611495 188
1825 3300005616 Ga0068852_100194808 Ga0068852_1001948083 188
1826 3300006173 Ga0070716_100207191 Ga0070716_1002071911 188
1827 3300009093 Ga0105240_10012494 Ga0105240_100124942 188
1828 3300009545 Ga0105237_10057560 Ga0105237_100575603 188
1829 3300009551 Ga0105238_10032773 Ga0105238_100327738 188
1830 3300009551 Ga0105238_10521334 Ga0105238_105213341 188
1831 3300010375 Ga0105239_10145471 Ga0105239_101454713 188
1832 3300011119 Ga0105246_10421353 Ga0105246_104213532 188
1833 3300013100 Ga0157373_10091018 Ga0157373_100910184 188
1834 3300013100 Ga0157373_10091080 Ga0157373_100910803 188
1835 3300013100 Ga0157373_10158216 Ga0157373_101582163 188
1836 3300013102 Ga0157371_10688070 Ga0157371_106880701 188
1837 3300013104 Ga0157370_10069321 Ga0157370_100693216 188
1838 3300013104 Ga0157370_10072786 Ga0157370_100727864 188
1839 3300013104 Ga0157370_10517719 Ga0157370_105177192 188
1840 3300013105 Ga0157369_10037284 Ga0157369_100372843 188
1841 3300013105 Ga0157369_10354454 Ga0157369_103544542 188
1842 3300013105 Ga0157369_10484221 Ga0157369_104842212 188
1843 3300013105 Ga0157369_10737342 Ga0157369_107373421 188
1844 3300013297 Ga0157378_10330333 Ga0157378_103303333 188
1845 3300013307 Ga0157372_10162368 Ga0157372_101623682 188
1846 3300013307 Ga0157372_10186145 Ga0157372_101861453 188
1847 3300013307 Ga0157372_10668220 Ga0157372_106682203 188
1848 3300013307 Ga0157372_11134075 Ga0157372_111340751 188
1849 3300020076 Ga0206355_1403083 Ga0206355_14030833 188
1850 3300022467 Ga0224712_10073116 Ga0224712_100731163 188
1851 3300025321 Ga0207656_10034120 Ga0207656_100341203 188
1852 3300025904 Ga0207647_10001428 Ga0207647_1000142823 188
1853 3300025904 Ga0207647_10001605 Ga0207647_100016059 188
1854 3300025904 Ga0207647_10005058 Ga0207647_100050588 188
1855 3300025904 Ga0207647_10136520 Ga0207647_101365203 188
1856 3300025909 Ga0207705_10012814 Ga0207705_100128142 188
1857 3300025909 Ga0207705_10092046 Ga0207705_100920461 188
1858 3300025909 Ga0207705_10208165 Ga0207705_102081651 188
1859 3300025909 Ga0207705_10413344 Ga0207705_104133441 188
1860 3300025909 Ga0207705_10533777 Ga0207705_105337771 188
1861 3300025912 Ga0207707_10280179 Ga0207707_102801792 188
1862 3300025912 Ga0207707_10281123 Ga0207707_102811231 188
1863 3300025912 Ga0207707_10566755 Ga0207707_105667552 188
1864 3300025913 Ga0207695_10414308 Ga0207695_104143082 188
1865 3300025914 Ga0207671_10109655 Ga0207671_101096553 188
1866 3300025915 Ga0207693_10025397 Ga0207693_100253974 188
1867 3300025916 Ga0207663_10117300 Ga0207663_101173003 188
1868 3300025917 Ga0207660_10090677 Ga0207660_100906771 188
1869 3300025917 Ga0207660_10127011 Ga0207660_101270113 188
1870 3300025917 Ga0207660_10132255 Ga0207660_101322552 188
1871 3300025919 Ga0207657_10003140 Ga0207657_1000314010 188
1872 3300025919 Ga0207657_10015454 Ga0207657_100154543 188
1873 3300025919 Ga0207657_10023414 Ga0207657_100234142 188
1874 3300025919 Ga0207657_10029076 Ga0207657_100290766 188
1875 3300025919 Ga0207657_10034505 Ga0207657_100345053 188
1876 3300025919 Ga0207657_10125891 Ga0207657_101258914 188
1877 3300025920 Ga0207649_10023188 Ga0207649_100231886 188
1878 3300025920 Ga0207649_10039151 Ga0207649_100391511 188
1879 3300025920 Ga0207649_10156205 Ga0207649_101562052 188
1880 3300025920 Ga0207649_10204995 Ga0207649_102049952 188
1881 3300025920 Ga0207649_10409089 Ga0207649_104090892 188
1882 3300025921 Ga0207652_10062022 Ga0207652_100620222 188
1883 3300025921 Ga0207652_10075635 Ga0207652_100756352 188
1884 3300025924 Ga0207694_10037544 Ga0207694_100375443 188
1885 3300025924 Ga0207694_10105007 Ga0207694_101050072 188
1886 3300025927 Ga0207687_10010252 Ga0207687_100102526 188
1887 3300025932 Ga0207690_10024735 Ga0207690_100247356 188
1888 3300025932 Ga0207690_10027937 Ga0207690_100279376 188
1889 3300025932 Ga0207690_10045727 Ga0207690_100457272 188
1890 3300025933 Ga0207706_10067025 Ga0207706_100670256 188
1891 3300025933 Ga0207706_10559277 Ga0207706_105592771 188
1892 3300025939 Ga0207665_10200106 Ga0207665_102001063 188
1893 3300025944 Ga0207661_10040495 Ga0207661_100404955 188
1894 3300025944 Ga0207661_10313167 Ga0207661_103131672 188
1895 3300025945 Ga0207679_10005586 Ga0207679_1000558612 188
1896 3300025945 Ga0207679_10325497 Ga0207679_103254973 188
1897 3300025945 Ga0207679_10372305 Ga0207679_103723052 188
1898 3300025945 Ga0207679_10947482 Ga0207679_109474821 188
1899 3300025949 Ga0207667_10089128 Ga0207667_100891281 188
1900 3300025981 Ga0207640_10148408 Ga0207640_101484083 188
1901 3300026023 Ga0207677_10404616 Ga0207677_104046162 188
1902 3300026041 Ga0207639_10010651 Ga0207639_100106513 188
1903 3300026041 Ga0207639_10059006 Ga0207639_100590064 188
1904 3300026041 Ga0207639_10202438 Ga0207639_102024383 188
1905 3300026067 Ga0207678_10065532 Ga0207678_100655325 188
1906 3300026067 Ga0207678_10126217 Ga0207678_101262173 188
1907 3300026078 Ga0207702_10033646 Ga0207702_100336462 188
1908 3300026078 Ga0207702_10213686 Ga0207702_102136863 188
1909 3300026078 Ga0207702_11067361 Ga0207702_110673611 188
1910 3300026089 Ga0207648_10085498 Ga0207648_100854984 188
1911 3300026116 Ga0207674_10008911 Ga0207674_100089117 188
1912 3300026116 Ga0207674_10010054 Ga0207674_100100546 188
1913 3300026116 Ga0207674_10205783 Ga0207674_102057833 188
1914 3300026142 Ga0207698_10063830 Ga0207698_100638304 188
1915 3300026142 Ga0207698_10236368 Ga0207698_102363683 188
1916 3300026142 Ga0207698_10315678 Ga0207698_103156781 188
1917 3300026142 Ga0207698_10951321 Ga0207698_109513211 188
1918 3300031731 Ga0307405_10032333 Ga0307405_100323335 188
1919 3300031731 Ga0307405_10078060 Ga0307405_100780603 188
1920 3300031852 Ga0307410_10362872 Ga0307410_103628722 188
1921 3300031901 Ga0307406_10008063 Ga0307406_100080637 188
1922 3300032002 Ga0307416_100003438 Ga0307416_1000034386 188
1923 3300032004 Ga0307414_10474124 Ga0307414_104741241 188
1924 3300032005 Ga0307411_10289723 Ga0307411_102897232 188
1925 3300032005 Ga0307411_10723282 Ga0307411_107232822 188
1926 3300032126 Ga0307415_100030148 Ga0307415_1000301484 188
1927 3300032126 Ga0307415_100116218 Ga0307415_1001162183 188
1928 3300032126 Ga0307415_100134814 Ga0307415_1001348144 188
1929 3300035170 Ga0373943_0455470 Ga0373943_0455470_80_700 188
1930 3300035692 Ga0373935_0047789 Ga0373935_0047789_916_1536 188
1931 3300035692 Ga0373935_0069053 Ga0373935_0069053_352_972 188
1932 3300035695 Ga0373927_0025599 Ga0373927_0025599_80_700 188
1933 3300037068 Ga0373925_0036385 Ga0373925_0036385_687_1307 188
1934 3300037312 Ga0395899_0053589 Ga0395899_0053589_1071_1685 188
1935 3300037312 Ga0395899_0162610 Ga0395899_0162610_929_1543 188
1936 3300037312 Ga0395899_0219249 Ga0395899_0219249_475_1095 188
1937 3300037418 Ga0395900_0034108 Ga0395900_0034108_3064_3678 188
1938 3300037418 Ga0395900_0414088 Ga0395900_0414088_414_1034 188
1939 3300037466 Ga0395898_0072459 Ga0395898_0072459_1743_2363 188
1940 3300037466 Ga0395898_0213635 Ga0395898_0213635_1056_1670 188
1941 3300037471 Ga0395905_0024791 Ga0395905_0024791_829_1443 188
1942 3300037471 Ga0395905_0365865 Ga0395905_0365865_26_646 188
1943 3300037471 Ga0395905_0691054 Ga0395905_0691054_117_737 188
1944 3300038443 Ga0395901_0062942 Ga0395901_0062942_1349_1963 188
1945 3300041405 Ga0439438_080358 Ga0439438_080358_94_774 188
1946 3300042007 Ga0439449_0016693 Ga0439449_0016693_1798_2478 188
1947 3300044694 Ga0466963_0076558 Ga0466963_0076558_396_1010 188
1948 3300044719 Ga0466971_0112712 Ga0466971_0112712_306_920 188
1949 3300044842 Ga0466957_0359512 Ga0466957_0359512_323_937 188
1950 3300045836 Ga0466958_0131142 Ga0466958_0131142_802_1416 188
1951 3300045836 Ga0466958_0437855 Ga0466958_0437855_174_788 188
1952 3300045976 Ga0466967_0282024 Ga0466967_0282024_383_997 188
1953 3300045976 Ga0466967_0661833 Ga0466967_0661833_397_1017 188
1954 3300046453 Ga0495627_000621 Ga0495627_000621_14793_15398 188
1955 3300048914 Ga0496111_0117561 Ga0496111_0117561_525_1139 188
1956 3300049533 Ga0501317_000859 Ga0501317_000859_11_607 188
1957 3300049551 Ga0501335_002933 Ga0501335_002933_286_882 188
1958 3300049669 Ga0501235_013185 Ga0501235_013185_137_817 188
1959 3300049706 Ga0501229_012675 Ga0501229_012675_217_897 188
1960 3300049708 Ga0501245_003957 Ga0501245_003957_89_685 188
1961 3300049759 Ga0501262_006069 Ga0501262_006069_736_1416 188
1962 3300049769 Ga0501272_015792 Ga0501272_015792_59_739 188
1963 3300049775 Ga0501279_013398 Ga0501279_013398_176_856 188
1964 3300001915 JGI24741J21665_1000991 JGI24741J21665_10009917 189
1965 3300001979 JGI24740J21852_10010914 JGI24740J21852_100109144 189
1966 3300001989 JGI24739J22299_10005667 JGI24739J22299_100056673 189
1967 3300001990 JGI24737J22298_10003617 JGI24737J22298_100036172 189
1968 3300002067 JGI24735J21928_10009748 JGI24735J21928_100097481 189
1969 3300002075 JGI24738J21930_10001427 JGI24738J21930_100014275 189
1970 3300005289 Ga0065704_10274314 Ga0065704_102743141 189
1971 3300005327 Ga0070658_10023993 Ga0070658_100239932 189
1972 3300005329 Ga0070683_100930702 Ga0070683_1009307021 189
1973 3300005339 Ga0070660_100243707 Ga0070660_1002437071 189
1974 3300005344 Ga0070661_100069336 Ga0070661_1000693364 189
1975 3300005366 Ga0070659_100456606 Ga0070659_1004566062 189
1976 3300005455 Ga0070663_100001785 Ga0070663_1000017854 189
1977 3300005457 Ga0070662_100093220 Ga0070662_1000932202 189
1978 3300005539 Ga0068853_100136236 Ga0068853_1001362364 189
1979 3300005563 Ga0068855_100315702 Ga0068855_1003157025 189
1980 3300005564 Ga0070664_100042114 Ga0070664_1000421145 189
1981 3300005577 Ga0068857_100283080 Ga0068857_1002830803 189
1982 3300005578 Ga0068854_100193076 Ga0068854_1001930764 189
1983 3300005614 Ga0068856_100013594 Ga0068856_1000135947 189
1984 3300005616 Ga0068852_100545318 Ga0068852_1005453183 189
1985 3300005834 Ga0068851_10012700 Ga0068851_100127001 189
1986 3300009011 Ga0105251_10014991 Ga0105251_100149912 189
1987 3300009093 Ga0105240_10332249 Ga0105240_103322491 189
1988 3300009174 Ga0105241_10076161 Ga0105241_100761614 189
1989 3300009545 Ga0105237_10015881 Ga0105237_100158818 189
1990 3300010375 Ga0105239_10474092 Ga0105239_104740921 189
1991 3300013100 Ga0157373_10085128 Ga0157373_100851284 189
1992 3300013105 Ga0157369_10640820 Ga0157369_106408201 189
1993 3300020077 Ga0206351_10532014 Ga0206351_105320141 189
1994 3300025321 Ga0207656_10020509 Ga0207656_100205091 189
1995 3300025735 Ga0207713_1030060 Ga0207713_10300602 189
1996 3300025911 Ga0207654_10015435 Ga0207654_100154353 189
1997 3300025913 Ga0207695_10165792 Ga0207695_101657921 189
1998 3300025914 Ga0207671_10137492 Ga0207671_101374924 189
1999 3300025919 Ga0207657_10325416 Ga0207657_103254162 189
2000 3300025920 Ga0207649_10158723 Ga0207649_101587231 189
2001 3300025924 Ga0207694_10132697 Ga0207694_101326971 189
2002 3300025933 Ga0207706_10012962 Ga0207706_100129626 189
2003 3300025945 Ga0207679_10252079 Ga0207679_102520792 189
2004 3300025949 Ga0207667_10087197 Ga0207667_100871972 189
2005 3300025981 Ga0207640_10017347 Ga0207640_100173472 189
2006 3300026041 Ga0207639_10000138 Ga0207639_1000013812 189
2007 3300026067 Ga0207678_10003288 Ga0207678_100032881 189
2008 3300026078 Ga0207702_10003043 Ga0207702_1000304312 189
2009 3300026142 Ga0207698_10018354 Ga0207698_100183545 189
2010 3300031548 Ga0307408_100468283 Ga0307408_1004682831 189
2011 3300031731 Ga0307405_10208850 Ga0307405_102088501 189
2012 3300031852 Ga0307410_10035455 Ga0307410_100354553 189
2013 3300031911 Ga0307412_10130640 Ga0307412_101306401 189
2014 3300031995 Ga0307409_100091735 Ga0307409_1000917352 189
2015 3300032004 Ga0307414_10226144 Ga0307414_102261441 189
2016 3300032005 Ga0307411_10175894 Ga0307411_101758941 189
2017 3300048913 Ga0496110_0137047 Ga0496110_0137047_1581_2177 189
2018 3300048921 Ga0496118_0330670 Ga0496118_0330670_133_729 189
2019 3300048924 Ga0496121_0000349 Ga0496121_0000349_8440_9036 189
2020 3300048924 Ga0496121_0072540 Ga0496121_0072540_111_707 189
2021 3300048925 Ga0496122_0067295 Ga0496122_0067295_365_961 189
2022 3300048926 Ga0496123_0044190 Ga0496123_0044190_1334_1930 189
2023 3300048927 Ga0496124_0223914 Ga0496124_0223914_486_1082 189
2024 3300048928 Ga0496125_0102662 Ga0496125_0102662_1154_1750 189
2025 3300048929 Ga0496126_0215458 Ga0496126_0215458_706_1302 189
2026 3300049663 Ga0501223_000042 Ga0501223_000042_39022_39621 189
2027 3300049705 Ga0501225_0000520 Ga0501225_0000520_21_620 189
2028 2162886007 SwRhRL2b_contig_3230906 SwRhRL2b_0914.00003780 190
2029 3300005289 Ga0065704_10000743 Ga0065704_1000074329 190
2030 3300005353 Ga0070669_100564065 Ga0070669_1005640652 190
2031 3300005548 Ga0070665_100100753 Ga0070665_1001007532 190
2032 3300025923 Ga0207681_10355686 Ga0207681_103556862 190
2033 3300028379 Ga0268266_10154815 Ga0268266_101548153 190
2034 3300048911 Ga0496108_0001779 Ga0496108_0001779_13225_13824 190
2035 3300048919 Ga0496116_0231958 Ga0496116_0231958_185_784 190
2036 3300048921 Ga0496118_0358344 Ga0496118_0358344_84_683 190
2037 3300048925 Ga0496122_0085973 Ga0496122_0085973_382_981 190
2038 3300048928 Ga0496125_0029187 Ga0496125_0029187_4126_4725 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

1

47

0.97

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

63

146

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fto-assembly1.cif.gz_h e. coli 70s ribosome with an improved ms2 tag inserted in h98 0.9875 1 40
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 0.9856 1 40
8am9-assembly1.cif.gz_h cryo-em structure of the proline-rich antimicrobial peptide drosocin bound to the elongating ribosome 0.9852 1 40
8aye-assembly1.cif.gz_h e. coli 70s ribosome bound to thermorubin and fmet-trna 0.983 1 39
7y7e-assembly1.cif.gz_h structure of the bacterial ribosome with human trna asp(manq34) and mrna(gau) 0.9809 1 39
ID Description Score Start End Superfamily
af_P0A7R1_1_50_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9756 1 48 3.40.5.10
af_A0A1D6HNM4_48_91_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9712 3 42 3.40.5.10
af_Q2G2T3_1_54_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9567 1 48 3.40.5.10
af_Q54QM2_41_88_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9475 3 48 3.40.5.10
3kniI01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.947 1 58 3.40.5.10
ID Description Score Start End GO Terms
AF-A0A653T3B7-F1-model_v4 LSU ribosomal protein L9p 0.9369 63 139 GO:0003735
GO:0005840
GO:0006412
AF-A0A656G2Q0-F1-model_v4 50S ribosomal protein L9 0.9234 52 137 GO:0003735
GO:0005840
GO:0006412
AF-A0A353K5N8-F1-model_v4 deleted 0.9179 54 139
AF-A0A7X6NEA0-F1-model_v4 deleted 0.9085 52 136
AF-X1M0K0-F1-model_v4 Large ribosomal subunit protein bL9 C-terminal domain-containing protein 0.9054 65 139 GO:0003735
GO:0005840
GO:0006412

Feature Viewer

pLDDT pTM Quality
79.25 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map